Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140214_SF053_01 B20140214_SF053_01 TB464176.[MT7]-IC[CAM]VSPHNHTVK[MT7].3b4_1.heavy 527.292 / 604.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCL28 chemokine (C-C motif) ligand 28 3 1 B20140214_SF053_01 B20140214_SF053_01 TB464176.[MT7]-IC[CAM]VSPHNHTVK[MT7].3y4_1.heavy 527.292 / 628.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCL28 chemokine (C-C motif) ligand 28 5 1 B20140214_SF053_01 B20140214_SF053_01 TB464176.[MT7]-IC[CAM]VSPHNHTVK[MT7].3b3_1.heavy 527.292 / 517.292 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCL28 chemokine (C-C motif) ligand 28 7 1 B20140214_SF053_01 B20140214_SF053_01 TB464176.[MT7]-IC[CAM]VSPHNHTVK[MT7].3y5_1.heavy 527.292 / 742.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCL28 chemokine (C-C motif) ligand 28 9 2 B20140214_SF053_01 B20140214_SF053_01 TB246691.[MT7]-DEYDDLSDLTAAQQETLSDWESQFTFK[MT7].4b8_1.heavy 868.406 / 1097.44 7719.0 49.39455032348633 39 12 10 7 10 0.9336592373248714 62.53677913019479 0.0281982421875 3 0.8957355245849571 3.7883182390033614 7719.0 78.1965701576004 0.0 - - - - - - - 150.26315789473685 15 19 PGRMC1 progesterone receptor membrane component 1 11 2 B20140214_SF053_01 B20140214_SF053_01 TB246691.[MT7]-DEYDDLSDLTAAQQETLSDWESQFTFK[MT7].4b4_1.heavy 868.406 / 667.269 4210.0 49.39455032348633 39 12 10 7 10 0.9336592373248714 62.53677913019479 0.0281982421875 3 0.8957355245849571 3.7883182390033614 4210.0 9.976107540597555 0.0 - - - - - - - 231.7826086956522 8 23 PGRMC1 progesterone receptor membrane component 1 13 2 B20140214_SF053_01 B20140214_SF053_01 TB246691.[MT7]-DEYDDLSDLTAAQQETLSDWESQFTFK[MT7].4b5_1.heavy 868.406 / 782.296 11836.0 49.39455032348633 39 12 10 7 10 0.9336592373248714 62.53677913019479 0.0281982421875 3 0.8957355245849571 3.7883182390033614 11836.0 43.17873780739253 0.0 - - - - - - - 200.88235294117646 23 17 PGRMC1 progesterone receptor membrane component 1 15 2 B20140214_SF053_01 B20140214_SF053_01 TB246691.[MT7]-DEYDDLSDLTAAQQETLSDWESQFTFK[MT7].4y3_1.heavy 868.406 / 539.331 13146.0 49.39455032348633 39 12 10 7 10 0.9336592373248714 62.53677913019479 0.0281982421875 3 0.8957355245849571 3.7883182390033614 13146.0 53.84590797674907 0.0 - - - - - - - 675.0 26 7 PGRMC1 progesterone receptor membrane component 1 17 3 B20140214_SF053_01 B20140214_SF053_01 TB246692.[MT7]-GYLSGQSLAETMEQIQRETTIDPEEDLNK[MT7].4b8_1.heavy 896.697 / 950.506 1984.0 45.77190017700195 44 14 10 10 10 2.6804022599686594 37.30783304188426 0.0 3 0.9497604624631272 5.482824453232022 1984.0 12.801886549417883 0.0 - - - - - - - 229.93333333333334 3 15 C3orf34 chromosome 3 open reading frame 34 19 3 B20140214_SF053_01 B20140214_SF053_01 TB246692.[MT7]-GYLSGQSLAETMEQIQRETTIDPEEDLNK[MT7].4b7_1.heavy 896.697 / 837.422 4335.0 45.77190017700195 44 14 10 10 10 2.6804022599686594 37.30783304188426 0.0 3 0.9497604624631272 5.482824453232022 4335.0 12.646188358611926 0.0 - - - - - - - 236.0 8 14 C3orf34 chromosome 3 open reading frame 34 21 3 B20140214_SF053_01 B20140214_SF053_01 TB246692.[MT7]-GYLSGQSLAETMEQIQRETTIDPEEDLNK[MT7].4y7_1.heavy 896.697 / 988.507 9405.0 45.77190017700195 44 14 10 10 10 2.6804022599686594 37.30783304188426 0.0 3 0.9497604624631272 5.482824453232022 9405.0 27.045601688951447 0.0 - - - - - - - 233.63636363636363 18 11 C3orf34 chromosome 3 open reading frame 34 23 3 B20140214_SF053_01 B20140214_SF053_01 TB246692.[MT7]-GYLSGQSLAETMEQIQRETTIDPEEDLNK[MT7].4b6_1.heavy 896.697 / 750.39 4041.0 45.77190017700195 44 14 10 10 10 2.6804022599686594 37.30783304188426 0.0 3 0.9497604624631272 5.482824453232022 4041.0 13.137710333755287 0.0 - - - - - - - 270.6875 8 16 C3orf34 chromosome 3 open reading frame 34 25 4 B20140214_SF053_01 B20140214_SF053_01 TB464170.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.3b4_1.heavy 769.426 / 599.388 33044.0 37.207200050354004 41 15 10 6 10 2.5722574118023167 31.311604420122357 0.035198211669921875 3 0.9568996213741665 5.923105910631595 33044.0 40.19437494829155 0.0 - - - - - - - 376.5 66 2 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 27 4 B20140214_SF053_01 B20140214_SF053_01 TB464170.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.3y8_1.heavy 769.426 / 1052.63 37311.0 37.207200050354004 41 15 10 6 10 2.5722574118023167 31.311604420122357 0.035198211669921875 3 0.9568996213741665 5.923105910631595 37311.0 141.8048015898767 0.0 - - - - - - - 216.25 74 12 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 29 4 B20140214_SF053_01 B20140214_SF053_01 TB464170.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.3y5_1.heavy 769.426 / 569.341 47182.0 37.207200050354004 41 15 10 6 10 2.5722574118023167 31.311604420122357 0.035198211669921875 3 0.9568996213741665 5.923105910631595 47182.0 60.92985516888123 0.0 - - - - - - - 669.2857142857143 94 7 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 31 4 B20140214_SF053_01 B20140214_SF053_01 TB464170.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.3y9_1.heavy 769.426 / 1215.7 4852.0 37.207200050354004 41 15 10 6 10 2.5722574118023167 31.311604420122357 0.035198211669921875 3 0.9568996213741665 5.923105910631595 4852.0 14.049074626865671 0.0 - - - - - - - 190.36363636363637 9 11 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 33 5 B20140214_SF053_01 B20140214_SF053_01 TB464279.[MT7]-SASLLSLQTELLLDLVAEAQSR.3b6_1.heavy 834.47 / 703.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 35 5 B20140214_SF053_01 B20140214_SF053_01 TB464279.[MT7]-SASLLSLQTELLLDLVAEAQSR.3b4_1.heavy 834.47 / 503.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 37 5 B20140214_SF053_01 B20140214_SF053_01 TB464279.[MT7]-SASLLSLQTELLLDLVAEAQSR.3b5_1.heavy 834.47 / 616.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 39 5 B20140214_SF053_01 B20140214_SF053_01 TB464279.[MT7]-SASLLSLQTELLLDLVAEAQSR.3y9_1.heavy 834.47 / 988.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 41 6 B20140214_SF053_01 B20140214_SF053_01 TB464079.[MT7]-HGESSLDIAR.2b7_1.heavy 614.824 / 870.407 2976.0 23.68709945678711 44 16 10 10 8 7.5023947911539235 13.329077285816796 0.0 4 0.96264272629497 6.365220042404579 2976.0 69.73421728786678 0.0 - - - - - - - 122.85 5 20 ANKRD22 ankyrin repeat domain 22 43 6 B20140214_SF053_01 B20140214_SF053_01 TB464079.[MT7]-HGESSLDIAR.2b9_1.heavy 614.824 / 1054.53 776.0 23.68709945678711 44 16 10 10 8 7.5023947911539235 13.329077285816796 0.0 4 0.96264272629497 6.365220042404579 776.0 5.639698942917548 1.0 - - - - - - - 138.66666666666666 6 24 ANKRD22 ankyrin repeat domain 22 45 6 B20140214_SF053_01 B20140214_SF053_01 TB464079.[MT7]-HGESSLDIAR.2y9_1.heavy 614.824 / 947.479 5758.0 23.68709945678711 44 16 10 10 8 7.5023947911539235 13.329077285816796 0.0 4 0.96264272629497 6.365220042404579 5758.0 111.71504273504274 0.0 - - - - - - - 116.78260869565217 11 23 ANKRD22 ankyrin repeat domain 22 47 6 B20140214_SF053_01 B20140214_SF053_01 TB464079.[MT7]-HGESSLDIAR.2y7_1.heavy 614.824 / 761.415 1714.0 23.68709945678711 44 16 10 10 8 7.5023947911539235 13.329077285816796 0.0 4 0.96264272629497 6.365220042404579 1714.0 7.433215734274125 2.0 - - - - - - - 140.57692307692307 4 26 ANKRD22 ankyrin repeat domain 22 49 7 B20140214_SF053_01 B20140214_SF053_01 TB464273.[MT7]-EAPGPINFTVFLTMFGEK[MT7].4y4_1.heavy 572.307 / 624.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 51 7 B20140214_SF053_01 B20140214_SF053_01 TB464273.[MT7]-EAPGPINFTVFLTMFGEK[MT7].4b7_1.heavy 572.307 / 823.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 53 7 B20140214_SF053_01 B20140214_SF053_01 TB464273.[MT7]-EAPGPINFTVFLTMFGEK[MT7].4y6_1.heavy 572.307 / 856.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 55 7 B20140214_SF053_01 B20140214_SF053_01 TB464273.[MT7]-EAPGPINFTVFLTMFGEK[MT7].4b6_1.heavy 572.307 / 709.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 57 8 B20140214_SF053_01 B20140214_SF053_01 TB464274.[MT7]-IIVPLNNRENISDPTSPLR.3y18_2.heavy 764.765 / 1018.05 74819.0 35.73149871826172 43 13 10 10 10 2.515279831238584 39.757007851789446 0.0 3 0.906248407320334 3.998712559234492 74819.0 318.75388939652163 0.0 - - - - - - - 744.1111111111111 149 9 IGJ immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides 59 8 B20140214_SF053_01 B20140214_SF053_01 TB464274.[MT7]-IIVPLNNRENISDPTSPLR.3y6_1.heavy 764.765 / 670.388 276209.0 35.73149871826172 43 13 10 10 10 2.515279831238584 39.757007851789446 0.0 3 0.906248407320334 3.998712559234492 276209.0 226.06777778351716 0.0 - - - - - - - 413.0 552 1 IGJ immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides 61 8 B20140214_SF053_01 B20140214_SF053_01 TB464274.[MT7]-IIVPLNNRENISDPTSPLR.3y8_1.heavy 764.765 / 872.447 10830.0 35.73149871826172 43 13 10 10 10 2.515279831238584 39.757007851789446 0.0 3 0.906248407320334 3.998712559234492 10830.0 26.744836655095842 0.0 - - - - - - - 691.3636363636364 21 11 IGJ immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides 63 8 B20140214_SF053_01 B20140214_SF053_01 TB464274.[MT7]-IIVPLNNRENISDPTSPLR.3y16_2.heavy 764.765 / 911.974 160550.0 35.73149871826172 43 13 10 10 10 2.515279831238584 39.757007851789446 0.0 3 0.906248407320334 3.998712559234492 160550.0 197.51275944126672 0.0 - - - - - - - 330.6 321 10 IGJ immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides 65 9 B20140214_SF053_01 B20140214_SF053_01 TB464271.[MT7]-IAAGLPMAGIPFLTTDLTYR.3b5_1.heavy 755.753 / 570.373 36885.0 50.73640060424805 46 16 10 10 10 4.382124755724691 22.819980163586777 0.0 3 0.9656504927607541 6.639739799592495 36885.0 108.68616450131049 0.0 - - - - - - - 613.7142857142857 73 7 TMEM126A transmembrane protein 126A 67 9 B20140214_SF053_01 B20140214_SF053_01 TB464271.[MT7]-IAAGLPMAGIPFLTTDLTYR.3y4_1.heavy 755.753 / 552.314 5302.0 50.73640060424805 46 16 10 10 10 4.382124755724691 22.819980163586777 0.0 3 0.9656504927607541 6.639739799592495 5302.0 60.384968603576326 0.0 - - - - - - - 147.22222222222223 10 18 TMEM126A transmembrane protein 126A 69 9 B20140214_SF053_01 B20140214_SF053_01 TB464271.[MT7]-IAAGLPMAGIPFLTTDLTYR.3y8_1.heavy 755.753 / 982.52 6353.0 50.73640060424805 46 16 10 10 10 4.382124755724691 22.819980163586777 0.0 3 0.9656504927607541 6.639739799592495 6353.0 75.86181242217027 0.0 - - - - - - - 126.23529411764706 12 17 TMEM126A transmembrane protein 126A 71 9 B20140214_SF053_01 B20140214_SF053_01 TB464271.[MT7]-IAAGLPMAGIPFLTTDLTYR.3y10_1.heavy 755.753 / 1226.64 15677.0 50.73640060424805 46 16 10 10 10 4.382124755724691 22.819980163586777 0.0 3 0.9656504927607541 6.639739799592495 15677.0 107.26850800582241 0.0 - - - - - - - 231.5 31 16 TMEM126A transmembrane protein 126A 73 10 B20140214_SF053_01 B20140214_SF053_01 TB464275.[MT7]-C[CAM]PLEDPGWNAQITLGLVK[MT7].3y6_1.heavy 767.083 / 774.521 42629.0 43.788700103759766 44 14 10 10 10 2.337696189200391 33.78891796939678 0.0 3 0.943996542703138 5.19047352924 42629.0 58.68825299141964 0.0 - - - - - - - 393.42857142857144 85 7 PHLDA3 pleckstrin homology-like domain, family A, member 3 75 10 B20140214_SF053_01 B20140214_SF053_01 TB464275.[MT7]-C[CAM]PLEDPGWNAQITLGLVK[MT7].3b5_1.heavy 767.083 / 759.346 63214.0 43.788700103759766 44 14 10 10 10 2.337696189200391 33.78891796939678 0.0 3 0.943996542703138 5.19047352924 63214.0 141.8694709190021 0.0 - - - - - - - 324.0 126 5 PHLDA3 pleckstrin homology-like domain, family A, member 3 77 10 B20140214_SF053_01 B20140214_SF053_01 TB464275.[MT7]-C[CAM]PLEDPGWNAQITLGLVK[MT7].3y4_1.heavy 767.083 / 560.389 64997.0 43.788700103759766 44 14 10 10 10 2.337696189200391 33.78891796939678 0.0 3 0.943996542703138 5.19047352924 64997.0 47.195645773031245 0.0 - - - - - - - 740.5714285714286 129 7 PHLDA3 pleckstrin homology-like domain, family A, member 3 79 10 B20140214_SF053_01 B20140214_SF053_01 TB464275.[MT7]-C[CAM]PLEDPGWNAQITLGLVK[MT7].3b7_1.heavy 767.083 / 913.421 23908.0 43.788700103759766 44 14 10 10 10 2.337696189200391 33.78891796939678 0.0 3 0.943996542703138 5.19047352924 23908.0 34.481632653061226 0.0 - - - - - - - 729.1428571428571 47 7 PHLDA3 pleckstrin homology-like domain, family A, member 3 81 11 B20140214_SF053_01 B20140214_SF053_01 TB464276.[MT7]-YLPATVEFAVHTFNQQSK[MT7].4b4_1.heavy 592.819 / 589.347 22948.0 43.13680076599121 42 16 10 6 10 2.5196311215079055 39.688349277156775 0.035999298095703125 3 0.9685616232945563 6.942052678262013 22948.0 38.527613446422286 0.0 - - - - - - - 353.0 45 5 CST9L cystatin 9-like 83 11 B20140214_SF053_01 B20140214_SF053_01 TB464276.[MT7]-YLPATVEFAVHTFNQQSK[MT7].4b5_1.heavy 592.819 / 690.394 19417.0 43.13680076599121 42 16 10 6 10 2.5196311215079055 39.688349277156775 0.035999298095703125 3 0.9685616232945563 6.942052678262013 19417.0 34.89361843779024 0.0 - - - - - - - 334.3333333333333 38 6 CST9L cystatin 9-like 85 11 B20140214_SF053_01 B20140214_SF053_01 TB464276.[MT7]-YLPATVEFAVHTFNQQSK[MT7].4y7_1.heavy 592.819 / 996.523 8184.0 43.13680076599121 42 16 10 6 10 2.5196311215079055 39.688349277156775 0.035999298095703125 3 0.9685616232945563 6.942052678262013 8184.0 34.74141621094323 0.0 - - - - - - - 230.5 16 16 CST9L cystatin 9-like 87 11 B20140214_SF053_01 B20140214_SF053_01 TB464276.[MT7]-YLPATVEFAVHTFNQQSK[MT7].4y6_1.heavy 592.819 / 895.475 6740.0 43.13680076599121 42 16 10 6 10 2.5196311215079055 39.688349277156775 0.035999298095703125 3 0.9685616232945563 6.942052678262013 6740.0 48.65962603878116 0.0 - - - - - - - 265.15384615384613 13 13 CST9L cystatin 9-like 89 12 B20140214_SF053_01 B20140214_SF053_01 TB464270.[MT7]-MMDFETFLPMLQHISK[MT7].4y4_1.heavy 564.792 / 628.39 5851.0 49.45392417907715 43 16 10 7 10 3.355429950164847 29.802440070336488 0.02989959716796875 3 0.9654375813365613 6.619138195662289 5851.0 19.137818246110328 0.0 - - - - - - - 209.07142857142858 11 14 MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 91 12 B20140214_SF053_01 B20140214_SF053_01 TB464270.[MT7]-MMDFETFLPMLQHISK[MT7].4b4_1.heavy 564.792 / 669.286 4943.0 49.45392417907715 43 16 10 7 10 3.355429950164847 29.802440070336488 0.02989959716796875 3 0.9654375813365613 6.619138195662289 4943.0 49.01301718700725 0.0 - - - - - - - 180.88235294117646 9 17 MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 93 12 B20140214_SF053_01 B20140214_SF053_01 TB464270.[MT7]-MMDFETFLPMLQHISK[MT7].4b5_1.heavy 564.792 / 798.328 3934.0 49.45392417907715 43 16 10 7 10 3.355429950164847 29.802440070336488 0.02989959716796875 3 0.9654375813365613 6.619138195662289 3934.0 17.70353950984452 2.0 - - - - - - - 132.3125 7 16 MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 95 12 B20140214_SF053_01 B20140214_SF053_01 TB464270.[MT7]-MMDFETFLPMLQHISK[MT7].4b3_1.heavy 564.792 / 522.217 8020.0 49.45392417907715 43 16 10 7 10 3.355429950164847 29.802440070336488 0.02989959716796875 3 0.9654375813365613 6.619138195662289 8020.0 31.40409586742186 0.0 - - - - - - - 230.57142857142858 16 14 MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 97 13 B20140214_SF053_01 B20140214_SF053_01 TB464189.[MT7]-FYGPEGPYGVFAGR.3y7_1.heavy 554.28 / 769.399 45785.0 39.925899505615234 50 20 10 10 10 11.249986098496679 8.88889987280632 0.0 3 0.9966112056437492 21.194200639407516 45785.0 157.35581578947367 0.0 - - - - - - - 350.2 91 10 PGRMC1 progesterone receptor membrane component 1 99 13 B20140214_SF053_01 B20140214_SF053_01 TB464189.[MT7]-FYGPEGPYGVFAGR.3b6_1.heavy 554.28 / 795.379 54746.0 39.925899505615234 50 20 10 10 10 11.249986098496679 8.88889987280632 0.0 3 0.9966112056437492 21.194200639407516 54746.0 179.44767737595524 0.0 - - - - - - - 349.14285714285717 109 7 PGRMC1 progesterone receptor membrane component 1 101 13 B20140214_SF053_01 B20140214_SF053_01 TB464189.[MT7]-FYGPEGPYGVFAGR.3b5_1.heavy 554.28 / 738.358 21182.0 39.925899505615234 50 20 10 10 10 11.249986098496679 8.88889987280632 0.0 3 0.9966112056437492 21.194200639407516 21182.0 55.8448125958589 0.0 - - - - - - - 709.8571428571429 42 7 PGRMC1 progesterone receptor membrane component 1 103 13 B20140214_SF053_01 B20140214_SF053_01 TB464189.[MT7]-FYGPEGPYGVFAGR.3b3_1.heavy 554.28 / 512.263 71610.0 39.925899505615234 50 20 10 10 10 11.249986098496679 8.88889987280632 0.0 3 0.9966112056437492 21.194200639407516 71610.0 120.8752142809683 0.0 - - - - - - - 1323.75 143 8 PGRMC1 progesterone receptor membrane component 1 105 14 B20140214_SF053_01 B20140214_SF053_01 TB464183.[MT7]-AMQRPETAATLK[MT7].3y3_1.heavy 535.639 / 505.347 18382.0 24.140100479125977 42 12 10 10 10 1.312129515824578 44.48561180829956 0.0 3 0.8987461673748306 3.8452284552259717 18382.0 19.933693714898432 0.0 - - - - - - - 1589.6666666666667 36 9 MRPS6 mitochondrial ribosomal protein S6 107 14 B20140214_SF053_01 B20140214_SF053_01 TB464183.[MT7]-AMQRPETAATLK[MT7].3y11_2.heavy 535.639 / 695.386 30931.0 24.140100479125977 42 12 10 10 10 1.312129515824578 44.48561180829956 0.0 3 0.8987461673748306 3.8452284552259717 30931.0 77.98519346068042 0.0 - - - - - - - 632.1333333333333 61 15 MRPS6 mitochondrial ribosomal protein S6 109 14 B20140214_SF053_01 B20140214_SF053_01 TB464183.[MT7]-AMQRPETAATLK[MT7].3y4_1.heavy 535.639 / 576.384 15221.0 24.140100479125977 42 12 10 10 10 1.312129515824578 44.48561180829956 0.0 3 0.8987461673748306 3.8452284552259717 15221.0 18.188648621317334 1.0 - - - - - - - 784.6923076923077 30 13 MRPS6 mitochondrial ribosomal protein S6 111 14 B20140214_SF053_01 B20140214_SF053_01 TB464183.[MT7]-AMQRPETAATLK[MT7].3y8_1.heavy 535.639 / 974.564 7627.0 24.140100479125977 42 12 10 10 10 1.312129515824578 44.48561180829956 0.0 3 0.8987461673748306 3.8452284552259717 7627.0 78.57672197427146 0.0 - - - - - - - 130.43478260869566 15 23 MRPS6 mitochondrial ribosomal protein S6 113 15 B20140214_SF053_01 B20140214_SF053_01 TB464182.[MT7]-AMQRPETAATLK[MT7].2y8_1.heavy 802.955 / 974.564 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS6 mitochondrial ribosomal protein S6 115 15 B20140214_SF053_01 B20140214_SF053_01 TB464182.[MT7]-AMQRPETAATLK[MT7].2b4_1.heavy 802.955 / 631.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS6 mitochondrial ribosomal protein S6 117 15 B20140214_SF053_01 B20140214_SF053_01 TB464182.[MT7]-AMQRPETAATLK[MT7].2b6_1.heavy 802.955 / 857.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS6 mitochondrial ribosomal protein S6 119 15 B20140214_SF053_01 B20140214_SF053_01 TB464182.[MT7]-AMQRPETAATLK[MT7].2y3_1.heavy 802.955 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS6 mitochondrial ribosomal protein S6 121 16 B20140214_SF053_01 B20140214_SF053_01 TB464282.[MT7]-GLIAAIC[CAM]AGPTALLAHEIGFGSK[MT7].4y5_1.heavy 639.612 / 639.358 N/A 48.7666015625 40 18 2 10 10 4.048431467663346 24.70092449353416 0.0 3 0.9811090236735711 8.964975362794103 57923.0 5.856027506726484 1.0 - - - - - - - 8028.0 590 1 PARK7 Parkinson disease (autosomal recessive, early onset) 7 123 16 B20140214_SF053_01 B20140214_SF053_01 TB464282.[MT7]-GLIAAIC[CAM]AGPTALLAHEIGFGSK[MT7].4y8_1.heavy 639.612 / 1018.54 12824.0 48.7666015625 40 18 2 10 10 4.048431467663346 24.70092449353416 0.0 3 0.9811090236735711 8.964975362794103 12824.0 57.44267657992565 0.0 - - - - - - - 138.3125 25 16 PARK7 Parkinson disease (autosomal recessive, early onset) 7 125 16 B20140214_SF053_01 B20140214_SF053_01 TB464282.[MT7]-GLIAAIC[CAM]AGPTALLAHEIGFGSK[MT7].4b5_1.heavy 639.612 / 570.373 128130.0 48.7666015625 40 18 2 10 10 4.048431467663346 24.70092449353416 0.0 3 0.9811090236735711 8.964975362794103 128130.0 281.8742110680492 0.0 - - - - - - - 725.0909090909091 256 11 PARK7 Parkinson disease (autosomal recessive, early onset) 7 127 16 B20140214_SF053_01 B20140214_SF053_01 TB464282.[MT7]-GLIAAIC[CAM]AGPTALLAHEIGFGSK[MT7].4y6_1.heavy 639.612 / 752.442 29904.0 48.7666015625 40 18 2 10 10 4.048431467663346 24.70092449353416 0.0 3 0.9811090236735711 8.964975362794103 29904.0 118.5848275862069 0.0 - - - - - - - 754.1818181818181 59 11 PARK7 Parkinson disease (autosomal recessive, early onset) 7 129 17 B20140214_SF053_01 B20140214_SF053_01 TB464283.[MT7]-LAGDMGELALEGAEGQVEGSAPDK[MT7].3b9_1.heavy 878.105 / 1002.5 42640.0 40.11520004272461 41 11 10 10 10 1.3359193258706474 59.573901654802086 0.0 3 0.8651522973141619 3.322270191869078 42640.0 79.95454783330868 0.0 - - - - - - - 273.09090909090907 85 11 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 131 17 B20140214_SF053_01 B20140214_SF053_01 TB464283.[MT7]-LAGDMGELALEGAEGQVEGSAPDK[MT7].3y3_1.heavy 878.105 / 503.295 99980.0 40.11520004272461 41 11 10 10 10 1.3359193258706474 59.573901654802086 0.0 3 0.8651522973141619 3.322270191869078 99980.0 153.50353121296243 0.0 - - - - - - - 761.5 199 8 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 133 17 B20140214_SF053_01 B20140214_SF053_01 TB464283.[MT7]-LAGDMGELALEGAEGQVEGSAPDK[MT7].3b4_1.heavy 878.105 / 501.279 18843.0 40.11520004272461 41 11 10 10 10 1.3359193258706474 59.573901654802086 0.0 3 0.8651522973141619 3.322270191869078 18843.0 39.52608250026307 0.0 - - - - - - - 779.8 37 10 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 135 17 B20140214_SF053_01 B20140214_SF053_01 TB464283.[MT7]-LAGDMGELALEGAEGQVEGSAPDK[MT7].3b7_1.heavy 878.105 / 818.383 48325.0 40.11520004272461 41 11 10 10 10 1.3359193258706474 59.573901654802086 0.0 3 0.8651522973141619 3.322270191869078 48325.0 96.01726677577741 0.0 - - - - - - - 312.3076923076923 96 13 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 137 18 B20140214_SF053_01 B20140214_SF053_01 TB246418.[MT7]-DTDNEEEIR.2y8_1.heavy 632.792 / 1005.45 8974.0 20.812949657440186 43 17 10 6 10 7.104125083777094 14.076328727426118 0.03619956970214844 3 0.9767721084044891 8.08189541586044 8974.0 48.77173913043478 0.0 - - - - - - - 132.05882352941177 17 17 CALML3 calmodulin-like 3 139 18 B20140214_SF053_01 B20140214_SF053_01 TB246418.[MT7]-DTDNEEEIR.2b4_1.heavy 632.792 / 590.254 2519.0 20.812949657440186 43 17 10 6 10 7.104125083777094 14.076328727426118 0.03619956970214844 3 0.9767721084044891 8.08189541586044 2519.0 12.707406936235174 0.0 - - - - - - - 226.64 5 25 CALML3 calmodulin-like 3 141 18 B20140214_SF053_01 B20140214_SF053_01 TB246418.[MT7]-DTDNEEEIR.2y6_1.heavy 632.792 / 789.374 12596.0 20.812949657440186 43 17 10 6 10 7.104125083777094 14.076328727426118 0.03619956970214844 3 0.9767721084044891 8.08189541586044 12596.0 46.44411374133949 0.0 - - - - - - - 166.8095238095238 25 21 CALML3 calmodulin-like 3 143 18 B20140214_SF053_01 B20140214_SF053_01 TB246418.[MT7]-DTDNEEEIR.2b5_1.heavy 632.792 / 719.296 4251.0 20.812949657440186 43 17 10 6 10 7.104125083777094 14.076328727426118 0.03619956970214844 3 0.9767721084044891 8.08189541586044 4251.0 31.998100072516316 0.0 - - - - - - - 153.61904761904762 8 21 CALML3 calmodulin-like 3 145 19 B20140214_SF053_01 B20140214_SF053_01 TB464284.[MT7]-LAAPQSYPVTWPGSGREAFTNPR.3y18_2.heavy 882.79 / 1011.49 5728.0 36.57109832763672 46 16 10 10 10 4.137527787097871 24.169021972935585 0.0 3 0.9623379055050525 6.339245754660968 5728.0 12.33624096385542 1.0 - - - - - - - 201.57142857142858 11 14 FAM163A family with sequence similarity 163, member A 147 19 B20140214_SF053_01 B20140214_SF053_01 TB464284.[MT7]-LAAPQSYPVTWPGSGREAFTNPR.3y6_1.heavy 882.79 / 705.368 4566.0 36.57109832763672 46 16 10 10 10 4.137527787097871 24.169021972935585 0.0 3 0.9623379055050525 6.339245754660968 4566.0 0.9567312729177581 0.0 - - - - - - - 290.5 9 14 FAM163A family with sequence similarity 163, member A 149 19 B20140214_SF053_01 B20140214_SF053_01 TB464284.[MT7]-LAAPQSYPVTWPGSGREAFTNPR.3y20_2.heavy 882.79 / 1124.05 56947.0 36.57109832763672 46 16 10 10 10 4.137527787097871 24.169021972935585 0.0 3 0.9623379055050525 6.339245754660968 56947.0 719.2131656626507 0.0 - - - - - - - 207.5 113 6 FAM163A family with sequence similarity 163, member A 151 19 B20140214_SF053_01 B20140214_SF053_01 TB464284.[MT7]-LAAPQSYPVTWPGSGREAFTNPR.3y16_2.heavy 882.79 / 886.447 15523.0 36.57109832763672 46 16 10 10 10 4.137527787097871 24.169021972935585 0.0 3 0.9623379055050525 6.339245754660968 15523.0 127.55043373493976 0.0 - - - - - - - 243.46666666666667 31 15 FAM163A family with sequence similarity 163, member A 153 20 B20140214_SF053_01 B20140214_SF053_01 TB464285.[MT7]-LAAPQSYPVTWPGSGREAFTNPR.4y16_2.heavy 662.344 / 886.447 70940.0 36.56217384338379 38 12 10 6 10 2.0278826267788195 39.41680043969932 0.03569793701171875 3 0.8994941157060489 3.859759568884563 70940.0 230.15817555938037 0.0 - - - - - - - 770.7142857142857 141 7 FAM163A family with sequence similarity 163, member A 155 20 B20140214_SF053_01 B20140214_SF053_01 TB464285.[MT7]-LAAPQSYPVTWPGSGREAFTNPR.4y12_2.heavy 662.344 / 644.823 38913.0 36.56217384338379 38 12 10 6 10 2.0278826267788195 39.41680043969932 0.03569793701171875 3 0.8994941157060489 3.859759568884563 38913.0 13.848422057836894 0.0 - - - - - - - 1908.0 77 2 FAM163A family with sequence similarity 163, member A 157 20 B20140214_SF053_01 B20140214_SF053_01 TB464285.[MT7]-LAAPQSYPVTWPGSGREAFTNPR.4b5_1.heavy 662.344 / 625.379 14520.0 36.56217384338379 38 12 10 6 10 2.0278826267788195 39.41680043969932 0.03569793701171875 3 0.8994941157060489 3.859759568884563 14520.0 17.836067007757055 0.0 - - - - - - - 1213.75 29 8 FAM163A family with sequence similarity 163, member A 159 20 B20140214_SF053_01 B20140214_SF053_01 TB464285.[MT7]-LAAPQSYPVTWPGSGREAFTNPR.4y14_2.heavy 662.344 / 788.387 33022.0 36.56217384338379 38 12 10 6 10 2.0278826267788195 39.41680043969932 0.03569793701171875 3 0.8994941157060489 3.859759568884563 33022.0 35.536208277651866 0.0 - - - - - - - 735.1428571428571 66 7 FAM163A family with sequence similarity 163, member A 161 21 B20140214_SF053_01 B20140214_SF053_01 TB464286.[MT7]-FLEELLTTQC[CAM]DRFSQEEIK[MT7].4b4_1.heavy 669.346 / 663.347 163615.0 44.899600982666016 45 15 10 10 10 2.4531029995263998 40.76469680209358 0.0 3 0.9573754301072054 5.956313276675079 163615.0 95.80235482199132 0.0 - - - - - - - 946.0 327 3 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 163 21 B20140214_SF053_01 B20140214_SF053_01 TB464286.[MT7]-FLEELLTTQC[CAM]DRFSQEEIK[MT7].4y13_2.heavy 669.346 / 893.432 70538.0 44.899600982666016 45 15 10 10 10 2.4531029995263998 40.76469680209358 0.0 3 0.9573754301072054 5.956313276675079 70538.0 138.2625960265152 0.0 - - - - - - - 315.0 141 9 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 165 21 B20140214_SF053_01 B20140214_SF053_01 TB464286.[MT7]-FLEELLTTQC[CAM]DRFSQEEIK[MT7].4b5_1.heavy 669.346 / 776.431 116428.0 44.899600982666016 45 15 10 10 10 2.4531029995263998 40.76469680209358 0.0 3 0.9573754301072054 5.956313276675079 116428.0 275.90914933703993 0.0 - - - - - - - 324.0 232 5 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 167 21 B20140214_SF053_01 B20140214_SF053_01 TB464286.[MT7]-FLEELLTTQC[CAM]DRFSQEEIK[MT7].4b3_1.heavy 669.346 / 534.304 52701.0 44.899600982666016 45 15 10 10 10 2.4531029995263998 40.76469680209358 0.0 3 0.9573754301072054 5.956313276675079 52701.0 119.04298390128999 0.0 - - - - - - - 307.8 105 10 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 169 22 B20140214_SF053_01 B20140214_SF053_01 TB464287.[MT7]-GLWPFASAAGGGGSEAAGAEQALVRPR.3b3_1.heavy 909.808 / 501.294 38275.0 41.1741247177124 43 17 10 6 10 6.3969300170029815 15.632498672675942 0.037097930908203125 3 0.9784497536557719 8.391763211941944 38275.0 83.61880630630631 0.0 - - - - - - - 290.8 76 5 TUSC2 tumor suppressor candidate 2 171 22 B20140214_SF053_01 B20140214_SF053_01 TB464287.[MT7]-GLWPFASAAGGGGSEAAGAEQALVRPR.3y24_2.heavy 909.808 / 1114.06 40051.0 41.1741247177124 43 17 10 6 10 6.3969300170029815 15.632498672675942 0.037097930908203125 3 0.9784497536557719 8.391763211941944 40051.0 167.08825911241567 0.0 - - - - - - - 336.1666666666667 80 6 TUSC2 tumor suppressor candidate 2 173 22 B20140214_SF053_01 B20140214_SF053_01 TB464287.[MT7]-GLWPFASAAGGGGSEAAGAEQALVRPR.3b24_2.heavy 909.808 / 1150.57 1615.0 41.1741247177124 43 17 10 6 10 6.3969300170029815 15.632498672675942 0.037097930908203125 3 0.9784497536557719 8.391763211941944 1615.0 3.597772277227723 0.0 - - - - - - - 205.85 3 20 TUSC2 tumor suppressor candidate 2 175 22 B20140214_SF053_01 B20140214_SF053_01 TB464287.[MT7]-GLWPFASAAGGGGSEAAGAEQALVRPR.3y19_2.heavy 909.808 / 877.451 3957.0 41.1741247177124 43 17 10 6 10 6.3969300170029815 15.632498672675942 0.037097930908203125 3 0.9784497536557719 8.391763211941944 3957.0 8.576298860844314 0.0 - - - - - - - 316.53846153846155 7 13 TUSC2 tumor suppressor candidate 2 177 23 B20140214_SF053_01 B20140214_SF053_01 TB464288.[MT7]-AIVFRPFK[MT7]GEVVDAVVTQVNK[MT7].3y3_1.heavy 916.876 / 504.326 6362.0 38.51025104522705 43 17 10 6 10 2.978867307222283 26.6886143269513 0.038196563720703125 3 0.971841064789036 7.337191382468368 6362.0 16.65591842076334 0.0 - - - - - - - 651.6666666666666 12 9 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 179 23 B20140214_SF053_01 B20140214_SF053_01 TB464288.[MT7]-AIVFRPFK[MT7]GEVVDAVVTQVNK[MT7].3b10_2.heavy 916.876 / 717.429 7518.0 38.51025104522705 43 17 10 6 10 2.978867307222283 26.6886143269513 0.038196563720703125 3 0.971841064789036 7.337191382468368 7518.0 15.166573104216761 0.0 - - - - - - - 273.625 15 16 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 181 23 B20140214_SF053_01 B20140214_SF053_01 TB464288.[MT7]-AIVFRPFK[MT7]GEVVDAVVTQVNK[MT7].3y8_1.heavy 916.876 / 1002.61 3553.0 38.51025104522705 43 17 10 6 10 2.978867307222283 26.6886143269513 0.038196563720703125 3 0.971841064789036 7.337191382468368 3553.0 17.765 0.0 - - - - - - - 197.38888888888889 7 18 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 183 23 B20140214_SF053_01 B20140214_SF053_01 TB464288.[MT7]-AIVFRPFK[MT7]GEVVDAVVTQVNK[MT7].3b13_2.heavy 916.876 / 874.011 11649.0 38.51025104522705 43 17 10 6 10 2.978867307222283 26.6886143269513 0.038196563720703125 3 0.971841064789036 7.337191382468368 11649.0 36.175372297594066 0.0 - - - - - - - 284.0625 23 16 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 185 24 B20140214_SF053_01 B20140214_SF053_01 TB464289.[MT7]-IAAVHNVPLSVLIRPLPSVLDPAK[MT7].4b7_1.heavy 702.683 / 849.506 21972.0 43.767799377441406 43 18 10 5 10 1.2203359270127385 47.39949614478991 0.04180145263671875 3 0.9807645597725717 8.884084544437632 21972.0 77.88999950541194 0.0 - - - - - - - 344.25 43 12 SRXN1 sulfiredoxin 1 187 24 B20140214_SF053_01 B20140214_SF053_01 TB464289.[MT7]-IAAVHNVPLSVLIRPLPSVLDPAK[MT7].4y3_1.heavy 702.683 / 459.305 369069.0 43.767799377441406 43 18 10 5 10 1.2203359270127385 47.39949614478991 0.04180145263671875 3 0.9807645597725717 8.884084544437632 369069.0 373.65794342354934 0.0 - - - - - - - 324.0 738 2 SRXN1 sulfiredoxin 1 189 24 B20140214_SF053_01 B20140214_SF053_01 TB464289.[MT7]-IAAVHNVPLSVLIRPLPSVLDPAK[MT7].4y17_2.heavy 702.683 / 980.11 110023.0 43.767799377441406 43 18 10 5 10 1.2203359270127385 47.39949614478991 0.04180145263671875 3 0.9807645597725717 8.884084544437632 110023.0 240.56422382724094 0.0 - - - - - - - 216.0 220 9 SRXN1 sulfiredoxin 1 191 24 B20140214_SF053_01 B20140214_SF053_01 TB464289.[MT7]-IAAVHNVPLSVLIRPLPSVLDPAK[MT7].4b6_1.heavy 702.683 / 750.438 31945.0 43.767799377441406 43 18 10 5 10 1.2203359270127385 47.39949614478991 0.04180145263671875 3 0.9807645597725717 8.884084544437632 31945.0 82.93260770505385 0.0 - - - - - - - 306.0 63 9 SRXN1 sulfiredoxin 1 193 25 B20140214_SF053_01 B20140214_SF053_01 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1590080.0 31.500600814819336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1590080.0 395.9735955680008 0.0 - - - - - - - 2871.0 3180 1 195 25 B20140214_SF053_01 B20140214_SF053_01 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 487028.0 31.500600814819336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 487028.0 254.85697515428689 0.0 - - - - - - - 2324.0 974 2 197 25 B20140214_SF053_01 B20140214_SF053_01 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 348958.0 31.500600814819336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 348958.0 123.93792065903321 0.0 - - - - - - - 1868.0 697 1 199 26 B20140214_SF053_01 B20140214_SF053_01 TB464280.[MT7]-SASLLSLQTELLLDLVAEAQSR.4b4_1.heavy 626.104 / 503.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 201 26 B20140214_SF053_01 B20140214_SF053_01 TB464280.[MT7]-SASLLSLQTELLLDLVAEAQSR.4b5_1.heavy 626.104 / 616.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 203 26 B20140214_SF053_01 B20140214_SF053_01 TB464280.[MT7]-SASLLSLQTELLLDLVAEAQSR.4y6_1.heavy 626.104 / 661.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 205 26 B20140214_SF053_01 B20140214_SF053_01 TB464280.[MT7]-SASLLSLQTELLLDLVAEAQSR.4b6_1.heavy 626.104 / 703.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 207 27 B20140214_SF053_01 B20140214_SF053_01 TB107955.[MT7]-RRTVEGGSSSVFSMFDQTQIQEFK[MT7].4y5_1.heavy 763.89 / 808.469 9490.0 39.9547758102417 43 17 10 6 10 2.2812062180717505 31.117798420125936 0.038501739501953125 3 0.976622082881035 8.055819701400537 9490.0 20.441187786219476 0.0 - - - - - - - 736.2 18 10 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 209 27 B20140214_SF053_01 B20140214_SF053_01 TB107955.[MT7]-RRTVEGGSSSVFSMFDQTQIQEFK[MT7].4y4_1.heavy 763.89 / 695.385 14807.0 39.9547758102417 43 17 10 6 10 2.2812062180717505 31.117798420125936 0.038501739501953125 3 0.976622082881035 8.055819701400537 14807.0 16.81076390807404 0.0 - - - - - - - 785.3 29 10 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 211 27 B20140214_SF053_01 B20140214_SF053_01 TB107955.[MT7]-RRTVEGGSSSVFSMFDQTQIQEFK[MT7].4b16_2.heavy 763.89 / 944.461 13253.0 39.9547758102417 43 17 10 6 10 2.2812062180717505 31.117798420125936 0.038501739501953125 3 0.976622082881035 8.055819701400537 13253.0 29.163080684596576 0.0 - - - - - - - 736.0 26 13 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 213 27 B20140214_SF053_01 B20140214_SF053_01 TB107955.[MT7]-RRTVEGGSSSVFSMFDQTQIQEFK[MT7].4y3_1.heavy 763.89 / 567.326 11371.0 39.9547758102417 43 17 10 6 10 2.2812062180717505 31.117798420125936 0.038501739501953125 3 0.976622082881035 8.055819701400537 11371.0 16.15869222105379 0.0 - - - - - - - 1186.3 22 10 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 215 28 B20140214_SF053_01 B20140214_SF053_01 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 293588.0 18.096900939941406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 293588.0 339.98333214015827 0.0 - - - - - - - 630.0 587 8 217 28 B20140214_SF053_01 B20140214_SF053_01 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 558619.0 18.096900939941406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 558619.0 1845.6567751990217 0.0 - - - - - - - 317.90909090909093 1117 11 219 28 B20140214_SF053_01 B20140214_SF053_01 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 200666.0 18.096900939941406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 200666.0 641.5259629461854 0.0 - - - - - - - 634.8571428571429 401 7 221 29 B20140214_SF053_01 B20140214_SF053_01 TB107954.[MT7]-EISILQEQISHLQFVIHSQHQNLR.4y8_1.heavy 761.165 / 1019.51 4517.0 43.31037521362305 43 17 10 6 10 7.066500499604981 14.151276152260941 0.038299560546875 3 0.9766131107041699 8.054268206386336 4517.0 6.525361155698235 0.0 - - - - - - - 156.0 9 9 CCDC68 coiled-coil domain containing 68 223 29 B20140214_SF053_01 B20140214_SF053_01 TB107954.[MT7]-EISILQEQISHLQFVIHSQHQNLR.4b4_1.heavy 761.165 / 587.352 8410.0 43.31037521362305 43 17 10 6 10 7.066500499604981 14.151276152260941 0.038299560546875 3 0.9766131107041699 8.054268206386336 8410.0 5.716767371601208 0.0 - - - - - - - 234.0 16 1 CCDC68 coiled-coil domain containing 68 225 29 B20140214_SF053_01 B20140214_SF053_01 TB107954.[MT7]-EISILQEQISHLQFVIHSQHQNLR.4b5_1.heavy 761.165 / 700.436 7398.0 43.31037521362305 43 17 10 6 10 7.066500499604981 14.151276152260941 0.038299560546875 3 0.9766131107041699 8.054268206386336 7398.0 7.366316916488222 0.0 - - - - - - - 363.3333333333333 14 3 CCDC68 coiled-coil domain containing 68 227 29 B20140214_SF053_01 B20140214_SF053_01 TB107954.[MT7]-EISILQEQISHLQFVIHSQHQNLR.4y7_1.heavy 761.165 / 882.454 8254.0 43.31037521362305 43 17 10 6 10 7.066500499604981 14.151276152260941 0.038299560546875 3 0.9766131107041699 8.054268206386336 8254.0 19.733213367609252 0.0 - - - - - - - 272.375 16 8 CCDC68 coiled-coil domain containing 68 229 30 B20140214_SF053_01 B20140214_SF053_01 TB464056.[MT7]-LAC[CAM]TPSLIR.2y8_1.heavy 587.84 / 917.487 72123.0 33.28620147705078 50 20 10 10 10 50.220796952913425 1.9912069514499962 0.0 3 0.999172295744167 42.89382893885053 72123.0 179.54633340603536 0.0 - - - - - - - 701.1 144 10 ATP5G3 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) 231 30 B20140214_SF053_01 B20140214_SF053_01 TB464056.[MT7]-LAC[CAM]TPSLIR.2y5_1.heavy 587.84 / 585.372 27473.0 33.28620147705078 50 20 10 10 10 50.220796952913425 1.9912069514499962 0.0 3 0.999172295744167 42.89382893885053 27473.0 41.097476286619155 0.0 - - - - - - - 205.25 54 4 ATP5G3 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) 233 30 B20140214_SF053_01 B20140214_SF053_01 TB464056.[MT7]-LAC[CAM]TPSLIR.2y6_1.heavy 587.84 / 686.42 15726.0 33.28620147705078 50 20 10 10 10 50.220796952913425 1.9912069514499962 0.0 3 0.999172295744167 42.89382893885053 15726.0 32.1373327176781 0.0 - - - - - - - 694.6 31 10 ATP5G3 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) 235 30 B20140214_SF053_01 B20140214_SF053_01 TB464056.[MT7]-LAC[CAM]TPSLIR.2y7_1.heavy 587.84 / 846.45 24567.0 33.28620147705078 50 20 10 10 10 50.220796952913425 1.9912069514499962 0.0 3 0.999172295744167 42.89382893885053 24567.0 64.35012465234915 0.0 - - - - - - - 721.7142857142857 49 7 ATP5G3 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) 237 31 B20140214_SF053_01 B20140214_SF053_01 TB246443.[MT7]-EEGDWNSSK[MT7].2y4_1.heavy 670.322 / 579.322 2068.0 22.84712505340576 43 17 10 6 10 3.4718389933682725 28.803179004272614 0.030300140380859375 3 0.9797922181589865 8.667003635995634 2068.0 11.581247699801551 0.0 - - - - - - - 214.76923076923077 4 26 CLEC2B C-type lectin domain family 2, member B 239 31 B20140214_SF053_01 B20140214_SF053_01 TB246443.[MT7]-EEGDWNSSK[MT7].2y8_1.heavy 670.322 / 1066.49 2309.0 22.84712505340576 43 17 10 6 10 3.4718389933682725 28.803179004272614 0.030300140380859375 3 0.9797922181589865 8.667003635995634 2309.0 26.069438925265295 0.0 - - - - - - - 118.91666666666667 4 24 CLEC2B C-type lectin domain family 2, member B 241 31 B20140214_SF053_01 B20140214_SF053_01 TB246443.[MT7]-EEGDWNSSK[MT7].2y5_1.heavy 670.322 / 765.401 6031.0 22.84712505340576 43 17 10 6 10 3.4718389933682725 28.803179004272614 0.030300140380859375 3 0.9797922181589865 8.667003635995634 6031.0 44.120929026343724 0.0 - - - - - - - 180.52 12 25 CLEC2B C-type lectin domain family 2, member B 243 31 B20140214_SF053_01 B20140214_SF053_01 TB246443.[MT7]-EEGDWNSSK[MT7].2b4_1.heavy 670.322 / 575.243 7513.0 22.84712505340576 43 17 10 6 10 3.4718389933682725 28.803179004272614 0.030300140380859375 3 0.9797922181589865 8.667003635995634 7513.0 32.3587714937606 0.0 - - - - - - - 615.2857142857143 15 7 CLEC2B C-type lectin domain family 2, member B 245 32 B20140214_SF053_01 B20140214_SF053_01 TB464259.[MT7]-GLAPDLPEDLY[MT7]HLIK[MT7].4y4_1.heavy 532.311 / 654.442 18686.0 41.09079933166504 46 20 10 6 10 18.876676463218956 5.297542721296789 0.036998748779296875 3 0.9949492310219418 17.358038794287733 18686.0 28.30568636659551 0.0 - - - - - - - 728.0 37 8 RPS13 ribosomal protein S13 247 32 B20140214_SF053_01 B20140214_SF053_01 TB464259.[MT7]-GLAPDLPEDLY[MT7]HLIK[MT7].4b5_1.heavy 532.311 / 598.332 226983.0 41.09079933166504 46 20 10 6 10 18.876676463218956 5.297542721296789 0.036998748779296875 3 0.9949492310219418 17.358038794287733 226983.0 255.86914709819305 0.0 - - - - - - - 667.25 453 8 RPS13 ribosomal protein S13 249 32 B20140214_SF053_01 B20140214_SF053_01 TB464259.[MT7]-GLAPDLPEDLY[MT7]HLIK[MT7].4y3_1.heavy 532.311 / 517.383 69324.0 41.09079933166504 46 20 10 6 10 18.876676463218956 5.297542721296789 0.036998748779296875 3 0.9949492310219418 17.358038794287733 69324.0 44.73509595922518 0.0 - - - - - - - 1456.0 138 2 RPS13 ribosomal protein S13 251 32 B20140214_SF053_01 B20140214_SF053_01 TB464259.[MT7]-GLAPDLPEDLY[MT7]HLIK[MT7].4b6_1.heavy 532.311 / 711.416 47564.0 41.09079933166504 46 20 10 6 10 18.876676463218956 5.297542721296789 0.036998748779296875 3 0.9949492310219418 17.358038794287733 47564.0 124.369760136639 0.0 - - - - - - - 687.5 95 8 RPS13 ribosomal protein S13 253 33 B20140214_SF053_01 B20140214_SF053_01 TB464052.[MT7]-LLK[MT7]PQK[MT7].2y4_1.heavy 579.9 / 788.523 2927.0 23.628599166870117 46 16 10 10 10 3.206908128501785 31.18268313059481 0.0 3 0.9644637455497682 6.527276084089324 2927.0 4.151245942929691 0.0 - - - - - - - 644.9166666666666 5 12 RBP7 retinol binding protein 7, cellular 255 33 B20140214_SF053_01 B20140214_SF053_01 TB464052.[MT7]-LLK[MT7]PQK[MT7].2b3_1.heavy 579.9 / 643.474 4325.0 23.628599166870117 46 16 10 10 10 3.206908128501785 31.18268313059481 0.0 3 0.9644637455497682 6.527276084089324 4325.0 24.72515840966545 0.0 - - - - - - - 665.0 8 9 RBP7 retinol binding protein 7, cellular 257 33 B20140214_SF053_01 B20140214_SF053_01 TB464052.[MT7]-LLK[MT7]PQK[MT7].2y5_1.heavy 579.9 / 901.607 1821.0 23.628599166870117 46 16 10 10 10 3.206908128501785 31.18268313059481 0.0 3 0.9644637455497682 6.527276084089324 1821.0 20.515125506072874 0.0 - - - - - - - 175.53571428571428 3 28 RBP7 retinol binding protein 7, cellular 259 33 B20140214_SF053_01 B20140214_SF053_01 TB464052.[MT7]-LLK[MT7]PQK[MT7].2y3_1.heavy 579.9 / 516.326 7415.0 23.628599166870117 46 16 10 10 10 3.206908128501785 31.18268313059481 0.0 3 0.9644637455497682 6.527276084089324 7415.0 8.685212298682284 1.0 - - - - - - - 722.2857142857143 16 14 RBP7 retinol binding protein 7, cellular 261 34 B20140214_SF053_01 B20140214_SF053_01 TB464258.[MT7]-EAFTVIDQNRDGIIDK[MT7].3y3_1.heavy 708.051 / 519.326 14232.0 34.09270095825195 41 11 10 10 10 1.0069171322892652 58.00296051107442 0.0 3 0.8714706256953467 3.4048334760650505 14232.0 21.747091254752853 0.0 - - - - - - - 1212.0 28 7 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 263 34 B20140214_SF053_01 B20140214_SF053_01 TB464258.[MT7]-EAFTVIDQNRDGIIDK[MT7].3y9_2.heavy 708.051 / 601.834 48794.0 34.09270095825195 41 11 10 10 10 1.0069171322892652 58.00296051107442 0.0 3 0.8714706256953467 3.4048334760650505 48794.0 69.37392762019896 0.0 - - - - - - - 806.0 97 10 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 265 34 B20140214_SF053_01 B20140214_SF053_01 TB464258.[MT7]-EAFTVIDQNRDGIIDK[MT7].3y5_1.heavy 708.051 / 689.431 20191.0 34.09270095825195 41 11 10 10 10 1.0069171322892652 58.00296051107442 0.0 3 0.8714706256953467 3.4048334760650505 20191.0 22.27295758861812 0.0 - - - - - - - 802.8181818181819 40 11 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 267 34 B20140214_SF053_01 B20140214_SF053_01 TB464258.[MT7]-EAFTVIDQNRDGIIDK[MT7].3y13_2.heavy 708.051 / 815.948 26010.0 34.09270095825195 41 11 10 10 10 1.0069171322892652 58.00296051107442 0.0 3 0.8714706256953467 3.4048334760650505 26010.0 105.55778978944983 0.0 - - - - - - - 243.0 52 15 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 269 35 B20140214_SF053_01 B20140214_SF053_01 TB464257.[MT7]-SEPPLPPGGQELLELLLR.3y7_1.heavy 701.404 / 869.582 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 271 35 B20140214_SF053_01 B20140214_SF053_01 TB464257.[MT7]-SEPPLPPGGQELLELLLR.3y11_1.heavy 701.404 / 1240.73 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 273 35 B20140214_SF053_01 B20140214_SF053_01 TB464257.[MT7]-SEPPLPPGGQELLELLLR.3b5_1.heavy 701.404 / 668.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 275 35 B20140214_SF053_01 B20140214_SF053_01 TB464257.[MT7]-SEPPLPPGGQELLELLLR.3y13_2.heavy 701.404 / 717.919 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 277 36 B20140214_SF053_01 B20140214_SF053_01 TB464190.[MT7]-ARIAAGLPMAGIPFLTTDLTYR.3b11_1.heavy 831.465 / 1153.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 279 36 B20140214_SF053_01 B20140214_SF053_01 TB464190.[MT7]-ARIAAGLPMAGIPFLTTDLTYR.3y5_1.heavy 831.465 / 667.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 281 36 B20140214_SF053_01 B20140214_SF053_01 TB464190.[MT7]-ARIAAGLPMAGIPFLTTDLTYR.3b7_1.heavy 831.465 / 797.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 283 36 B20140214_SF053_01 B20140214_SF053_01 TB464190.[MT7]-ARIAAGLPMAGIPFLTTDLTYR.3y10_1.heavy 831.465 / 1226.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 285 37 B20140214_SF053_01 B20140214_SF053_01 TB246445.[MT7]-YQSALLPHK[MT7].3y3_1.heavy 448.934 / 525.326 88970.0 29.21897554397583 42 15 10 7 10 3.464967515215862 22.841484866648948 0.029100418090820312 3 0.9583786440221508 6.0281812574792015 88970.0 56.55799992616769 0.0 - - - - - - - 808.0 177 2 TMEM126A transmembrane protein 126A 287 37 B20140214_SF053_01 B20140214_SF053_01 TB246445.[MT7]-YQSALLPHK[MT7].3b4_1.heavy 448.934 / 594.3 70297.0 29.21897554397583 42 15 10 7 10 3.464967515215862 22.841484866648948 0.029100418090820312 3 0.9583786440221508 6.0281812574792015 70297.0 44.35508904496566 0.0 - - - - - - - 1324.0 140 2 TMEM126A transmembrane protein 126A 289 37 B20140214_SF053_01 B20140214_SF053_01 TB246445.[MT7]-YQSALLPHK[MT7].3b5_1.heavy 448.934 / 707.385 51982.0 29.21897554397583 42 15 10 7 10 3.464967515215862 22.841484866648948 0.029100418090820312 3 0.9583786440221508 6.0281812574792015 51982.0 147.15570478302186 0.0 - - - - - - - 812.6 103 10 TMEM126A transmembrane protein 126A 291 37 B20140214_SF053_01 B20140214_SF053_01 TB246445.[MT7]-YQSALLPHK[MT7].3b3_1.heavy 448.934 / 523.263 15801.0 29.21897554397583 42 15 10 7 10 3.464967515215862 22.841484866648948 0.029100418090820312 3 0.9583786440221508 6.0281812574792015 15801.0 12.421572445705165 0.0 - - - - - - - 830.5 31 4 TMEM126A transmembrane protein 126A 293 38 B20140214_SF053_01 B20140214_SF053_01 TB464256.[MT7]-GASSFPVPPPGAQGVAELLR.3y11_1.heavy 698.72 / 1110.63 26497.0 42.896199226379395 39 13 10 6 10 0.9406209728159514 69.48011301047775 0.031597137451171875 3 0.9070991074250933 4.017274003608912 26497.0 0.7944787115565835 2.0 - - - - - - - 1293.0 52 1 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 295 38 B20140214_SF053_01 B20140214_SF053_01 TB464256.[MT7]-GASSFPVPPPGAQGVAELLR.3b5_1.heavy 698.72 / 594.3 81107.0 42.896199226379395 39 13 10 6 10 0.9406209728159514 69.48011301047775 0.031597137451171875 3 0.9070991074250933 4.017274003608912 81107.0 25.23284631428339 0.0 - - - - - - - 6624.0 162 1 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 297 38 B20140214_SF053_01 B20140214_SF053_01 TB464256.[MT7]-GASSFPVPPPGAQGVAELLR.3y12_1.heavy 698.72 / 1207.68 16965.0 42.896199226379395 39 13 10 6 10 0.9406209728159514 69.48011301047775 0.031597137451171875 3 0.9070991074250933 4.017274003608912 16965.0 12.97372281014285 0.0 - - - - - - - 808.0 33 3 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 299 38 B20140214_SF053_01 B20140214_SF053_01 TB464256.[MT7]-GASSFPVPPPGAQGVAELLR.3y12_2.heavy 698.72 / 604.343 101383.0 42.896199226379395 39 13 10 6 10 0.9406209728159514 69.48011301047775 0.031597137451171875 3 0.9070991074250933 4.017274003608912 101383.0 16.32755141100935 1.0 - - - - - - - 9815.5 202 2 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 301 39 B20140214_SF053_01 B20140214_SF053_01 TB464254.[MT7]-GASSFPVPPPGAQGVAELLR.2y12_1.heavy 1047.58 / 1207.68 N/A 42.8882999420166 38 12 10 6 10 1.7957659898177918 27.84327149723627 0.031597137451171875 2 0.8842284931344101 3.591531969899715 1451.0 4.378322498615754 0.0 - - - - - - - 274.06666666666666 2 15 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 303 39 B20140214_SF053_01 B20140214_SF053_01 TB464254.[MT7]-GASSFPVPPPGAQGVAELLR.2b7_1.heavy 1047.58 / 790.422 19019.0 42.8882999420166 38 12 10 6 10 1.7957659898177918 27.84327149723627 0.031597137451171875 2 0.8842284931344101 3.591531969899715 19019.0 15.82114996342704 1.0 - - - - - - - 268.3333333333333 38 3 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 305 39 B20140214_SF053_01 B20140214_SF053_01 TB464254.[MT7]-GASSFPVPPPGAQGVAELLR.2b5_1.heavy 1047.58 / 594.3 13619.0 42.8882999420166 38 12 10 6 10 1.7957659898177918 27.84327149723627 0.031597137451171875 2 0.8842284931344101 3.591531969899715 13619.0 23.136470000088796 0.0 - - - - - - - 282.1666666666667 27 6 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 307 39 B20140214_SF053_01 B20140214_SF053_01 TB464254.[MT7]-GASSFPVPPPGAQGVAELLR.2y11_1.heavy 1047.58 / 1110.63 N/A 42.8882999420166 38 12 10 6 10 1.7957659898177918 27.84327149723627 0.031597137451171875 2 0.8842284931344101 3.591531969899715 1048.0 0.6827059274217612 3.0 - - - - - - - 223.15384615384616 2 13 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 309 40 B20140214_SF053_01 B20140214_SF053_01 TB464251.[MT7]-NAVPDIQGDSEAVSVRK[MT7].4y4_1.heavy 519.035 / 633.416 36813.0 28.595800399780273 38 8 10 10 10 0.532915100677024 89.52128638047489 0.0 3 0.7525358889656837 2.4278046461372687 36813.0 21.889498466428407 0.0 - - - - - - - 1652.2857142857142 73 7 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 311 40 B20140214_SF053_01 B20140214_SF053_01 TB464251.[MT7]-NAVPDIQGDSEAVSVRK[MT7].4y10_2.heavy 519.035 / 596.326 428538.0 28.595800399780273 38 8 10 10 10 0.532915100677024 89.52128638047489 0.0 3 0.7525358889656837 2.4278046461372687 428538.0 67.79650184637899 0.0 - - - - - - - 1290.0 857 2 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 313 40 B20140214_SF053_01 B20140214_SF053_01 TB464251.[MT7]-NAVPDIQGDSEAVSVRK[MT7].4b5_1.heavy 519.035 / 641.338 303216.0 28.595800399780273 38 8 10 10 10 0.532915100677024 89.52128638047489 0.0 3 0.7525358889656837 2.4278046461372687 303216.0 56.33249017463833 0.0 - - - - - - - 1729.8181818181818 606 11 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 315 40 B20140214_SF053_01 B20140214_SF053_01 TB464251.[MT7]-NAVPDIQGDSEAVSVRK[MT7].4y6_1.heavy 519.035 / 803.522 21240.0 28.595800399780273 38 8 10 10 10 0.532915100677024 89.52128638047489 0.0 3 0.7525358889656837 2.4278046461372687 21240.0 88.06060507349648 0.0 - - - - - - - 1086.2857142857142 42 7 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 317 41 B20140214_SF053_01 B20140214_SF053_01 TB464250.[MT7]-NAVPDIQGDSEAVSVRK[MT7].3b5_1.heavy 691.711 / 641.338 24291.0 28.595800399780273 35 5 10 10 10 0.5078467217141155 106.79599268581401 0.0 3 0.6147449280323426 1.9206166369634783 24291.0 49.704032865654426 0.0 - - - - - - - 744.0714285714286 48 14 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 319 41 B20140214_SF053_01 B20140214_SF053_01 TB464250.[MT7]-NAVPDIQGDSEAVSVRK[MT7].3y14_2.heavy 691.711 / 822.937 99835.0 28.595800399780273 35 5 10 10 10 0.5078467217141155 106.79599268581401 0.0 3 0.6147449280323426 1.9206166369634783 99835.0 171.92951793124405 0.0 - - - - - - - 309.57142857142856 199 7 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 321 41 B20140214_SF053_01 B20140214_SF053_01 TB464250.[MT7]-NAVPDIQGDSEAVSVRK[MT7].3y8_1.heavy 691.711 / 1019.6 10555.0 28.595800399780273 35 5 10 10 10 0.5078467217141155 106.79599268581401 0.0 3 0.6147449280323426 1.9206166369634783 10555.0 35.37459309504338 0.0 - - - - - - - 205.15 21 20 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 323 41 B20140214_SF053_01 B20140214_SF053_01 TB464250.[MT7]-NAVPDIQGDSEAVSVRK[MT7].3y10_1.heavy 691.711 / 1191.65 16916.0 28.595800399780273 35 5 10 10 10 0.5078467217141155 106.79599268581401 0.0 3 0.6147449280323426 1.9206166369634783 16916.0 171.56726157716804 0.0 - - - - - - - 161.27777777777777 33 18 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 325 42 B20140214_SF053_01 B20140214_SF053_01 TB107956.[MT7]-WGEGFVLVYDITDRGSFEEVLPLK[MT7].4b7_1.heavy 765.16 / 933.495 7182.0 50.01340103149414 41 11 10 10 10 1.7208116646000198 58.11211189299074 0.0 3 0.8683704022072241 3.363585242074121 7182.0 21.39808265955719 0.0 - - - - - - - 255.33333333333334 14 18 RERG RAS-like, estrogen-regulated, growth inhibitor 327 42 B20140214_SF053_01 B20140214_SF053_01 TB107956.[MT7]-WGEGFVLVYDITDRGSFEEVLPLK[MT7].4b4_1.heavy 765.16 / 574.274 2585.0 50.01340103149414 41 11 10 10 10 1.7208116646000198 58.11211189299074 0.0 3 0.8683704022072241 3.363585242074121 2585.0 10.490462094537751 0.0 - - - - - - - 289.39130434782606 5 23 RERG RAS-like, estrogen-regulated, growth inhibitor 329 42 B20140214_SF053_01 B20140214_SF053_01 TB107956.[MT7]-WGEGFVLVYDITDRGSFEEVLPLK[MT7].4b5_1.heavy 765.16 / 721.343 7421.0 50.01340103149414 41 11 10 10 10 1.7208116646000198 58.11211189299074 0.0 3 0.8683704022072241 3.363585242074121 7421.0 25.586037443767204 0.0 - - - - - - - 656.7142857142857 14 7 RERG RAS-like, estrogen-regulated, growth inhibitor 331 42 B20140214_SF053_01 B20140214_SF053_01 TB107956.[MT7]-WGEGFVLVYDITDRGSFEEVLPLK[MT7].4y3_1.heavy 765.16 / 501.352 49745.0 50.01340103149414 41 11 10 10 10 1.7208116646000198 58.11211189299074 0.0 3 0.8683704022072241 3.363585242074121 49745.0 99.19430727331931 0.0 - - - - - - - 670.5 99 8 RERG RAS-like, estrogen-regulated, growth inhibitor 333 43 B20140214_SF053_01 B20140214_SF053_01 TB107958.[MT7]-IFYPEIEEVQALDDTERGSGGFGSTGK[MT7].4y5_1.heavy 798.4 / 593.338 25973.0 43.09187602996826 44 18 10 6 10 5.703986516374298 17.53159824500503 0.035900115966796875 3 0.9882032535736217 11.351503379221295 25973.0 35.587314917127074 0.0 - - - - - - - 281.0 51 2 DUT deoxyuridine triphosphatase 335 43 B20140214_SF053_01 B20140214_SF053_01 TB107958.[MT7]-IFYPEIEEVQALDDTERGSGGFGSTGK[MT7].4b5_1.heavy 798.4 / 794.42 63445.0 43.09187602996826 44 18 10 6 10 5.703986516374298 17.53159824500503 0.035900115966796875 3 0.9882032535736217 11.351503379221295 63445.0 37.26313795145056 0.0 - - - - - - - 482.0 126 1 DUT deoxyuridine triphosphatase 337 43 B20140214_SF053_01 B20140214_SF053_01 TB107958.[MT7]-IFYPEIEEVQALDDTERGSGGFGSTGK[MT7].4b6_1.heavy 798.4 / 907.505 25410.0 43.09187602996826 44 18 10 6 10 5.703986516374298 17.53159824500503 0.035900115966796875 3 0.9882032535736217 11.351503379221295 25410.0 44.23055062166963 0.0 - - - - - - - 273.2 50 5 DUT deoxyuridine triphosphatase 339 43 B20140214_SF053_01 B20140214_SF053_01 TB107958.[MT7]-IFYPEIEEVQALDDTERGSGGFGSTGK[MT7].4b3_1.heavy 798.4 / 568.325 71728.0 43.09187602996826 44 18 10 6 10 5.703986516374298 17.53159824500503 0.035900115966796875 3 0.9882032535736217 11.351503379221295 71728.0 46.94240837696335 0.0 - - - - - - - 362.0 143 2 DUT deoxyuridine triphosphatase 341 44 B20140214_SF053_01 B20140214_SF053_01 TB107959.[MT7]-IFYPEIEEVQALDDTERGSGGFGSTGK[MT7].3y11_1.heavy 1064.2 / 1154.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 343 44 B20140214_SF053_01 B20140214_SF053_01 TB107959.[MT7]-IFYPEIEEVQALDDTERGSGGFGSTGK[MT7].3b3_1.heavy 1064.2 / 568.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 345 44 B20140214_SF053_01 B20140214_SF053_01 TB107959.[MT7]-IFYPEIEEVQALDDTERGSGGFGSTGK[MT7].3y5_1.heavy 1064.2 / 593.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 347 44 B20140214_SF053_01 B20140214_SF053_01 TB107959.[MT7]-IFYPEIEEVQALDDTERGSGGFGSTGK[MT7].3y10_1.heavy 1064.2 / 998.502 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 349 45 B20140214_SF053_01 B20140214_SF053_01 TB107960.[MT7]-TVC[CAM]TYWEDFHSC[CAM]TVTALTDC[CAM]QEGAK[MT7].4y4_1.heavy 817.621 / 548.316 24090.0 39.7422981262207 38 8 10 10 10 1.4915712944102333 52.65489074126041 0.0 3 0.7861006398741301 2.619349952815709 24090.0 46.136913451511994 0.0 - - - - - - - 740.0909090909091 48 11 NRN1 neuritin 1 351 45 B20140214_SF053_01 B20140214_SF053_01 TB107960.[MT7]-TVC[CAM]TYWEDFHSC[CAM]TVTALTDC[CAM]QEGAK[MT7].4b8_1.heavy 817.621 / 1199.52 2795.0 39.7422981262207 38 8 10 10 10 1.4915712944102333 52.65489074126041 0.0 3 0.7861006398741301 2.619349952815709 2795.0 15.445088999871942 0.0 - - - - - - - 193.57142857142858 5 14 NRN1 neuritin 1 353 45 B20140214_SF053_01 B20140214_SF053_01 TB107960.[MT7]-TVC[CAM]TYWEDFHSC[CAM]TVTALTDC[CAM]QEGAK[MT7].4b4_1.heavy 817.621 / 606.304 4029.0 39.7422981262207 38 8 10 10 10 1.4915712944102333 52.65489074126041 0.0 3 0.7861006398741301 2.619349952815709 4029.0 7.4850763985870366 0.0 - - - - - - - 709.25 8 8 NRN1 neuritin 1 355 45 B20140214_SF053_01 B20140214_SF053_01 TB107960.[MT7]-TVC[CAM]TYWEDFHSC[CAM]TVTALTDC[CAM]QEGAK[MT7].4y6_1.heavy 817.621 / 836.405 6166.0 39.7422981262207 38 8 10 10 10 1.4915712944102333 52.65489074126041 0.0 3 0.7861006398741301 2.619349952815709 6166.0 17.242310030395135 1.0 - - - - - - - 667.2222222222222 12 9 NRN1 neuritin 1 357 46 B20140214_SF053_01 B20140214_SF053_01 TB107965.[MT7]-RVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLR.4b8_1.heavy 1106.51 / 1013.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - CETN1 centrin, EF-hand protein, 1 359 46 B20140214_SF053_01 B20140214_SF053_01 TB107965.[MT7]-RVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLR.4y10_1.heavy 1106.51 / 1221.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - CETN1 centrin, EF-hand protein, 1 361 46 B20140214_SF053_01 B20140214_SF053_01 TB107965.[MT7]-RVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLR.4b5_1.heavy 1106.51 / 714.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - CETN1 centrin, EF-hand protein, 1 363 46 B20140214_SF053_01 B20140214_SF053_01 TB107965.[MT7]-RVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLR.4b9_1.heavy 1106.51 / 1127.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - CETN1 centrin, EF-hand protein, 1 365 47 B20140214_SF053_01 B20140214_SF053_01 TB107963.[MT7]-DEYDDLSDLTAAQQETLSDWESQFTFK[MT7].3b8_1.heavy 1157.54 / 1097.44 2006.0 49.3922004699707 44 17 10 7 10 2.69819789873805 37.0617737293362 0.0281982421875 3 0.9703272345167581 7.1466674556280685 2006.0 37.70017482517483 0.0 - - - - - - - 95.66666666666667 4 12 PGRMC1 progesterone receptor membrane component 1 367 47 B20140214_SF053_01 B20140214_SF053_01 TB107963.[MT7]-DEYDDLSDLTAAQQETLSDWESQFTFK[MT7].3y8_1.heavy 1157.54 / 1216.61 1003.0 49.3922004699707 44 17 10 7 10 2.69819789873805 37.0617737293362 0.0281982421875 3 0.9703272345167581 7.1466674556280685 1003.0 9.074344405594406 0.0 - - - - - - - 191.2 2 10 PGRMC1 progesterone receptor membrane component 1 369 47 B20140214_SF053_01 B20140214_SF053_01 TB107963.[MT7]-DEYDDLSDLTAAQQETLSDWESQFTFK[MT7].3b4_1.heavy 1157.54 / 667.269 N/A 49.3922004699707 44 17 10 7 10 2.69819789873805 37.0617737293362 0.0281982421875 3 0.9703272345167581 7.1466674556280685 1003.0 9.118181818181819 0.0 - - - - - - - 137.0 2 15 PGRMC1 progesterone receptor membrane component 1 371 47 B20140214_SF053_01 B20140214_SF053_01 TB107963.[MT7]-DEYDDLSDLTAAQQETLSDWESQFTFK[MT7].3b5_1.heavy 1157.54 / 782.296 2579.0 49.3922004699707 44 17 10 7 10 2.69819789873805 37.0617737293362 0.0281982421875 3 0.9703272345167581 7.1466674556280685 2579.0 52.89636458333333 0.0 - - - - - - - 103.72222222222223 5 18 PGRMC1 progesterone receptor membrane component 1 373 48 B20140214_SF053_01 B20140214_SF053_01 TB464269.[MT7]-RGASSFPVPPPGAQGVAELLR.4y5_1.heavy 563.317 / 601.367 12050.0 39.926175117492676 34 13 10 3 8 1.433038214804918 46.04228280131134 0.07590103149414062 4 0.9154517300076808 4.214067970047 12050.0 7.61401098901099 1.0 - - - - - - - 707.75 24 4 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 375 48 B20140214_SF053_01 B20140214_SF053_01 TB464269.[MT7]-RGASSFPVPPPGAQGVAELLR.4b5_1.heavy 563.317 / 603.333 2750.0 39.926175117492676 34 13 10 3 8 1.433038214804918 46.04228280131134 0.07590103149414062 4 0.9154517300076808 4.214067970047 2750.0 0.956336939721793 11.0 - - - - - - - 1267.0 8 9 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 377 48 B20140214_SF053_01 B20140214_SF053_01 TB464269.[MT7]-RGASSFPVPPPGAQGVAELLR.4y7_1.heavy 563.317 / 757.457 8168.0 39.926175117492676 34 13 10 3 8 1.433038214804918 46.04228280131134 0.07590103149414062 4 0.9154517300076808 4.214067970047 8168.0 8.44332584269663 1.0 - - - - - - - 404.0 18 1 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 379 48 B20140214_SF053_01 B20140214_SF053_01 TB464269.[MT7]-RGASSFPVPPPGAQGVAELLR.4b6_1.heavy 563.317 / 750.401 10756.0 39.926175117492676 34 13 10 3 8 1.433038214804918 46.04228280131134 0.07590103149414062 4 0.9154517300076808 4.214067970047 10756.0 14.174364500178687 0.0 - - - - - - - 404.3333333333333 21 3 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 381 49 B20140214_SF053_01 B20140214_SF053_01 TB464268.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].4y5_1.heavy 562.791 / 665.41 12042.0 45.893798828125 47 17 10 10 10 2.959037244891341 33.7947757070804 0.0 3 0.9762753441724605 7.996501557919229 12042.0 56.37532012254237 0.0 - - - - - - - 301.0 24 12 BET1 blocked early in transport 1 homolog (S. cerevisiae) 383 49 B20140214_SF053_01 B20140214_SF053_01 TB464268.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].4b4_1.heavy 562.791 / 571.357 25048.0 45.893798828125 47 17 10 10 10 2.959037244891341 33.7947757070804 0.0 3 0.9762753441724605 7.996501557919229 25048.0 84.15100845315982 0.0 - - - - - - - 267.77777777777777 50 9 BET1 blocked early in transport 1 homolog (S. cerevisiae) 385 49 B20140214_SF053_01 B20140214_SF053_01 TB464268.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].4b5_1.heavy 562.791 / 702.398 8831.0 45.893798828125 47 17 10 10 10 2.959037244891341 33.7947757070804 0.0 3 0.9762753441724605 7.996501557919229 8831.0 22.03294363627557 1.0 - - - - - - - 308.7692307692308 22 13 BET1 blocked early in transport 1 homolog (S. cerevisiae) 387 49 B20140214_SF053_01 B20140214_SF053_01 TB464268.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].4b6_1.heavy 562.791 / 817.425 13568.0 45.893798828125 47 17 10 10 10 2.959037244891341 33.7947757070804 0.0 3 0.9762753441724605 7.996501557919229 13568.0 21.86153931719349 0.0 - - - - - - - 216.15384615384616 27 13 BET1 blocked early in transport 1 homolog (S. cerevisiae) 389 50 B20140214_SF053_01 B20140214_SF053_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 355697.0 20.281400680541992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 355697.0 1286.6804950800865 0.0 - - - - - - - 299.0 711 10 391 50 B20140214_SF053_01 B20140214_SF053_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 221912.0 20.281400680541992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 221912.0 1113.0711970216516 0.0 - - - - - - - 207.36363636363637 443 11 393 50 B20140214_SF053_01 B20140214_SF053_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 212514.0 20.281400680541992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 212514.0 783.9761488702902 0.0 - - - - - - - 269.2307692307692 425 13 395 51 B20140214_SF053_01 B20140214_SF053_01 TB464264.[MT7]-GEPLALPLNVSEY[MT7]C[CAM]VPR.4b4_1.heavy 551.301 / 541.31 23126.0 37.788848876953125 38 14 10 6 8 2.591104459118083 28.847285706244108 0.0373992919921875 4 0.9305849358032581 4.656833317020724 23126.0 21.992372549019606 1.0 - - - - - - - 1322.2222222222222 51 9 BEX2 brain expressed X-linked 2 397 51 B20140214_SF053_01 B20140214_SF053_01 TB464264.[MT7]-GEPLALPLNVSEY[MT7]C[CAM]VPR.4b5_1.heavy 551.301 / 612.347 44466.0 37.788848876953125 38 14 10 6 8 2.591104459118083 28.847285706244108 0.0373992919921875 4 0.9305849358032581 4.656833317020724 44466.0 90.85014117647059 0.0 - - - - - - - 1141.4285714285713 88 7 BEX2 brain expressed X-linked 2 399 51 B20140214_SF053_01 B20140214_SF053_01 TB464264.[MT7]-GEPLALPLNVSEY[MT7]C[CAM]VPR.4y7_1.heavy 551.301 / 1054.51 3316.0 37.788848876953125 38 14 10 6 8 2.591104459118083 28.847285706244108 0.0373992919921875 4 0.9305849358032581 4.656833317020724 3316.0 38.66065882352942 0.0 - - - - - - - 179.44444444444446 6 9 BEX2 brain expressed X-linked 2 401 51 B20140214_SF053_01 B20140214_SF053_01 TB464264.[MT7]-GEPLALPLNVSEY[MT7]C[CAM]VPR.4b6_1.heavy 551.301 / 725.431 7737.0 37.788848876953125 38 14 10 6 8 2.591104459118083 28.847285706244108 0.0373992919921875 4 0.9305849358032581 4.656833317020724 7737.0 20.740361344537813 1.0 - - - - - - - 631.4285714285714 15 7 BEX2 brain expressed X-linked 2 403 52 B20140214_SF053_01 B20140214_SF053_01 TB464265.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].4y4_1.heavy 552.799 / 516.326 63686.0 40.8567008972168 45 15 10 10 10 2.261514286414261 36.58154425104229 0.0 3 0.9513017549340707 5.569642453678695 63686.0 59.5318583368836 0.0 - - - - - - - 790.1111111111111 127 9 MCTS1 malignant T cell amplified sequence 1 405 52 B20140214_SF053_01 B20140214_SF053_01 TB464265.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].4b7_1.heavy 552.799 / 833.464 25730.0 40.8567008972168 45 15 10 10 10 2.261514286414261 36.58154425104229 0.0 3 0.9513017549340707 5.569642453678695 25730.0 54.57266159270105 0.0 - - - - - - - 271.9 51 10 MCTS1 malignant T cell amplified sequence 1 407 52 B20140214_SF053_01 B20140214_SF053_01 TB464265.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].4b5_1.heavy 552.799 / 648.384 13185.0 40.8567008972168 45 15 10 10 10 2.261514286414261 36.58154425104229 0.0 3 0.9513017549340707 5.569642453678695 13185.0 21.583618909049164 0.0 - - - - - - - 751.0 26 10 MCTS1 malignant T cell amplified sequence 1 409 52 B20140214_SF053_01 B20140214_SF053_01 TB464265.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].4b3_1.heavy 552.799 / 504.33 15582.0 40.8567008972168 45 15 10 10 10 2.261514286414261 36.58154425104229 0.0 3 0.9513017549340707 5.569642453678695 15582.0 16.15269935960096 0.0 - - - - - - - 419.5 31 4 MCTS1 malignant T cell amplified sequence 1 411 53 B20140214_SF053_01 B20140214_SF053_01 TB464266.[MT7]-TVHC[CAM]QPAIFVASLAAVEK[MT7].4y4_1.heavy 558.063 / 590.363 111000.0 40.345001220703125 30 12 4 6 8 43.53960294149735 2.296759576203911 0.0355987548828125 4 0.888698245089077 3.6643622999809438 111000.0 116.707496994645 0.0 - - - - - - - 404.0 222 1 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 413 53 B20140214_SF053_01 B20140214_SF053_01 TB464266.[MT7]-TVHC[CAM]QPAIFVASLAAVEK[MT7].4b8_2.heavy 558.063 / 526.277 142287.0 40.345001220703125 30 12 4 6 8 43.53960294149735 2.296759576203911 0.0355987548828125 4 0.888698245089077 3.6643622999809438 142287.0 127.9853461536315 0.0 - - - - - - - 663.0 284 5 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 415 53 B20140214_SF053_01 B20140214_SF053_01 TB464266.[MT7]-TVHC[CAM]QPAIFVASLAAVEK[MT7].4b5_1.heavy 558.063 / 770.374 27326.0 40.345001220703125 30 12 4 6 8 43.53960294149735 2.296759576203911 0.0355987548828125 4 0.888698245089077 3.6643622999809438 27326.0 59.86821428571428 0.0 - - - - - - - 754.5555555555555 54 9 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 417 53 B20140214_SF053_01 B20140214_SF053_01 TB464266.[MT7]-TVHC[CAM]QPAIFVASLAAVEK[MT7].4y3_1.heavy 558.063 / 519.326 102511.0 40.345001220703125 30 12 4 6 8 43.53960294149735 2.296759576203911 0.0355987548828125 4 0.888698245089077 3.6643622999809438 102511.0 21.149098444438632 1.0 - - - - - - - 889.0 545 1 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 419 54 B20140214_SF053_01 B20140214_SF053_01 TB464267.[MT7]-ENTEFSELELQEWYK[MT7].3y3_1.heavy 745.035 / 640.357 28142.0 41.79439926147461 44 14 10 10 10 1.245901024716 53.50879832678777 0.0 3 0.9337154909823953 4.766808829490928 28142.0 38.1116305834093 0.0 - - - - - - - 735.0 56 8 HPCA hippocalcin 421 54 B20140214_SF053_01 B20140214_SF053_01 TB464267.[MT7]-ENTEFSELELQEWYK[MT7].3b4_1.heavy 745.035 / 618.285 19911.0 41.79439926147461 44 14 10 10 10 1.245901024716 53.50879832678777 0.0 3 0.9337154909823953 4.766808829490928 19911.0 26.769450441609422 0.0 - - - - - - - 784.125 39 8 HPCA hippocalcin 423 54 B20140214_SF053_01 B20140214_SF053_01 TB464267.[MT7]-ENTEFSELELQEWYK[MT7].3b5_1.heavy 745.035 / 765.354 15443.0 41.79439926147461 44 14 10 10 10 1.245901024716 53.50879832678777 0.0 3 0.9337154909823953 4.766808829490928 15443.0 32.964176334106725 0.0 - - - - - - - 793.75 30 8 HPCA hippocalcin 425 54 B20140214_SF053_01 B20140214_SF053_01 TB464267.[MT7]-ENTEFSELELQEWYK[MT7].3b7_1.heavy 745.035 / 981.428 22655.0 41.79439926147461 44 14 10 10 10 1.245901024716 53.50879832678777 0.0 3 0.9337154909823953 4.766808829490928 22655.0 52.16753097554236 0.0 - - - - - - - 253.3846153846154 45 13 HPCA hippocalcin 427 55 B20140214_SF053_01 B20140214_SF053_01 TB464260.[MT7]-SLVIWDNDRLTC[CAM]IQK[MT7].4y9_2.heavy 538.047 / 646.349 76076.0 37.6560001373291 46 20 10 6 10 6.171463194391177 16.203612798158336 0.03839874267578125 3 0.990584751834732 12.708817554227888 76076.0 107.76014779191574 0.0 - - - - - - - 731.0 152 7 RBP7 retinol binding protein 7, cellular 429 55 B20140214_SF053_01 B20140214_SF053_01 TB464260.[MT7]-SLVIWDNDRLTC[CAM]IQK[MT7].4y10_2.heavy 538.047 / 703.863 103879.0 37.6560001373291 46 20 10 6 10 6.171463194391177 16.203612798158336 0.03839874267578125 3 0.990584751834732 12.708817554227888 103879.0 103.64347518309124 0.0 - - - - - - - 312.6666666666667 207 3 RBP7 retinol binding protein 7, cellular 431 55 B20140214_SF053_01 B20140214_SF053_01 TB464260.[MT7]-SLVIWDNDRLTC[CAM]IQK[MT7].4b4_1.heavy 538.047 / 557.378 120851.0 37.6560001373291 46 20 10 6 10 6.171463194391177 16.203612798158336 0.03839874267578125 3 0.990584751834732 12.708817554227888 120851.0 107.15035070454479 0.0 - - - - - - - 1290.125 241 8 RBP7 retinol binding protein 7, cellular 433 55 B20140214_SF053_01 B20140214_SF053_01 TB464260.[MT7]-SLVIWDNDRLTC[CAM]IQK[MT7].4y3_1.heavy 538.047 / 532.357 54584.0 37.6560001373291 46 20 10 6 10 6.171463194391177 16.203612798158336 0.03839874267578125 3 0.990584751834732 12.708817554227888 54584.0 11.500430568197164 0.0 - - - - - - - 1450.0 109 2 RBP7 retinol binding protein 7, cellular 435 56 B20140214_SF053_01 B20140214_SF053_01 TB464261.[MT7]-SLLSPGLLPHLLPALGFK[MT7].4b8_1.heavy 541.089 / 925.584 30812.0 49.68540000915527 40 14 10 6 10 1.2618003853195698 46.107082676510046 0.034999847412109375 3 0.932036002121932 4.706867540267798 30812.0 111.88439067055393 0.0 - - - - - - - 142.54545454545453 61 11 MRPL36 mitochondrial ribosomal protein L36 437 56 B20140214_SF053_01 B20140214_SF053_01 TB464261.[MT7]-SLLSPGLLPHLLPALGFK[MT7].4b7_1.heavy 541.089 / 812.5 23366.0 49.68540000915527 40 14 10 6 10 1.2618003853195698 46.107082676510046 0.034999847412109375 3 0.932036002121932 4.706867540267798 23366.0 102.78920634920634 0.0 - - - - - - - 226.625 46 16 MRPL36 mitochondrial ribosomal protein L36 439 56 B20140214_SF053_01 B20140214_SF053_01 TB464261.[MT7]-SLLSPGLLPHLLPALGFK[MT7].4b4_1.heavy 541.089 / 545.341 48594.0 49.68540000915527 40 14 10 6 10 1.2618003853195698 46.107082676510046 0.034999847412109375 3 0.932036002121932 4.706867540267798 48594.0 -5.509523809523813 0.0 - - - - - - - 213.8181818181818 97 11 MRPL36 mitochondrial ribosomal protein L36 441 56 B20140214_SF053_01 B20140214_SF053_01 TB464261.[MT7]-SLLSPGLLPHLLPALGFK[MT7].4b6_1.heavy 541.089 / 699.416 20770.0 49.68540000915527 40 14 10 6 10 1.2618003853195698 46.107082676510046 0.034999847412109375 3 0.932036002121932 4.706867540267798 20770.0 109.8168916797488 0.0 - - - - - - - 252.0 41 14 MRPL36 mitochondrial ribosomal protein L36 443 57 B20140214_SF053_01 B20140214_SF053_01 TB464262.[MT7]-C[CAM]HLIETNIRDQEELK[MT7].4y10_2.heavy 547.292 / 695.376 78639.0 28.489200592041016 46 16 10 10 10 1.9465123451728854 35.075692013067 0.0 3 0.9607385842565526 6.207948908138443 78639.0 81.69867616682112 0.0 - - - - - - - 753.8571428571429 157 7 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 445 57 B20140214_SF053_01 B20140214_SF053_01 TB464262.[MT7]-C[CAM]HLIETNIRDQEELK[MT7].4y12_2.heavy 547.292 / 816.44 32024.0 28.489200592041016 46 16 10 10 10 1.9465123451728854 35.075692013067 0.0 3 0.9607385842565526 6.207948908138443 32024.0 151.83040871934605 0.0 - - - - - - - 317.7857142857143 64 14 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 447 57 B20140214_SF053_01 B20140214_SF053_01 TB464262.[MT7]-C[CAM]HLIETNIRDQEELK[MT7].4y11_2.heavy 547.292 / 759.898 122271.0 28.489200592041016 46 16 10 10 10 1.9465123451728854 35.075692013067 0.0 3 0.9607385842565526 6.207948908138443 122271.0 137.0529865015182 0.0 - - - - - - - 756.875 244 8 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 449 57 B20140214_SF053_01 B20140214_SF053_01 TB464262.[MT7]-C[CAM]HLIETNIRDQEELK[MT7].4b3_1.heavy 547.292 / 555.283 77033.0 28.489200592041016 46 16 10 10 10 1.9465123451728854 35.075692013067 0.0 3 0.9607385842565526 6.207948908138443 77033.0 87.09557428421238 0.0 - - - - - - - 1114.142857142857 154 7 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 451 58 B20140214_SF053_01 B20140214_SF053_01 TB464263.[MT7]-AGAVGAHLPASGLDIFGDLK[MT7].4y4_1.heavy 550.061 / 576.347 154791.0 42.754350662231445 33 7 10 6 10 0.5961423312806431 89.79010721446265 0.03260040283203125 3 0.7346413459888061 2.340655159808966 154791.0 131.86577981398204 0.0 - - - - - - - 775.3333333333334 309 3 SEC11C SEC11 homolog C (S. cerevisiae) 453 58 B20140214_SF053_01 B20140214_SF053_01 TB464263.[MT7]-AGAVGAHLPASGLDIFGDLK[MT7].4b7_1.heavy 550.061 / 708.391 59991.0 42.754350662231445 33 7 10 6 10 0.5961423312806431 89.79010721446265 0.03260040283203125 3 0.7346413459888061 2.340655159808966 59991.0 101.67952143294036 0.0 - - - - - - - 793.1111111111111 119 9 SEC11C SEC11 homolog C (S. cerevisiae) 455 58 B20140214_SF053_01 B20140214_SF053_01 TB464263.[MT7]-AGAVGAHLPASGLDIFGDLK[MT7].4b5_1.heavy 550.061 / 500.295 13153.0 42.754350662231445 33 7 10 6 10 0.5961423312806431 89.79010721446265 0.03260040283203125 3 0.7346413459888061 2.340655159808966 13153.0 20.779218248557402 0.0 - - - - - - - 772.6363636363636 26 11 SEC11C SEC11 homolog C (S. cerevisiae) 457 58 B20140214_SF053_01 B20140214_SF053_01 TB464263.[MT7]-AGAVGAHLPASGLDIFGDLK[MT7].4b6_1.heavy 550.061 / 571.332 38016.0 42.754350662231445 33 7 10 6 10 0.5961423312806431 89.79010721446265 0.03260040283203125 3 0.7346413459888061 2.340655159808966 38016.0 63.07854621846738 0.0 - - - - - - - 686.4444444444445 76 9 SEC11C SEC11 homolog C (S. cerevisiae) 459 59 B20140214_SF053_01 B20140214_SF053_01 TB463941.[MT7]-EIEGK[MT7].2b3_1.heavy 432.257 / 516.279 21785.0 19.873467127482098 32 20 0 6 6 6.816248214054143 14.670827243910233 0.038799285888671875 5 0.9973424264710344 23.93445249816116 21785.0 20.062307790538817 0.0 - - - - - - - 1680.857142857143 43 7 EIF5A2 eukaryotic translation initiation factor 5A2 461 59 B20140214_SF053_01 B20140214_SF053_01 TB463941.[MT7]-EIEGK[MT7].2y4_1.heavy 432.257 / 590.363 56475.0 19.873467127482098 32 20 0 6 6 6.816248214054143 14.670827243910233 0.038799285888671875 5 0.9973424264710344 23.93445249816116 56475.0 40.182420141507464 0.0 - - - - - - - 759.0 112 4 EIF5A2 eukaryotic translation initiation factor 5A2 463 59 B20140214_SF053_01 B20140214_SF053_01 TB463941.[MT7]-EIEGK[MT7].2b4_1.heavy 432.257 / 573.3 4706.0 19.873467127482098 32 20 0 6 6 6.816248214054143 14.670827243910233 0.038799285888671875 5 0.9973424264710344 23.93445249816116 4706.0 2.2035652060827697 7.0 - - - - - - - 1340.8333333333333 38 12 EIF5A2 eukaryotic translation initiation factor 5A2 465 59 B20140214_SF053_01 B20140214_SF053_01 TB463941.[MT7]-EIEGK[MT7].2y3_1.heavy 432.257 / 477.279 N/A 19.873467127482098 32 20 0 6 6 6.816248214054143 14.670827243910233 0.038799285888671875 5 0.9973424264710344 23.93445249816116 34803.0 30.74221095570692 2.0 - - - - - - - 784.3333333333334 473 6 EIF5A2 eukaryotic translation initiation factor 5A2 467 60 B20140214_SF053_01 B20140214_SF053_01 TB463943.[MT7]-ELSFAR.2b3_1.heavy 433.746 / 474.268 23432.0 30.060699462890625 48 18 10 10 10 6.755115071075797 14.803596822233605 0.0 3 0.9860462177358529 10.435423956150334 23432.0 19.556384855150963 1.0 - - - - - - - 1333.9 48 10 PHLDA3 pleckstrin homology-like domain, family A, member 3 469 60 B20140214_SF053_01 B20140214_SF053_01 TB463943.[MT7]-ELSFAR.2y4_1.heavy 433.746 / 480.257 43619.0 30.060699462890625 48 18 10 10 10 6.755115071075797 14.803596822233605 0.0 3 0.9860462177358529 10.435423956150334 43619.0 60.1983503055464 0.0 - - - - - - - 1144.6 87 10 PHLDA3 pleckstrin homology-like domain, family A, member 3 471 60 B20140214_SF053_01 B20140214_SF053_01 TB463943.[MT7]-ELSFAR.2y5_1.heavy 433.746 / 593.341 137347.0 30.060699462890625 48 18 10 10 10 6.755115071075797 14.803596822233605 0.0 3 0.9860462177358529 10.435423956150334 137347.0 94.9215313324622 0.0 - - - - - - - 856.0 274 5 PHLDA3 pleckstrin homology-like domain, family A, member 3 473 60 B20140214_SF053_01 B20140214_SF053_01 TB463943.[MT7]-ELSFAR.2b4_1.heavy 433.746 / 621.336 30687.0 30.060699462890625 48 18 10 10 10 6.755115071075797 14.803596822233605 0.0 3 0.9860462177358529 10.435423956150334 30687.0 30.323328005656666 0.0 - - - - - - - 736.0 61 9 PHLDA3 pleckstrin homology-like domain, family A, member 3 475 61 B20140214_SF053_01 B20140214_SF053_01 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 3472680.0 38.61840057373047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 3472680.0 705.4202789585727 0.0 - - - - - - - 2138.0 6945 1 477 61 B20140214_SF053_01 B20140214_SF053_01 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 1722430.0 38.61840057373047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1722430.0 561.3445343171715 0.0 - - - - - - - 1603.0 3444 2 479 61 B20140214_SF053_01 B20140214_SF053_01 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 2357090.0 38.61840057373047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2357090.0 516.1525533738838 0.0 - - - - - - - 2055.0 4714 2 481 62 B20140214_SF053_01 B20140214_SF053_01 TB464034.[MT7]-DLENLGER.2b3_1.heavy 545.286 / 502.263 22704.0 28.06773312886556 30 18 0 6 6 2.823806490304679 27.989132872381745 0.038299560546875 5 0.9856683658524376 10.29661479764518 22704.0 4.468816709101433 3.0 - - - - - - - 2125.4 95 5 MRPS6 mitochondrial ribosomal protein S6 483 62 B20140214_SF053_01 B20140214_SF053_01 TB464034.[MT7]-DLENLGER.2y5_1.heavy 545.286 / 588.31 N/A 28.06773312886556 30 18 0 6 6 2.823806490304679 27.989132872381745 0.038299560546875 5 0.9856683658524376 10.29661479764518 37900.0 46.538302969524764 1.0 - - - - - - - 768.8571428571429 346 7 MRPS6 mitochondrial ribosomal protein S6 485 62 B20140214_SF053_01 B20140214_SF053_01 TB464034.[MT7]-DLENLGER.2b4_1.heavy 545.286 / 616.306 22252.0 28.06773312886556 30 18 0 6 6 2.823806490304679 27.989132872381745 0.038299560546875 5 0.9856683658524376 10.29661479764518 22252.0 20.376536289908636 0.0 - - - - - - - 407.0 44 1 MRPS6 mitochondrial ribosomal protein S6 487 62 B20140214_SF053_01 B20140214_SF053_01 TB464034.[MT7]-DLENLGER.2y7_1.heavy 545.286 / 830.437 41473.0 28.06773312886556 30 18 0 6 6 2.823806490304679 27.989132872381745 0.038299560546875 5 0.9856683658524376 10.29661479764518 41473.0 68.98791361437456 0.0 - - - - - - - 740.75 82 8 MRPS6 mitochondrial ribosomal protein S6 489 63 B20140214_SF053_01 B20140214_SF053_01 TB107930.[MT7]-LPTALDGFSLEAMLTIYQLHK[MT7].4y5_1.heavy 663.12 / 832.48 3839.0 51.3674259185791 44 18 10 6 10 5.252534640132971 19.03842751191612 0.03910064697265625 3 0.9895640055270336 12.070271352426513 3839.0 111.26742162447258 0.0 - - - - - - - 152.57142857142858 7 14 NTS neurotensin 491 63 B20140214_SF053_01 B20140214_SF053_01 TB107930.[MT7]-LPTALDGFSLEAMLTIYQLHK[MT7].4b7_1.heavy 663.12 / 812.463 3601.0 51.3674259185791 44 18 10 6 10 5.252534640132971 19.03842751191612 0.03910064697265625 3 0.9895640055270336 12.070271352426513 3601.0 36.0206981580511 0.0 - - - - - - - 215.0 7 14 NTS neurotensin 493 63 B20140214_SF053_01 B20140214_SF053_01 TB107930.[MT7]-LPTALDGFSLEAMLTIYQLHK[MT7].4b4_1.heavy 663.12 / 527.331 5421.0 51.3674259185791 44 18 10 6 10 5.252534640132971 19.03842751191612 0.03910064697265625 3 0.9895640055270336 12.070271352426513 5421.0 52.35111235015333 0.0 - - - - - - - 165.23529411764707 10 17 NTS neurotensin 495 63 B20140214_SF053_01 B20140214_SF053_01 TB107930.[MT7]-LPTALDGFSLEAMLTIYQLHK[MT7].4y3_1.heavy 663.12 / 541.358 2295.0 51.3674259185791 44 18 10 6 10 5.252534640132971 19.03842751191612 0.03910064697265625 3 0.9895640055270336 12.070271352426513 2295.0 18.014285714285712 1.0 - - - - - - - 197.94444444444446 4 18 NTS neurotensin 497 64 B20140214_SF053_01 B20140214_SF053_01 TB463946.[MT7]-DIDVIR.2y4_1.heavy 437.759 / 502.298 36356.0 29.326400756835938 44 14 10 10 10 1.7327380391150213 47.83295869205849 0.0 3 0.9398375924291359 5.006082402065724 36356.0 16.451216253871305 0.0 - - - - - - - 1323.0 72 5 MRPS6 mitochondrial ribosomal protein S6 499 64 B20140214_SF053_01 B20140214_SF053_01 TB463946.[MT7]-DIDVIR.2b3_1.heavy 437.759 / 488.247 176971.0 29.326400756835938 44 14 10 10 10 1.7327380391150213 47.83295869205849 0.0 3 0.9398375924291359 5.006082402065724 176971.0 133.38615869496357 0.0 - - - - - - - 1717.857142857143 353 7 MRPS6 mitochondrial ribosomal protein S6 501 64 B20140214_SF053_01 B20140214_SF053_01 TB463946.[MT7]-DIDVIR.2y5_1.heavy 437.759 / 615.382 90706.0 29.326400756835938 44 14 10 10 10 1.7327380391150213 47.83295869205849 0.0 3 0.9398375924291359 5.006082402065724 90706.0 121.28376696696697 0.0 - - - - - - - 370.0 181 3 MRPS6 mitochondrial ribosomal protein S6 503 64 B20140214_SF053_01 B20140214_SF053_01 TB463946.[MT7]-DIDVIR.2b4_1.heavy 437.759 / 587.316 130855.0 29.326400756835938 44 14 10 10 10 1.7327380391150213 47.83295869205849 0.0 3 0.9398375924291359 5.006082402065724 130855.0 65.99524870756491 0.0 - - - - - - - 740.0 261 1 MRPS6 mitochondrial ribosomal protein S6 505 65 B20140214_SF053_01 B20140214_SF053_01 TB107932.[MT7]-ATDLRPIYISVQPPSLHVLEQR.4y5_1.heavy 669.879 / 644.373 55108.0 39.38329887390137 42 16 10 6 10 3.840878624576115 20.93334027188261 0.034999847412109375 3 0.9692751940983536 7.022625526833906 55108.0 48.09397113353367 0.0 - - - - - - - 438.3333333333333 110 3 GUK1 guanylate kinase 1 507 65 B20140214_SF053_01 B20140214_SF053_01 TB107932.[MT7]-ATDLRPIYISVQPPSLHVLEQR.4y9_1.heavy 669.879 / 1078.6 28499.0 39.38329887390137 42 16 10 6 10 3.840878624576115 20.93334027188261 0.034999847412109375 3 0.9692751940983536 7.022625526833906 28499.0 80.682100456621 0.0 - - - - - - - 273.6666666666667 56 15 GUK1 guanylate kinase 1 509 65 B20140214_SF053_01 B20140214_SF053_01 TB107932.[MT7]-ATDLRPIYISVQPPSLHVLEQR.4y6_1.heavy 669.879 / 781.432 36547.0 39.38329887390137 42 16 10 6 10 3.840878624576115 20.93334027188261 0.034999847412109375 3 0.9692751940983536 7.022625526833906 36547.0 70.22562922868741 0.0 - - - - - - - 687.75 73 8 GUK1 guanylate kinase 1 511 65 B20140214_SF053_01 B20140214_SF053_01 TB107932.[MT7]-ATDLRPIYISVQPPSLHVLEQR.4b10_2.heavy 669.879 / 637.865 76708.0 39.38329887390137 42 16 10 6 10 3.840878624576115 20.93334027188261 0.034999847412109375 3 0.9692751940983536 7.022625526833906 76708.0 114.77745422212342 0.0 - - - - - - - 896.5833333333334 153 12 GUK1 guanylate kinase 1 513 66 B20140214_SF053_01 B20140214_SF053_01 TB107933.[MT7]-RLVQQWSVAVFLLSYAVPSC[CAM]GR.3b9_2.heavy 894.155 / 606.852 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTHLH parathyroid hormone-like hormone 515 66 B20140214_SF053_01 B20140214_SF053_01 TB107933.[MT7]-RLVQQWSVAVFLLSYAVPSC[CAM]GR.3b9_1.heavy 894.155 / 1212.7 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTHLH parathyroid hormone-like hormone 517 66 B20140214_SF053_01 B20140214_SF053_01 TB107933.[MT7]-RLVQQWSVAVFLLSYAVPSC[CAM]GR.3y5_1.heavy 894.155 / 576.256 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTHLH parathyroid hormone-like hormone 519 66 B20140214_SF053_01 B20140214_SF053_01 TB107933.[MT7]-RLVQQWSVAVFLLSYAVPSC[CAM]GR.3y9_1.heavy 894.155 / 996.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTHLH parathyroid hormone-like hormone 521 67 B20140214_SF053_01 B20140214_SF053_01 TB464130.[MT7]-RYQQC[CAM]VQK[MT7].2y4_1.heavy 699.382 / 678.372 2073.0 19.14970064163208 44 18 10 6 10 5.086969961980157 19.658067719565214 0.03240013122558594 3 0.9831581314319573 9.496330359045832 2073.0 10.855236486486486 0.0 - - - - - - - 205.15384615384616 4 26 TRIAP1 TP53 regulated inhibitor of apoptosis 1 523 67 B20140214_SF053_01 B20140214_SF053_01 TB464130.[MT7]-RYQQC[CAM]VQK[MT7].2b7_1.heavy 699.382 / 1107.55 3191.0 19.14970064163208 44 18 10 6 10 5.086969961980157 19.658067719565214 0.03240013122558594 3 0.9831581314319573 9.496330359045832 3191.0 101.53181818181818 0.0 - - - - - - - 77.58823529411765 6 17 TRIAP1 TP53 regulated inhibitor of apoptosis 1 525 67 B20140214_SF053_01 B20140214_SF053_01 TB464130.[MT7]-RYQQC[CAM]VQK[MT7].2b6_1.heavy 699.382 / 979.49 1217.0 19.14970064163208 44 18 10 6 10 5.086969961980157 19.658067719565214 0.03240013122558594 3 0.9831581314319573 9.496330359045832 1217.0 42.41060606060606 0.0 - - - - - - - 56.1 2 10 TRIAP1 TP53 regulated inhibitor of apoptosis 1 527 67 B20140214_SF053_01 B20140214_SF053_01 TB464130.[MT7]-RYQQC[CAM]VQK[MT7].2y7_1.heavy 699.382 / 1097.55 1777.0 19.14970064163208 44 18 10 6 10 5.086969961980157 19.658067719565214 0.03240013122558594 3 0.9831581314319573 9.496330359045832 1777.0 67.66959595959595 0.0 - - - - - - - 92.2 3 10 TRIAP1 TP53 regulated inhibitor of apoptosis 1 529 68 B20140214_SF053_01 B20140214_SF053_01 TB107938.[MT7]-MEAQRSEPPLPPGGQELLELLLR.4y5_1.heavy 680.125 / 643.414 4399.0 50.85794925689697 35 9 10 6 10 0.8332468135192932 73.73212641262141 0.037403106689453125 3 0.8137607661209627 2.814127938968274 4399.0 12.153398317615338 0.0 - - - - - - - 217.8235294117647 8 17 GPSM3 G-protein signaling modulator 3 531 68 B20140214_SF053_01 B20140214_SF053_01 TB107938.[MT7]-MEAQRSEPPLPPGGQELLELLLR.4b8_2.heavy 680.125 / 537.262 5742.0 50.85794925689697 35 9 10 6 10 0.8332468135192932 73.73212641262141 0.037403106689453125 3 0.8137607661209627 2.814127938968274 5742.0 23.74235911270983 0.0 - - - - - - - 234.5 11 16 GPSM3 G-protein signaling modulator 3 533 68 B20140214_SF053_01 B20140214_SF053_01 TB107938.[MT7]-MEAQRSEPPLPPGGQELLELLLR.4b7_1.heavy 680.125 / 976.464 1019.0 50.85794925689697 35 9 10 6 10 0.8332468135192932 73.73212641262141 0.037403106689453125 3 0.8137607661209627 2.814127938968274 1019.0 20.38 0.0 - - - - - - - 166.73333333333332 2 15 GPSM3 G-protein signaling modulator 3 535 68 B20140214_SF053_01 B20140214_SF053_01 TB107938.[MT7]-MEAQRSEPPLPPGGQELLELLLR.4b10_2.heavy 680.125 / 642.33 7871.0 50.85794925689697 35 9 10 6 10 0.8332468135192932 73.73212641262141 0.037403106689453125 3 0.8137607661209627 2.814127938968274 7871.0 21.283413905752425 0.0 - - - - - - - 282.0 15 11 GPSM3 G-protein signaling modulator 3 537 69 B20140214_SF053_01 B20140214_SF053_01 TB246527.[MT7]-TRSERGDGSDVK[MT7].3y3_1.heavy 532.284 / 505.31 2305.0 16.274599075317383 43 13 10 10 10 2.0021615652417246 49.946019210456086 0.0 3 0.9097314165259325 4.076351969403433 2305.0 17.654454542691266 0.0 - - - - - - - 196.0 4 27 PAGE4 P antigen family, member 4 (prostate associated) 539 69 B20140214_SF053_01 B20140214_SF053_01 TB246527.[MT7]-TRSERGDGSDVK[MT7].3b4_1.heavy 532.284 / 618.333 2866.0 16.274599075317383 43 13 10 10 10 2.0021615652417246 49.946019210456086 0.0 3 0.9097314165259325 4.076351969403433 2866.0 23.16613144536468 0.0 - - - - - - - 166.72727272727272 5 22 PAGE4 P antigen family, member 4 (prostate associated) 541 69 B20140214_SF053_01 B20140214_SF053_01 TB246527.[MT7]-TRSERGDGSDVK[MT7].3b10_2.heavy 532.284 / 603.285 27490.0 16.274599075317383 43 13 10 10 10 2.0021615652417246 49.946019210456086 0.0 3 0.9097314165259325 4.076351969403433 27490.0 163.7412131404216 0.0 - - - - - - - 212.1818181818182 54 22 PAGE4 P antigen family, member 4 (prostate associated) 543 69 B20140214_SF053_01 B20140214_SF053_01 TB246527.[MT7]-TRSERGDGSDVK[MT7].3y5_1.heavy 532.284 / 649.364 10614.0 16.274599075317383 43 13 10 10 10 2.0021615652417246 49.946019210456086 0.0 3 0.9097314165259325 4.076351969403433 10614.0 153.96791878172587 0.0 - - - - - - - 119.18181818181819 21 22 PAGE4 P antigen family, member 4 (prostate associated) 545 70 B20140214_SF053_01 B20140214_SF053_01 TB107935.[MT7]-NQLIEQFPGIEPWLNQIMPK[MT7].3b6_1.heavy 895.156 / 870.48 10350.0 50.30349922180176 39 13 10 6 10 2.8896030453640966 34.60682952990167 0.03440093994140625 3 0.90345492961835 3.939487174839884 10350.0 99.23102047652945 0.0 - - - - - - - 244.86666666666667 20 15 MCTS1 malignant T cell amplified sequence 1 547 70 B20140214_SF053_01 B20140214_SF053_01 TB107935.[MT7]-NQLIEQFPGIEPWLNQIMPK[MT7].3b4_1.heavy 895.156 / 613.379 10303.0 50.30349922180176 39 13 10 6 10 2.8896030453640966 34.60682952990167 0.03440093994140625 3 0.90345492961835 3.939487174839884 10303.0 33.53425258055318 0.0 - - - - - - - 283.0 20 15 MCTS1 malignant T cell amplified sequence 1 549 70 B20140214_SF053_01 B20140214_SF053_01 TB107935.[MT7]-NQLIEQFPGIEPWLNQIMPK[MT7].3b3_1.heavy 895.156 / 500.295 8299.0 50.30349922180176 39 13 10 6 10 2.8896030453640966 34.60682952990167 0.03440093994140625 3 0.90345492961835 3.939487174839884 8299.0 53.0224170915304 0.0 - - - - - - - 248.57142857142858 16 14 MCTS1 malignant T cell amplified sequence 1 551 70 B20140214_SF053_01 B20140214_SF053_01 TB107935.[MT7]-NQLIEQFPGIEPWLNQIMPK[MT7].3b7_1.heavy 895.156 / 1017.55 10112.0 50.30349922180176 39 13 10 6 10 2.8896030453640966 34.60682952990167 0.03440093994140625 3 0.90345492961835 3.939487174839884 10112.0 51.08942408376963 0.0 - - - - - - - 196.875 20 16 MCTS1 malignant T cell amplified sequence 1 553 71 B20140214_SF053_01 B20140214_SF053_01 TB107936.[MT7]-MEAQRSEPPLPPGGQELLELLLR.3y11_1.heavy 906.497 / 1240.73 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 555 71 B20140214_SF053_01 B20140214_SF053_01 TB107936.[MT7]-MEAQRSEPPLPPGGQELLELLLR.3b7_1.heavy 906.497 / 976.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 557 71 B20140214_SF053_01 B20140214_SF053_01 TB107936.[MT7]-MEAQRSEPPLPPGGQELLELLLR.3y13_2.heavy 906.497 / 717.919 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 559 71 B20140214_SF053_01 B20140214_SF053_01 TB107936.[MT7]-MEAQRSEPPLPPGGQELLELLLR.3b8_2.heavy 906.497 / 537.262 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 561 72 B20140214_SF053_01 B20140214_SF053_01 TB464039.[MT7]-RILNVTK[MT7].2y4_1.heavy 566.376 / 605.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 563 72 B20140214_SF053_01 B20140214_SF053_01 TB464039.[MT7]-RILNVTK[MT7].2y5_1.heavy 566.376 / 718.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 565 72 B20140214_SF053_01 B20140214_SF053_01 TB464039.[MT7]-RILNVTK[MT7].2b4_1.heavy 566.376 / 641.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 567 72 B20140214_SF053_01 B20140214_SF053_01 TB464039.[MT7]-RILNVTK[MT7].2y6_1.heavy 566.376 / 831.542 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 569 73 B20140214_SF053_01 B20140214_SF053_01 TB464038.[MT7]-NTEISFK[MT7].2y4_1.heavy 563.821 / 638.399 14095.0 29.368999481201172 42 16 10 6 10 3.6689179091915256 27.255992768188094 0.030399322509765625 3 0.9600252145100943 6.151936470777432 14095.0 32.55099068237873 0.0 - - - - - - - 712.5 28 14 FABP3;PMP2 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor);peripheral myelin protein 2 571 73 B20140214_SF053_01 B20140214_SF053_01 TB464038.[MT7]-NTEISFK[MT7].2b4_1.heavy 563.821 / 602.327 11098.0 29.368999481201172 42 16 10 6 10 3.6689179091915256 27.255992768188094 0.030399322509765625 3 0.9600252145100943 6.151936470777432 11098.0 22.1070782400073 0.0 - - - - - - - 752.7692307692307 22 13 FABP3;PMP2 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor);peripheral myelin protein 2 573 73 B20140214_SF053_01 B20140214_SF053_01 TB464038.[MT7]-NTEISFK[MT7].2y3_1.heavy 563.821 / 525.315 22150.0 29.368999481201172 42 16 10 6 10 3.6689179091915256 27.255992768188094 0.030399322509765625 3 0.9600252145100943 6.151936470777432 22150.0 29.988935945605046 0.0 - - - - - - - 1766.142857142857 44 7 FABP3;PMP2 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor);peripheral myelin protein 2 575 73 B20140214_SF053_01 B20140214_SF053_01 TB464038.[MT7]-NTEISFK[MT7].2y6_1.heavy 563.821 / 868.49 12222.0 29.368999481201172 42 16 10 6 10 3.6689179091915256 27.255992768188094 0.030399322509765625 3 0.9600252145100943 6.151936470777432 12222.0 71.27701078019368 0.0 - - - - - - - 261.6363636363636 24 22 FABP3;PMP2 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor);peripheral myelin protein 2 577 74 B20140214_SF053_01 B20140214_SF053_01 TB463950.[MT7]-ISAHSQQHNR.3y6_1.heavy 441.233 / 769.37 12580.0 16.240299224853516 48 18 10 10 10 2.2500041675417646 34.975618870306874 0.0 3 0.9807071119073606 8.87080497492753 12580.0 157.4639455782313 0.0 - - - - - - - 100.57894736842105 25 19 MRPS6 mitochondrial ribosomal protein S6 579 74 B20140214_SF053_01 B20140214_SF053_01 TB463950.[MT7]-ISAHSQQHNR.3b3_1.heavy 441.233 / 416.263 29196.0 16.240299224853516 48 18 10 10 10 2.2500041675417646 34.975618870306874 0.0 3 0.9807071119073606 8.87080497492753 29196.0 44.95567093874352 0.0 - - - - - - - 773.9090909090909 58 11 MRPS6 mitochondrial ribosomal protein S6 581 74 B20140214_SF053_01 B20140214_SF053_01 TB463950.[MT7]-ISAHSQQHNR.3y4_1.heavy 441.233 / 554.279 18723.0 16.240299224853516 48 18 10 10 10 2.2500041675417646 34.975618870306874 0.0 3 0.9807071119073606 8.87080497492753 18723.0 54.41457870515384 0.0 - - - - - - - 234.94444444444446 37 18 MRPS6 mitochondrial ribosomal protein S6 583 74 B20140214_SF053_01 B20140214_SF053_01 TB463950.[MT7]-ISAHSQQHNR.3y5_1.heavy 441.233 / 682.338 9460.0 16.240299224853516 48 18 10 10 10 2.2500041675417646 34.975618870306874 0.0 3 0.9807071119073606 8.87080497492753 9460.0 185.86326454033772 0.0 - - - - - - - 109.34782608695652 18 23 MRPS6 mitochondrial ribosomal protein S6 585 75 B20140214_SF053_01 B20140214_SF053_01 TB464043.[MT7]-AFRLFDDDETGK[MT7].3b5_1.heavy 567.961 / 779.469 28807.0 35.401350021362305 43 18 10 5 10 23.224304206602646 4.305834056874354 0.043102264404296875 3 0.9839040802001836 9.714494631426463 28807.0 26.675703870087776 0.0 - - - - - - - 1311.857142857143 57 7 CETN1 centrin, EF-hand protein, 1 587 75 B20140214_SF053_01 B20140214_SF053_01 TB464043.[MT7]-AFRLFDDDETGK[MT7].3y5_1.heavy 567.961 / 693.354 12559.0 35.401350021362305 43 18 10 5 10 23.224304206602646 4.305834056874354 0.043102264404296875 3 0.9839040802001836 9.714494631426463 12559.0 17.88618035599607 0.0 - - - - - - - 784.8571428571429 25 7 CETN1 centrin, EF-hand protein, 1 589 75 B20140214_SF053_01 B20140214_SF053_01 TB464043.[MT7]-AFRLFDDDETGK[MT7].3b7_2.heavy 567.961 / 505.265 23941.0 35.401350021362305 43 18 10 5 10 23.224304206602646 4.305834056874354 0.043102264404296875 3 0.9839040802001836 9.714494631426463 23941.0 16.378504185960892 0.0 - - - - - - - 235.0 47 1 CETN1 centrin, EF-hand protein, 1 591 75 B20140214_SF053_01 B20140214_SF053_01 TB464043.[MT7]-AFRLFDDDETGK[MT7].3b8_2.heavy 567.961 / 562.778 28572.0 35.401350021362305 43 18 10 5 10 23.224304206602646 4.305834056874354 0.043102264404296875 3 0.9839040802001836 9.714494631426463 28572.0 33.968290105560094 0.0 - - - - - - - 1169.4 57 10 CETN1 centrin, EF-hand protein, 1 593 76 B20140214_SF053_01 B20140214_SF053_01 TB107943.[MT7]-AIVFRPFK[MT7]GEVVDAVVTQVNK[MT7].4b14_2.heavy 687.909 / 909.529 129645.0 38.53889846801758 40 10 10 10 10 0.9959955862922059 58.25320279142507 0.0 3 0.833868288845503 2.984912456599804 129645.0 202.3635357720291 0.0 - - - - - - - 247.0 259 1 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 595 76 B20140214_SF053_01 B20140214_SF053_01 TB107943.[MT7]-AIVFRPFK[MT7]GEVVDAVVTQVNK[MT7].4b13_2.heavy 687.909 / 874.011 110264.0 38.53889846801758 40 10 10 10 10 0.9959955862922059 58.25320279142507 0.0 3 0.833868288845503 2.984912456599804 110264.0 161.52535489304364 0.0 - - - - - - - 773.125 220 8 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 597 76 B20140214_SF053_01 B20140214_SF053_01 TB107943.[MT7]-AIVFRPFK[MT7]GEVVDAVVTQVNK[MT7].4y3_1.heavy 687.909 / 504.326 136902.0 38.53889846801758 40 10 10 10 10 0.9959955862922059 58.25320279142507 0.0 3 0.833868288845503 2.984912456599804 136902.0 113.56195589059523 0.0 - - - - - - - 495.0 273 1 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 599 76 B20140214_SF053_01 B20140214_SF053_01 TB107943.[MT7]-AIVFRPFK[MT7]GEVVDAVVTQVNK[MT7].4b10_2.heavy 687.909 / 717.429 32494.0 38.53889846801758 40 10 10 10 10 0.9959955862922059 58.25320279142507 0.0 3 0.833868288845503 2.984912456599804 32494.0 43.64171701580301 0.0 - - - - - - - 365.14285714285717 64 7 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 601 77 B20140214_SF053_01 B20140214_SF053_01 TB107941.[MT7]-EPGLFDVVIINDSLDQAYAELK[MT7].3b8_1.heavy 913.156 / 1001.54 3490.0 52.003700256347656 45 15 10 10 10 2.623315024535469 38.11970696035936 0.0 3 0.9508403076795303 5.543223475326145 3490.0 42.76239144385026 0.0 - - - - - - - 107.76923076923077 6 13 GUK1 guanylate kinase 1 603 77 B20140214_SF053_01 B20140214_SF053_01 TB107941.[MT7]-EPGLFDVVIINDSLDQAYAELK[MT7].3b6_1.heavy 913.156 / 803.406 3708.0 52.003700256347656 45 15 10 10 10 2.623315024535469 38.11970696035936 0.0 3 0.9508403076795303 5.543223475326145 3708.0 29.473846153846154 0.0 - - - - - - - 153.88235294117646 7 17 GUK1 guanylate kinase 1 605 77 B20140214_SF053_01 B20140214_SF053_01 TB107941.[MT7]-EPGLFDVVIINDSLDQAYAELK[MT7].3b7_1.heavy 913.156 / 902.474 3147.0 52.003700256347656 45 15 10 10 10 2.623315024535469 38.11970696035936 0.0 3 0.9508403076795303 5.543223475326145 3147.0 58.61468778801843 0.0 - - - - - - - 104.63636363636364 6 11 GUK1 guanylate kinase 1 607 77 B20140214_SF053_01 B20140214_SF053_01 TB107941.[MT7]-EPGLFDVVIINDSLDQAYAELK[MT7].3y4_1.heavy 913.156 / 604.379 3303.0 52.003700256347656 45 15 10 10 10 2.623315024535469 38.11970696035936 0.0 3 0.9508403076795303 5.543223475326145 3303.0 20.64534672021419 0.0 - - - - - - - 134.25 6 16 GUK1 guanylate kinase 1 609 78 B20140214_SF053_01 B20140214_SF053_01 TB107942.[MT7]-EPGLFDVVIINDSLDQAYAELK[MT7].4b8_1.heavy 685.119 / 1001.54 4835.0 52.003700256347656 45 15 10 10 10 1.8063205609641277 43.80693745135402 0.0 3 0.9500801657860971 5.500502643979441 4835.0 60.31714377682404 0.0 - - - - - - - 142.36363636363637 9 11 GUK1 guanylate kinase 1 611 78 B20140214_SF053_01 B20140214_SF053_01 TB107942.[MT7]-EPGLFDVVIINDSLDQAYAELK[MT7].4y4_1.heavy 685.119 / 604.379 9203.0 52.003700256347656 45 15 10 10 10 1.8063205609641277 43.80693745135402 0.0 3 0.9500801657860971 5.500502643979441 9203.0 75.19574831460675 0.0 - - - - - - - 180.92857142857142 18 14 GUK1 guanylate kinase 1 613 78 B20140214_SF053_01 B20140214_SF053_01 TB107942.[MT7]-EPGLFDVVIINDSLDQAYAELK[MT7].4b7_1.heavy 685.119 / 902.474 5868.0 52.003700256347656 45 15 10 10 10 1.8063205609641277 43.80693745135402 0.0 3 0.9500801657860971 5.500502643979441 5868.0 92.17679281437125 0.0 - - - - - - - 108.33333333333333 11 12 GUK1 guanylate kinase 1 615 78 B20140214_SF053_01 B20140214_SF053_01 TB107942.[MT7]-EPGLFDVVIINDSLDQAYAELK[MT7].4b6_1.heavy 685.119 / 803.406 10737.0 52.003700256347656 45 15 10 10 10 1.8063205609641277 43.80693745135402 0.0 3 0.9500801657860971 5.500502643979441 10737.0 92.35039297426944 0.0 - - - - - - - 194.0 21 11 GUK1 guanylate kinase 1 617 79 B20140214_SF053_01 B20140214_SF053_01 TB246511.[MT7]-LLTHNLLSSHVR.4y4_1.heavy 384.23 / 498.278 58231.0 31.524700164794922 43 13 10 10 10 1.8896608166018072 42.3470111633778 0.0 3 0.928138221383667 4.575912012471686 58231.0 92.04793978046698 0.0 - - - - - - - 1171.4 116 10 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 619 79 B20140214_SF053_01 B20140214_SF053_01 TB246511.[MT7]-LLTHNLLSSHVR.4y5_1.heavy 384.23 / 585.31 161026.0 31.524700164794922 43 13 10 10 10 1.8896608166018072 42.3470111633778 0.0 3 0.928138221383667 4.575912012471686 161026.0 270.3852566359441 0.0 - - - - - - - 1248.142857142857 322 7 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 621 79 B20140214_SF053_01 B20140214_SF053_01 TB246511.[MT7]-LLTHNLLSSHVR.4b5_2.heavy 384.23 / 362.217 215254.0 31.524700164794922 43 13 10 10 10 1.8896608166018072 42.3470111633778 0.0 3 0.928138221383667 4.575912012471686 215254.0 132.1823480124494 0.0 - - - - - - - 1793.875 430 8 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 623 79 B20140214_SF053_01 B20140214_SF053_01 TB246511.[MT7]-LLTHNLLSSHVR.4y6_1.heavy 384.23 / 698.394 58231.0 31.524700164794922 43 13 10 10 10 1.8896608166018072 42.3470111633778 0.0 3 0.928138221383667 4.575912012471686 58231.0 219.4752462283879 0.0 - - - - - - - 744.375 116 8 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 625 80 B20140214_SF053_01 B20140214_SF053_01 TB246510.[MT7]-LLTHNLLSSHVR.3y7_1.heavy 511.971 / 811.479 47373.0 31.524700164794922 48 18 10 10 10 5.823677903254857 17.171279329186447 0.0 3 0.9867770265691712 10.720575195773746 47373.0 149.02468513119533 0.0 - - - - - - - 675.1111111111111 94 9 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 627 80 B20140214_SF053_01 B20140214_SF053_01 TB246510.[MT7]-LLTHNLLSSHVR.3y6_1.heavy 511.971 / 698.394 162941.0 31.524700164794922 48 18 10 10 10 5.823677903254857 17.171279329186447 0.0 3 0.9867770265691712 10.720575195773746 162941.0 179.0314680378526 0.0 - - - - - - - 1247.2727272727273 325 11 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 629 80 B20140214_SF053_01 B20140214_SF053_01 TB246510.[MT7]-LLTHNLLSSHVR.3y8_1.heavy 511.971 / 925.521 23172.0 31.524700164794922 48 18 10 10 10 5.823677903254857 17.171279329186447 0.0 3 0.9867770265691712 10.720575195773746 23172.0 168.14149659863946 0.0 - - - - - - - 226.33333333333334 46 21 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 631 80 B20140214_SF053_01 B20140214_SF053_01 TB246510.[MT7]-LLTHNLLSSHVR.3y5_1.heavy 511.971 / 585.31 256953.0 31.524700164794922 48 18 10 10 10 5.823677903254857 17.171279329186447 0.0 3 0.9867770265691712 10.720575195773746 256953.0 252.00965606595994 0.0 - - - - - - - 392.0 513 1 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 633 81 B20140214_SF053_01 B20140214_SF053_01 TB246319.[MT7]-THSTFK[MT7].2b3_1.heavy 504.789 / 470.248 N/A 18.86039924621582 36 16 0 10 10 1.9350497457956333 40.955984558188526 0.0 3 0.9666473561339314 6.738802290698115 5552.0 0.2711905498581134 10.0 - - - - - - - 3143.714285714286 120 7 FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) 635 81 B20140214_SF053_01 B20140214_SF053_01 TB246319.[MT7]-THSTFK[MT7].2y4_1.heavy 504.789 / 626.363 7559.0 18.86039924621582 36 16 0 10 10 1.9350497457956333 40.955984558188526 0.0 3 0.9666473561339314 6.738802290698115 7559.0 22.210136291103147 0.0 - - - - - - - 611.5714285714286 15 7 FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) 637 81 B20140214_SF053_01 B20140214_SF053_01 TB246319.[MT7]-THSTFK[MT7].2y5_1.heavy 504.789 / 763.422 6154.0 18.86039924621582 36 16 0 10 10 1.9350497457956333 40.955984558188526 0.0 3 0.9666473561339314 6.738802290698115 6154.0 29.94558106477579 0.0 - - - - - - - 241.3913043478261 12 23 FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) 639 81 B20140214_SF053_01 B20140214_SF053_01 TB246319.[MT7]-THSTFK[MT7].2y3_1.heavy 504.789 / 539.331 3779.0 18.86039924621582 36 16 0 10 10 1.9350497457956333 40.955984558188526 0.0 3 0.9666473561339314 6.738802290698115 3779.0 14.786575096124231 0.0 - - - - - - - 267.4166666666667 7 24 FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) 641 82 B20140214_SF053_01 B20140214_SF053_01 TB107948.[MT7]-EGPYDVVVLPGGNLGAQNLSESAAVK[MT7].4b8_1.heavy 718.888 / 1003.52 11508.0 39.81480026245117 45 15 10 10 10 2.538384162000264 31.294106292639295 0.0 3 0.9556023377379129 5.8352876861148975 11508.0 35.13063374485597 0.0 - - - - - - - 694.2857142857143 23 7 PARK7 Parkinson disease (autosomal recessive, early onset) 7 643 82 B20140214_SF053_01 B20140214_SF053_01 TB107948.[MT7]-EGPYDVVVLPGGNLGAQNLSESAAVK[MT7].4b7_1.heavy 718.888 / 904.453 20666.0 39.81480026245117 45 15 10 10 10 2.538384162000264 31.294106292639295 0.0 3 0.9556023377379129 5.8352876861148975 20666.0 45.51920230115202 0.0 - - - - - - - 740.7142857142857 41 7 PARK7 Parkinson disease (autosomal recessive, early onset) 7 645 82 B20140214_SF053_01 B20140214_SF053_01 TB107948.[MT7]-EGPYDVVVLPGGNLGAQNLSESAAVK[MT7].4b5_1.heavy 718.888 / 706.316 24232.0 39.81480026245117 45 15 10 10 10 2.538384162000264 31.294106292639295 0.0 3 0.9556023377379129 5.8352876861148975 24232.0 24.480145434090417 0.0 - - - - - - - 761.5 48 10 PARK7 Parkinson disease (autosomal recessive, early onset) 7 647 82 B20140214_SF053_01 B20140214_SF053_01 TB107948.[MT7]-EGPYDVVVLPGGNLGAQNLSESAAVK[MT7].4b6_1.heavy 718.888 / 805.385 26664.0 39.81480026245117 45 15 10 10 10 2.538384162000264 31.294106292639295 0.0 3 0.9556023377379129 5.8352876861148975 26664.0 53.68317348927876 0.0 - - - - - - - 283.5 53 6 PARK7 Parkinson disease (autosomal recessive, early onset) 7 649 83 B20140214_SF053_01 B20140214_SF053_01 TB107945.[MT7]-TMHHLLLEVEVIEGTLQC[CAM]PESGR.3b4_1.heavy 931.478 / 651.315 2711.0 45.521849632263184 34 8 10 6 10 0.6323978655712554 82.31485175322362 0.039798736572265625 3 0.798815137545671 2.703952719476182 2711.0 11.1357219657841 0.0 - - - - - - - 257.6666666666667 5 15 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 651 83 B20140214_SF053_01 B20140214_SF053_01 TB107945.[MT7]-TMHHLLLEVEVIEGTLQC[CAM]PESGR.3b3_1.heavy 931.478 / 514.256 2596.0 45.521849632263184 34 8 10 6 10 0.6323978655712554 82.31485175322362 0.039798736572265625 3 0.798815137545671 2.703952719476182 2596.0 16.6040075436115 0.0 - - - - - - - 227.47058823529412 5 17 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 653 83 B20140214_SF053_01 B20140214_SF053_01 TB107945.[MT7]-TMHHLLLEVEVIEGTLQC[CAM]PESGR.3b8_2.heavy 931.478 / 560.309 12172.0 45.521849632263184 34 8 10 6 10 0.6323978655712554 82.31485175322362 0.039798736572265625 3 0.798815137545671 2.703952719476182 12172.0 56.75576107899807 0.0 - - - - - - - 266.3076923076923 24 13 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 655 83 B20140214_SF053_01 B20140214_SF053_01 TB107945.[MT7]-TMHHLLLEVEVIEGTLQC[CAM]PESGR.3y10_1.heavy 931.478 / 1104.51 7673.0 45.521849632263184 34 8 10 6 10 0.6323978655712554 82.31485175322362 0.039798736572265625 3 0.798815137545671 2.703952719476182 7673.0 45.66777898201669 0.0 - - - - - - - 193.41176470588235 15 17 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 657 84 B20140214_SF053_01 B20140214_SF053_01 TB464149.[MT7]-ESYSIYIYK[MT7].2b3_1.heavy 727.394 / 524.247 7380.0 35.468101501464844 46 16 10 10 10 2.4049846701350663 33.22528258123175 0.0 3 0.9686046547127753 6.946833745503511 7380.0 11.683259033056192 0.0 - - - - - - - 767.1111111111111 14 9 HIST1H2BA histone cluster 1, H2ba 659 84 B20140214_SF053_01 B20140214_SF053_01 TB464149.[MT7]-ESYSIYIYK[MT7].2y4_1.heavy 727.394 / 730.426 16109.0 35.468101501464844 46 16 10 10 10 2.4049846701350663 33.22528258123175 0.0 3 0.9686046547127753 6.946833745503511 16109.0 64.63905462184874 0.0 - - - - - - - 389.54545454545456 32 11 HIST1H2BA histone cluster 1, H2ba 661 84 B20140214_SF053_01 B20140214_SF053_01 TB464149.[MT7]-ESYSIYIYK[MT7].2b4_1.heavy 727.394 / 611.279 9126.0 35.468101501464844 46 16 10 10 10 2.4049846701350663 33.22528258123175 0.0 3 0.9686046547127753 6.946833745503511 9126.0 18.94189422160617 0.0 - - - - - - - 800.0833333333334 18 12 HIST1H2BA histone cluster 1, H2ba 663 84 B20140214_SF053_01 B20140214_SF053_01 TB464149.[MT7]-ESYSIYIYK[MT7].2y3_1.heavy 727.394 / 567.362 8967.0 35.468101501464844 46 16 10 10 10 2.4049846701350663 33.22528258123175 0.0 3 0.9686046547127753 6.946833745503511 8967.0 12.610161402489817 0.0 - - - - - - - 270.0 17 5 HIST1H2BA histone cluster 1, H2ba 665 85 B20140214_SF053_01 B20140214_SF053_01 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1769690.0 35.94329833984375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1769690.0 91.36411775287897 0.0 - - - - - - - 826.0 3539 1 667 85 B20140214_SF053_01 B20140214_SF053_01 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 443249.0 35.94329833984375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 443249.0 76.63648529674678 0.0 - - - - - - - 495.0 886 1 669 85 B20140214_SF053_01 B20140214_SF053_01 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 646997.0 35.94329833984375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 646997.0 149.55347470242194 0.0 - - - - - - - 495.0 1293 1 671 86 B20140214_SF053_01 B20140214_SF053_01 TB464010.[MT7]-DIDVIRGNIVK[MT7].3y10_2.heavy 510.647 / 635.902 52533.0 31.627224445343018 38 11 10 7 10 0.8966528221399848 65.66075139549021 0.025300979614257812 3 0.8717100779011562 3.4080809305158355 52533.0 101.51747252032135 0.0 - - - - - - - 752.2 105 15 MRPS6 mitochondrial ribosomal protein S6 673 86 B20140214_SF053_01 B20140214_SF053_01 TB464010.[MT7]-DIDVIRGNIVK[MT7].3b4_1.heavy 510.647 / 587.316 28496.0 31.627224445343018 38 11 10 7 10 0.8966528221399848 65.66075139549021 0.025300979614257812 3 0.8717100779011562 3.4080809305158355 28496.0 30.943226613828344 0.0 - - - - - - - 1729.4444444444443 56 9 MRPS6 mitochondrial ribosomal protein S6 675 86 B20140214_SF053_01 B20140214_SF053_01 TB464010.[MT7]-DIDVIRGNIVK[MT7].3y8_2.heavy 510.647 / 521.846 77372.0 31.627224445343018 38 11 10 7 10 0.8966528221399848 65.66075139549021 0.025300979614257812 3 0.8717100779011562 3.4080809305158355 77372.0 117.6355361456375 0.0 - - - - - - - 1286.7142857142858 154 7 MRPS6 mitochondrial ribosomal protein S6 677 86 B20140214_SF053_01 B20140214_SF053_01 TB464010.[MT7]-DIDVIRGNIVK[MT7].3y5_1.heavy 510.647 / 674.432 17927.0 31.627224445343018 38 11 10 7 10 0.8966528221399848 65.66075139549021 0.025300979614257812 3 0.8717100779011562 3.4080809305158355 17927.0 22.345912065028337 0.0 - - - - - - - 727.5625 35 16 MRPS6 mitochondrial ribosomal protein S6 679 87 B20140214_SF053_01 B20140214_SF053_01 TB246400.[MT7]-RNANVNLK[MT7].3y3_1.heavy 406.25 / 518.342 28451.0 20.242900848388672 42 12 10 10 10 1.009012167002887 61.269210138753834 0.0 3 0.889664435534718 3.6806804007433085 28451.0 31.426813294232648 1.0 - - - - - - - 747.8461538461538 56 13 ANKRD22 ankyrin repeat domain 22 681 87 B20140214_SF053_01 B20140214_SF053_01 TB246400.[MT7]-RNANVNLK[MT7].3b4_1.heavy 406.25 / 600.333 35849.0 20.242900848388672 42 12 10 10 10 1.009012167002887 61.269210138753834 0.0 3 0.889664435534718 3.6806804007433085 35849.0 33.5209906881657 0.0 - - - - - - - 344.25 71 8 ANKRD22 ankyrin repeat domain 22 683 87 B20140214_SF053_01 B20140214_SF053_01 TB246400.[MT7]-RNANVNLK[MT7].3b5_1.heavy 406.25 / 699.402 4132.0 20.242900848388672 42 12 10 10 10 1.009012167002887 61.269210138753834 0.0 3 0.889664435534718 3.6806804007433085 4132.0 16.84704331450094 0.0 - - - - - - - 232.28571428571428 8 21 ANKRD22 ankyrin repeat domain 22 685 87 B20140214_SF053_01 B20140214_SF053_01 TB246400.[MT7]-RNANVNLK[MT7].3b4_2.heavy 406.25 / 300.67 39312.0 20.242900848388672 42 12 10 10 10 1.009012167002887 61.269210138753834 0.0 3 0.889664435534718 3.6806804007433085 39312.0 28.11622861910722 0.0 - - - - - - - 1298.5833333333333 78 12 ANKRD22 ankyrin repeat domain 22 687 88 B20140214_SF053_01 B20140214_SF053_01 TB464152.[MT7]-WYQNPDYNFFNNYK[MT7].3b6_1.heavy 734.349 / 948.433 27128.0 41.33039855957031 47 17 10 10 10 2.1758008090479506 36.28929098219358 0.0 3 0.9739970348427753 7.636693057366816 27128.0 28.285727658646863 0.0 - - - - - - - 324.0 54 2 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 689 88 B20140214_SF053_01 B20140214_SF053_01 TB464152.[MT7]-WYQNPDYNFFNNYK[MT7].3b4_1.heavy 734.349 / 736.354 57658.0 41.33039855957031 47 17 10 10 10 2.1758008090479506 36.28929098219358 0.0 3 0.9739970348427753 7.636693057366816 57658.0 15.448211438212706 0.0 - - - - - - - 1215.0 115 1 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 691 88 B20140214_SF053_01 B20140214_SF053_01 TB464152.[MT7]-WYQNPDYNFFNNYK[MT7].3y4_1.heavy 734.349 / 682.364 43000.0 41.33039855957031 47 17 10 10 10 2.1758008090479506 36.28929098219358 0.0 3 0.9739970348427753 7.636693057366816 43000.0 39.03565977113081 0.0 - - - - - - - 243.0 86 1 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 693 88 B20140214_SF053_01 B20140214_SF053_01 TB464152.[MT7]-WYQNPDYNFFNNYK[MT7].3b3_1.heavy 734.349 / 622.311 33364.0 41.33039855957031 47 17 10 10 10 2.1758008090479506 36.28929098219358 0.0 3 0.9739970348427753 7.636693057366816 33364.0 17.745789108537323 0.0 - - - - - - - 729.0 66 2 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 695 89 B20140214_SF053_01 B20140214_SF053_01 TB464156.[MT7]-SLHVGTQC[CAM]ALTR.3y6_1.heavy 496.269 / 748.377 39524.0 26.211000442504883 47 17 10 10 10 3.147240938778427 31.773862232109273 0.0 3 0.9792100301295731 8.544371865466518 39524.0 34.952272428781384 2.0 - - - - - - - 671.4 220 10 MLANA melan-A 697 89 B20140214_SF053_01 B20140214_SF053_01 TB464156.[MT7]-SLHVGTQC[CAM]ALTR.3b3_1.heavy 496.269 / 482.284 130049.0 26.211000442504883 47 17 10 10 10 3.147240938778427 31.773862232109273 0.0 3 0.9792100301295731 8.544371865466518 130049.0 72.89833413228214 0.0 - - - - - - - 1273.0 260 2 MLANA melan-A 699 89 B20140214_SF053_01 B20140214_SF053_01 TB464156.[MT7]-SLHVGTQC[CAM]ALTR.3y8_1.heavy 496.269 / 906.446 42403.0 26.211000442504883 47 17 10 10 10 3.147240938778427 31.773862232109273 0.0 3 0.9792100301295731 8.544371865466518 42403.0 142.62292737213062 0.0 - - - - - - - 192.88888888888889 84 18 MLANA melan-A 701 89 B20140214_SF053_01 B20140214_SF053_01 TB464156.[MT7]-SLHVGTQC[CAM]ALTR.3y5_1.heavy 496.269 / 620.318 94363.0 26.211000442504883 47 17 10 10 10 3.147240938778427 31.773862232109273 0.0 3 0.9792100301295731 8.544371865466518 94363.0 37.91804842525146 0.0 - - - - - - - 1664.6666666666667 188 9 MLANA melan-A 703 90 B20140214_SF053_01 B20140214_SF053_01 TB464154.[MT7]-LSDEEVDEMIR.2y4_1.heavy 740.359 / 548.286 26837.0 36.069801330566406 48 18 10 10 10 5.1688342612083495 19.346722093701338 0.0 3 0.9849791626912533 10.057039899587524 26837.0 66.07415348952908 0.0 - - - - - - - 673.0 53 9 CALML3 calmodulin-like 3 705 90 B20140214_SF053_01 B20140214_SF053_01 TB464154.[MT7]-LSDEEVDEMIR.2y8_1.heavy 740.359 / 1020.47 20455.0 36.069801330566406 48 18 10 10 10 5.1688342612083495 19.346722093701338 0.0 3 0.9849791626912533 10.057039899587524 20455.0 59.95969465648855 0.0 - - - - - - - 267.72727272727275 40 11 CALML3 calmodulin-like 3 707 90 B20140214_SF053_01 B20140214_SF053_01 TB464154.[MT7]-LSDEEVDEMIR.2y10_1.heavy 740.359 / 1222.53 24710.0 36.069801330566406 48 18 10 10 10 5.1688342612083495 19.346722093701338 0.0 3 0.9849791626912533 10.057039899587524 24710.0 149.99801223241587 0.0 - - - - - - - 257.0 49 14 CALML3 calmodulin-like 3 709 90 B20140214_SF053_01 B20140214_SF053_01 TB464154.[MT7]-LSDEEVDEMIR.2b5_1.heavy 740.359 / 718.338 8837.0 36.069801330566406 48 18 10 10 10 5.1688342612083495 19.346722093701338 0.0 3 0.9849791626912533 10.057039899587524 8837.0 4.824486300868472 1.0 - - - - - - - 841.5714285714286 24 7 CALML3 calmodulin-like 3 711 91 B20140214_SF053_01 B20140214_SF053_01 TB107911.[MT7]-YYRVC[CAM]TLAIIDPGDSDIIR.3b8_1.heavy 795.418 / 1171.6 7750.0 40.81155014038086 39 13 10 6 10 1.7589823072223856 56.85105506144079 0.0370025634765625 3 0.9061742728437993 3.9971069194208284 7750.0 23.803317137297814 0.0 - - - - - - - 256.92857142857144 15 14 RPL30 ribosomal protein L30 713 91 B20140214_SF053_01 B20140214_SF053_01 TB107911.[MT7]-YYRVC[CAM]TLAIIDPGDSDIIR.3y8_1.heavy 795.418 / 872.447 50173.0 40.81155014038086 39 13 10 6 10 1.7589823072223856 56.85105506144079 0.0370025634765625 3 0.9061742728437993 3.9971069194208284 50173.0 56.53186758559495 0.0 - - - - - - - 339.5 100 4 RPL30 ribosomal protein L30 715 91 B20140214_SF053_01 B20140214_SF053_01 TB107911.[MT7]-YYRVC[CAM]TLAIIDPGDSDIIR.3y5_1.heavy 795.418 / 603.346 11265.0 40.81155014038086 39 13 10 6 10 1.7589823072223856 56.85105506144079 0.0370025634765625 3 0.9061742728437993 3.9971069194208284 11265.0 10.357945116809967 0.0 - - - - - - - 1238.375 22 8 RPL30 ribosomal protein L30 717 91 B20140214_SF053_01 B20140214_SF053_01 TB107911.[MT7]-YYRVC[CAM]TLAIIDPGDSDIIR.3b8_2.heavy 795.418 / 586.306 42423.0 40.81155014038086 39 13 10 6 10 1.7589823072223856 56.85105506144079 0.0370025634765625 3 0.9061742728437993 3.9971069194208284 42423.0 22.124320047138198 0.0 - - - - - - - 2271.285714285714 84 7 RPL30 ribosomal protein L30 719 92 B20140214_SF053_01 B20140214_SF053_01 TB464155.[MT7]-GQPGPAATDRNPR.3b4_1.heavy 494.263 / 484.264 66516.0 17.501800537109375 43 13 10 10 10 2.2990106876104477 43.49697047469505 0.0 3 0.9006530227630232 3.882596096926657 66516.0 100.16925234303751 0.0 - - - - - - - 762.6923076923077 133 13 FGF5 fibroblast growth factor 5 721 92 B20140214_SF053_01 B20140214_SF053_01 TB464155.[MT7]-GQPGPAATDRNPR.3y11_2.heavy 494.263 / 576.299 205991.0 17.501800537109375 43 13 10 10 10 2.2990106876104477 43.49697047469505 0.0 3 0.9006530227630232 3.882596096926657 205991.0 190.8254435953638 0.0 - - - - - - - 285.0 411 9 FGF5 fibroblast growth factor 5 723 92 B20140214_SF053_01 B20140214_SF053_01 TB464155.[MT7]-GQPGPAATDRNPR.3y4_1.heavy 494.263 / 542.316 18558.0 17.501800537109375 43 13 10 10 10 2.2990106876104477 43.49697047469505 0.0 3 0.9006530227630232 3.882596096926657 18558.0 37.711180825162856 0.0 - - - - - - - 680.2222222222222 37 9 FGF5 fibroblast growth factor 5 725 92 B20140214_SF053_01 B20140214_SF053_01 TB464155.[MT7]-GQPGPAATDRNPR.3y12_2.heavy 494.263 / 640.329 37525.0 17.501800537109375 43 13 10 10 10 2.2990106876104477 43.49697047469505 0.0 3 0.9006530227630232 3.882596096926657 37525.0 69.54224970390716 0.0 - - - - - - - 665.6666666666666 75 9 FGF5 fibroblast growth factor 5 727 93 B20140214_SF053_01 B20140214_SF053_01 TB464292.[MT7]-DSLYNEGILIVWDPSVYHSDIPK[MT7].3b4_1.heavy 983.514 / 623.316 3676.0 46.40890121459961 48 18 10 10 10 6.456679794634709 15.48783634633651 0.0 3 0.9844427190399331 9.881681973324609 3676.0 25.91585223074737 0.0 - - - - - - - 270.3529411764706 7 17 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 729 93 B20140214_SF053_01 B20140214_SF053_01 TB464292.[MT7]-DSLYNEGILIVWDPSVYHSDIPK[MT7].3b5_1.heavy 983.514 / 737.359 1991.0 46.40890121459961 48 18 10 10 10 6.456679794634709 15.48783634633651 0.0 3 0.9844427190399331 9.881681973324609 1991.0 15.928 0.0 - - - - - - - 165.07692307692307 3 13 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 731 93 B20140214_SF053_01 B20140214_SF053_01 TB464292.[MT7]-DSLYNEGILIVWDPSVYHSDIPK[MT7].3b8_1.heavy 983.514 / 1036.51 4901.0 46.40890121459961 48 18 10 10 10 6.456679794634709 15.48783634633651 0.0 3 0.9844427190399331 9.881681973324609 4901.0 9.752365031612934 1.0 - - - - - - - 218.15384615384616 11 13 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 733 93 B20140214_SF053_01 B20140214_SF053_01 TB464292.[MT7]-DSLYNEGILIVWDPSVYHSDIPK[MT7].3b7_1.heavy 983.514 / 923.423 6662.0 46.40890121459961 48 18 10 10 10 6.456679794634709 15.48783634633651 0.0 3 0.9844427190399331 9.881681973324609 6662.0 121.83413122824889 0.0 - - - - - - - 167.27272727272728 13 11 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 735 94 B20140214_SF053_01 B20140214_SF053_01 TB107913.[MT7]-DTDNEEEIREAFRVFDK[MT7].4y4_1.heavy 601.052 / 652.379 8149.0 39.29249954223633 50 20 10 10 10 12.599908410884794 7.936565627224093 0.0 3 0.9984685881436836 31.532683228796266 8149.0 15.085521876221826 0.0 - - - - - - - 748.0909090909091 16 11 CALML3 calmodulin-like 3 737 94 B20140214_SF053_01 B20140214_SF053_01 TB107913.[MT7]-DTDNEEEIREAFRVFDK[MT7].4b4_1.heavy 601.052 / 590.254 16215.0 39.29249954223633 50 20 10 10 10 12.599908410884794 7.936565627224093 0.0 3 0.9984685881436836 31.532683228796266 16215.0 14.920299243835274 0.0 - - - - - - - 1375.857142857143 32 7 CALML3 calmodulin-like 3 739 94 B20140214_SF053_01 B20140214_SF053_01 TB107913.[MT7]-DTDNEEEIREAFRVFDK[MT7].4b5_1.heavy 601.052 / 719.296 14075.0 39.29249954223633 50 20 10 10 10 12.599908410884794 7.936565627224093 0.0 3 0.9984685881436836 31.532683228796266 14075.0 37.033547709484345 0.0 - - - - - - - 667.4444444444445 28 9 CALML3 calmodulin-like 3 741 94 B20140214_SF053_01 B20140214_SF053_01 TB107913.[MT7]-DTDNEEEIREAFRVFDK[MT7].4y3_1.heavy 601.052 / 553.31 13170.0 39.29249954223633 50 20 10 10 10 12.599908410884794 7.936565627224093 0.0 3 0.9984685881436836 31.532683228796266 13170.0 25.26286420362495 0.0 - - - - - - - 812.625 26 8 CALML3 calmodulin-like 3 743 95 B20140214_SF053_01 B20140214_SF053_01 TB107912.[MT7]-GIGIENIHYLNDGLWHMK[MT7].4b7_1.heavy 600.32 / 841.49 10745.0 40.03037452697754 39 13 10 6 10 1.095303888272166 54.053387373320575 0.03769683837890625 3 0.9192033791034715 4.3121845430977235 10745.0 27.528765032975556 0.0 - - - - - - - 712.375 21 8 MCTS1 malignant T cell amplified sequence 1 745 95 B20140214_SF053_01 B20140214_SF053_01 TB107912.[MT7]-GIGIENIHYLNDGLWHMK[MT7].4b5_1.heavy 600.32 / 614.363 10175.0 40.03037452697754 39 13 10 6 10 1.095303888272166 54.053387373320575 0.03769683837890625 3 0.9192033791034715 4.3121845430977235 10175.0 16.032894736842103 0.0 - - - - - - - 1161.7272727272727 20 11 MCTS1 malignant T cell amplified sequence 1 747 95 B20140214_SF053_01 B20140214_SF053_01 TB107912.[MT7]-GIGIENIHYLNDGLWHMK[MT7].4y3_1.heavy 600.32 / 559.314 19455.0 40.03037452697754 39 13 10 6 10 1.095303888272166 54.053387373320575 0.03769683837890625 3 0.9192033791034715 4.3121845430977235 19455.0 16.625454414003414 0.0 - - - - - - - 1314.142857142857 38 7 MCTS1 malignant T cell amplified sequence 1 749 95 B20140214_SF053_01 B20140214_SF053_01 TB107912.[MT7]-GIGIENIHYLNDGLWHMK[MT7].4b6_1.heavy 600.32 / 728.406 17013.0 40.03037452697754 39 13 10 6 10 1.095303888272166 54.053387373320575 0.03769683837890625 3 0.9192033791034715 4.3121845430977235 17013.0 36.064423963133635 0.0 - - - - - - - 748.9 34 10 MCTS1 malignant T cell amplified sequence 1 751 96 B20140214_SF053_01 B20140214_SF053_01 TB464291.[MT7]-K[MT7]FLEELLTTQC[CAM]DRFSQEEIK[MT7].4b4_1.heavy 737.396 / 806.501 3571.0 41.11854934692383 31 5 10 6 10 0.4109013378182879 113.8970048924151 0.0370025634765625 3 0.6408800850903351 1.9943152671171551 3571.0 5.424534700235684 1.0 - - - - - - - 722.3 7 10 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 753 96 B20140214_SF053_01 B20140214_SF053_01 TB464291.[MT7]-K[MT7]FLEELLTTQC[CAM]DRFSQEEIK[MT7].4y13_2.heavy 737.396 / 893.432 19965.0 41.11854934692383 31 5 10 6 10 0.4109013378182879 113.8970048924151 0.0370025634765625 3 0.6408800850903351 1.9943152671171551 19965.0 34.095158450704226 0.0 - - - - - - - 823.1428571428571 39 7 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 755 96 B20140214_SF053_01 B20140214_SF053_01 TB464291.[MT7]-K[MT7]FLEELLTTQC[CAM]DRFSQEEIK[MT7].4b5_1.heavy 737.396 / 935.544 10551.0 41.11854934692383 31 5 10 6 10 0.4109013378182879 113.8970048924151 0.0370025634765625 3 0.6408800850903351 1.9943152671171551 10551.0 28.29705877482138 0.0 - - - - - - - 760.875 21 8 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 757 96 B20140214_SF053_01 B20140214_SF053_01 TB464291.[MT7]-K[MT7]FLEELLTTQC[CAM]DRFSQEEIK[MT7].4b6_2.heavy 737.396 / 524.818 34168.0 41.11854934692383 31 5 10 6 10 0.4109013378182879 113.8970048924151 0.0370025634765625 3 0.6408800850903351 1.9943152671171551 34168.0 64.77907668242267 0.0 - - - - - - - 776.7142857142857 68 7 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 759 97 B20140214_SF053_01 B20140214_SF053_01 TB107915.[MT7]-FFDSAC[CAM]TMGAYHPLLYEK[MT7].3y6_1.heavy 813.397 / 906.542 18083.0 39.569801330566406 44 14 10 10 10 2.691261818075263 37.15729154568767 0.0 3 0.9426411923095294 5.128191641314502 18083.0 11.593333389720124 0.0 - - - - - - - 328.8333333333333 36 6 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 761 97 B20140214_SF053_01 B20140214_SF053_01 TB107915.[MT7]-FFDSAC[CAM]TMGAYHPLLYEK[MT7].3b5_1.heavy 813.397 / 712.342 3123.0 39.569801330566406 44 14 10 10 10 2.691261818075263 37.15729154568767 0.0 3 0.9426411923095294 5.128191641314502 3123.0 1.8307102254376333 0.0 - - - - - - - 849.2222222222222 6 9 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 763 97 B20140214_SF053_01 B20140214_SF053_01 TB107915.[MT7]-FFDSAC[CAM]TMGAYHPLLYEK[MT7].3y4_1.heavy 813.397 / 696.405 5096.0 39.569801330566406 44 14 10 10 10 2.691261818075263 37.15729154568767 0.0 3 0.9426411923095294 5.128191641314502 5096.0 3.8906730942122505 0.0 - - - - - - - 1174.4285714285713 10 7 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 765 97 B20140214_SF053_01 B20140214_SF053_01 TB107915.[MT7]-FFDSAC[CAM]TMGAYHPLLYEK[MT7].3b3_1.heavy 813.397 / 554.273 6247.0 39.569801330566406 44 14 10 10 10 2.691261818075263 37.15729154568767 0.0 3 0.9426411923095294 5.128191641314502 6247.0 10.189502687882637 0.0 - - - - - - - 751.4285714285714 12 7 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 767 98 B20140214_SF053_01 B20140214_SF053_01 TB464290.[MT7]-VFQSLPHENK[MT7]PLTLSNYQTNK[MT7].4y5_1.heavy 723.4 / 797.427 5350.0 32.589524269104004 37 11 10 6 10 1.185957899713718 54.58004855469581 0.033298492431640625 3 0.851929279431628 3.166774967548174 5350.0 18.86099927036839 0.0 - - - - - - - 751.0 10 8 CSTB cystatin B (stefin B) 769 98 B20140214_SF053_01 B20140214_SF053_01 TB464290.[MT7]-VFQSLPHENK[MT7]PLTLSNYQTNK[MT7].4b4_1.heavy 723.4 / 606.337 10498.0 32.589524269104004 37 11 10 6 10 1.185957899713718 54.58004855469581 0.033298492431640625 3 0.851929279431628 3.166774967548174 10498.0 15.677762831396109 0.0 - - - - - - - 697.3125 20 16 CSTB cystatin B (stefin B) 771 98 B20140214_SF053_01 B20140214_SF053_01 TB464290.[MT7]-VFQSLPHENK[MT7]PLTLSNYQTNK[MT7].4y3_1.heavy 723.4 / 506.306 35936.0 32.589524269104004 37 11 10 6 10 1.185957899713718 54.58004855469581 0.033298492431640625 3 0.851929279431628 3.166774967548174 35936.0 54.83676950994375 0.0 - - - - - - - 703.1428571428571 71 14 CSTB cystatin B (stefin B) 773 98 B20140214_SF053_01 B20140214_SF053_01 TB464290.[MT7]-VFQSLPHENK[MT7]PLTLSNYQTNK[MT7].4b3_1.heavy 723.4 / 519.305 5401.0 32.589524269104004 37 11 10 6 10 1.185957899713718 54.58004855469581 0.033298492431640625 3 0.851929279431628 3.166774967548174 5401.0 8.769700744550429 0.0 - - - - - - - 1218.5714285714287 10 7 CSTB cystatin B (stefin B) 775 99 B20140214_SF053_01 B20140214_SF053_01 TB107914.[MT7]-YGFVIAVTTIDNIGAGVIQPGR.3b6_1.heavy 802.448 / 795.452 10418.0 51.38697624206543 35 9 10 6 10 0.8008197417060545 71.81205980395876 0.03910064697265625 3 0.8054222826839997 2.7511116482207667 10418.0 45.33214092764875 0.0 - - - - - - - 241.46153846153845 20 13 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 777 99 B20140214_SF053_01 B20140214_SF053_01 TB107914.[MT7]-YGFVIAVTTIDNIGAGVIQPGR.3b4_1.heavy 802.448 / 611.331 6778.0 51.38697624206543 35 9 10 6 10 0.8008197417060545 71.81205980395876 0.03910064697265625 3 0.8054222826839997 2.7511116482207667 6778.0 20.263246914303572 0.0 - - - - - - - 194.0 13 11 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 779 99 B20140214_SF053_01 B20140214_SF053_01 TB107914.[MT7]-YGFVIAVTTIDNIGAGVIQPGR.3b3_1.heavy 802.448 / 512.263 3054.0 51.38697624206543 35 9 10 6 10 0.8008197417060545 71.81205980395876 0.03910064697265625 3 0.8054222826839997 2.7511116482207667 3054.0 45.918636881047235 0.0 - - - - - - - 167.4375 6 16 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 781 99 B20140214_SF053_01 B20140214_SF053_01 TB107914.[MT7]-YGFVIAVTTIDNIGAGVIQPGR.3y9_1.heavy 802.448 / 854.484 19873.0 51.38697624206543 35 9 10 6 10 0.8008197417060545 71.81205980395876 0.03910064697265625 3 0.8054222826839997 2.7511116482207667 19873.0 125.32217131474103 0.0 - - - - - - - 209.125 39 8 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 783 100 B20140214_SF053_01 B20140214_SF053_01 TB246605.[MT7]-RLVQSPNSYFMDVK[MT7].3y3_1.heavy 658.024 / 505.31 22831.0 34.75310134887695 40 14 10 6 10 2.3659645282993353 29.657089824948514 0.0352020263671875 3 0.9493482553678548 5.460277981808614 22831.0 23.224154954000863 0.0 - - - - - - - 742.4444444444445 45 9 RPS27L;RPS27 ribosomal protein S27-like;ribosomal protein S27 785 100 B20140214_SF053_01 B20140214_SF053_01 TB246605.[MT7]-RLVQSPNSYFMDVK[MT7].3b5_1.heavy 658.024 / 728.453 6205.0 34.75310134887695 40 14 10 6 10 2.3659645282993353 29.657089824948514 0.0352020263671875 3 0.9493482553678548 5.460277981808614 6205.0 19.68045219774428 0.0 - - - - - - - 803.6 12 10 RPS27L;RPS27 ribosomal protein S27-like;ribosomal protein S27 787 100 B20140214_SF053_01 B20140214_SF053_01 TB246605.[MT7]-RLVQSPNSYFMDVK[MT7].3y4_1.heavy 658.024 / 636.351 20365.0 34.75310134887695 40 14 10 6 10 2.3659645282993353 29.657089824948514 0.0352020263671875 3 0.9493482553678548 5.460277981808614 20365.0 17.22042779078845 0.0 - - - - - - - 1829.75 40 8 RPS27L;RPS27 ribosomal protein S27-like;ribosomal protein S27 789 100 B20140214_SF053_01 B20140214_SF053_01 TB246605.[MT7]-RLVQSPNSYFMDVK[MT7].3y5_1.heavy 658.024 / 783.419 14558.0 34.75310134887695 40 14 10 6 10 2.3659645282993353 29.657089824948514 0.0352020263671875 3 0.9493482553678548 5.460277981808614 14558.0 35.63480615062711 0.0 - - - - - - - 328.25 29 8 RPS27L;RPS27 ribosomal protein S27-like;ribosomal protein S27 791 101 B20140214_SF053_01 B20140214_SF053_01 TB107916.[MT7]-AAGYDLYSAYDYTIPPMEK[MT7].3b6_1.heavy 819.403 / 735.379 11242.0 40.67169952392578 41 11 10 10 10 1.0726716205422484 61.0218482527158 0.0 3 0.8584056605219182 3.240234809814931 11242.0 23.25637039321511 0.0 - - - - - - - 314.6 22 5 DUT deoxyuridine triphosphatase 793 101 B20140214_SF053_01 B20140214_SF053_01 TB107916.[MT7]-AAGYDLYSAYDYTIPPMEK[MT7].3b5_1.heavy 819.403 / 622.295 13601.0 40.67169952392578 41 11 10 10 10 1.0726716205422484 61.0218482527158 0.0 3 0.8584056605219182 3.240234809814931 13601.0 44.9289069674863 0.0 - - - - - - - 209.5 27 6 DUT deoxyuridine triphosphatase 795 101 B20140214_SF053_01 B20140214_SF053_01 TB107916.[MT7]-AAGYDLYSAYDYTIPPMEK[MT7].3b7_1.heavy 819.403 / 898.443 5896.0 40.67169952392578 41 11 10 10 10 1.0726716205422484 61.0218482527158 0.0 3 0.8584056605219182 3.240234809814931 5896.0 18.062624281596392 0.0 - - - - - - - 290.7 11 10 DUT deoxyuridine triphosphatase 797 101 B20140214_SF053_01 B20140214_SF053_01 TB107916.[MT7]-AAGYDLYSAYDYTIPPMEK[MT7].3y5_1.heavy 819.403 / 745.404 40331.0 40.67169952392578 41 11 10 10 10 1.0726716205422484 61.0218482527158 0.0 3 0.8584056605219182 3.240234809814931 40331.0 22.28030195803607 0.0 - - - - - - - 786.0 80 2 DUT deoxyuridine triphosphatase 799 102 B20140214_SF053_01 B20140214_SF053_01 TB107919.[MT7]-GLIAAIC[CAM]AGPTALLAHEIGFGSK[MT7].3y7_1.heavy 852.48 / 881.485 11326.0 48.77387619018555 47 20 10 7 10 4.529699111710674 17.40154521023824 0.0290985107421875 3 0.9921426794347442 13.913627026661514 11326.0 72.94730918114143 0.0 - - - - - - - 185.66666666666666 22 21 PARK7 Parkinson disease (autosomal recessive, early onset) 7 801 102 B20140214_SF053_01 B20140214_SF053_01 TB107919.[MT7]-GLIAAIC[CAM]AGPTALLAHEIGFGSK[MT7].3y6_1.heavy 852.48 / 752.442 14529.0 48.77387619018555 47 20 10 7 10 4.529699111710674 17.40154521023824 0.0290985107421875 3 0.9921426794347442 13.913627026661514 14529.0 64.93711272315687 0.0 - - - - - - - 683.1428571428571 29 7 PARK7 Parkinson disease (autosomal recessive, early onset) 7 803 102 B20140214_SF053_01 B20140214_SF053_01 TB107919.[MT7]-GLIAAIC[CAM]AGPTALLAHEIGFGSK[MT7].3b5_1.heavy 852.48 / 570.373 30683.0 48.77387619018555 47 20 10 7 10 4.529699111710674 17.40154521023824 0.0290985107421875 3 0.9921426794347442 13.913627026661514 30683.0 97.64829791465267 0.0 - - - - - - - 668.5 61 10 PARK7 Parkinson disease (autosomal recessive, early onset) 7 805 102 B20140214_SF053_01 B20140214_SF053_01 TB107919.[MT7]-GLIAAIC[CAM]AGPTALLAHEIGFGSK[MT7].3y5_1.heavy 852.48 / 639.358 19589.0 48.77387619018555 47 20 10 7 10 4.529699111710674 17.40154521023824 0.0290985107421875 3 0.9921426794347442 13.913627026661514 19589.0 68.18659090909091 0.0 - - - - - - - 243.6875 39 16 PARK7 Parkinson disease (autosomal recessive, early onset) 7 807 103 B20140214_SF053_01 B20140214_SF053_01 TB107918.[MT7]-ADGTVNQIEGEATPVNLTEPAK[MT7].3b6_1.heavy 848.113 / 702.354 10947.0 33.86367607116699 39 13 10 6 10 2.601449514777751 38.44010788290976 0.03749847412109375 3 0.9016307887549135 3.902174368416949 10947.0 29.70041190684167 0.0 - - - - - - - 636.6666666666666 21 9 APOD apolipoprotein D 809 103 B20140214_SF053_01 B20140214_SF053_01 TB107918.[MT7]-ADGTVNQIEGEATPVNLTEPAK[MT7].3y5_1.heavy 848.113 / 689.395 25420.0 33.86367607116699 39 13 10 6 10 2.601449514777751 38.44010788290976 0.03749847412109375 3 0.9016307887549135 3.902174368416949 25420.0 54.58150215224826 0.0 - - - - - - - 753.0 50 8 APOD apolipoprotein D 811 103 B20140214_SF053_01 B20140214_SF053_01 TB107918.[MT7]-ADGTVNQIEGEATPVNLTEPAK[MT7].3b7_1.heavy 848.113 / 830.412 32178.0 33.86367607116699 39 13 10 6 10 2.601449514777751 38.44010788290976 0.03749847412109375 3 0.9016307887549135 3.902174368416949 32178.0 18.396907055592145 0.0 - - - - - - - 1792.8 64 5 APOD apolipoprotein D 813 103 B20140214_SF053_01 B20140214_SF053_01 TB107918.[MT7]-ADGTVNQIEGEATPVNLTEPAK[MT7].3y9_1.heavy 848.113 / 1112.64 23509.0 33.86367607116699 39 13 10 6 10 2.601449514777751 38.44010788290976 0.03749847412109375 3 0.9016307887549135 3.902174368416949 23509.0 118.27306400381163 0.0 - - - - - - - 254.8235294117647 47 17 APOD apolipoprotein D 815 104 B20140214_SF053_01 B20140214_SF053_01 TB107854.[MT7]-AADTDGDGQVNYEEFVR.2y4_1.heavy 1015.46 / 550.298 3335.0 34.3568000793457 45 15 10 10 10 3.078692265161005 27.121320681534236 0.0 3 0.9561300737793236 5.870543167863148 3335.0 85.88767123287673 0.0 - - - - - - - 109.125 6 8 CALML3 calmodulin-like 3 817 104 B20140214_SF053_01 B20140214_SF053_01 TB107854.[MT7]-AADTDGDGQVNYEEFVR.2b7_1.heavy 1015.46 / 790.333 14356.0 34.3568000793457 45 15 10 10 10 3.078692265161005 27.121320681534236 0.0 3 0.9561300737793236 5.870543167863148 14356.0 213.9541063531442 0.0 - - - - - - - 153.44444444444446 28 9 CALML3 calmodulin-like 3 819 104 B20140214_SF053_01 B20140214_SF053_01 TB107854.[MT7]-AADTDGDGQVNYEEFVR.2y10_1.heavy 1015.46 / 1240.6 10296.0 34.3568000793457 45 15 10 10 10 3.078692265161005 27.121320681534236 0.0 3 0.9561300737793236 5.870543167863148 10296.0 199.30565895134626 0.0 - - - - - - - 101.8 20 10 CALML3 calmodulin-like 3 821 104 B20140214_SF053_01 B20140214_SF053_01 TB107854.[MT7]-AADTDGDGQVNYEEFVR.2b5_1.heavy 1015.46 / 618.285 19794.0 34.3568000793457 45 15 10 10 10 3.078692265161005 27.121320681534236 0.0 3 0.9561300737793236 5.870543167863148 19794.0 97.37737931034484 0.0 - - - - - - - 223.23076923076923 39 13 CALML3 calmodulin-like 3 823 105 B20140214_SF053_01 B20140214_SF053_01 TB107853.[MT7]-EDPDSVPPIDVLWIK[MT7].3b6_1.heavy 671.038 / 787.359 6053.0 46.85902500152588 41 15 10 6 10 2.549653077543284 31.129494855134467 0.037899017333984375 3 0.9503919025168467 5.5179041398197555 6053.0 37.39243121360444 0.0 - - - - - - - 249.1 12 20 SRXN1 sulfiredoxin 1 825 105 B20140214_SF053_01 B20140214_SF053_01 TB107853.[MT7]-EDPDSVPPIDVLWIK[MT7].3y3_1.heavy 671.038 / 590.378 8138.0 46.85902500152588 41 15 10 6 10 2.549653077543284 31.129494855134467 0.037899017333984375 3 0.9503919025168467 5.5179041398197555 8138.0 17.80923103735303 0.0 - - - - - - - 1237.5555555555557 16 9 SRXN1 sulfiredoxin 1 827 105 B20140214_SF053_01 B20140214_SF053_01 TB107853.[MT7]-EDPDSVPPIDVLWIK[MT7].3b4_1.heavy 671.038 / 601.259 2136.0 46.85902500152588 41 15 10 6 10 2.549653077543284 31.129494855134467 0.037899017333984375 3 0.9503919025168467 5.5179041398197555 2136.0 3.0514285714285716 1.0 - - - - - - - 648.5 5 8 SRXN1 sulfiredoxin 1 829 105 B20140214_SF053_01 B20140214_SF053_01 TB107853.[MT7]-EDPDSVPPIDVLWIK[MT7].3b5_1.heavy 671.038 / 688.291 4120.0 46.85902500152588 41 15 10 6 10 2.549653077543284 31.129494855134467 0.037899017333984375 3 0.9503919025168467 5.5179041398197555 4120.0 6.949047282992236 0.0 - - - - - - - 766.7142857142857 8 14 SRXN1 sulfiredoxin 1 831 106 B20140214_SF053_01 B20140214_SF053_01 TB464299.[MT7]-LRPEMLQDLRENTEFSELELQEWYK[MT7].4y4_1.heavy 871.947 / 769.4 8015.0 44.37229919433594 30 5 10 5 10 1.9877394059947557 35.26657103729178 0.04019927978515625 3 0.6085662183188758 1.9042505958268092 8015.0 26.29259259259259 0.0 - - - - - - - 694.1428571428571 16 7 HPCA hippocalcin 833 106 B20140214_SF053_01 B20140214_SF053_01 TB464299.[MT7]-LRPEMLQDLRENTEFSELELQEWYK[MT7].4b8_1.heavy 871.947 / 1127.6 1619.0 44.37229919433594 30 5 10 5 10 1.9877394059947557 35.26657103729178 0.04019927978515625 3 0.6085662183188758 1.9042505958268092 1619.0 15.723621399176956 0.0 - - - - - - - 216.0 3 12 HPCA hippocalcin 835 106 B20140214_SF053_01 B20140214_SF053_01 TB464299.[MT7]-LRPEMLQDLRENTEFSELELQEWYK[MT7].4b14_2.heavy 871.947 / 935.484 4291.0 44.37229919433594 30 5 10 5 10 1.9877394059947557 35.26657103729178 0.04019927978515625 3 0.6085662183188758 1.9042505958268092 4291.0 14.265493827160494 0.0 - - - - - - - 253.8 8 15 HPCA hippocalcin 837 106 B20140214_SF053_01 B20140214_SF053_01 TB464299.[MT7]-LRPEMLQDLRENTEFSELELQEWYK[MT7].4b17_2.heavy 871.947 / 1117.06 6476.0 44.37229919433594 30 5 10 5 10 1.9877394059947557 35.26657103729178 0.04019927978515625 3 0.6085662183188758 1.9042505958268092 6476.0 45.1720987654321 0.0 - - - - - - - 193.15384615384616 12 13 HPCA hippocalcin 839 107 B20140214_SF053_01 B20140214_SF053_01 TB464297.[MT7]-ITTVFSHAQTVVLC[CAM]VGC[CAM]STVLC[CAM]QPTGGK[MT7].4y5_1.heavy 827.932 / 603.358 47680.0 42.74620056152344 48 18 10 10 10 9.540919505011493 10.481170074590157 0.0 3 0.98588952205381 10.377183731775895 47680.0 54.18110016143411 0.0 - - - - - - - 1210.125 95 8 RPS27L;RPS27 ribosomal protein S27-like;ribosomal protein S27 841 107 B20140214_SF053_01 B20140214_SF053_01 TB464297.[MT7]-ITTVFSHAQTVVLC[CAM]VGC[CAM]STVLC[CAM]QPTGGK[MT7].4b11_2.heavy 827.932 / 665.368 14038.0 42.74620056152344 48 18 10 10 10 9.540919505011493 10.481170074590157 0.0 3 0.98588952205381 10.377183731775895 14038.0 22.18000685327935 0.0 - - - - - - - 679.9285714285714 28 14 RPS27L;RPS27 ribosomal protein S27-like;ribosomal protein S27 843 107 B20140214_SF053_01 B20140214_SF053_01 TB464297.[MT7]-ITTVFSHAQTVVLC[CAM]VGC[CAM]STVLC[CAM]QPTGGK[MT7].4y7_1.heavy 827.932 / 891.448 13796.0 42.74620056152344 48 18 10 10 10 9.540919505011493 10.481170074590157 0.0 3 0.98588952205381 10.377183731775895 13796.0 36.36155038759691 0.0 - - - - - - - 654.1111111111111 27 9 RPS27L;RPS27 ribosomal protein S27-like;ribosomal protein S27 845 107 B20140214_SF053_01 B20140214_SF053_01 TB464297.[MT7]-ITTVFSHAQTVVLC[CAM]VGC[CAM]STVLC[CAM]QPTGGK[MT7].4b10_2.heavy 827.932 / 615.834 6858.0 42.74620056152344 48 18 10 10 10 9.540919505011493 10.481170074590157 0.0 3 0.98588952205381 10.377183731775895 6858.0 10.852196626624472 0.0 - - - - - - - 342.8125 13 16 RPS27L;RPS27 ribosomal protein S27-like;ribosomal protein S27 847 108 B20140214_SF053_01 B20140214_SF053_01 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 167259.0 24.463699340820312 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 167259.0 145.5845502859797 0.0 - - - - - - - 1238.7857142857142 334 14 849 108 B20140214_SF053_01 B20140214_SF053_01 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 272660.0 24.463699340820312 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 272660.0 794.7031905720035 0.0 - - - - - - - 694.4444444444445 545 9 851 108 B20140214_SF053_01 B20140214_SF053_01 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 979436.0 24.463699340820312 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 979436.0 1492.0280592607003 0.0 - - - - - - - 1670.7142857142858 1958 7 853 109 B20140214_SF053_01 B20140214_SF053_01 TB107852.[MT7]-HLNQGTDEDIYLLGK[MT7].3b9_2.heavy 668.693 / 577.763 120364.0 34.130401611328125 37 7 10 10 10 0.9073825795784349 65.24420103846866 0.0 3 0.7263046611466936 2.3029529403391793 120364.0 160.51424369112925 0.0 - - - - - - - 874.5714285714286 240 7 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 855 109 B20140214_SF053_01 B20140214_SF053_01 TB107852.[MT7]-HLNQGTDEDIYLLGK[MT7].3b9_1.heavy 668.693 / 1154.52 32308.0 34.130401611328125 37 7 10 10 10 0.9073825795784349 65.24420103846866 0.0 3 0.7263046611466936 2.3029529403391793 32308.0 259.07647393364925 0.0 - - - - - - - 165.52941176470588 64 17 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 857 109 B20140214_SF053_01 B20140214_SF053_01 TB107852.[MT7]-HLNQGTDEDIYLLGK[MT7].3y4_1.heavy 668.693 / 574.404 51454.0 34.130401611328125 37 7 10 10 10 0.9073825795784349 65.24420103846866 0.0 3 0.7263046611466936 2.3029529403391793 51454.0 64.12670323637286 0.0 - - - - - - - 844.7 102 10 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 859 109 B20140214_SF053_01 B20140214_SF053_01 TB107852.[MT7]-HLNQGTDEDIYLLGK[MT7].3y5_1.heavy 668.693 / 737.468 36602.0 34.130401611328125 37 7 10 10 10 0.9073825795784349 65.24420103846866 0.0 3 0.7263046611466936 2.3029529403391793 36602.0 133.90618051415797 0.0 - - - - - - - 739.0 73 8 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 861 110 B20140214_SF053_01 B20140214_SF053_01 TB464016.[MT7]-EVAAQVK[MT7].2y4_1.heavy 516.818 / 589.379 21934.0 21.264349460601807 43 17 10 6 10 3.0063035190024716 22.44170222225474 0.030599594116210938 3 0.9760875902330503 7.964920759986281 21934.0 58.63299453981499 0.0 - - - - - - - 672.4 43 10 PARK7 Parkinson disease (autosomal recessive, early onset) 7 863 110 B20140214_SF053_01 B20140214_SF053_01 TB464016.[MT7]-EVAAQVK[MT7].2y5_1.heavy 516.818 / 660.416 27305.0 21.264349460601807 43 17 10 6 10 3.0063035190024716 22.44170222225474 0.030599594116210938 3 0.9760875902330503 7.964920759986281 27305.0 57.11034840538267 0.0 - - - - - - - 681.2857142857143 54 7 PARK7 Parkinson disease (autosomal recessive, early onset) 7 865 110 B20140214_SF053_01 B20140214_SF053_01 TB464016.[MT7]-EVAAQVK[MT7].2b4_1.heavy 516.818 / 515.295 16263.0 21.264349460601807 43 17 10 6 10 3.0063035190024716 22.44170222225474 0.030599594116210938 3 0.9760875902330503 7.964920759986281 16263.0 49.52679771826752 0.0 - - - - - - - 631.5454545454545 32 11 PARK7 Parkinson disease (autosomal recessive, early onset) 7 867 110 B20140214_SF053_01 B20140214_SF053_01 TB464016.[MT7]-EVAAQVK[MT7].2y6_1.heavy 516.818 / 759.484 30722.0 21.264349460601807 43 17 10 6 10 3.0063035190024716 22.44170222225474 0.030599594116210938 3 0.9760875902330503 7.964920759986281 30722.0 126.10286182347707 0.0 - - - - - - - 694.8 61 10 PARK7 Parkinson disease (autosomal recessive, early onset) 7 869 111 B20140214_SF053_01 B20140214_SF053_01 TB246408.[MT7]-MREENMER.3y3_1.heavy 413.529 / 435.202 10971.0 19.7012996673584 41 11 10 10 10 2.2015519552154363 45.422502868079874 0.0 3 0.8708394486599623 3.3963164192164594 10971.0 15.669368723098996 0.0 - - - - - - - 788.9 21 10 BEX1;BEX2 brain expressed, X-linked 1;brain expressed X-linked 2 871 111 B20140214_SF053_01 B20140214_SF053_01 TB246408.[MT7]-MREENMER.3b5_1.heavy 413.529 / 804.379 3192.0 19.7012996673584 41 11 10 10 10 2.2015519552154363 45.422502868079874 0.0 3 0.8708394486599623 3.3963164192164594 3192.0 48.195844155844156 0.0 - - - - - - - 106.26315789473684 6 19 BEX1;BEX2 brain expressed, X-linked 1;brain expressed X-linked 2 873 111 B20140214_SF053_01 B20140214_SF053_01 TB246408.[MT7]-MREENMER.3y4_1.heavy 413.529 / 549.245 9173.0 19.7012996673584 41 11 10 10 10 2.2015519552154363 45.422502868079874 0.0 3 0.8708394486599623 3.3963164192164594 9173.0 16.189834362898956 0.0 - - - - - - - 697.3 18 10 BEX1;BEX2 brain expressed, X-linked 1;brain expressed X-linked 2 875 111 B20140214_SF053_01 B20140214_SF053_01 TB246408.[MT7]-MREENMER.3y5_1.heavy 413.529 / 678.288 3743.0 19.7012996673584 41 11 10 10 10 2.2015519552154363 45.422502868079874 0.0 3 0.8708394486599623 3.3963164192164594 3743.0 14.10217298172125 0.0 - - - - - - - 278.9 7 20 BEX1;BEX2 brain expressed, X-linked 1;brain expressed X-linked 2 877 112 B20140214_SF053_01 B20140214_SF053_01 TB464294.[MT7]-GTEFAESADAALQGDPALQDAGDSSRK[MT7].4b4_1.heavy 749.618 / 579.289 46393.0 34.690101623535156 46 16 10 10 10 1.875118619926869 39.091349385078885 0.0 3 0.9624880416038146 6.351999620285786 46393.0 52.34665861723317 0.0 - - - - - - - 1185.5 92 10 GYPC glycophorin C (Gerbich blood group) 879 112 B20140214_SF053_01 B20140214_SF053_01 TB464294.[MT7]-GTEFAESADAALQGDPALQDAGDSSRK[MT7].4b5_1.heavy 749.618 / 650.327 57076.0 34.690101623535156 46 16 10 10 10 1.875118619926869 39.091349385078885 0.0 3 0.9624880416038146 6.351999620285786 57076.0 24.705432555664675 0.0 - - - - - - - 1610.0 114 2 GYPC glycophorin C (Gerbich blood group) 881 112 B20140214_SF053_01 B20140214_SF053_01 TB464294.[MT7]-GTEFAESADAALQGDPALQDAGDSSRK[MT7].4b9_1.heavy 749.618 / 1052.47 31977.0 34.690101623535156 46 16 10 10 10 1.875118619926869 39.091349385078885 0.0 3 0.9624880416038146 6.351999620285786 31977.0 47.16007582734095 0.0 - - - - - - - 265.375 63 8 GYPC glycophorin C (Gerbich blood group) 883 112 B20140214_SF053_01 B20140214_SF053_01 TB464294.[MT7]-GTEFAESADAALQGDPALQDAGDSSRK[MT7].4b6_1.heavy 749.618 / 779.369 75077.0 34.690101623535156 46 16 10 10 10 1.875118619926869 39.091349385078885 0.0 3 0.9624880416038146 6.351999620285786 75077.0 39.90814230423584 0.0 - - - - - - - 695.0 150 4 GYPC glycophorin C (Gerbich blood group) 885 113 B20140214_SF053_01 B20140214_SF053_01 TB107851.[MT7]-QVASMTK[MT7]PTTIIEK[MT7].3y7_1.heavy 660.391 / 945.574 7774.0 29.85540008544922 46 20 10 10 6 11.895661309009355 8.406426292942918 0.0 5 0.998940548409529 37.91259057216934 7774.0 29.014191993497256 0.0 - - - - - - - 284.72727272727275 15 22 FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) 887 113 B20140214_SF053_01 B20140214_SF053_01 TB107851.[MT7]-QVASMTK[MT7]PTTIIEK[MT7].3b6_1.heavy 660.391 / 762.394 1382.0 29.85540008544922 46 20 10 10 6 11.895661309009355 8.406426292942918 0.0 5 0.998940548409529 37.91259057216934 1382.0 3.214624277456647 9.0 - - - - - - - 245.96153846153845 7 26 FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) 889 113 B20140214_SF053_01 B20140214_SF053_01 TB107851.[MT7]-QVASMTK[MT7]PTTIIEK[MT7].3y3_1.heavy 660.391 / 533.341 4967.0 29.85540008544922 46 20 10 10 6 11.895661309009355 8.406426292942918 0.0 5 0.998940548409529 37.91259057216934 4967.0 9.704986515876469 0.0 - - - - - - - 700.9230769230769 9 13 FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) 891 113 B20140214_SF053_01 B20140214_SF053_01 TB107851.[MT7]-QVASMTK[MT7]PTTIIEK[MT7].3y4_1.heavy 660.391 / 646.426 N/A 29.85540008544922 46 20 10 10 6 11.895661309009355 8.406426292942918 0.0 5 0.998940548409529 37.91259057216934 3758.0 3.9286089419690704 2.0 - - - - - - - 1703.0 9 7 FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) 893 114 B20140214_SF053_01 B20140214_SF053_01 TB464293.[MT7]-ARGLWPFASAAGGGGSEAAGAEQALVRPR.4b4_1.heavy 739.392 / 542.353 12211.0 38.007049560546875 34 8 10 6 10 0.7040463363788279 85.22967582409524 0.0337982177734375 3 0.7873361587382826 2.627241482714091 12211.0 20.433181173536973 0.0 - - - - - - - 761.4166666666666 24 12 TUSC2 tumor suppressor candidate 2 895 114 B20140214_SF053_01 B20140214_SF053_01 TB464293.[MT7]-ARGLWPFASAAGGGGSEAAGAEQALVRPR.4b5_1.heavy 739.392 / 728.432 67970.0 38.007049560546875 34 8 10 6 10 0.7040463363788279 85.22967582409524 0.0337982177734375 3 0.7873361587382826 2.627241482714091 67970.0 75.95248493644223 0.0 - - - - - - - 256.0 135 1 TUSC2 tumor suppressor candidate 2 897 114 B20140214_SF053_01 B20140214_SF053_01 TB464293.[MT7]-ARGLWPFASAAGGGGSEAAGAEQALVRPR.4y19_2.heavy 739.392 / 877.451 88293.0 38.007049560546875 34 8 10 6 10 0.7040463363788279 85.22967582409524 0.0337982177734375 3 0.7873361587382826 2.627241482714091 88293.0 108.42563799729285 0.0 - - - - - - - 427.0 176 2 TUSC2 tumor suppressor candidate 2 899 114 B20140214_SF053_01 B20140214_SF053_01 TB464293.[MT7]-ARGLWPFASAAGGGGSEAAGAEQALVRPR.4y18_2.heavy 739.392 / 841.932 126889.0 38.007049560546875 34 8 10 6 10 0.7040463363788279 85.22967582409524 0.0337982177734375 3 0.7873361587382826 2.627241482714091 126889.0 101.8870833571846 0.0 - - - - - - - 256.0 253 1 TUSC2 tumor suppressor candidate 2 901 115 B20140214_SF053_01 B20140214_SF053_01 TB107868.[MT7]-IAPASNVSHTVVLRPLK[MT7].4y8_1.heavy 523.323 / 1069.72 2814.0 30.836400349934895 34 7 10 7 10 0.44012895609787 117.19923253202509 0.028499603271484375 3 0.7020844923455521 2.2023755530279594 2814.0 29.250059171597634 0.0 - - - - - - - 110.6 5 10 SSR2 signal sequence receptor, beta (translocon-associated protein beta) 903 115 B20140214_SF053_01 B20140214_SF053_01 TB107868.[MT7]-IAPASNVSHTVVLRPLK[MT7].4y7_1.heavy 523.323 / 968.674 23759.0 30.836400349934895 34 7 10 7 10 0.44012895609787 117.19923253202509 0.028499603271484375 3 0.7020844923455521 2.2023755530279594 23759.0 39.78807327786346 0.0 - - - - - - - 697.75 47 8 SSR2 signal sequence receptor, beta (translocon-associated protein beta) 905 115 B20140214_SF053_01 B20140214_SF053_01 TB107868.[MT7]-IAPASNVSHTVVLRPLK[MT7].4y3_1.heavy 523.323 / 501.352 N/A 30.836400349934895 34 7 10 7 10 0.44012895609787 117.19923253202509 0.028499603271484375 3 0.7020844923455521 2.2023755530279594 61681.0 11.082457869954556 2.0 - - - - - - - 2814.0 123 1 SSR2 signal sequence receptor, beta (translocon-associated protein beta) 907 115 B20140214_SF053_01 B20140214_SF053_01 TB107868.[MT7]-IAPASNVSHTVVLRPLK[MT7].4b6_1.heavy 523.323 / 698.395 136279.0 30.836400349934895 34 7 10 7 10 0.44012895609787 117.19923253202509 0.028499603271484375 3 0.7020844923455521 2.2023755530279594 136279.0 133.81205236186713 0.0 - - - - - - - 1234.0 272 8 SSR2 signal sequence receptor, beta (translocon-associated protein beta) 909 116 B20140214_SF053_01 B20140214_SF053_01 TB107869.[MT7]-FFLHHLIAEIHTAEIR.4y5_1.heavy 523.546 / 589.33 80309.0 40.54455089569092 43 17 10 6 10 2.5554489867871863 32.92497529022753 0.037799835205078125 3 0.9705611572683803 7.1751465930444525 80309.0 129.22749208705318 0.0 - - - - - - - 1221.5 160 8 PTHLH parathyroid hormone-like hormone 911 116 B20140214_SF053_01 B20140214_SF053_01 TB107869.[MT7]-FFLHHLIAEIHTAEIR.4b4_1.heavy 523.546 / 689.389 34395.0 40.54455089569092 43 17 10 6 10 2.5554489867871863 32.92497529022753 0.037799835205078125 3 0.9705611572683803 7.1751465930444525 34395.0 53.61795413386092 0.0 - - - - - - - 293.8 68 10 PTHLH parathyroid hormone-like hormone 913 116 B20140214_SF053_01 B20140214_SF053_01 TB107869.[MT7]-FFLHHLIAEIHTAEIR.4y6_1.heavy 523.546 / 726.389 25657.0 40.54455089569092 43 17 10 6 10 2.5554489867871863 32.92497529022753 0.037799835205078125 3 0.9705611572683803 7.1751465930444525 25657.0 81.90515831524695 0.0 - - - - - - - 344.4166666666667 51 12 PTHLH parathyroid hormone-like hormone 915 116 B20140214_SF053_01 B20140214_SF053_01 TB107869.[MT7]-FFLHHLIAEIHTAEIR.4b3_1.heavy 523.546 / 552.33 60847.0 40.54455089569092 43 17 10 6 10 2.5554489867871863 32.92497529022753 0.037799835205078125 3 0.9705611572683803 7.1751465930444525 60847.0 87.59114714861322 0.0 - - - - - - - 765.2727272727273 121 11 PTHLH parathyroid hormone-like hormone 917 117 B20140214_SF053_01 B20140214_SF053_01 TB464021.[MT7]-FAEHVFR.2y4_1.heavy 525.286 / 558.315 11350.0 29.291825771331787 37 18 6 7 6 3.872096628208726 25.825801781775546 0.029100418090820312 5 0.9815912420796363 9.082002796089593 11350.0 13.724399871958862 0.0 - - - - - - - 1161.888888888889 22 9 HPCA;HPCAL1;NCALD hippocalcin;hippocalcin-like 1;neurocalcin delta 919 117 B20140214_SF053_01 B20140214_SF053_01 TB464021.[MT7]-FAEHVFR.2y5_1.heavy 525.286 / 687.357 4643.0 29.291825771331787 37 18 6 7 6 3.872096628208726 25.825801781775546 0.029100418090820312 5 0.9815912420796363 9.082002796089593 4643.0 2.963792046633995 0.0 - - - - - - - 1232.857142857143 9 7 HPCA;HPCAL1;NCALD hippocalcin;hippocalcin-like 1;neurocalcin delta 921 117 B20140214_SF053_01 B20140214_SF053_01 TB464021.[MT7]-FAEHVFR.2b4_1.heavy 525.286 / 629.316 7598.0 29.291825771331787 37 18 6 7 6 3.872096628208726 25.825801781775546 0.029100418090820312 5 0.9815912420796363 9.082002796089593 7598.0 8.736282508136243 2.0 - - - - - - - 1172.6 61 10 HPCA;HPCAL1;NCALD hippocalcin;hippocalcin-like 1;neurocalcin delta 923 117 B20140214_SF053_01 B20140214_SF053_01 TB464021.[MT7]-FAEHVFR.2y6_1.heavy 525.286 / 758.394 20026.0 29.291825771331787 37 18 6 7 6 3.872096628208726 25.825801781775546 0.029100418090820312 5 0.9815912420796363 9.082002796089593 20026.0 53.374210538780346 0.0 - - - - - - - 633.0714285714286 40 14 HPCA;HPCAL1;NCALD hippocalcin;hippocalcin-like 1;neurocalcin delta 925 118 B20140214_SF053_01 B20140214_SF053_01 TB107922.[MT7]-AFQHWELIQEDILDTGNDK[MT7].3y6_1.heavy 854.102 / 793.381 N/A N/A - - - - - - - - - 0.0 - - - - - - - NTS neurotensin 927 118 B20140214_SF053_01 B20140214_SF053_01 TB107922.[MT7]-AFQHWELIQEDILDTGNDK[MT7].3b6_1.heavy 854.102 / 943.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - NTS neurotensin 929 118 B20140214_SF053_01 B20140214_SF053_01 TB107922.[MT7]-AFQHWELIQEDILDTGNDK[MT7].3b4_1.heavy 854.102 / 628.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - NTS neurotensin 931 118 B20140214_SF053_01 B20140214_SF053_01 TB107922.[MT7]-AFQHWELIQEDILDTGNDK[MT7].3y5_1.heavy 854.102 / 678.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - NTS neurotensin 933 119 B20140214_SF053_01 B20140214_SF053_01 TB463937.[MT7]-DISLTR.2b3_1.heavy 424.752 / 460.252 35375.0 26.719999313354492 50 20 10 10 10 7.046890666822737 14.190655812329702 0.0 3 0.9902850947771792 12.510966571842827 35375.0 20.764499644991268 0.0 - - - - - - - 1788.5714285714287 70 7 LGALS14 lectin, galactoside-binding, soluble, 14 935 119 B20140214_SF053_01 B20140214_SF053_01 TB463937.[MT7]-DISLTR.2y4_1.heavy 424.752 / 476.283 53691.0 26.719999313354492 50 20 10 10 10 7.046890666822737 14.190655812329702 0.0 3 0.9902850947771792 12.510966571842827 53691.0 39.00007910544197 0.0 - - - - - - - 1777.2857142857142 107 7 LGALS14 lectin, galactoside-binding, soluble, 14 937 119 B20140214_SF053_01 B20140214_SF053_01 TB463937.[MT7]-DISLTR.2y5_1.heavy 424.752 / 589.367 98629.0 26.719999313354492 50 20 10 10 10 7.046890666822737 14.190655812329702 0.0 3 0.9902850947771792 12.510966571842827 98629.0 153.0557639035413 0.0 - - - - - - - 868.8888888888889 197 9 LGALS14 lectin, galactoside-binding, soluble, 14 939 119 B20140214_SF053_01 B20140214_SF053_01 TB463937.[MT7]-DISLTR.2b4_1.heavy 424.752 / 573.336 25042.0 26.719999313354492 50 20 10 10 10 7.046890666822737 14.190655812329702 0.0 3 0.9902850947771792 12.510966571842827 25042.0 39.63454470053642 0.0 - - - - - - - 1134.6 50 10 LGALS14 lectin, galactoside-binding, soluble, 14 941 120 B20140214_SF053_01 B20140214_SF053_01 TB107926.[MT7]-RMPGQC[CAM]SVLLFPGQGSQVVGMGR.3y11_1.heavy 869.114 / 1075.53 3999.0 38.04077339172363 46 20 10 6 10 4.12876204154787 18.17100346436031 0.03369903564453125 3 0.9953857495292219 18.16120457092672 3999.0 16.462608209606987 0.0 - - - - - - - 205.76470588235293 7 17 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 943 120 B20140214_SF053_01 B20140214_SF053_01 TB107926.[MT7]-RMPGQC[CAM]SVLLFPGQGSQVVGMGR.3y12_1.heavy 869.114 / 1172.58 17330.0 38.04077339172363 46 20 10 6 10 4.12876204154787 18.17100346436031 0.03369903564453125 3 0.9953857495292219 18.16120457092672 17330.0 101.48198198198197 0.0 - - - - - - - 178.35714285714286 34 14 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 945 120 B20140214_SF053_01 B20140214_SF053_01 TB107926.[MT7]-RMPGQC[CAM]SVLLFPGQGSQVVGMGR.3b8_1.heavy 869.114 / 1060.51 2916.0 38.04077339172363 46 20 10 6 10 4.12876204154787 18.17100346436031 0.03369903564453125 3 0.9953857495292219 18.16120457092672 2916.0 14.07456 0.0 - - - - - - - 196.0 5 17 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 947 120 B20140214_SF053_01 B20140214_SF053_01 TB107926.[MT7]-RMPGQC[CAM]SVLLFPGQGSQVVGMGR.3y9_1.heavy 869.114 / 890.451 5499.0 38.04077339172363 46 20 10 6 10 4.12876204154787 18.17100346436031 0.03369903564453125 3 0.9953857495292219 18.16120457092672 5499.0 26.83182224887556 0.0 - - - - - - - 211.53846153846155 10 13 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 949 121 B20140214_SF053_01 B20140214_SF053_01 TB107925.[MT7]-HFYWTSDSC[CAM]PRPGVVLLTFR.4y15_2.heavy 646.333 / 852.448 5356.0 40.38949966430664 34 8 10 6 10 1.7885095511352043 38.23940337703242 0.0355987548828125 3 0.7575600499564504 2.453961647856749 5356.0 37.681312362590894 0.0 - - - - - - - 649.0 10 7 CCL22 chemokine (C-C motif) ligand 22 951 121 B20140214_SF053_01 B20140214_SF053_01 TB107925.[MT7]-HFYWTSDSC[CAM]PRPGVVLLTFR.4y9_1.heavy 646.333 / 1001.61 1380.0 40.38949966430664 34 8 10 6 10 1.7885095511352043 38.23940337703242 0.0355987548828125 3 0.7575600499564504 2.453961647856749 1380.0 5.52 0.0 - - - - - - - 196.31578947368422 2 19 CCL22 chemokine (C-C motif) ligand 22 953 121 B20140214_SF053_01 B20140214_SF053_01 TB107925.[MT7]-HFYWTSDSC[CAM]PRPGVVLLTFR.4y13_2.heavy 646.333 / 751.419 7954.0 40.38949966430664 34 8 10 6 10 1.7885095511352043 38.23940337703242 0.0355987548828125 3 0.7575600499564504 2.453961647856749 7954.0 14.532436956939542 0.0 - - - - - - - 750.875 15 8 CCL22 chemokine (C-C motif) ligand 22 955 121 B20140214_SF053_01 B20140214_SF053_01 TB107925.[MT7]-HFYWTSDSC[CAM]PRPGVVLLTFR.4b3_1.heavy 646.333 / 592.3 5600.0 40.38949966430664 34 8 10 6 10 1.7885095511352043 38.23940337703242 0.0355987548828125 3 0.7575600499564504 2.453961647856749 5600.0 0.9919137466307277 3.0 - - - - - - - 848.5454545454545 11 11 CCL22 chemokine (C-C motif) ligand 22 957 122 B20140214_SF053_01 B20140214_SF053_01 TB107923.[MT7]-RVLGYDLLELSLHGPQETLDR.4y8_1.heavy 642.853 / 915.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 959 122 B20140214_SF053_01 B20140214_SF053_01 TB107923.[MT7]-RVLGYDLLELSLHGPQETLDR.4b7_1.heavy 642.853 / 961.559 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 961 122 B20140214_SF053_01 B20140214_SF053_01 TB107923.[MT7]-RVLGYDLLELSLHGPQETLDR.4y7_1.heavy 642.853 / 858.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 963 122 B20140214_SF053_01 B20140214_SF053_01 TB107923.[MT7]-RVLGYDLLELSLHGPQETLDR.4b6_1.heavy 642.853 / 848.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 965 123 B20140214_SF053_01 B20140214_SF053_01 TB107867.[MT7]-EAFDLFDVDGSGTIDAK[MT7].2y8_1.heavy 1044.52 / 892.486 6385.0 43.6382999420166 38 15 10 5 8 3.1798359561998515 31.44816316861442 0.043003082275390625 4 0.9508256058356274 5.542387859502734 6385.0 45.195821401533856 0.0 - - - - - - - 186.9 12 10 CETN1 centrin, EF-hand protein, 1 967 123 B20140214_SF053_01 B20140214_SF053_01 TB107867.[MT7]-EAFDLFDVDGSGTIDAK[MT7].2b4_1.heavy 1044.52 / 607.284 12148.0 43.6382999420166 38 15 10 5 8 3.1798359561998515 31.44816316861442 0.043003082275390625 4 0.9508256058356274 5.542387859502734 12148.0 33.044050465883444 0.0 - - - - - - - 282.375 24 8 CETN1 centrin, EF-hand protein, 1 969 123 B20140214_SF053_01 B20140214_SF053_01 TB107867.[MT7]-EAFDLFDVDGSGTIDAK[MT7].2b5_1.heavy 1044.52 / 720.369 5685.0 43.6382999420166 38 15 10 5 8 3.1798359561998515 31.44816316861442 0.043003082275390625 4 0.9508256058356274 5.542387859502734 5685.0 22.760143508177215 1.0 - - - - - - - 187.0 13 10 CETN1 centrin, EF-hand protein, 1 971 123 B20140214_SF053_01 B20140214_SF053_01 TB107867.[MT7]-EAFDLFDVDGSGTIDAK[MT7].2y11_1.heavy 1044.52 / 1221.61 2103.0 43.6382999420166 38 15 10 5 8 3.1798359561998515 31.44816316861442 0.043003082275390625 4 0.9508256058356274 5.542387859502734 2103.0 12.723386420930707 1.0 - - - - - - - 165.5 4 8 CETN1 centrin, EF-hand protein, 1 973 124 B20140214_SF053_01 B20140214_SF053_01 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 728634.0 33.4359016418457 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 728634.0 1159.2352576340568 0.0 - - - - - - - 265.6 1457 5 975 124 B20140214_SF053_01 B20140214_SF053_01 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 740951.0 33.4359016418457 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 740951.0 581.3710909864062 0.0 - - - - - - - 241.5 1481 2 977 124 B20140214_SF053_01 B20140214_SF053_01 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1281450.0 33.4359016418457 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1281450.0 1122.235460139918 0.0 - - - - - - - 739.75 2562 4 979 125 B20140214_SF053_01 B20140214_SF053_01 TB107865.[MT7]-NDLRDTFAALGRVNVK[MT7].4y4_1.heavy 520.049 / 603.395 13097.0 37.22482490539551 40 14 10 6 10 1.6222703982282154 43.334384079096594 0.03530120849609375 3 0.9325344489390818 4.724424354753161 13097.0 7.690669976923975 0.0 - - - - - - - 1753.0 26 8 MYL2 myosin, light chain 2, regulatory, cardiac, slow 981 125 B20140214_SF053_01 B20140214_SF053_01 TB107865.[MT7]-NDLRDTFAALGRVNVK[MT7].4b8_2.heavy 520.049 / 539.276 23236.0 37.22482490539551 40 14 10 6 10 1.6222703982282154 43.334384079096594 0.03530120849609375 3 0.9325344489390818 4.724424354753161 23236.0 11.448507614443052 0.0 - - - - - - - 1436.0 46 1 MYL2 myosin, light chain 2, regulatory, cardiac, slow 983 125 B20140214_SF053_01 B20140214_SF053_01 TB107865.[MT7]-NDLRDTFAALGRVNVK[MT7].4y9_2.heavy 520.049 / 536.341 38530.0 37.22482490539551 40 14 10 6 10 1.6222703982282154 43.334384079096594 0.03530120849609375 3 0.9325344489390818 4.724424354753161 38530.0 35.228011513101706 0.0 - - - - - - - 739.125 77 8 MYL2 myosin, light chain 2, regulatory, cardiac, slow 985 125 B20140214_SF053_01 B20140214_SF053_01 TB107865.[MT7]-NDLRDTFAALGRVNVK[MT7].4y3_1.heavy 520.049 / 504.326 22730.0 37.22482490539551 40 14 10 6 10 1.6222703982282154 43.334384079096594 0.03530120849609375 3 0.9325344489390818 4.724424354753161 22730.0 17.54281121984524 0.0 - - - - - - - 2233.0 45 7 MYL2 myosin, light chain 2, regulatory, cardiac, slow 987 126 B20140214_SF053_01 B20140214_SF053_01 TB107863.[MT7]-NAVPDIQGDSEAVSVRK[MT7].2y8_1.heavy 1037.06 / 1019.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 989 126 B20140214_SF053_01 B20140214_SF053_01 TB107863.[MT7]-NAVPDIQGDSEAVSVRK[MT7].2y6_1.heavy 1037.06 / 803.522 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 991 126 B20140214_SF053_01 B20140214_SF053_01 TB107863.[MT7]-NAVPDIQGDSEAVSVRK[MT7].2y10_1.heavy 1037.06 / 1191.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 993 126 B20140214_SF053_01 B20140214_SF053_01 TB107863.[MT7]-NAVPDIQGDSEAVSVRK[MT7].2b5_1.heavy 1037.06 / 641.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 995 127 B20140214_SF053_01 B20140214_SF053_01 TB464027.[MT7]-FNLMEK[MT7].2y4_1.heavy 535.301 / 664.382 13998.0 33.89179992675781 50 20 10 10 10 7.146113655402755 13.993620144061929 0.0 3 0.9904949997120631 12.648578025272377 13998.0 22.332290793449403 0.0 - - - - - - - 1189.888888888889 27 9 SF3B5 splicing factor 3b, subunit 5, 10kDa 997 127 B20140214_SF053_01 B20140214_SF053_01 TB464027.[MT7]-FNLMEK[MT7].2b3_1.heavy 535.301 / 519.305 19933.0 33.89179992675781 50 20 10 10 10 7.146113655402755 13.993620144061929 0.0 3 0.9904949997120631 12.648578025272377 19933.0 9.927659280408733 0.0 - - - - - - - 1806.0 39 1 SF3B5 splicing factor 3b, subunit 5, 10kDa 999 127 B20140214_SF053_01 B20140214_SF053_01 TB464027.[MT7]-FNLMEK[MT7].2y5_1.heavy 535.301 / 778.425 33093.0 33.89179992675781 50 20 10 10 10 7.146113655402755 13.993620144061929 0.0 3 0.9904949997120631 12.648578025272377 33093.0 77.15779964221825 0.0 - - - - - - - 673.7777777777778 66 9 SF3B5 splicing factor 3b, subunit 5, 10kDa 1001 127 B20140214_SF053_01 B20140214_SF053_01 TB464027.[MT7]-FNLMEK[MT7].2y3_1.heavy 535.301 / 551.298 35544.0 33.89179992675781 50 20 10 10 10 7.146113655402755 13.993620144061929 0.0 3 0.9904949997120631 12.648578025272377 35544.0 42.5362314912268 0.0 - - - - - - - 1644.875 71 8 SF3B5 splicing factor 3b, subunit 5, 10kDa 1003 128 B20140214_SF053_01 B20140214_SF053_01 TB107862.[MT7]-LFENYQTQSEEVRK[MT7].3y6_1.heavy 687.028 / 891.502 7394.0 30.768199920654297 46 16 10 10 10 1.7649053320900692 44.95184441723418 0.0 3 0.9616446030407543 6.281323126884084 7394.0 21.74705882352941 0.0 - - - - - - - 222.76923076923077 14 26 CCDC68 coiled-coil domain containing 68 1005 128 B20140214_SF053_01 B20140214_SF053_01 TB107862.[MT7]-LFENYQTQSEEVRK[MT7].3b4_1.heavy 687.028 / 648.347 14096.0 30.768199920654297 46 16 10 10 10 1.7649053320900692 44.95184441723418 0.0 3 0.9616446030407543 6.281323126884084 14096.0 15.06262298933451 0.0 - - - - - - - 709.2666666666667 28 15 CCDC68 coiled-coil domain containing 68 1007 128 B20140214_SF053_01 B20140214_SF053_01 TB107862.[MT7]-LFENYQTQSEEVRK[MT7].3b3_1.heavy 687.028 / 534.304 10464.0 30.768199920654297 46 16 10 10 10 1.7649053320900692 44.95184441723418 0.0 3 0.9616446030407543 6.281323126884084 10464.0 20.98410406086579 0.0 - - - - - - - 678.6153846153846 20 13 CCDC68 coiled-coil domain containing 68 1009 128 B20140214_SF053_01 B20140214_SF053_01 TB107862.[MT7]-LFENYQTQSEEVRK[MT7].3y8_1.heavy 687.028 / 1120.61 7999.0 30.768199920654297 46 16 10 10 10 1.7649053320900692 44.95184441723418 0.0 3 0.9616446030407543 6.281323126884084 7999.0 45.2147881777791 0.0 - - - - - - - 159.4375 15 16 CCDC68 coiled-coil domain containing 68 1011 129 B20140214_SF053_01 B20140214_SF053_01 TB464028.[MT7]-ITC[CAM]SSSK[MT7].2b3_1.heavy 535.791 / 519.272 1672.0 19.190200805664062 46 18 10 10 8 5.760452899874519 17.359746141172046 0.0 4 0.9898299167098058 12.22732227754449 1672.0 0.6419773556049075 18.0 - - - - - - - 1259.0 5 10 JTB jumping translocation breakpoint 1013 129 B20140214_SF053_01 B20140214_SF053_01 TB464028.[MT7]-ITC[CAM]SSSK[MT7].2y4_1.heavy 535.791 / 552.311 3343.0 19.190200805664062 46 18 10 10 8 5.760452899874519 17.359746141172046 0.0 4 0.9898299167098058 12.22732227754449 3343.0 21.25000346974181 0.0 - - - - - - - 235.82608695652175 6 23 JTB jumping translocation breakpoint 1015 129 B20140214_SF053_01 B20140214_SF053_01 TB464028.[MT7]-ITC[CAM]SSSK[MT7].2y5_1.heavy 535.791 / 712.342 4503.0 19.190200805664062 46 18 10 10 8 5.760452899874519 17.359746141172046 0.0 4 0.9898299167098058 12.22732227754449 4503.0 15.755420254656382 1.0 - - - - - - - 657.5454545454545 15 11 JTB jumping translocation breakpoint 1017 129 B20140214_SF053_01 B20140214_SF053_01 TB464028.[MT7]-ITC[CAM]SSSK[MT7].2y6_1.heavy 535.791 / 813.389 11634.0 19.190200805664062 46 18 10 10 8 5.760452899874519 17.359746141172046 0.0 4 0.9898299167098058 12.22732227754449 11634.0 43.19025490638394 0.0 - - - - - - - 164.125 23 16 JTB jumping translocation breakpoint 1019 130 B20140214_SF053_01 B20140214_SF053_01 TB107860.[MT7]-GYLSGQSLAETMEQIQR.2y4_1.heavy 1028.02 / 544.32 2621.0 41.07229995727539 50 20 10 10 10 7.045947241405107 14.192555886929682 0.0 3 0.9907055634260928 12.791276420669336 2621.0 15.495220125786163 0.0 - - - - - - - 123.875 5 16 C3orf34 chromosome 3 open reading frame 34 1021 130 B20140214_SF053_01 B20140214_SF053_01 TB107860.[MT7]-GYLSGQSLAETMEQIQR.2y8_1.heavy 1028.02 / 1034.49 1747.0 41.07229995727539 50 20 10 10 10 7.045947241405107 14.192555886929682 0.0 3 0.9907055634260928 12.791276420669336 1747.0 12.305911949685536 0.0 - - - - - - - 165.33333333333334 3 12 C3orf34 chromosome 3 open reading frame 34 1023 130 B20140214_SF053_01 B20140214_SF053_01 TB107860.[MT7]-GYLSGQSLAETMEQIQR.2y9_1.heavy 1028.02 / 1105.53 3018.0 41.07229995727539 50 20 10 10 10 7.045947241405107 14.192555886929682 0.0 3 0.9907055634260928 12.791276420669336 3018.0 41.98814271593917 0.0 - - - - - - - 152.85714285714286 6 14 C3orf34 chromosome 3 open reading frame 34 1025 130 B20140214_SF053_01 B20140214_SF053_01 TB107860.[MT7]-GYLSGQSLAETMEQIQR.2y7_1.heavy 1028.02 / 905.451 2938.0 41.07229995727539 50 20 10 10 10 7.045947241405107 14.192555886929682 0.0 3 0.9907055634260928 12.791276420669336 2938.0 6.789495798319328 0.0 - - - - - - - 271.25 5 12 C3orf34 chromosome 3 open reading frame 34 1027 131 B20140214_SF053_01 B20140214_SF053_01 TB246618.[MT7]-GEPLALPLNVSEYC[CAM]VPR.2b3_1.heavy 1029.54 / 428.226 1774.0 41.976975440979004 28 5 10 3 10 0.3859288540847568 115.38297181047979 0.07349777221679688 3 0.6960586820046333 2.1792019015160813 1774.0 22.193522419569508 0.0 - - - - - - - 188.33333333333334 3 15 BEX2 brain expressed X-linked 2 1029 131 B20140214_SF053_01 B20140214_SF053_01 TB246618.[MT7]-GEPLALPLNVSEYC[CAM]VPR.2b4_1.heavy 1029.54 / 541.31 8227.0 41.976975440979004 28 5 10 3 10 0.3859288540847568 115.38297181047979 0.07349777221679688 3 0.6960586820046333 2.1792019015160813 8227.0 32.702772129383604 0.0 - - - - - - - 248.75 16 12 BEX2 brain expressed X-linked 2 1031 131 B20140214_SF053_01 B20140214_SF053_01 TB246618.[MT7]-GEPLALPLNVSEYC[CAM]VPR.2b6_1.heavy 1029.54 / 725.431 26778.0 41.976975440979004 28 5 10 3 10 0.3859288540847568 115.38297181047979 0.07349777221679688 3 0.6960586820046333 2.1792019015160813 26778.0 112.50456266184814 0.0 - - - - - - - 254.46153846153845 53 13 BEX2 brain expressed X-linked 2 1033 131 B20140214_SF053_01 B20140214_SF053_01 TB246618.[MT7]-GEPLALPLNVSEYC[CAM]VPR.2b5_1.heavy 1029.54 / 612.347 25326.0 41.976975440979004 28 5 10 3 10 0.3859288540847568 115.38297181047979 0.07349777221679688 3 0.6960586820046333 2.1792019015160813 25326.0 85.9698842359986 0.0 - - - - - - - 225.8 50 10 BEX2 brain expressed X-linked 2 1035 132 B20140214_SF053_01 B20140214_SF053_01 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 557464.0 28.1205997467041 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 557464.0 567.021762965155 0.0 - - - - - - - 1480.0 1114 1 1037 132 B20140214_SF053_01 B20140214_SF053_01 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 687994.0 28.1205997467041 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 687994.0 508.0371427561914 0.0 - - - - - - - 1804.0 1375 1 1039 132 B20140214_SF053_01 B20140214_SF053_01 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 1013480.0 28.1205997467041 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1013480.0 617.2568372423569 0.0 - - - - - - - 3191.5 2026 2 1041 133 B20140214_SF053_01 B20140214_SF053_01 TB246369.[MT7]-C[CAM]YTERK[MT7].2y4_1.heavy 572.805 / 677.406 638.0 17.904325008392334 39 13 10 6 10 1.573532635660196 51.52424963384503 0.03669929504394531 3 0.9143827849217039 4.187293596820093 638.0 7.9030172556827605 0.0 - - - - - - - 0.0 1 0 CLEC2B C-type lectin domain family 2, member B 1043 133 B20140214_SF053_01 B20140214_SF053_01 TB246369.[MT7]-C[CAM]YTERK[MT7].2y5_1.heavy 572.805 / 840.47 1300.0 17.904325008392334 39 13 10 6 10 1.573532635660196 51.52424963384503 0.03669929504394531 3 0.9143827849217039 4.187293596820093 1300.0 19.87525280382423 0.0 - - - - - - - 88.31818181818181 2 22 CLEC2B C-type lectin domain family 2, member B 1045 133 B20140214_SF053_01 B20140214_SF053_01 TB246369.[MT7]-C[CAM]YTERK[MT7].2b4_1.heavy 572.805 / 698.294 613.0 17.904325008392334 39 13 10 6 10 1.573532635660196 51.52424963384503 0.03669929504394531 3 0.9143827849217039 4.187293596820093 613.0 6.164676304211189 0.0 - - - - - - - 0.0 1 0 CLEC2B C-type lectin domain family 2, member B 1047 133 B20140214_SF053_01 B20140214_SF053_01 TB246369.[MT7]-C[CAM]YTERK[MT7].2y3_1.heavy 572.805 / 576.359 270.0 17.904325008392334 39 13 10 6 10 1.573532635660196 51.52424963384503 0.03669929504394531 3 0.9143827849217039 4.187293596820093 270.0 -0.5 4.0 - - - - - - - 0.0 0 0 CLEC2B C-type lectin domain family 2, member B 1049 134 B20140214_SF053_01 B20140214_SF053_01 TB463987.[MT7]-QNEALVR.2y4_1.heavy 487.281 / 458.309 N/A 22.090199788411457 42 15 10 7 10 1.6970081281949296 46.69640533262058 0.028499603271484375 3 0.9553048288667658 5.8156876734153995 8361.0 5.754153118098643 1.0 - - - - - - - 2658.1428571428573 16 7 ANKRD22 ankyrin repeat domain 22 1051 134 B20140214_SF053_01 B20140214_SF053_01 TB463987.[MT7]-QNEALVR.2b3_1.heavy 487.281 / 516.253 5550.0 22.090199788411457 42 15 10 7 10 1.6970081281949296 46.69640533262058 0.028499603271484375 3 0.9553048288667658 5.8156876734153995 5550.0 4.27739728139849 1.0 - - - - - - - 1230.142857142857 11 7 ANKRD22 ankyrin repeat domain 22 1053 134 B20140214_SF053_01 B20140214_SF053_01 TB463987.[MT7]-QNEALVR.2y6_1.heavy 487.281 / 701.394 15619.0 22.090199788411457 42 15 10 7 10 1.6970081281949296 46.69640533262058 0.028499603271484375 3 0.9553048288667658 5.8156876734153995 15619.0 14.37325494685332 0.0 - - - - - - - 427.0 31 1 ANKRD22 ankyrin repeat domain 22 1055 134 B20140214_SF053_01 B20140214_SF053_01 TB463987.[MT7]-QNEALVR.2b5_1.heavy 487.281 / 700.375 12346.0 22.090199788411457 42 15 10 7 10 1.6970081281949296 46.69640533262058 0.028499603271484375 3 0.9553048288667658 5.8156876734153995 12346.0 19.672261445957627 1.0 - - - - - - - 740.8181818181819 24 11 ANKRD22 ankyrin repeat domain 22 1057 135 B20140214_SF053_01 B20140214_SF053_01 TB464005.[MT7]-K[MT7]DDAK[MT7].2b3_1.heavy 504.806 / 647.36 9100.0 15.364399909973145 50 20 10 10 10 4.150014558567169 24.096301010212827 0.0 3 0.9913978066280357 13.296763775984148 9100.0 90.32089552238806 0.0 - - - - - - - 113.84 18 25 MYL3;NASP;VPS18;SAFB myosin, light chain 3, alkali; ventricular, skeletal, slow;nuclear autoantigenic sperm protein (histone-binding);vacuolar protein sorting 18 homolog (S. cerevisiae);scaffold attachment factor B 1059 135 B20140214_SF053_01 B20140214_SF053_01 TB464005.[MT7]-K[MT7]DDAK[MT7].2y4_1.heavy 504.806 / 592.306 1004.0 15.364399909973145 50 20 10 10 10 4.150014558567169 24.096301010212827 0.0 3 0.9913978066280357 13.296763775984148 1004.0 21.10756192959583 0.0 - - - - - - - 91.15384615384616 2 26 MYL3;NASP;VPS18;SAFB myosin, light chain 3, alkali; ventricular, skeletal, slow;nuclear autoantigenic sperm protein (histone-binding);vacuolar protein sorting 18 homolog (S. cerevisiae);scaffold attachment factor B 1061 135 B20140214_SF053_01 B20140214_SF053_01 TB464005.[MT7]-K[MT7]DDAK[MT7].2b4_1.heavy 504.806 / 718.397 528.0 15.364399909973145 50 20 10 10 10 4.150014558567169 24.096301010212827 0.0 3 0.9913978066280357 13.296763775984148 528.0 2.09827270969702 2.0 - - - - - - - 0.0 1 0 MYL3;NASP;VPS18;SAFB myosin, light chain 3, alkali; ventricular, skeletal, slow;nuclear autoantigenic sperm protein (histone-binding);vacuolar protein sorting 18 homolog (S. cerevisiae);scaffold attachment factor B 1063 135 B20140214_SF053_01 B20140214_SF053_01 TB464005.[MT7]-K[MT7]DDAK[MT7].2y3_1.heavy 504.806 / 477.279 2364.0 15.364399909973145 50 20 10 10 10 4.150014558567169 24.096301010212827 0.0 3 0.9913978066280357 13.296763775984148 2364.0 12.093838310027568 0.0 - - - - - - - 265.0 4 25 MYL3;NASP;VPS18;SAFB myosin, light chain 3, alkali; ventricular, skeletal, slow;nuclear autoantigenic sperm protein (histone-binding);vacuolar protein sorting 18 homolog (S. cerevisiae);scaffold attachment factor B 1065 136 B20140214_SF053_01 B20140214_SF053_01 TB107909.[MT7]-GLTPSQIGVILRDSHGVAQVR.4y8_1.heavy 587.589 / 853.464 4013.0 37.426300048828125 45 15 10 10 10 2.9959318950230482 27.82981974666606 0.0 3 0.9581763535087765 6.013482232999445 4013.0 14.735234375 0.0 - - - - - - - 213.57142857142858 8 14 RPS13 ribosomal protein S13 1067 136 B20140214_SF053_01 B20140214_SF053_01 TB107909.[MT7]-GLTPSQIGVILRDSHGVAQVR.4y6_1.heavy 587.589 / 629.373 13832.0 37.426300048828125 45 15 10 10 10 2.9959318950230482 27.82981974666606 0.0 3 0.9581763535087765 6.013482232999445 13832.0 12.26522556818036 0.0 - - - - - - - 1233.4444444444443 27 9 RPS13 ribosomal protein S13 1069 136 B20140214_SF053_01 B20140214_SF053_01 TB107909.[MT7]-GLTPSQIGVILRDSHGVAQVR.4b6_1.heavy 587.589 / 728.406 15113.0 37.426300048828125 45 15 10 10 10 2.9959318950230482 27.82981974666606 0.0 3 0.9581763535087765 6.013482232999445 15113.0 14.11412724280902 0.0 - - - - - - - 1223.8333333333333 30 12 RPS13 ribosomal protein S13 1071 136 B20140214_SF053_01 B20140214_SF053_01 TB107909.[MT7]-GLTPSQIGVILRDSHGVAQVR.4y14_2.heavy 587.589 / 753.929 48071.0 37.426300048828125 45 15 10 10 10 2.9959318950230482 27.82981974666606 0.0 3 0.9581763535087765 6.013482232999445 48071.0 187.28512161551419 0.0 - - - - - - - 683.0 96 11 RPS13 ribosomal protein S13 1073 137 B20140214_SF053_01 B20140214_SF053_01 TB464109.[MT7]-AVPPFVFTRR.3b5_1.heavy 445.267 / 656.389 11470.0 35.10665035247803 38 14 10 6 8 3.2335920705874512 30.925360347581773 0.038997650146484375 4 0.9457294468135968 5.273467683743792 11470.0 4.658018678241772 0.0 - - - - - - - 276.75 22 4 TUSC2 tumor suppressor candidate 2 1075 137 B20140214_SF053_01 B20140214_SF053_01 TB464109.[MT7]-AVPPFVFTRR.3y7_2.heavy 445.267 / 461.767 12341.0 35.10665035247803 38 14 10 6 8 3.2335920705874512 30.925360347581773 0.038997650146484375 4 0.9457294468135968 5.273467683743792 12341.0 0.7264809765770232 2.0 - - - - - - - 277.0 32 2 TUSC2 tumor suppressor candidate 2 1077 137 B20140214_SF053_01 B20140214_SF053_01 TB464109.[MT7]-AVPPFVFTRR.3y4_1.heavy 445.267 / 579.336 12578.0 35.10665035247803 38 14 10 6 8 3.2335920705874512 30.925360347581773 0.038997650146484375 4 0.9457294468135968 5.273467683743792 12578.0 14.847554343798901 0.0 - - - - - - - 237.33333333333334 25 3 TUSC2 tumor suppressor candidate 2 1079 137 B20140214_SF053_01 B20140214_SF053_01 TB464109.[MT7]-AVPPFVFTRR.3y8_2.heavy 445.267 / 510.293 55928.0 35.10665035247803 38 14 10 6 8 3.2335920705874512 30.925360347581773 0.038997650146484375 4 0.9457294468135968 5.273467683743792 55928.0 49.31853130016051 0.0 - - - - - - - 356.0 111 2 TUSC2 tumor suppressor candidate 2 1081 138 B20140214_SF053_01 B20140214_SF053_01 TB107905.[MT7]-C[CAM]PLEDPGWNAQITLGLVK[MT7].2y4_1.heavy 1150.12 / 560.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHLDA3 pleckstrin homology-like domain, family A, member 3 1083 138 B20140214_SF053_01 B20140214_SF053_01 TB107905.[MT7]-C[CAM]PLEDPGWNAQITLGLVK[MT7].2y6_1.heavy 1150.12 / 774.521 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHLDA3 pleckstrin homology-like domain, family A, member 3 1085 138 B20140214_SF053_01 B20140214_SF053_01 TB107905.[MT7]-C[CAM]PLEDPGWNAQITLGLVK[MT7].2y10_1.heavy 1150.12 / 1200.74 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHLDA3 pleckstrin homology-like domain, family A, member 3 1087 138 B20140214_SF053_01 B20140214_SF053_01 TB107905.[MT7]-C[CAM]PLEDPGWNAQITLGLVK[MT7].2b5_1.heavy 1150.12 / 759.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHLDA3 pleckstrin homology-like domain, family A, member 3 1089 139 B20140214_SF053_01 B20140214_SF053_01 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 693137.0 38.116600036621094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 693137.0 183.06432455358808 0.0 - - - - - - - 343.85714285714283 1386 7 1091 139 B20140214_SF053_01 B20140214_SF053_01 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 1517940.0 38.116600036621094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1517940.0 229.85376333519739 0.0 - - - - - - - 365.2 3035 5 1093 139 B20140214_SF053_01 B20140214_SF053_01 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 1510060.0 38.116600036621094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1510060.0 200.07677866373555 0.0 - - - - - - - 1222.0 3020 7 1095 140 B20140214_SF053_01 B20140214_SF053_01 TB464300.[MT7]-LSASTSNLPC[CAM]WLVEEFVVAEEC[CAM]SPC[CAM]SNFR.3y6_1.heavy 1178.21 / 780.346 2972.0 52.13240051269531 37 12 10 5 10 1.173146142684491 55.89830980604962 0.044403076171875 3 0.8907184901578622 3.6987270424342973 2972.0 14.094386956521738 0.0 - - - - - - - 172.7 5 10 JTB jumping translocation breakpoint 1097 140 B20140214_SF053_01 B20140214_SF053_01 TB464300.[MT7]-LSASTSNLPC[CAM]WLVEEFVVAEEC[CAM]SPC[CAM]SNFR.3b7_1.heavy 1178.21 / 805.417 2109.0 52.13240051269531 37 12 10 5 10 1.173146142684491 55.89830980604962 0.044403076171875 3 0.8907184901578622 3.6987270424342973 2109.0 12.389207779886148 0.0 - - - - - - - 167.9 4 10 JTB jumping translocation breakpoint 1099 140 B20140214_SF053_01 B20140214_SF053_01 TB464300.[MT7]-LSASTSNLPC[CAM]WLVEEFVVAEEC[CAM]SPC[CAM]SNFR.3b13_2.heavy 1178.21 / 787.412 1055.0 52.13240051269531 37 12 10 5 10 1.173146142684491 55.89830980604962 0.044403076171875 3 0.8907184901578622 3.6987270424342973 1055.0 26.375 0.0 - - - - - - - 124.8 2 5 JTB jumping translocation breakpoint 1101 140 B20140214_SF053_01 B20140214_SF053_01 TB464300.[MT7]-LSASTSNLPC[CAM]WLVEEFVVAEEC[CAM]SPC[CAM]SNFR.3b3_1.heavy 1178.21 / 416.263 1103.0 52.13240051269531 37 12 10 5 10 1.173146142684491 55.89830980604962 0.044403076171875 3 0.8907184901578622 3.6987270424342973 1103.0 11.336388888888889 0.0 - - - - - - - 120.0 2 12 JTB jumping translocation breakpoint 1103 141 B20140214_SF053_01 B20140214_SF053_01 TB107906.[MT7]-TYGTSGLDNRPLFGETSAK[MT7].3y11_2.heavy 768.069 / 682.376 22240.0 32.53135108947754 36 10 10 6 10 1.146502230514051 72.0515993265246 0.033298492431640625 3 0.8493700004974856 3.1390485317994123 22240.0 43.51325559153088 0.0 - - - - - - - 765.3076923076923 44 13 C7orf23 chromosome 7 open reading frame 23 1105 141 B20140214_SF053_01 B20140214_SF053_01 TB107906.[MT7]-TYGTSGLDNRPLFGETSAK[MT7].3y4_1.heavy 768.069 / 550.332 3177.0 32.53135108947754 36 10 10 6 10 1.146502230514051 72.0515993265246 0.033298492431640625 3 0.8493700004974856 3.1390485317994123 3177.0 5.998957029449423 0.0 - - - - - - - 654.7142857142857 6 7 C7orf23 chromosome 7 open reading frame 23 1107 141 B20140214_SF053_01 B20140214_SF053_01 TB107906.[MT7]-TYGTSGLDNRPLFGETSAK[MT7].3b8_1.heavy 768.069 / 939.454 6563.0 32.53135108947754 36 10 10 6 10 1.146502230514051 72.0515993265246 0.033298492431640625 3 0.8493700004974856 3.1390485317994123 6563.0 15.958797389635318 0.0 - - - - - - - 222.4090909090909 13 22 C7orf23 chromosome 7 open reading frame 23 1109 141 B20140214_SF053_01 B20140214_SF053_01 TB107906.[MT7]-TYGTSGLDNRPLFGETSAK[MT7].3y9_1.heavy 768.069 / 1093.6 3438.0 32.53135108947754 36 10 10 6 10 1.146502230514051 72.0515993265246 0.033298492431640625 3 0.8493700004974856 3.1390485317994123 3438.0 12.556633846153845 0.0 - - - - - - - 214.05555555555554 6 18 C7orf23 chromosome 7 open reading frame 23 1111 142 B20140214_SF053_01 B20140214_SF053_01 TB246350.[MT7]-IIVPLNNR.2b3_1.heavy 541.844 / 470.346 20663.0 33.51465129852295 44 18 10 6 10 3.391547026200466 29.485069564855635 0.033397674560546875 3 0.9802248368630021 8.761612391785878 20663.0 14.364926672161552 0.0 - - - - - - - 662.0 41 1 IGJ immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides 1113 142 B20140214_SF053_01 B20140214_SF053_01 TB246350.[MT7]-IIVPLNNR.2y5_1.heavy 541.844 / 613.342 45591.0 33.51465129852295 44 18 10 6 10 3.391547026200466 29.485069564855635 0.033397674560546875 3 0.9802248368630021 8.761612391785878 45591.0 22.839030718232042 0.0 - - - - - - - 294.0 91 1 IGJ immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides 1115 142 B20140214_SF053_01 B20140214_SF053_01 TB246350.[MT7]-IIVPLNNR.2y6_1.heavy 541.844 / 712.41 13530.0 33.51465129852295 44 18 10 6 10 3.391547026200466 29.485069564855635 0.033397674560546875 3 0.9802248368630021 8.761612391785878 13530.0 20.17234663245485 0.0 - - - - - - - 1113.4285714285713 27 7 IGJ immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides 1117 142 B20140214_SF053_01 B20140214_SF053_01 TB246350.[MT7]-IIVPLNNR.2y7_1.heavy 541.844 / 825.494 25148.0 33.51465129852295 44 18 10 6 10 3.391547026200466 29.485069564855635 0.033397674560546875 3 0.9802248368630021 8.761612391785878 25148.0 18.782724603591447 0.0 - - - - - - - 269.6666666666667 50 3 IGJ immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides 1119 143 B20140214_SF053_01 B20140214_SF053_01 TB107908.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.4y5_1.heavy 577.321 / 569.341 104364.0 37.215999603271484 38 8 10 10 10 0.6130785633045092 93.73014309093261 0.0 3 0.7712238477754533 2.529335029707403 104364.0 78.78673094576402 0.0 - - - - - - - 937.0 208 2 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 1121 143 B20140214_SF053_01 B20140214_SF053_01 TB107908.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.4y8_1.heavy 577.321 / 1052.63 20276.0 37.215999603271484 38 8 10 10 10 0.6130785633045092 93.73014309093261 0.0 3 0.7712238477754533 2.529335029707403 20276.0 81.53518488072889 0.0 - - - - - - - 247.2 40 10 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 1123 143 B20140214_SF053_01 B20140214_SF053_01 TB107908.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.4y8_2.heavy 577.321 / 526.82 261038.0 37.215999603271484 38 8 10 10 10 0.6130785633045092 93.73014309093261 0.0 3 0.7712238477754533 2.529335029707403 261038.0 121.13434138415245 0.0 - - - - - - - 766.5 522 2 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 1125 143 B20140214_SF053_01 B20140214_SF053_01 TB107908.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.4b4_1.heavy 577.321 / 599.388 165193.0 37.215999603271484 38 8 10 10 10 0.6130785633045092 93.73014309093261 0.0 3 0.7712238477754533 2.529335029707403 165193.0 200.75422333217034 0.0 - - - - - - - 937.0 330 1 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 1127 144 B20140214_SF053_01 B20140214_SF053_01 TB107901.[MT7]-DTGTYEDFVEGLRVFDK[MT7].3y3_1.heavy 760.386 / 553.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 1129 144 B20140214_SF053_01 B20140214_SF053_01 TB107901.[MT7]-DTGTYEDFVEGLRVFDK[MT7].3b4_1.heavy 760.386 / 519.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 1131 144 B20140214_SF053_01 B20140214_SF053_01 TB107901.[MT7]-DTGTYEDFVEGLRVFDK[MT7].3y4_1.heavy 760.386 / 652.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 1133 144 B20140214_SF053_01 B20140214_SF053_01 TB107901.[MT7]-DTGTYEDFVEGLRVFDK[MT7].3y8_1.heavy 760.386 / 1107.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 1135 145 B20140214_SF053_01 B20140214_SF053_01 TB107902.[MT7]-IQRADGDC[CAM]DLAAVILHVK[MT7].4b11_2.heavy 571.319 / 680.326 41588.0 38.94540023803711 40 10 10 10 10 0.8855466664044382 70.53115786167153 0.0 3 0.8396284307967548 3.039597161205313 41588.0 41.583758187733956 0.0 - - - - - - - 861.8888888888889 83 9 CCL28 chemokine (C-C motif) ligand 28 1137 145 B20140214_SF053_01 B20140214_SF053_01 TB107902.[MT7]-IQRADGDC[CAM]DLAAVILHVK[MT7].4b9_1.heavy 571.319 / 1175.52 N/A 38.94540023803711 40 10 10 10 10 0.8855466664044382 70.53115786167153 0.0 3 0.8396284307967548 3.039597161205313 578.0 9.693686746987952 0.0 - - - - - - - 0.0 1 0 CCL28 chemokine (C-C motif) ligand 28 1139 145 B20140214_SF053_01 B20140214_SF053_01 TB107902.[MT7]-IQRADGDC[CAM]DLAAVILHVK[MT7].4b9_2.heavy 571.319 / 588.265 31108.0 38.94540023803711 40 10 10 10 10 0.8855466664044382 70.53115786167153 0.0 3 0.8396284307967548 3.039597161205313 31108.0 34.28618852459016 0.0 - - - - - - - 1382.125 62 8 CCL28 chemokine (C-C motif) ligand 28 1141 145 B20140214_SF053_01 B20140214_SF053_01 TB107902.[MT7]-IQRADGDC[CAM]DLAAVILHVK[MT7].4b10_2.heavy 571.319 / 644.807 26817.0 38.94540023803711 40 10 10 10 10 0.8855466664044382 70.53115786167153 0.0 3 0.8396284307967548 3.039597161205313 26817.0 30.30109295375633 0.0 - - - - - - - 1662.142857142857 53 7 CCL28 chemokine (C-C motif) ligand 28 1143 146 B20140214_SF053_01 B20140214_SF053_01 TB246622.[MT7]-EAFDLFDVDGSGTIDAK[MT7].3y6_1.heavy 696.684 / 748.432 54009.0 43.6598014831543 46 16 10 10 10 3.695125661370473 27.0626790978771 0.0 3 0.9603998672705523 6.181165222410665 54009.0 88.13953302674048 0.0 - - - - - - - 487.0 108 1 CETN1 centrin, EF-hand protein, 1 1145 146 B20140214_SF053_01 B20140214_SF053_01 TB246622.[MT7]-EAFDLFDVDGSGTIDAK[MT7].3b4_1.heavy 696.684 / 607.284 162028.0 43.6598014831543 46 16 10 10 10 3.695125661370473 27.0626790978771 0.0 3 0.9603998672705523 6.181165222410665 162028.0 71.00767349857158 0.0 - - - - - - - 730.0 324 3 CETN1 centrin, EF-hand protein, 1 1147 146 B20140214_SF053_01 B20140214_SF053_01 TB246622.[MT7]-EAFDLFDVDGSGTIDAK[MT7].3b5_1.heavy 696.684 / 720.369 120183.0 43.6598014831543 46 16 10 10 10 3.695125661370473 27.0626790978771 0.0 3 0.9603998672705523 6.181165222410665 120183.0 118.38504719914171 1.0 - - - - - - - 405.0 250 1 CETN1 centrin, EF-hand protein, 1 1149 146 B20140214_SF053_01 B20140214_SF053_01 TB246622.[MT7]-EAFDLFDVDGSGTIDAK[MT7].3b7_1.heavy 696.684 / 982.464 93665.0 43.6598014831543 46 16 10 10 10 3.695125661370473 27.0626790978771 0.0 3 0.9603998672705523 6.181165222410665 93665.0 178.35633515193487 0.0 - - - - - - - 324.5 187 2 CETN1 centrin, EF-hand protein, 1 1151 147 B20140214_SF053_01 B20140214_SF053_01 TB107903.[MT7]-EAPGPINFTVFLTMFGEK[MT7].3y6_1.heavy 762.741 / 856.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 1153 147 B20140214_SF053_01 B20140214_SF053_01 TB107903.[MT7]-EAPGPINFTVFLTMFGEK[MT7].3b6_1.heavy 762.741 / 709.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 1155 147 B20140214_SF053_01 B20140214_SF053_01 TB107903.[MT7]-EAPGPINFTVFLTMFGEK[MT7].3y5_1.heavy 762.741 / 755.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 1157 147 B20140214_SF053_01 B20140214_SF053_01 TB107903.[MT7]-EAPGPINFTVFLTMFGEK[MT7].3b7_1.heavy 762.741 / 823.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 1159 148 B20140214_SF053_01 B20140214_SF053_01 TB246624.[MT7]-RFIWEYDPTLESTYR.3b5_1.heavy 707.357 / 876.485 31189.0 40.33610153198242 45 15 10 10 10 2.2765089872270865 34.873571432961974 0.0 3 0.9520492855996028 5.613244686633008 31189.0 155.30325102880659 0.0 - - - - - - - 295.4117647058824 62 17 RERG RAS-like, estrogen-regulated, growth inhibitor 1161 148 B20140214_SF053_01 B20140214_SF053_01 TB246624.[MT7]-RFIWEYDPTLESTYR.3y8_1.heavy 707.357 / 966.489 66834.0 40.33610153198242 45 15 10 10 10 2.2765089872270865 34.873571432961974 0.0 3 0.9520492855996028 5.613244686633008 66834.0 261.4718174603174 0.0 - - - - - - - 270.0 133 12 RERG RAS-like, estrogen-regulated, growth inhibitor 1163 148 B20140214_SF053_01 B20140214_SF053_01 TB246624.[MT7]-RFIWEYDPTLESTYR.3y5_1.heavy 707.357 / 655.305 55087.0 40.33610153198242 45 15 10 10 10 2.2765089872270865 34.873571432961974 0.0 3 0.9520492855996028 5.613244686633008 55087.0 65.45831790123457 0.0 - - - - - - - 718.875 110 8 RERG RAS-like, estrogen-regulated, growth inhibitor 1165 148 B20140214_SF053_01 B20140214_SF053_01 TB246624.[MT7]-RFIWEYDPTLESTYR.3b7_1.heavy 707.357 / 1154.58 26247.0 40.33610153198242 45 15 10 10 10 2.2765089872270865 34.873571432961974 0.0 3 0.9520492855996028 5.613244686633008 26247.0 74.99142857142857 0.0 - - - - - - - 182.25 52 12 RERG RAS-like, estrogen-regulated, growth inhibitor 1167 149 B20140214_SF053_01 B20140214_SF053_01 TB464102.[MT7]-SAPPSPPPPGTR.2y9_1.heavy 652.858 / 905.484 4592.0 20.406200408935547 41 15 10 6 10 1.911422389723233 35.30062265460094 0.03839874267578125 3 0.9529342621936385 5.666197091651515 4592.0 5.969573650083204 0.0 - - - - - - - 711.375 9 8 GPSM3 G-protein signaling modulator 3 1169 149 B20140214_SF053_01 B20140214_SF053_01 TB464102.[MT7]-SAPPSPPPPGTR.2y6_1.heavy 652.858 / 624.346 1452.0 20.406200408935547 41 15 10 6 10 1.911422389723233 35.30062265460094 0.03839874267578125 3 0.9529342621936385 5.666197091651515 1452.0 1.9954141861108279 4.0 - - - - - - - 680.1111111111111 3 9 GPSM3 G-protein signaling modulator 3 1171 149 B20140214_SF053_01 B20140214_SF053_01 TB464102.[MT7]-SAPPSPPPPGTR.2y10_1.heavy 652.858 / 1002.54 5691.0 20.406200408935547 41 15 10 6 10 1.911422389723233 35.30062265460094 0.03839874267578125 3 0.9529342621936385 5.666197091651515 5691.0 0.6041401273885351 0.0 - - - - - - - 717.7142857142857 11 7 GPSM3 G-protein signaling modulator 3 1173 149 B20140214_SF053_01 B20140214_SF053_01 TB464102.[MT7]-SAPPSPPPPGTR.2y7_1.heavy 652.858 / 721.399 6005.0 20.406200408935547 41 15 10 6 10 1.911422389723233 35.30062265460094 0.03839874267578125 3 0.9529342621936385 5.666197091651515 6005.0 4.805257195678583 0.0 - - - - - - - 790.4285714285714 12 7 GPSM3 G-protein signaling modulator 3 1175 150 B20140214_SF053_01 B20140214_SF053_01 TB246620.[MT7]-NDLRDTFAALGRVNVK[MT7].3y7_1.heavy 693.063 / 929.601 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2 myosin, light chain 2, regulatory, cardiac, slow 1177 150 B20140214_SF053_01 B20140214_SF053_01 TB246620.[MT7]-NDLRDTFAALGRVNVK[MT7].3b9_1.heavy 693.063 / 1148.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2 myosin, light chain 2, regulatory, cardiac, slow 1179 150 B20140214_SF053_01 B20140214_SF053_01 TB246620.[MT7]-NDLRDTFAALGRVNVK[MT7].3y3_1.heavy 693.063 / 504.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2 myosin, light chain 2, regulatory, cardiac, slow 1181 150 B20140214_SF053_01 B20140214_SF053_01 TB246620.[MT7]-NDLRDTFAALGRVNVK[MT7].3y4_1.heavy 693.063 / 603.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2 myosin, light chain 2, regulatory, cardiac, slow 1183 151 B20140214_SF053_01 B20140214_SF053_01 TB246491.[MT7]-RK[MT7]IPYILK[MT7].3b6_2.heavy 488.333 / 530.349 6153.0 28.836000442504883 32 14 2 10 6 1.447828688137315 45.69058513971389 0.0 6 0.9483712512558152 5.407918291894303 6153.0 6.174461712061763 1.0 - - - - - - - 1623.0 28 8 NTS neurotensin 1185 151 B20140214_SF053_01 B20140214_SF053_01 TB246491.[MT7]-RK[MT7]IPYILK[MT7].3y3_1.heavy 488.333 / 517.383 9455.0 28.836000442504883 32 14 2 10 6 1.447828688137315 45.69058513971389 0.0 6 0.9483712512558152 5.407918291894303 9455.0 4.482909279484637 2.0 - - - - - - - 339.0 52 2 NTS neurotensin 1187 151 B20140214_SF053_01 B20140214_SF053_01 TB246491.[MT7]-RK[MT7]IPYILK[MT7].3y4_1.heavy 488.333 / 680.446 2986.0 28.836000442504883 32 14 2 10 6 1.447828688137315 45.69058513971389 0.0 6 0.9483712512558152 5.407918291894303 2986.0 6.246814907021093 1.0 - - - - - - - 703.1818181818181 5 11 NTS neurotensin 1189 151 B20140214_SF053_01 B20140214_SF053_01 TB246491.[MT7]-RK[MT7]IPYILK[MT7].3y5_1.heavy 488.333 / 777.499 5203.0 28.836000442504883 32 14 2 10 6 1.447828688137315 45.69058513971389 0.0 6 0.9483712512558152 5.407918291894303 5203.0 16.692834635583452 0.0 - - - - - - - 285.6818181818182 10 22 NTS neurotensin 1191 152 B20140214_SF053_01 B20140214_SF053_01 TB464204.[MT7]-RAVSEHQLLHDK[MT7].3b6_1.heavy 574.328 / 824.45 1735.0 21.476099967956543 36 11 10 7 8 0.8819482035452207 57.48962807616786 0.029001235961914062 4 0.8725180400566199 3.4191054332470534 1735.0 4.508460022522522 1.0 - - - - - - - 112.75 3 20 PTHLH parathyroid hormone-like hormone 1193 152 B20140214_SF053_01 B20140214_SF053_01 TB464204.[MT7]-RAVSEHQLLHDK[MT7].3y3_1.heavy 574.328 / 543.301 7347.0 21.476099967956543 36 11 10 7 8 0.8819482035452207 57.48962807616786 0.029001235961914062 4 0.8725180400566199 3.4191054332470534 7347.0 15.444642095899002 0.0 - - - - - - - 761.3076923076923 14 13 PTHLH parathyroid hormone-like hormone 1195 152 B20140214_SF053_01 B20140214_SF053_01 TB464204.[MT7]-RAVSEHQLLHDK[MT7].3b5_1.heavy 574.328 / 687.391 3064.0 21.476099967956543 36 11 10 7 8 0.8819482035452207 57.48962807616786 0.029001235961914062 4 0.8725180400566199 3.4191054332470534 3064.0 12.835675675675674 2.0 - - - - - - - 209.29166666666666 9 24 PTHLH parathyroid hormone-like hormone 1197 152 B20140214_SF053_01 B20140214_SF053_01 TB464204.[MT7]-RAVSEHQLLHDK[MT7].3y4_1.heavy 574.328 / 656.385 3839.0 21.476099967956543 36 11 10 7 8 0.8819482035452207 57.48962807616786 0.029001235961914062 4 0.8725180400566199 3.4191054332470534 3839.0 19.818562774597257 0.0 - - - - - - - 729.25 7 8 PTHLH parathyroid hormone-like hormone 1199 153 B20140214_SF053_01 B20140214_SF053_01 TB246499.[MT7]-TTVYVVEDQRR.3b4_1.heavy 503.943 / 609.336 91910.0 25.606550693511963 44 18 10 6 10 4.2015605050438785 23.80068069469719 0.031000137329101562 3 0.9878417214929349 11.181120273708634 91910.0 153.5303092127656 0.0 - - - - - - - 697.125 183 8 C5orf32 chromosome 5 open reading frame 32 1201 153 B20140214_SF053_01 B20140214_SF053_01 TB246499.[MT7]-TTVYVVEDQRR.3b5_1.heavy 503.943 / 708.405 53274.0 25.606550693511963 44 18 10 6 10 4.2015605050438785 23.80068069469719 0.031000137329101562 3 0.9878417214929349 11.181120273708634 53274.0 147.27947837150128 0.0 - - - - - - - 730.0833333333334 106 12 C5orf32 chromosome 5 open reading frame 32 1203 153 B20140214_SF053_01 B20140214_SF053_01 TB246499.[MT7]-TTVYVVEDQRR.3b3_1.heavy 503.943 / 446.273 68249.0 25.606550693511963 44 18 10 6 10 4.2015605050438785 23.80068069469719 0.031000137329101562 3 0.9878417214929349 11.181120273708634 68249.0 37.46319608563085 0.0 - - - - - - - 1321.0 136 7 C5orf32 chromosome 5 open reading frame 32 1205 153 B20140214_SF053_01 B20140214_SF053_01 TB246499.[MT7]-TTVYVVEDQRR.3y8_2.heavy 503.943 / 532.778 23811.0 25.606550693511963 44 18 10 6 10 4.2015605050438785 23.80068069469719 0.031000137329101562 3 0.9878417214929349 11.181120273708634 23811.0 18.978630398490235 0.0 - - - - - - - 790.3333333333334 47 9 C5orf32 chromosome 5 open reading frame 32 1207 154 B20140214_SF053_01 B20140214_SF053_01 TB463996.[MT7]-IVSFLLR.2y5_1.heavy 496.325 / 635.388 71673.0 44.47570037841797 46 16 10 10 10 3.385848870536972 29.534690951560602 0.0 3 0.9697872222219355 7.0821887512544235 71673.0 195.9181617598066 0.0 - - - - - - - 333.0 143 9 ANKRD22 ankyrin repeat domain 22 1209 154 B20140214_SF053_01 B20140214_SF053_01 TB463996.[MT7]-IVSFLLR.2b4_1.heavy 496.325 / 591.362 20269.0 44.47570037841797 46 16 10 10 10 3.385848870536972 29.534690951560602 0.0 3 0.9697872222219355 7.0821887512544235 20269.0 39.994328337778455 0.0 - - - - - - - 764.7142857142857 40 7 ANKRD22 ankyrin repeat domain 22 1211 154 B20140214_SF053_01 B20140214_SF053_01 TB463996.[MT7]-IVSFLLR.2y6_1.heavy 496.325 / 734.456 112860.0 44.47570037841797 46 16 10 10 10 3.385848870536972 29.534690951560602 0.0 3 0.9697872222219355 7.0821887512544235 112860.0 254.7465452139267 0.0 - - - - - - - 243.0 225 9 ANKRD22 ankyrin repeat domain 22 1213 154 B20140214_SF053_01 B20140214_SF053_01 TB463996.[MT7]-IVSFLLR.2b5_1.heavy 496.325 / 704.446 34945.0 44.47570037841797 46 16 10 10 10 3.385848870536972 29.534690951560602 0.0 3 0.9697872222219355 7.0821887512544235 34945.0 112.92369462719297 0.0 - - - - - - - 236.76923076923077 69 13 ANKRD22 ankyrin repeat domain 22 1215 155 B20140214_SF053_01 B20140214_SF053_01 TB463997.[MT7]-IEASLC[CAM]R.2y4_1.heavy 496.769 / 535.266 45529.0 27.634899139404297 50 20 10 10 10 7.331632304696064 13.639527440014675 0.0 3 0.9907112065648944 12.795167354081585 45529.0 25.618737809596457 1.0 - - - - - - - 361.0 91 1 GNG3 guanine nucleotide binding protein (G protein), gamma 3 1217 155 B20140214_SF053_01 B20140214_SF053_01 TB463997.[MT7]-IEASLC[CAM]R.2y5_1.heavy 496.769 / 606.303 101039.0 27.634899139404297 50 20 10 10 10 7.331632304696064 13.639527440014675 0.0 3 0.9907112065648944 12.795167354081585 101039.0 79.40705393283736 0.0 - - - - - - - 779.5 202 4 GNG3 guanine nucleotide binding protein (G protein), gamma 3 1219 155 B20140214_SF053_01 B20140214_SF053_01 TB463997.[MT7]-IEASLC[CAM]R.2b4_1.heavy 496.769 / 545.305 40109.0 27.634899139404297 50 20 10 10 10 7.331632304696064 13.639527440014675 0.0 3 0.9907112065648944 12.795167354081585 40109.0 33.22891759777944 0.0 - - - - - - - 1239.0 80 7 GNG3 guanine nucleotide binding protein (G protein), gamma 3 1221 155 B20140214_SF053_01 B20140214_SF053_01 TB463997.[MT7]-IEASLC[CAM]R.2y6_1.heavy 496.769 / 735.345 265087.0 27.634899139404297 50 20 10 10 10 7.331632304696064 13.639527440014675 0.0 3 0.9907112065648944 12.795167354081585 265087.0 134.32298768331816 0.0 - - - - - - - 835.5 530 2 GNG3 guanine nucleotide binding protein (G protein), gamma 3 1223 156 B20140214_SF053_01 B20140214_SF053_01 TB463998.[MT7]-DIPIVHR.2y4_1.heavy 497.302 / 524.33 2695.0 26.496599197387695 50 20 10 10 10 5.7229646978253585 17.473460921049977 0.0 3 0.9901695581357219 12.437108745985626 2695.0 2.9353605011591255 2.0 - - - - - - - 707.3529411764706 5 17 SEC11C SEC11 homolog C (S. cerevisiae) 1225 156 B20140214_SF053_01 B20140214_SF053_01 TB463998.[MT7]-DIPIVHR.2y5_1.heavy 497.302 / 621.383 31088.0 26.496599197387695 50 20 10 10 10 5.7229646978253585 17.473460921049977 0.0 3 0.9901695581357219 12.437108745985626 31088.0 35.406047635549065 0.0 - - - - - - - 1262.0 62 8 SEC11C SEC11 homolog C (S. cerevisiae) 1227 156 B20140214_SF053_01 B20140214_SF053_01 TB463998.[MT7]-DIPIVHR.2b4_1.heavy 497.302 / 583.357 3177.0 26.496599197387695 50 20 10 10 10 5.7229646978253585 17.473460921049977 0.0 3 0.9901695581357219 12.437108745985626 3177.0 4.717150061428514 0.0 - - - - - - - 723.875 6 16 SEC11C SEC11 homolog C (S. cerevisiae) 1229 156 B20140214_SF053_01 B20140214_SF053_01 TB463998.[MT7]-DIPIVHR.2y6_1.heavy 497.302 / 734.467 9572.0 26.496599197387695 50 20 10 10 10 5.7229646978253585 17.473460921049977 0.0 3 0.9901695581357219 12.437108745985626 9572.0 8.676855464977011 0.0 - - - - - - - 750.6666666666666 19 12 SEC11C SEC11 homolog C (S. cerevisiae) 1231 157 B20140214_SF053_01 B20140214_SF053_01 TB463999.[MT7]-DTFAALGR.2b4_1.heavy 497.776 / 579.289 15774.0 32.34170150756836 48 18 10 10 10 2.565693699250155 30.62900416427546 0.0 3 0.9843344178469788 9.847375728609384 15774.0 8.215388665056587 0.0 - - - - - - - 1733.909090909091 31 11 MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 1233 157 B20140214_SF053_01 B20140214_SF053_01 TB463999.[MT7]-DTFAALGR.2y6_1.heavy 497.776 / 634.367 15200.0 32.34170150756836 48 18 10 10 10 2.565693699250155 30.62900416427546 0.0 3 0.9843344178469788 9.847375728609384 15200.0 10.576954269473283 2.0 - - - - - - - 1190.4 45 10 MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 1235 157 B20140214_SF053_01 B20140214_SF053_01 TB463999.[MT7]-DTFAALGR.2b5_1.heavy 497.776 / 650.327 16682.0 32.34170150756836 48 18 10 10 10 2.565693699250155 30.62900416427546 0.0 3 0.9843344178469788 9.847375728609384 16682.0 17.75346247894365 0.0 - - - - - - - 1159.125 33 8 MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 1237 157 B20140214_SF053_01 B20140214_SF053_01 TB463999.[MT7]-DTFAALGR.2y7_1.heavy 497.776 / 735.415 35515.0 32.34170150756836 48 18 10 10 10 2.565693699250155 30.62900416427546 0.0 3 0.9843344178469788 9.847375728609384 35515.0 29.352175308253678 0.0 - - - - - - - 764.8888888888889 71 9 MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 1239 158 B20140214_SF053_01 B20140214_SF053_01 TB246346.[MT7]-FSFVC[CAM]K[MT7].2b3_1.heavy 538.296 / 526.278 N/A 34.000466664632164 33 16 2 5 10 4.026593111781593 24.834890743592993 0.040897369384765625 3 0.9681271991887452 6.894327981327209 9339.0 0.8871237321891314 2.0 - - - - - - - 1287.0 103 2 REG1A;REG1B regenerating islet-derived 1 alpha;regenerating islet-derived 1 beta 1241 158 B20140214_SF053_01 B20140214_SF053_01 TB246346.[MT7]-FSFVC[CAM]K[MT7].2y4_1.heavy 538.296 / 697.382 7059.0 34.000466664632164 33 16 2 5 10 4.026593111781593 24.834890743592993 0.040897369384765625 3 0.9681271991887452 6.894327981327209 7059.0 9.438234100626415 1.0 - - - - - - - 790.375 14 8 REG1A;REG1B regenerating islet-derived 1 alpha;regenerating islet-derived 1 beta 1243 158 B20140214_SF053_01 B20140214_SF053_01 TB246346.[MT7]-FSFVC[CAM]K[MT7].2y5_1.heavy 538.296 / 784.414 21251.0 34.000466664632164 33 16 2 5 10 4.026593111781593 24.834890743592993 0.040897369384765625 3 0.9681271991887452 6.894327981327209 21251.0 49.56413154634745 0.0 - - - - - - - 682.8571428571429 42 14 REG1A;REG1B regenerating islet-derived 1 alpha;regenerating islet-derived 1 beta 1245 158 B20140214_SF053_01 B20140214_SF053_01 TB246346.[MT7]-FSFVC[CAM]K[MT7].2y3_1.heavy 538.296 / 550.314 9927.0 34.000466664632164 33 16 2 5 10 4.026593111781593 24.834890743592993 0.040897369384765625 3 0.9681271991887452 6.894327981327209 9927.0 11.583441750443523 0.0 - - - - - - - 1294.3 19 10 REG1A;REG1B regenerating islet-derived 1 alpha;regenerating islet-derived 1 beta 1247 159 B20140214_SF053_01 B20140214_SF053_01 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 252706.0 40.709800720214844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 252706.0 318.3859945364088 0.0 - - - - - - - 666.1428571428571 505 7 1249 159 B20140214_SF053_01 B20140214_SF053_01 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 499140.0 40.709800720214844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 499140.0 242.9686776013923 0.0 - - - - - - - 322.0 998 1 1251 159 B20140214_SF053_01 B20140214_SF053_01 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 605154.0 40.709800720214844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 605154.0 262.70528990228013 0.0 - - - - - - - 804.0 1210 6 1253 160 B20140214_SF053_01 B20140214_SF053_01 TB246348.[MT7]-RPYILK[MT7].3y3_1.heavy 359.906 / 517.383 51896.0 26.907899856567383 45 15 10 10 10 2.9218019404627738 34.22545471516846 0.0 3 0.9582610510994098 6.01962363541116 51896.0 76.13218372311526 0.0 - - - - - - - 1711.2222222222222 103 9 NTS neurotensin 1255 160 B20140214_SF053_01 B20140214_SF053_01 TB246348.[MT7]-RPYILK[MT7].3b4_1.heavy 359.906 / 674.411 32565.0 26.907899856567383 45 15 10 10 10 2.9218019404627738 34.22545471516846 0.0 3 0.9582610510994098 6.01962363541116 32565.0 302.89932890855454 0.0 - - - - - - - 259.05263157894734 65 19 NTS neurotensin 1257 160 B20140214_SF053_01 B20140214_SF053_01 TB246348.[MT7]-RPYILK[MT7].3y4_1.heavy 359.906 / 680.446 12105.0 26.907899856567383 45 15 10 10 10 2.9218019404627738 34.22545471516846 0.0 3 0.9582610510994098 6.01962363541116 12105.0 83.52896678966789 0.0 - - - - - - - 140.64705882352942 24 17 NTS neurotensin 1259 160 B20140214_SF053_01 B20140214_SF053_01 TB246348.[MT7]-RPYILK[MT7].3b3_1.heavy 359.906 / 561.326 60568.0 26.907899856567383 45 15 10 10 10 2.9218019404627738 34.22545471516846 0.0 3 0.9582610510994098 6.01962363541116 60568.0 98.20902256458731 0.0 - - - - - - - 391.3333333333333 121 6 NTS neurotensin 1261 161 B20140214_SF053_01 B20140214_SF053_01 TB463969.[MT7]-ELYAAAR.2b3_1.heavy 469.265 / 550.299 21908.0 25.47209930419922 50 20 10 10 10 10.48004930679981 9.541939839454441 0.0 3 0.9958722855363747 19.202512037780874 21908.0 18.076335971922095 0.0 - - - - - - - 1253.0 43 7 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 1263 161 B20140214_SF053_01 B20140214_SF053_01 TB463969.[MT7]-ELYAAAR.2y5_1.heavy 469.265 / 551.294 43604.0 25.47209930419922 50 20 10 10 10 10.48004930679981 9.541939839454441 0.0 3 0.9958722855363747 19.202512037780874 43604.0 55.37024442921265 1.0 - - - - - - - 402.3333333333333 87 3 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 1265 161 B20140214_SF053_01 B20140214_SF053_01 TB463969.[MT7]-ELYAAAR.2b4_1.heavy 469.265 / 621.336 26134.0 25.47209930419922 50 20 10 10 10 10.48004930679981 9.541939839454441 0.0 3 0.9958722855363747 19.202512037780874 26134.0 45.887868544600934 0.0 - - - - - - - 1116.0 52 7 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 1267 161 B20140214_SF053_01 B20140214_SF053_01 TB463969.[MT7]-ELYAAAR.2y6_1.heavy 469.265 / 664.378 79325.0 25.47209930419922 50 20 10 10 10 10.48004930679981 9.541939839454441 0.0 3 0.9958722855363747 19.202512037780874 79325.0 111.5099731255919 0.0 - - - - - - - 776.875 158 8 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 1269 162 B20140214_SF053_01 B20140214_SF053_01 TB463966.[MT7]-ALGFEPR.2y5_1.heavy 467.267 / 605.304 N/A 30.473100662231445 43 13 10 10 10 1.7253663604817342 47.10793229725063 0.0 3 0.9245087084539828 4.463167660510509 747349.0 308.4395377631036 1.0 - - - - - - - 2277.0 1677 8 CETN1 centrin, EF-hand protein, 1 1271 162 B20140214_SF053_01 B20140214_SF053_01 TB463966.[MT7]-ALGFEPR.2b4_1.heavy 467.267 / 533.32 104108.0 30.473100662231445 43 13 10 10 10 1.7253663604817342 47.10793229725063 0.0 3 0.9245087084539828 4.463167660510509 104108.0 79.23206642214419 0.0 - - - - - - - 822.0 208 1 CETN1 centrin, EF-hand protein, 1 1273 162 B20140214_SF053_01 B20140214_SF053_01 TB463966.[MT7]-ALGFEPR.2y6_1.heavy 467.267 / 718.388 206053.0 30.473100662231445 43 13 10 10 10 1.7253663604817342 47.10793229725063 0.0 3 0.9245087084539828 4.463167660510509 206053.0 401.9678966112374 0.0 - - - - - - - 746.375 412 8 CETN1 centrin, EF-hand protein, 1 1275 162 B20140214_SF053_01 B20140214_SF053_01 TB463966.[MT7]-ALGFEPR.2b5_1.heavy 467.267 / 662.363 292118.0 30.473100662231445 43 13 10 10 10 1.7253663604817342 47.10793229725063 0.0 3 0.9245087084539828 4.463167660510509 292118.0 550.3321077623694 0.0 - - - - - - - 797.4285714285714 584 7 CETN1 centrin, EF-hand protein, 1 1277 163 B20140214_SF053_01 B20140214_SF053_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 1912230.0 35.899898529052734 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 1912230.0 534.185782003357 0.0 - - - - - - - 1362.888888888889 3824 9 1279 163 B20140214_SF053_01 B20140214_SF053_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 317242.0 35.899898529052734 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 317242.0 227.7528151357759 1.0 - - - - - - - 1254.857142857143 1033 7 1281 163 B20140214_SF053_01 B20140214_SF053_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 232461.0 35.899898529052734 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 232461.0 114.00205343986059 0.0 - - - - - - - 2403.125 464 8 1283 164 B20140214_SF053_01 B20140214_SF053_01 TB246248.[MT7]-IAGEASR.2y5_1.heavy 424.241 / 519.252 31468.0 19.332499980926514 46 20 10 6 10 9.823450955185269 10.17972201990945 0.03439903259277344 3 0.9972398826811233 23.485437567009765 31468.0 30.16413110698825 0.0 - - - - - - - 745.0 62 14 HIST1H2BD;HIST1H2BB;HIST2H2BF;HIST1H2BG;HIST1H2BN;HIST1H2BM;HIST1H2BF;HIST1H2BE;HIST1H2BH;HIST1H2BI;HIST1H2BC;HIST1H2BO;HIST2H2BE;HIST1H2BK;HIST1H2BJ histone cluster 1, H2bd;histone cluster 1, H2bb;histone cluster 2, H2bf;histone cluster 1, H2bg;histone cluster 1, H2bn;histone cluster 1, H2bm;histone cluster 1, H2bf;histone cluster 1, H2be;histone cluster 1, H2bh;histone cluster 1, H2bi;histone cluster 1, H2bc;histone cluster 1, H2bo;histone cluster 2, H2be;histone cluster 1, H2bk;histone cluster 1, H2bj 1285 164 B20140214_SF053_01 B20140214_SF053_01 TB246248.[MT7]-IAGEASR.2b4_1.heavy 424.241 / 515.295 28073.0 19.332499980926514 46 20 10 6 10 9.823450955185269 10.17972201990945 0.03439903259277344 3 0.9972398826811233 23.485437567009765 28073.0 24.32752466752467 0.0 - - - - - - - 1197.7777777777778 56 9 HIST1H2BD;HIST1H2BB;HIST2H2BF;HIST1H2BG;HIST1H2BN;HIST1H2BM;HIST1H2BF;HIST1H2BE;HIST1H2BH;HIST1H2BI;HIST1H2BC;HIST1H2BO;HIST2H2BE;HIST1H2BK;HIST1H2BJ histone cluster 1, H2bd;histone cluster 1, H2bb;histone cluster 2, H2bf;histone cluster 1, H2bg;histone cluster 1, H2bn;histone cluster 1, H2bm;histone cluster 1, H2bf;histone cluster 1, H2be;histone cluster 1, H2bh;histone cluster 1, H2bi;histone cluster 1, H2bc;histone cluster 1, H2bo;histone cluster 2, H2be;histone cluster 1, H2bk;histone cluster 1, H2bj 1287 164 B20140214_SF053_01 B20140214_SF053_01 TB246248.[MT7]-IAGEASR.2y6_1.heavy 424.241 / 590.289 177503.0 19.332499980926514 46 20 10 6 10 9.823450955185269 10.17972201990945 0.03439903259277344 3 0.9972398826811233 23.485437567009765 177503.0 320.88854025974024 0.0 - - - - - - - 645.0 355 7 HIST1H2BD;HIST1H2BB;HIST2H2BF;HIST1H2BG;HIST1H2BN;HIST1H2BM;HIST1H2BF;HIST1H2BE;HIST1H2BH;HIST1H2BI;HIST1H2BC;HIST1H2BO;HIST2H2BE;HIST1H2BK;HIST1H2BJ histone cluster 1, H2bd;histone cluster 1, H2bb;histone cluster 2, H2bf;histone cluster 1, H2bg;histone cluster 1, H2bn;histone cluster 1, H2bm;histone cluster 1, H2bf;histone cluster 1, H2be;histone cluster 1, H2bh;histone cluster 1, H2bi;histone cluster 1, H2bc;histone cluster 1, H2bo;histone cluster 2, H2be;histone cluster 1, H2bk;histone cluster 1, H2bj 1289 164 B20140214_SF053_01 B20140214_SF053_01 TB246248.[MT7]-IAGEASR.2b5_1.heavy 424.241 / 586.332 20967.0 19.332499980926514 46 20 10 6 10 9.823450955185269 10.17972201990945 0.03439903259277344 3 0.9972398826811233 23.485437567009765 20967.0 17.619327731092437 0.0 - - - - - - - 367.5 41 8 HIST1H2BD;HIST1H2BB;HIST2H2BF;HIST1H2BG;HIST1H2BN;HIST1H2BM;HIST1H2BF;HIST1H2BE;HIST1H2BH;HIST1H2BI;HIST1H2BC;HIST1H2BO;HIST2H2BE;HIST1H2BK;HIST1H2BJ histone cluster 1, H2bd;histone cluster 1, H2bb;histone cluster 2, H2bf;histone cluster 1, H2bg;histone cluster 1, H2bn;histone cluster 1, H2bm;histone cluster 1, H2bf;histone cluster 1, H2be;histone cluster 1, H2bh;histone cluster 1, H2bi;histone cluster 1, H2bc;histone cluster 1, H2bo;histone cluster 2, H2be;histone cluster 1, H2bk;histone cluster 1, H2bj 1291 165 B20140214_SF053_01 B20140214_SF053_01 TB246230.[MT7]-NVAQR.2y4_1.heavy 366.218 / 473.283 10591.0 16.061599731445312 47 17 10 10 10 2.8516074833691185 27.993914410462377 0.0 3 0.975655512635099 7.893634940968891 10591.0 9.197252420953983 1.0 - - - - - - - 743.2 21 10 CCDC68 coiled-coil domain containing 68 1293 165 B20140214_SF053_01 B20140214_SF053_01 TB246230.[MT7]-NVAQR.2b3_1.heavy 366.218 / 429.258 6635.0 16.061599731445312 47 17 10 10 10 2.8516074833691185 27.993914410462377 0.0 3 0.975655512635099 7.893634940968891 6635.0 5.812607107360773 0.0 - - - - - - - 632.0 13 10 CCDC68 coiled-coil domain containing 68 1295 165 B20140214_SF053_01 B20140214_SF053_01 TB246230.[MT7]-NVAQR.2y3_1.heavy 366.218 / 374.215 6180.0 16.061599731445312 47 17 10 10 10 2.8516074833691185 27.993914410462377 0.0 3 0.975655512635099 7.893634940968891 6180.0 17.126199221533906 0.0 - - - - - - - 673.2666666666667 12 15 CCDC68 coiled-coil domain containing 68 1297 166 B20140214_SF053_01 B20140214_SF053_01 TB463970.[MT7]-MLQVFR.2y4_1.heavy 469.274 / 549.314 21746.0 37.087650299072266 44 18 10 6 10 2.912084228603304 34.33966607757155 0.0384979248046875 3 0.982912533984223 9.427644015075469 21746.0 18.356017467248908 1.0 - - - - - - - 290.5 43 2 LGALS14 lectin, galactoside-binding, soluble, 14 1299 166 B20140214_SF053_01 B20140214_SF053_01 TB463970.[MT7]-MLQVFR.2b3_1.heavy 469.274 / 517.292 28303.0 37.087650299072266 44 18 10 6 10 2.912084228603304 34.33966607757155 0.0384979248046875 3 0.982912533984223 9.427644015075469 28303.0 17.9025 0.0 - - - - - - - 498.0 56 1 LGALS14 lectin, galactoside-binding, soluble, 14 1301 166 B20140214_SF053_01 B20140214_SF053_01 TB463970.[MT7]-MLQVFR.2y5_1.heavy 469.274 / 662.398 61504.0 37.087650299072266 44 18 10 6 10 2.912084228603304 34.33966607757155 0.0384979248046875 3 0.982912533984223 9.427644015075469 61504.0 34.57454876108206 0.0 - - - - - - - 304.3333333333333 123 6 LGALS14 lectin, galactoside-binding, soluble, 14 1303 166 B20140214_SF053_01 B20140214_SF053_01 TB463970.[MT7]-MLQVFR.2b4_1.heavy 469.274 / 616.361 24319.0 37.087650299072266 44 18 10 6 10 2.912084228603304 34.33966607757155 0.0384979248046875 3 0.982912533984223 9.427644015075469 24319.0 12.089327731092435 0.0 - - - - - - - 83.0 48 1 LGALS14 lectin, galactoside-binding, soluble, 14 1305 167 B20140214_SF053_01 B20140214_SF053_01 TB246235.[MT7]-AGGTLGR.2y5_1.heavy 388.231 / 503.294 10893.0 18.963499069213867 48 18 10 10 10 3.2853548660494427 30.43811219098152 0.0 3 0.9859589607943393 10.4028723253415 10893.0 6.2373798427920795 8.0 - - - - - - - 1275.111111111111 33 9 SRXN1 sulfiredoxin 1 1307 167 B20140214_SF053_01 B20140214_SF053_01 TB246235.[MT7]-AGGTLGR.2b4_1.heavy 388.231 / 431.237 29501.0 18.963499069213867 48 18 10 10 10 3.2853548660494427 30.43811219098152 0.0 3 0.9859589607943393 10.4028723253415 29501.0 36.53254881432707 0.0 - - - - - - - 1235.625 59 8 SRXN1 sulfiredoxin 1 1309 167 B20140214_SF053_01 B20140214_SF053_01 TB246235.[MT7]-AGGTLGR.2y6_1.heavy 388.231 / 560.315 125363.0 18.963499069213867 48 18 10 10 10 3.2853548660494427 30.43811219098152 0.0 3 0.9859589607943393 10.4028723253415 125363.0 250.39568515980957 0.0 - - - - - - - 691.8333333333334 250 6 SRXN1 sulfiredoxin 1 1311 167 B20140214_SF053_01 B20140214_SF053_01 TB246235.[MT7]-AGGTLGR.2b5_1.heavy 388.231 / 544.321 22855.0 18.963499069213867 48 18 10 10 10 3.2853548660494427 30.43811219098152 0.0 3 0.9859589607943393 10.4028723253415 22855.0 24.761625938409686 0.0 - - - - - - - 1783.0 45 7 SRXN1 sulfiredoxin 1 1313 168 B20140214_SF053_01 B20140214_SF053_01 TB246645.[MT7]-TYGTSGLDNRPLFGETSAK[MT7].4b8_1.heavy 576.303 / 939.454 6897.0 32.53967571258545 43 17 10 6 10 14.195946307964848 7.044264456247873 0.033298492431640625 3 0.9764392558915451 8.024379679889686 6897.0 29.8332464028777 0.0 - - - - - - - 661.3333333333334 13 9 C7orf23 chromosome 7 open reading frame 23 1315 168 B20140214_SF053_01 B20140214_SF053_01 TB246645.[MT7]-TYGTSGLDNRPLFGETSAK[MT7].4y4_1.heavy 576.303 / 550.332 27531.0 32.53967571258545 43 17 10 6 10 14.195946307964848 7.044264456247873 0.033298492431640625 3 0.9764392558915451 8.024379679889686 27531.0 20.900597155653337 0.0 - - - - - - - 1749.6363636363637 55 11 C7orf23 chromosome 7 open reading frame 23 1317 168 B20140214_SF053_01 B20140214_SF053_01 TB246645.[MT7]-TYGTSGLDNRPLFGETSAK[MT7].4b14_2.heavy 576.303 / 812.416 16685.0 32.53967571258545 43 17 10 6 10 14.195946307964848 7.044264456247873 0.033298492431640625 3 0.9764392558915451 8.024379679889686 16685.0 49.867528089887635 0.0 - - - - - - - 628.6 33 10 C7orf23 chromosome 7 open reading frame 23 1319 168 B20140214_SF053_01 B20140214_SF053_01 TB246645.[MT7]-TYGTSGLDNRPLFGETSAK[MT7].4b6_1.heavy 576.303 / 711.343 19077.0 32.53967571258545 43 17 10 6 10 14.195946307964848 7.044264456247873 0.033298492431640625 3 0.9764392558915451 8.024379679889686 19077.0 35.66010105613252 0.0 - - - - - - - 667.3846153846154 38 13 C7orf23 chromosome 7 open reading frame 23 1321 169 B20140214_SF053_01 B20140214_SF053_01 TB464127.[MT7]-GLSQSALPYRR.3b6_1.heavy 464.601 / 688.375 100412.0 26.99370050430298 38 12 10 6 10 1.8695295460517158 35.67042087625147 0.03959846496582031 3 0.8809081882346729 3.5400877215105853 100412.0 58.94623761233831 0.0 - - - - - - - 749.5 200 12 RPS13 ribosomal protein S13 1323 169 B20140214_SF053_01 B20140214_SF053_01 TB464127.[MT7]-GLSQSALPYRR.3b4_1.heavy 464.601 / 530.305 53285.0 26.99370050430298 38 12 10 6 10 1.8695295460517158 35.67042087625147 0.03959846496582031 3 0.8809081882346729 3.5400877215105853 53285.0 49.71239254987854 0.0 - - - - - - - 1764.888888888889 106 9 RPS13 ribosomal protein S13 1325 169 B20140214_SF053_01 B20140214_SF053_01 TB464127.[MT7]-GLSQSALPYRR.3b5_1.heavy 464.601 / 617.338 75572.0 26.99370050430298 38 12 10 6 10 1.8695295460517158 35.67042087625147 0.03959846496582031 3 0.8809081882346729 3.5400877215105853 75572.0 50.796054299573 0.0 - - - - - - - 729.25 151 4 RPS13 ribosomal protein S13 1327 169 B20140214_SF053_01 B20140214_SF053_01 TB464127.[MT7]-GLSQSALPYRR.3y4_1.heavy 464.601 / 591.336 132869.0 26.99370050430298 38 12 10 6 10 1.8695295460517158 35.67042087625147 0.03959846496582031 3 0.8809081882346729 3.5400877215105853 132869.0 90.38015167778138 0.0 - - - - - - - 1301.625 265 8 RPS13 ribosomal protein S13 1329 170 B20140214_SF053_01 B20140214_SF053_01 TB246647.[MT7]-SRPQLGRPMSSGAHGEEGSAR.4y5_1.heavy 578.542 / 519.252 7470.0 19.823200861612957 46 20 10 6 10 7.521342544653605 13.295498696716452 0.03660011291503906 3 0.9983915760038983 30.76832610726013 7470.0 23.139216284333713 0.0 - - - - - - - 752.8181818181819 14 11 COX6A1 cytochrome c oxidase subunit VIa polypeptide 1 1331 170 B20140214_SF053_01 B20140214_SF053_01 TB246647.[MT7]-SRPQLGRPMSSGAHGEEGSAR.4y7_1.heavy 578.542 / 705.316 22912.0 19.823200861612957 46 20 10 6 10 7.521342544653605 13.295498696716452 0.03660011291503906 3 0.9983915760038983 30.76832610726013 22912.0 118.52744588744588 0.0 - - - - - - - 238.4375 45 16 COX6A1 cytochrome c oxidase subunit VIa polypeptide 1 1333 170 B20140214_SF053_01 B20140214_SF053_01 TB246647.[MT7]-SRPQLGRPMSSGAHGEEGSAR.4y6_1.heavy 578.542 / 648.295 4544.0 19.823200861612957 46 20 10 6 10 7.521342544653605 13.295498696716452 0.03660011291503906 3 0.9983915760038983 30.76832610726013 4544.0 45.44 0.0 - - - - - - - 119.84210526315789 9 19 COX6A1 cytochrome c oxidase subunit VIa polypeptide 1 1335 170 B20140214_SF053_01 B20140214_SF053_01 TB246647.[MT7]-SRPQLGRPMSSGAHGEEGSAR.4y11_2.heavy 578.542 / 529.237 N/A 19.823200861612957 46 20 10 6 10 7.521342544653605 13.295498696716452 0.03660011291503906 3 0.9983915760038983 30.76832610726013 1617.0 0.4387209302325581 23.0 - - - - - - - 1150.25 31 8 COX6A1 cytochrome c oxidase subunit VIa polypeptide 1 1337 171 B20140214_SF053_01 B20140214_SF053_01 TB246640.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].2y6_1.heavy 1124.57 / 766.458 N/A 45.88003285725912 39 14 10 5 10 1.421540989706973 55.841706770718226 0.04129791259765625 3 0.9416338879696481 5.083310917214048 665.0 3.4959459459459463 2.0 - - - - - - - 0.0 1 0 BET1 blocked early in transport 1 homolog (S. cerevisiae) 1339 171 B20140214_SF053_01 B20140214_SF053_01 TB246640.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].2b3_1.heavy 1124.57 / 442.315 1404.0 45.88003285725912 39 14 10 5 10 1.421540989706973 55.841706770718226 0.04129791259765625 3 0.9416338879696481 5.083310917214048 1404.0 7.399459459459459 0.0 - - - - - - - 159.3846153846154 2 13 BET1 blocked early in transport 1 homolog (S. cerevisiae) 1341 171 B20140214_SF053_01 B20140214_SF053_01 TB246640.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].2b4_1.heavy 1124.57 / 571.357 3179.0 45.88003285725912 39 14 10 5 10 1.421540989706973 55.841706770718226 0.04129791259765625 3 0.9416338879696481 5.083310917214048 3179.0 20.119346846846845 0.0 - - - - - - - 216.30769230769232 6 13 BET1 blocked early in transport 1 homolog (S. cerevisiae) 1343 171 B20140214_SF053_01 B20140214_SF053_01 TB246640.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].2b6_1.heavy 1124.57 / 817.425 2513.0 45.88003285725912 39 14 10 5 10 1.421540989706973 55.841706770718226 0.04129791259765625 3 0.9416338879696481 5.083310917214048 2513.0 12.341476654319294 0.0 - - - - - - - 222.0 5 12 BET1 blocked early in transport 1 homolog (S. cerevisiae) 1345 172 B20140214_SF053_01 B20140214_SF053_01 TB464123.[MT7]-GEPLALPLNVSEYC[CAM]VPR.3y7_1.heavy 686.699 / 910.409 117302.0 41.9953498840332 42 16 10 6 10 2.972724161233455 26.58693332342556 0.0366973876953125 3 0.9608000995892756 6.212850295370797 117302.0 158.14185990423505 0.0 - - - - - - - 373.3333333333333 234 3 BEX2 brain expressed X-linked 2 1347 172 B20140214_SF053_01 B20140214_SF053_01 TB464123.[MT7]-GEPLALPLNVSEYC[CAM]VPR.3b6_1.heavy 686.699 / 725.431 170396.0 41.9953498840332 42 16 10 6 10 2.972724161233455 26.58693332342556 0.0366973876953125 3 0.9608000995892756 6.212850295370797 170396.0 158.66620202590278 0.0 - - - - - - - 480.0 340 3 BEX2 brain expressed X-linked 2 1349 172 B20140214_SF053_01 B20140214_SF053_01 TB464123.[MT7]-GEPLALPLNVSEYC[CAM]VPR.3b4_1.heavy 686.699 / 541.31 70525.0 41.9953498840332 42 16 10 6 10 2.972724161233455 26.58693332342556 0.0366973876953125 3 0.9608000995892756 6.212850295370797 70525.0 123.83691246226822 0.0 - - - - - - - 360.0 141 2 BEX2 brain expressed X-linked 2 1351 172 B20140214_SF053_01 B20140214_SF053_01 TB464123.[MT7]-GEPLALPLNVSEYC[CAM]VPR.3b5_1.heavy 686.699 / 612.347 234364.0 41.9953498840332 42 16 10 6 10 2.972724161233455 26.58693332342556 0.0366973876953125 3 0.9608000995892756 6.212850295370797 234364.0 138.93012529232618 0.0 - - - - - - - 160.0 468 1 BEX2 brain expressed X-linked 2 1353 173 B20140214_SF053_01 B20140214_SF053_01 TB463977.[MT7]-LAYTVSR.2b3_1.heavy 477.28 / 492.294 24706.0 27.67340087890625 50 20 10 10 10 7.33623797684758 13.630964578247026 0.0 3 0.9971501072581042 23.112393188749852 24706.0 22.73792906196806 0.0 - - - - - - - 1244.7777777777778 49 9 NNAT neuronatin 1355 173 B20140214_SF053_01 B20140214_SF053_01 TB463977.[MT7]-LAYTVSR.2y5_1.heavy 477.28 / 625.33 70100.0 27.67340087890625 50 20 10 10 10 7.33623797684758 13.630964578247026 0.0 3 0.9971501072581042 23.112393188749852 70100.0 49.705834970158136 0.0 - - - - - - - 909.125 140 8 NNAT neuronatin 1357 173 B20140214_SF053_01 B20140214_SF053_01 TB463977.[MT7]-LAYTVSR.2b4_1.heavy 477.28 / 593.341 21725.0 27.67340087890625 50 20 10 10 10 7.33623797684758 13.630964578247026 0.0 3 0.9971501072581042 23.112393188749852 21725.0 31.743743033927363 0.0 - - - - - - - 1193.7142857142858 43 7 NNAT neuronatin 1359 173 B20140214_SF053_01 B20140214_SF053_01 TB463977.[MT7]-LAYTVSR.2y6_1.heavy 477.28 / 696.367 255647.0 27.67340087890625 50 20 10 10 10 7.33623797684758 13.630964578247026 0.0 3 0.9971501072581042 23.112393188749852 255647.0 295.64853553083856 0.0 - - - - - - - 372.75 511 4 NNAT neuronatin 1361 174 B20140214_SF053_01 B20140214_SF053_01 TB464232.[MT7]-LFQEDNDIPLYLK[MT7].2b3_1.heavy 948.521 / 533.32 7657.0 42.73040008544922 44 18 10 6 10 4.746892973973674 16.59344936363258 0.0316009521484375 3 0.9862406937368376 10.509084260227862 7657.0 18.077151563753006 0.0 - - - - - - - 233.3684210526316 15 19 COX7A1 cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) 1363 174 B20140214_SF053_01 B20140214_SF053_01 TB464232.[MT7]-LFQEDNDIPLYLK[MT7].2b4_1.heavy 948.521 / 662.363 5723.0 42.73040008544922 44 18 10 6 10 4.746892973973674 16.59344936363258 0.0316009521484375 3 0.9862406937368376 10.509084260227862 5723.0 28.228465089769163 0.0 - - - - - - - 674.875 11 8 COX7A1 cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) 1365 174 B20140214_SF053_01 B20140214_SF053_01 TB464232.[MT7]-LFQEDNDIPLYLK[MT7].2y3_1.heavy 948.521 / 567.362 7174.0 42.73040008544922 44 18 10 6 10 4.746892973973674 16.59344936363258 0.0316009521484375 3 0.9862406937368376 10.509084260227862 7174.0 34.42919742313023 0.0 - - - - - - - 254.6315789473684 14 19 COX7A1 cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) 1367 174 B20140214_SF053_01 B20140214_SF053_01 TB464232.[MT7]-LFQEDNDIPLYLK[MT7].2b7_1.heavy 948.521 / 1006.46 12333.0 42.73040008544922 44 18 10 6 10 4.746892973973674 16.59344936363258 0.0316009521484375 3 0.9862406937368376 10.509084260227862 12333.0 32.13583958080355 0.0 - - - - - - - 227.1818181818182 24 11 COX7A1 cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) 1369 175 B20140214_SF053_01 B20140214_SF053_01 TB246463.[MT7]-GLSQSALPYRR.2b4_1.heavy 696.397 / 530.305 1809.0 27.003600120544434 34 8 10 6 10 1.1737898256992239 55.24408323823513 0.03959846496582031 3 0.7775806512062481 2.5667082826707897 1809.0 4.257484286248464 0.0 - - - - - - - 293.95454545454544 3 22 RPS13 ribosomal protein S13 1371 175 B20140214_SF053_01 B20140214_SF053_01 TB246463.[MT7]-GLSQSALPYRR.2b6_1.heavy 696.397 / 688.375 9136.0 27.003600120544434 34 8 10 6 10 1.1737898256992239 55.24408323823513 0.03959846496582031 3 0.7775806512062481 2.5667082826707897 9136.0 10.368410437859353 0.0 - - - - - - - 756.0 18 14 RPS13 ribosomal protein S13 1373 175 B20140214_SF053_01 B20140214_SF053_01 TB246463.[MT7]-GLSQSALPYRR.2b7_1.heavy 696.397 / 801.459 2759.0 27.003600120544434 34 8 10 6 10 1.1737898256992239 55.24408323823513 0.03959846496582031 3 0.7775806512062481 2.5667082826707897 2759.0 11.041153110686174 0.0 - - - - - - - 196.65 5 20 RPS13 ribosomal protein S13 1375 175 B20140214_SF053_01 B20140214_SF053_01 TB246463.[MT7]-GLSQSALPYRR.2b10_1.heavy 696.397 / 1217.68 2035.0 27.003600120544434 34 8 10 6 10 1.1737898256992239 55.24408323823513 0.03959846496582031 3 0.7775806512062481 2.5667082826707897 2035.0 14.628468328882182 0.0 - - - - - - - 121.26315789473684 4 19 RPS13 ribosomal protein S13 1377 176 B20140214_SF053_01 B20140214_SF053_01 TB246654.[MT7]-ADGTVNQIEGEATPVNLTEPAK[MT7].4y5_1.heavy 636.336 / 689.395 12473.0 33.86367607116699 42 16 10 6 10 2.8007425942474455 35.70481636027313 0.03749847412109375 3 0.9654690186928329 6.622168147072149 12473.0 17.73957385491741 0.0 - - - - - - - 714.1111111111111 24 9 APOD apolipoprotein D 1379 176 B20140214_SF053_01 B20140214_SF053_01 TB246654.[MT7]-ADGTVNQIEGEATPVNLTEPAK[MT7].4b7_1.heavy 636.336 / 830.412 16933.0 33.86367607116699 42 16 10 6 10 2.8007425942474455 35.70481636027313 0.03749847412109375 3 0.9654690186928329 6.622168147072149 16933.0 41.39377653142527 0.0 - - - - - - - 680.25 33 8 APOD apolipoprotein D 1381 176 B20140214_SF053_01 B20140214_SF053_01 TB246654.[MT7]-ADGTVNQIEGEATPVNLTEPAK[MT7].4y3_1.heavy 636.336 / 459.305 49967.0 33.86367607116699 42 16 10 6 10 2.8007425942474455 35.70481636027313 0.03749847412109375 3 0.9654690186928329 6.622168147072149 49967.0 62.49316578661575 0.0 - - - - - - - 1301.7777777777778 99 9 APOD apolipoprotein D 1383 176 B20140214_SF053_01 B20140214_SF053_01 TB246654.[MT7]-ADGTVNQIEGEATPVNLTEPAK[MT7].4b6_1.heavy 636.336 / 702.354 9298.0 33.86367607116699 42 16 10 6 10 2.8007425942474455 35.70481636027313 0.03749847412109375 3 0.9654690186928329 6.622168147072149 9298.0 22.523483883520335 0.0 - - - - - - - 725.7333333333333 18 15 APOD apolipoprotein D 1385 177 B20140214_SF053_01 B20140214_SF053_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 204397.0 43.95180130004883 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 204397.0 416.9764633576556 0.0 - - - - - - - 303.75 408 4 1387 177 B20140214_SF053_01 B20140214_SF053_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 361202.0 43.95180130004883 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 361202.0 263.37041246546846 0.0 - - - - - - - 486.0 722 1 1389 177 B20140214_SF053_01 B20140214_SF053_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 301610.0 43.95180130004883 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 301610.0 330.437874134428 0.0 - - - - - - - 425.25 603 4 1391 178 B20140214_SF053_01 B20140214_SF053_01 TB246669.[MT7]-NQLIEQFPGIEPWLNQIMPK[MT7].4b4_1.heavy 671.618 / 613.379 19182.0 50.294898986816406 34 12 4 10 8 1.0064843610126604 62.46093189788287 0.0 4 0.8941764880235498 3.759800968657375 19182.0 43.83777048163181 0.0 - - - - - - - 376.0 38 12 MCTS1 malignant T cell amplified sequence 1 1393 178 B20140214_SF053_01 B20140214_SF053_01 TB246669.[MT7]-NQLIEQFPGIEPWLNQIMPK[MT7].4b5_1.heavy 671.618 / 742.422 10390.0 50.294898986816406 34 12 4 10 8 1.0064843610126604 62.46093189788287 0.0 4 0.8941764880235498 3.759800968657375 10390.0 43.52746808510638 0.0 - - - - - - - 305.5 20 18 MCTS1 malignant T cell amplified sequence 1 1395 178 B20140214_SF053_01 B20140214_SF053_01 TB246669.[MT7]-NQLIEQFPGIEPWLNQIMPK[MT7].4y3_1.heavy 671.618 / 519.308 23178.0 50.294898986816406 34 12 4 10 8 1.0064843610126604 62.46093189788287 0.0 4 0.8941764880235498 3.759800968657375 23178.0 51.19355623100304 0.0 - - - - - - - 687.375 46 8 MCTS1 malignant T cell amplified sequence 1 1397 178 B20140214_SF053_01 B20140214_SF053_01 TB246669.[MT7]-NQLIEQFPGIEPWLNQIMPK[MT7].4b3_1.heavy 671.618 / 500.295 20687.0 50.294898986816406 34 12 4 10 8 1.0064843610126604 62.46093189788287 0.0 4 0.8941764880235498 3.759800968657375 20687.0 35.37770432624114 1.0 - - - - - - - 705.0 89 11 MCTS1 malignant T cell amplified sequence 1 1399 179 B20140214_SF053_01 B20140214_SF053_01 TB246257.[MT7]-SASSNVR.2y5_1.heavy 432.736 / 562.294 2984.0 15.914799690246582 48 18 10 10 10 5.598026743248349 13.655780598632784 0.0 3 0.9853398826444172 10.180325103311503 2984.0 17.965834666404156 0.0 - - - - - - - 243.5909090909091 5 22 C1orf21 chromosome 1 open reading frame 21 1401 179 B20140214_SF053_01 B20140214_SF053_01 TB246257.[MT7]-SASSNVR.2b6_1.heavy 432.736 / 690.354 3139.0 15.914799690246582 48 18 10 10 10 5.598026743248349 13.655780598632784 0.0 3 0.9853398826444172 10.180325103311503 3139.0 10.857057856975189 0.0 - - - - - - - 219.55 6 20 C1orf21 chromosome 1 open reading frame 21 1403 179 B20140214_SF053_01 B20140214_SF053_01 TB246257.[MT7]-SASSNVR.2y6_1.heavy 432.736 / 633.331 10492.0 15.914799690246582 48 18 10 10 10 5.598026743248349 13.655780598632784 0.0 3 0.9853398826444172 10.180325103311503 10492.0 83.25390821857079 0.0 - - - - - - - 196.57142857142858 20 21 C1orf21 chromosome 1 open reading frame 21 1405 179 B20140214_SF053_01 B20140214_SF053_01 TB246257.[MT7]-SASSNVR.2b5_1.heavy 432.736 / 591.286 7926.0 15.914799690246582 48 18 10 10 10 5.598026743248349 13.655780598632784 0.0 3 0.9853398826444172 10.180325103311503 7926.0 30.094623264284085 0.0 - - - - - - - 254.61904761904762 15 21 C1orf21 chromosome 1 open reading frame 21 1407 180 B20140214_SF053_01 B20140214_SF053_01 TB464245.[MT7]-FQPPAIILIYESEIK[MT7].2y4_1.heavy 1025.1 / 620.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf34 chromosome 3 open reading frame 34 1409 180 B20140214_SF053_01 B20140214_SF053_01 TB464245.[MT7]-FQPPAIILIYESEIK[MT7].2y8_1.heavy 1025.1 / 1138.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf34 chromosome 3 open reading frame 34 1411 180 B20140214_SF053_01 B20140214_SF053_01 TB464245.[MT7]-FQPPAIILIYESEIK[MT7].2y5_1.heavy 1025.1 / 749.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf34 chromosome 3 open reading frame 34 1413 180 B20140214_SF053_01 B20140214_SF053_01 TB464245.[MT7]-FQPPAIILIYESEIK[MT7].2y6_1.heavy 1025.1 / 912.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf34 chromosome 3 open reading frame 34 1415 181 B20140214_SF053_01 B20140214_SF053_01 TB464244.[MT7]-AADTDGDGQVNYEEFVR.3y7_1.heavy 677.312 / 956.447 73509.0 34.3568000793457 48 18 10 10 10 4.077095989864202 24.527261621655065 0.0 3 0.9866534136911803 10.670703553285781 73509.0 662.0986690140845 0.0 - - - - - - - 318.75 147 12 CALML3 calmodulin-like 3 1417 181 B20140214_SF053_01 B20140214_SF053_01 TB464244.[MT7]-AADTDGDGQVNYEEFVR.3y6_1.heavy 677.312 / 842.404 37675.0 34.3568000793457 48 18 10 10 10 4.077095989864202 24.527261621655065 0.0 3 0.9866534136911803 10.670703553285781 37675.0 106.94545042664048 0.0 - - - - - - - 361.3 75 10 CALML3 calmodulin-like 3 1419 181 B20140214_SF053_01 B20140214_SF053_01 TB464244.[MT7]-AADTDGDGQVNYEEFVR.3b5_1.heavy 677.312 / 618.285 52618.0 34.3568000793457 48 18 10 10 10 4.077095989864202 24.527261621655065 0.0 3 0.9866534136911803 10.670703553285781 52618.0 72.10527219073676 0.0 - - - - - - - 1193.857142857143 105 7 CALML3 calmodulin-like 3 1421 181 B20140214_SF053_01 B20140214_SF053_01 TB464244.[MT7]-AADTDGDGQVNYEEFVR.3b7_1.heavy 677.312 / 790.333 51980.0 34.3568000793457 48 18 10 10 10 4.077095989864202 24.527261621655065 0.0 3 0.9866534136911803 10.670703553285781 51980.0 164.098456461091 0.0 - - - - - - - 779.0 103 7 CALML3 calmodulin-like 3 1423 182 B20140214_SF053_01 B20140214_SF053_01 TB464243.[MT7]-HLNQGTDEDIYLLGK[MT7].2y4_1.heavy 1002.54 / 574.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 1425 182 B20140214_SF053_01 B20140214_SF053_01 TB464243.[MT7]-HLNQGTDEDIYLLGK[MT7].2y5_1.heavy 1002.54 / 737.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 1427 182 B20140214_SF053_01 B20140214_SF053_01 TB464243.[MT7]-HLNQGTDEDIYLLGK[MT7].2b4_1.heavy 1002.54 / 637.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 1429 182 B20140214_SF053_01 B20140214_SF053_01 TB464243.[MT7]-HLNQGTDEDIYLLGK[MT7].2b9_1.heavy 1002.54 / 1154.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 1431 183 B20140214_SF053_01 B20140214_SF053_01 TB246254.[MT7]-MVQGK[MT7].2b3_1.heavy 425.757 / 503.277 6133.0 19.81100082397461 50 20 10 10 10 7.004546480281749 14.276441776995336 0.0 3 0.9960132938847421 19.53938405959192 6133.0 6.958698675666001 0.0 - - - - - - - 1214.7272727272727 12 11 RERG RAS-like, estrogen-regulated, growth inhibitor 1433 183 B20140214_SF053_01 B20140214_SF053_01 TB246254.[MT7]-MVQGK[MT7].2y4_1.heavy 425.757 / 575.363 24645.0 19.81100082397461 50 20 10 10 10 7.004546480281749 14.276441776995336 0.0 3 0.9960132938847421 19.53938405959192 24645.0 44.486707979049996 0.0 - - - - - - - 687.6666666666666 49 12 RERG RAS-like, estrogen-regulated, growth inhibitor 1435 183 B20140214_SF053_01 B20140214_SF053_01 TB246254.[MT7]-MVQGK[MT7].2y3_1.heavy 425.757 / 476.295 13439.0 19.81100082397461 50 20 10 10 10 7.004546480281749 14.276441776995336 0.0 3 0.9960132938847421 19.53938405959192 13439.0 22.473926249745183 0.0 - - - - - - - 779.25 26 12 RERG RAS-like, estrogen-regulated, growth inhibitor 1437 184 B20140214_SF053_01 B20140214_SF053_01 TB246393.[MT7]-K[MT7]FPVFK[MT7].2y4_1.heavy 599.39 / 634.404 13032.0 31.074525356292725 47 20 10 7 10 4.46548460698266 22.393986051061606 0.028299331665039062 3 0.9900389597558679 12.355173833558547 13032.0 33.457650254668934 0.0 - - - - - - - 267.4782608695652 26 23 CSTB cystatin B (stefin B) 1439 184 B20140214_SF053_01 B20140214_SF053_01 TB246393.[MT7]-K[MT7]FPVFK[MT7].2y5_1.heavy 599.39 / 781.473 7473.0 31.074525356292725 47 20 10 7 10 4.46548460698266 22.393986051061606 0.028299331665039062 3 0.9900389597558679 12.355173833558547 7473.0 28.724792574883978 0.0 - - - - - - - 247.15384615384616 14 26 CSTB cystatin B (stefin B) 1441 184 B20140214_SF053_01 B20140214_SF053_01 TB246393.[MT7]-K[MT7]FPVFK[MT7].2b4_1.heavy 599.39 / 760.496 4238.0 31.074525356292725 47 20 10 7 10 4.46548460698266 22.393986051061606 0.028299331665039062 3 0.9900389597558679 12.355173833558547 4238.0 11.64838431245617 0.0 - - - - - - - 609.0 8 11 CSTB cystatin B (stefin B) 1443 184 B20140214_SF053_01 B20140214_SF053_01 TB246393.[MT7]-K[MT7]FPVFK[MT7].2y3_1.heavy 599.39 / 537.352 1777.0 31.074525356292725 47 20 10 7 10 4.46548460698266 22.393986051061606 0.028299331665039062 3 0.9900389597558679 12.355173833558547 1777.0 0.9756495535378177 17.0 - - - - - - - 749.8181818181819 3 11 CSTB cystatin B (stefin B) 1445 185 B20140214_SF053_01 B20140214_SF053_01 TB464242.[MT7]-GLAPDLPEDLYHLIK[MT7].3b6_1.heavy 661.378 / 711.416 38870.0 45.691200256347656 44 14 10 10 10 1.5891071263188792 41.966387388310466 0.0 3 0.9336811743956694 4.765561411682728 38870.0 126.92006708760852 0.0 - - - - - - - 701.1428571428571 77 7 RPS13 ribosomal protein S13 1447 185 B20140214_SF053_01 B20140214_SF053_01 TB464242.[MT7]-GLAPDLPEDLYHLIK[MT7].3y3_1.heavy 661.378 / 517.383 39916.0 45.691200256347656 44 14 10 10 10 1.5891071263188792 41.966387388310466 0.0 3 0.9336811743956694 4.765561411682728 39916.0 51.28920101923669 0.0 - - - - - - - 770.2857142857143 79 7 RPS13 ribosomal protein S13 1449 185 B20140214_SF053_01 B20140214_SF053_01 TB464242.[MT7]-GLAPDLPEDLYHLIK[MT7].3b5_1.heavy 661.378 / 598.332 33559.0 45.691200256347656 44 14 10 10 10 1.5891071263188792 41.966387388310466 0.0 3 0.9336811743956694 4.765561411682728 33559.0 73.66299785035321 0.0 - - - - - - - 735.7142857142857 67 7 RPS13 ribosomal protein S13 1451 185 B20140214_SF053_01 B20140214_SF053_01 TB464242.[MT7]-GLAPDLPEDLYHLIK[MT7].3y4_1.heavy 661.378 / 654.442 30822.0 45.691200256347656 44 14 10 10 10 1.5891071263188792 41.966387388310466 0.0 3 0.9336811743956694 4.765561411682728 30822.0 107.29553369796977 0.0 - - - - - - - 265.3 61 10 RPS13 ribosomal protein S13 1453 186 B20140214_SF053_01 B20140214_SF053_01 TB464248.[MT7]-LYPAAVDTIVAIMAEGK[MT7].4y5_1.heavy 513.293 / 679.357 8675.0 52.003700256347656 43 13 10 10 10 1.0527701477825178 55.36454284098849 0.0 3 0.9136140936124265 4.168346228424601 8675.0 -10.84375 0.0 - - - - - - - 127.0 17 3 MCTS1 malignant T cell amplified sequence 1 1455 186 B20140214_SF053_01 B20140214_SF053_01 TB464248.[MT7]-LYPAAVDTIVAIMAEGK[MT7].4y4_1.heavy 513.293 / 548.316 19257.0 52.003700256347656 43 13 10 10 10 1.0527701477825178 55.36454284098849 0.0 3 0.9136140936124265 4.168346228424601 19257.0 -40.11874999999998 0.0 - - - - - - - 63.666666666666664 38 3 MCTS1 malignant T cell amplified sequence 1 1457 186 B20140214_SF053_01 B20140214_SF053_01 TB464248.[MT7]-LYPAAVDTIVAIMAEGK[MT7].4b4_1.heavy 513.293 / 589.347 11201.0 52.003700256347656 43 13 10 10 10 1.0527701477825178 55.36454284098849 0.0 3 0.9136140936124265 4.168346228424601 11201.0 -4.699720279720282 0.0 - - - - - - - 127.33333333333333 22 3 MCTS1 malignant T cell amplified sequence 1 1459 186 B20140214_SF053_01 B20140214_SF053_01 TB464248.[MT7]-LYPAAVDTIVAIMAEGK[MT7].4b5_1.heavy 513.293 / 660.384 15062.0 52.003700256347656 43 13 10 10 10 1.0527701477825178 55.36454284098849 0.0 3 0.9136140936124265 4.168346228424601 15062.0 -12.551666666666677 0.0 - - - - - - - 143.0 30 2 MCTS1 malignant T cell amplified sequence 1 1461 187 B20140214_SF053_01 B20140214_SF053_01 TB464246.[MT7]-FQPPAIILIYESEIK[MT7].3b6_1.heavy 683.734 / 798.463 133641.0 49.63290023803711 45 15 10 10 10 1.8417782538704672 43.17312330526874 0.0 3 0.9555730440624024 5.833349094098668 133641.0 127.02278368982864 0.0 - - - - - - - 764.0 267 2 C3orf34 chromosome 3 open reading frame 34 1463 187 B20140214_SF053_01 B20140214_SF053_01 TB464246.[MT7]-FQPPAIILIYESEIK[MT7].3b5_1.heavy 683.734 / 685.379 69556.0 49.63290023803711 45 15 10 10 10 1.8417782538704672 43.17312330526874 0.0 3 0.9555730440624024 5.833349094098668 69556.0 118.83752148940641 0.0 - - - - - - - 345.0 139 1 C3orf34 chromosome 3 open reading frame 34 1465 187 B20140214_SF053_01 B20140214_SF053_01 TB464246.[MT7]-FQPPAIILIYESEIK[MT7].3y4_1.heavy 683.734 / 620.374 105247.0 49.63290023803711 45 15 10 10 10 1.8417782538704672 43.17312330526874 0.0 3 0.9555730440624024 5.833349094098668 105247.0 87.99227798646795 0.0 - - - - - - - 937.0 210 1 C3orf34 chromosome 3 open reading frame 34 1467 187 B20140214_SF053_01 B20140214_SF053_01 TB464246.[MT7]-FQPPAIILIYESEIK[MT7].3b7_1.heavy 683.734 / 911.547 91394.0 49.63290023803711 45 15 10 10 10 1.8417782538704672 43.17312330526874 0.0 3 0.9555730440624024 5.833349094098668 91394.0 109.51180892252435 0.0 - - - - - - - 444.0 182 1 C3orf34 chromosome 3 open reading frame 34 1469 188 B20140214_SF053_01 B20140214_SF053_01 TB464247.[MT7]-LYPAAVDTIVAIMAEGK[MT7].3b4_1.heavy 684.055 / 589.347 19884.0 52.003700256347656 38 8 10 10 10 1.1588491644229728 67.33130915124788 0.0 3 0.781250566525212 2.5890114517253253 19884.0 -5.561958041958036 0.0 - - - - - - - 196.5 39 8 MCTS1 malignant T cell amplified sequence 1 1471 188 B20140214_SF053_01 B20140214_SF053_01 TB464247.[MT7]-LYPAAVDTIVAIMAEGK[MT7].3b5_1.heavy 684.055 / 660.384 57315.0 52.003700256347656 38 8 10 10 10 1.1588491644229728 67.33130915124788 0.0 3 0.781250566525212 2.5890114517253253 57315.0 -2.004020979020993 0.0 - - - - - - - 143.0 114 8 MCTS1 malignant T cell amplified sequence 1 1473 188 B20140214_SF053_01 B20140214_SF053_01 TB464247.[MT7]-LYPAAVDTIVAIMAEGK[MT7].3y4_1.heavy 684.055 / 548.316 124786.0 52.003700256347656 38 8 10 10 10 1.1588491644229728 67.33130915124788 0.0 3 0.781250566525212 2.5890114517253253 124786.0 -19.65133858267717 0.0 - - - - - - - 293.0 249 7 MCTS1 malignant T cell amplified sequence 1 1475 188 B20140214_SF053_01 B20140214_SF053_01 TB464247.[MT7]-LYPAAVDTIVAIMAEGK[MT7].3b7_1.heavy 684.055 / 874.479 27513.0 52.003700256347656 38 8 10 10 10 1.1588491644229728 67.33130915124788 0.0 3 0.781250566525212 2.5890114517253253 27513.0 -6.936050420168073 0.0 - - - - - - - 129.42857142857142 55 7 MCTS1 malignant T cell amplified sequence 1 1477 189 B20140214_SF053_01 B20140214_SF053_01 TB107891.[MT7]-ALNNLIVENVNQENDEK[MT7].3b6_1.heavy 748.729 / 783.484 102798.0 35.64580154418945 44 14 10 10 10 1.8390249941983443 47.51055606256508 0.0 3 0.9417210439111271 5.0871482900250475 102798.0 143.56068822983252 0.0 - - - - - - - 410.0 205 1 BEX2 brain expressed X-linked 2 1479 189 B20140214_SF053_01 B20140214_SF053_01 TB107891.[MT7]-ALNNLIVENVNQENDEK[MT7].3b4_1.heavy 748.729 / 557.316 106323.0 35.64580154418945 44 14 10 10 10 1.8390249941983443 47.51055606256508 0.0 3 0.9417210439111271 5.0871482900250475 106323.0 77.032259244586 0.0 - - - - - - - 1394.0 212 2 BEX2 brain expressed X-linked 2 1481 189 B20140214_SF053_01 B20140214_SF053_01 TB107891.[MT7]-ALNNLIVENVNQENDEK[MT7].3b5_1.heavy 748.729 / 670.4 142721.0 35.64580154418945 44 14 10 10 10 1.8390249941983443 47.51055606256508 0.0 3 0.9417210439111271 5.0871482900250475 142721.0 103.23268864197334 0.0 - - - - - - - 1339.3333333333333 285 3 BEX2 brain expressed X-linked 2 1483 189 B20140214_SF053_01 B20140214_SF053_01 TB107891.[MT7]-ALNNLIVENVNQENDEK[MT7].3y4_1.heavy 748.729 / 649.327 54432.0 35.64580154418945 44 14 10 10 10 1.8390249941983443 47.51055606256508 0.0 3 0.9417210439111271 5.0871482900250475 54432.0 68.64625072332427 0.0 - - - - - - - 806.3333333333334 108 6 BEX2 brain expressed X-linked 2 1485 190 B20140214_SF053_01 B20140214_SF053_01 TB107892.[MT7]-RFFLHHLIAEIHTAEIR.4y5_1.heavy 562.571 / 589.33 26357.0 36.92035102844238 37 11 10 6 10 1.4932847035265084 51.871339660430934 0.03859710693359375 3 0.874995588633353 3.45356977352436 26357.0 31.674383141674113 0.0 - - - - - - - 793.3333333333334 52 9 PTHLH parathyroid hormone-like hormone 1487 190 B20140214_SF053_01 B20140214_SF053_01 TB107892.[MT7]-RFFLHHLIAEIHTAEIR.4b4_1.heavy 562.571 / 708.431 7142.0 36.92035102844238 37 11 10 6 10 1.4932847035265084 51.871339660430934 0.03859710693359375 3 0.874995588633353 3.45356977352436 7142.0 11.784512180629829 0.0 - - - - - - - 780.4545454545455 14 11 PTHLH parathyroid hormone-like hormone 1489 190 B20140214_SF053_01 B20140214_SF053_01 TB107892.[MT7]-RFFLHHLIAEIHTAEIR.4b5_1.heavy 562.571 / 845.49 14369.0 36.92035102844238 37 11 10 6 10 1.4932847035265084 51.871339660430934 0.03859710693359375 3 0.874995588633353 3.45356977352436 14369.0 66.06922549019609 0.0 - - - - - - - 249.6875 28 16 PTHLH parathyroid hormone-like hormone 1491 190 B20140214_SF053_01 B20140214_SF053_01 TB107892.[MT7]-RFFLHHLIAEIHTAEIR.4y6_1.heavy 562.571 / 726.389 9353.0 36.92035102844238 37 11 10 6 10 1.4932847035265084 51.871339660430934 0.03859710693359375 3 0.874995588633353 3.45356977352436 9353.0 23.715225770308123 0.0 - - - - - - - 755.5555555555555 18 9 PTHLH parathyroid hormone-like hormone 1493 191 B20140214_SF053_01 B20140214_SF053_01 TB107890.[MT7]-K[MT7]VPQYPC[CAM]LWVNVSAAGR.3y7_1.heavy 745.077 / 674.358 28567.0 37.91950035095215 40 14 10 6 10 2.8589776781561085 34.97753786748513 0.03800201416015625 3 0.9460203003539249 5.287786617014425 28567.0 23.515518292682927 0.0 - - - - - - - 1262.857142857143 57 7 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 1495 191 B20140214_SF053_01 B20140214_SF053_01 TB107890.[MT7]-K[MT7]VPQYPC[CAM]LWVNVSAAGR.3b4_1.heavy 745.077 / 741.486 9352.0 37.91950035095215 40 14 10 6 10 2.8589776781561085 34.97753786748513 0.03800201416015625 3 0.9460203003539249 5.287786617014425 9352.0 10.845176470588235 0.0 - - - - - - - 701.25 18 12 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 1497 191 B20140214_SF053_01 B20140214_SF053_01 TB107890.[MT7]-K[MT7]VPQYPC[CAM]LWVNVSAAGR.3y8_1.heavy 745.077 / 773.426 19470.0 37.91950035095215 40 14 10 6 10 2.8589776781561085 34.97753786748513 0.03800201416015625 3 0.9460203003539249 5.287786617014425 19470.0 24.452555688459626 0.0 - - - - - - - 648.125 38 8 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 1499 191 B20140214_SF053_01 B20140214_SF053_01 TB107890.[MT7]-K[MT7]VPQYPC[CAM]LWVNVSAAGR.3y9_1.heavy 745.077 / 959.506 13688.0 37.91950035095215 40 14 10 6 10 2.8589776781561085 34.97753786748513 0.03800201416015625 3 0.9460203003539249 5.287786617014425 13688.0 36.657895424836596 0.0 - - - - - - - 283.3333333333333 27 9 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 1501 192 B20140214_SF053_01 B20140214_SF053_01 TB246592.[MT7]-ANMHISESQQEFFR.3y7_1.heavy 623.301 / 941.448 9376.0 32.2505989074707 50 20 10 10 10 12.684311860568554 7.8837544440126734 0.0 3 0.9982692522363436 29.660797403697046 9376.0 41.433100751260675 0.0 - - - - - - - 256.22727272727275 18 22 C1orf21 chromosome 1 open reading frame 21 1503 192 B20140214_SF053_01 B20140214_SF053_01 TB246592.[MT7]-ANMHISESQQEFFR.3b3_1.heavy 623.301 / 461.23 N/A 32.2505989074707 50 20 10 10 10 12.684311860568554 7.8837544440126734 0.0 3 0.9982692522363436 29.660797403697046 27020.0 13.741114269644648 0.0 - - - - - - - 843.0 54 1 C1orf21 chromosome 1 open reading frame 21 1505 192 B20140214_SF053_01 B20140214_SF053_01 TB246592.[MT7]-ANMHISESQQEFFR.3y5_1.heavy 623.301 / 726.357 8901.0 32.2505989074707 50 20 10 10 10 12.684311860568554 7.8837544440126734 0.0 3 0.9982692522363436 29.660797403697046 8901.0 19.95998828776071 0.0 - - - - - - - 718.7647058823529 17 17 C1orf21 chromosome 1 open reading frame 21 1507 192 B20140214_SF053_01 B20140214_SF053_01 TB246592.[MT7]-ANMHISESQQEFFR.3y9_1.heavy 623.301 / 1157.52 11008.0 32.2505989074707 50 20 10 10 10 12.684311860568554 7.8837544440126734 0.0 3 0.9982692522363436 29.660797403697046 11008.0 42.48035950739254 0.0 - - - - - - - 187.0 22 20 C1orf21 chromosome 1 open reading frame 21 1509 193 B20140214_SF053_01 B20140214_SF053_01 TB246665.[MT7]-EEVDQMFAAFPPDVTGNLDYK[MT7].4b4_1.heavy 669.329 / 617.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2 myosin, light chain 2, regulatory, cardiac, slow 1511 193 B20140214_SF053_01 B20140214_SF053_01 TB246665.[MT7]-EEVDQMFAAFPPDVTGNLDYK[MT7].4b5_1.heavy 669.329 / 745.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2 myosin, light chain 2, regulatory, cardiac, slow 1513 193 B20140214_SF053_01 B20140214_SF053_01 TB246665.[MT7]-EEVDQMFAAFPPDVTGNLDYK[MT7].4b3_1.heavy 669.329 / 502.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2 myosin, light chain 2, regulatory, cardiac, slow 1515 193 B20140214_SF053_01 B20140214_SF053_01 TB246665.[MT7]-EEVDQMFAAFPPDVTGNLDYK[MT7].4b6_1.heavy 669.329 / 876.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2 myosin, light chain 2, regulatory, cardiac, slow 1517 194 B20140214_SF053_01 B20140214_SF053_01 TB246664.[MT7]-C[CAM]FVSFPLNTGDLDC[CAM]ETC[CAM]TITR.3b4_1.heavy 884.074 / 638.309 7259.0 42.446200370788574 39 18 10 3 8 5.440118438989747 18.381952731633987 0.07139968872070312 4 0.9893190784779843 11.930830975678932 7259.0 13.225362635986574 0.0 - - - - - - - 750.2 14 10 TMEM126A transmembrane protein 126A 1519 194 B20140214_SF053_01 B20140214_SF053_01 TB246664.[MT7]-C[CAM]FVSFPLNTGDLDC[CAM]ETC[CAM]TITR.3b3_1.heavy 884.074 / 551.277 8953.0 42.446200370788574 39 18 10 3 8 5.440118438989747 18.381952731633987 0.07139968872070312 4 0.9893190784779843 11.930830975678932 8953.0 6.5942922409943705 0.0 - - - - - - - 783.4285714285714 17 7 TMEM126A transmembrane protein 126A 1521 194 B20140214_SF053_01 B20140214_SF053_01 TB246664.[MT7]-C[CAM]FVSFPLNTGDLDC[CAM]ETC[CAM]TITR.3y8_1.heavy 884.074 / 1040.45 4597.0 42.446200370788574 39 18 10 3 8 5.440118438989747 18.381952731633987 0.07139968872070312 4 0.9893190784779843 11.930830975678932 4597.0 0.0 2.0 - - - - - - - 714.2857142857143 9 7 TMEM126A transmembrane protein 126A 1523 194 B20140214_SF053_01 B20140214_SF053_01 TB246664.[MT7]-C[CAM]FVSFPLNTGDLDC[CAM]ETC[CAM]TITR.3y9_1.heavy 884.074 / 1155.48 4436.0 42.446200370788574 39 18 10 3 8 5.440118438989747 18.381952731633987 0.07139968872070312 4 0.9893190784779843 11.930830975678932 4436.0 4.10939403163135 1.0 - - - - - - - 714.5714285714286 8 7 TMEM126A transmembrane protein 126A 1525 195 B20140214_SF053_01 B20140214_SF053_01 TB107894.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].3y6_1.heavy 750.052 / 766.458 26304.0 45.893798828125 43 13 10 10 10 1.1131941041923457 52.577784088264224 0.0 3 0.9177639055808492 4.273748795753299 26304.0 32.18129344987802 0.0 - - - - - - - 782.2857142857143 52 7 BET1 blocked early in transport 1 homolog (S. cerevisiae) 1527 195 B20140214_SF053_01 B20140214_SF053_01 TB107894.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].3b6_1.heavy 750.052 / 817.425 28900.0 45.893798828125 43 13 10 10 10 1.1131941041923457 52.577784088264224 0.0 3 0.9177639055808492 4.273748795753299 28900.0 29.25766860545631 0.0 - - - - - - - 1209.4285714285713 57 7 BET1 blocked early in transport 1 homolog (S. cerevisiae) 1529 195 B20140214_SF053_01 B20140214_SF053_01 TB107894.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].3b4_1.heavy 750.052 / 571.357 46342.0 45.893798828125 43 13 10 10 10 1.1131941041923457 52.577784088264224 0.0 3 0.9177639055808492 4.273748795753299 46342.0 76.594769178506 0.0 - - - - - - - 814.4285714285714 92 7 BET1 blocked early in transport 1 homolog (S. cerevisiae) 1531 195 B20140214_SF053_01 B20140214_SF053_01 TB107894.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].3y5_1.heavy 750.052 / 665.41 47640.0 45.893798828125 43 13 10 10 10 1.1131941041923457 52.577784088264224 0.0 3 0.9177639055808492 4.273748795753299 47640.0 79.97488220670317 0.0 - - - - - - - 310.5 95 2 BET1 blocked early in transport 1 homolog (S. cerevisiae) 1533 196 B20140214_SF053_01 B20140214_SF053_01 TB107899.[MT7]-EASGPINFTVFLTMFGEK[MT7].3y6_1.heavy 759.401 / 856.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 1535 196 B20140214_SF053_01 B20140214_SF053_01 TB107899.[MT7]-EASGPINFTVFLTMFGEK[MT7].3b6_1.heavy 759.401 / 699.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 1537 196 B20140214_SF053_01 B20140214_SF053_01 TB107899.[MT7]-EASGPINFTVFLTMFGEK[MT7].3y4_1.heavy 759.401 / 624.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 1539 196 B20140214_SF053_01 B20140214_SF053_01 TB107899.[MT7]-EASGPINFTVFLTMFGEK[MT7].3b7_1.heavy 759.401 / 813.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 1541 197 B20140214_SF053_01 B20140214_SF053_01 TB246599.[MT7]-GAQGGDYFYSFGGC[CAM]HR.3y7_1.heavy 641.617 / 820.352 62624.0 33.70920181274414 45 15 10 10 10 3.7779355234482708 26.46948297008681 0.0 3 0.959227584857792 6.091053196030145 62624.0 105.49892810457516 0.0 - - - - - - - 686.1818181818181 125 11 SRXN1 sulfiredoxin 1 1543 197 B20140214_SF053_01 B20140214_SF053_01 TB246599.[MT7]-GAQGGDYFYSFGGC[CAM]HR.3b6_1.heavy 641.617 / 630.296 93767.0 33.70920181274414 45 15 10 10 10 3.7779355234482708 26.46948297008681 0.0 3 0.959227584857792 6.091053196030145 93767.0 48.60664938442174 0.0 - - - - - - - 816.0 187 1 SRXN1 sulfiredoxin 1 1545 197 B20140214_SF053_01 B20140214_SF053_01 TB246599.[MT7]-GAQGGDYFYSFGGC[CAM]HR.3y5_1.heavy 641.617 / 586.251 61944.0 33.70920181274414 45 15 10 10 10 3.7779355234482708 26.46948297008681 0.0 3 0.959227584857792 6.091053196030145 61944.0 53.652659846547316 0.0 - - - - - - - 816.0 123 7 SRXN1 sulfiredoxin 1 1547 197 B20140214_SF053_01 B20140214_SF053_01 TB246599.[MT7]-GAQGGDYFYSFGGC[CAM]HR.3b7_1.heavy 641.617 / 793.36 69628.0 33.70920181274414 45 15 10 10 10 3.7779355234482708 26.46948297008681 0.0 3 0.959227584857792 6.091053196030145 69628.0 118.86621483375959 0.0 - - - - - - - 714.0 139 8 SRXN1 sulfiredoxin 1 1549 198 B20140214_SF053_01 B20140214_SF053_01 TB107897.[MT7]-IAAGLPMAGIPFLTTDLTYR.2y4_1.heavy 1133.13 / 552.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 1551 198 B20140214_SF053_01 B20140214_SF053_01 TB107897.[MT7]-IAAGLPMAGIPFLTTDLTYR.2b4_1.heavy 1133.13 / 457.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 1553 198 B20140214_SF053_01 B20140214_SF053_01 TB107897.[MT7]-IAAGLPMAGIPFLTTDLTYR.2y10_1.heavy 1133.13 / 1226.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 1555 198 B20140214_SF053_01 B20140214_SF053_01 TB107897.[MT7]-IAAGLPMAGIPFLTTDLTYR.2b5_1.heavy 1133.13 / 570.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 1557 199 B20140214_SF053_01 B20140214_SF053_01 TB246661.[MT7]-LAGDMGELALEGAEGQVEGSAPDK[MT7].4b7_1.heavy 658.831 / 818.383 101279.0 40.11520004272461 40 10 10 10 10 0.7581348940877066 79.93631992986118 0.0 3 0.8388679789076886 3.0322117932036443 101279.0 146.5303517105145 0.0 - - - - - - - 1254.5 202 8 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 1559 199 B20140214_SF053_01 B20140214_SF053_01 TB246661.[MT7]-LAGDMGELALEGAEGQVEGSAPDK[MT7].4b4_1.heavy 658.831 / 501.279 31736.0 40.11520004272461 40 10 10 10 10 0.7581348940877066 79.93631992986118 0.0 3 0.8388679789076886 3.0322117932036443 31736.0 35.82300825008182 0.0 - - - - - - - 1262.6 63 10 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 1561 199 B20140214_SF053_01 B20140214_SF053_01 TB246661.[MT7]-LAGDMGELALEGAEGQVEGSAPDK[MT7].4y3_1.heavy 658.831 / 503.295 147264.0 40.11520004272461 40 10 10 10 10 0.7581348940877066 79.93631992986118 0.0 3 0.8388679789076886 3.0322117932036443 147264.0 125.00751163181049 0.0 - - - - - - - 324.0 294 1 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 1563 199 B20140214_SF053_01 B20140214_SF053_01 TB246661.[MT7]-LAGDMGELALEGAEGQVEGSAPDK[MT7].4b6_1.heavy 658.831 / 689.341 24935.0 40.11520004272461 40 10 10 10 10 0.7581348940877066 79.93631992986118 0.0 3 0.8388679789076886 3.0322117932036443 24935.0 58.4895061728395 0.0 - - - - - - - 776.25 49 12 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 1565 200 B20140214_SF053_01 B20140214_SF053_01 TB246660.[MT7]-AFQHWELIQEDILDTGNDK[MT7].4y4_1.heavy 640.828 / 577.306 23237.0 42.1974983215332 37 7 10 10 10 0.553641954276708 94.45136192372601 0.0 3 0.7378943372889103 2.3558431863187863 23237.0 43.73049560134208 0.0 - - - - - - - 746.375 46 8 NTS neurotensin 1567 200 B20140214_SF053_01 B20140214_SF053_01 TB246660.[MT7]-AFQHWELIQEDILDTGNDK[MT7].4b7_2.heavy 640.828 / 528.773 35582.0 42.1974983215332 37 7 10 10 10 0.553641954276708 94.45136192372601 0.0 3 0.7378943372889103 2.3558431863187863 35582.0 58.829645500519106 0.0 - - - - - - - 776.625 71 8 NTS neurotensin 1569 200 B20140214_SF053_01 B20140214_SF053_01 TB246660.[MT7]-AFQHWELIQEDILDTGNDK[MT7].4b4_1.heavy 640.828 / 628.332 10973.0 42.1974983215332 37 7 10 10 10 0.553641954276708 94.45136192372601 0.0 3 0.7378943372889103 2.3558431863187863 10973.0 11.33487794917907 1.0 - - - - - - - 821.5454545454545 21 11 NTS neurotensin 1571 200 B20140214_SF053_01 B20140214_SF053_01 TB246660.[MT7]-AFQHWELIQEDILDTGNDK[MT7].4b6_1.heavy 640.828 / 943.454 5971.0 42.1974983215332 37 7 10 10 10 0.553641954276708 94.45136192372601 0.0 3 0.7378943372889103 2.3558431863187863 5971.0 19.380748921231625 0.0 - - - - - - - 182.8 11 15 NTS neurotensin 1573 201 B20140214_SF053_01 B20140214_SF053_01 TB246679.[MT7]-DSLYNEGILIVWDPSVYHSDIPK[MT7].4b8_1.heavy 737.888 / 1036.51 24134.0 46.40890121459961 50 20 10 10 10 5.112526163933476 19.559802100467298 0.0 3 0.9936342178835132 15.45986973287188 24134.0 73.30845989831064 0.0 - - - - - - - 301.5 48 12 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 1575 201 B20140214_SF053_01 B20140214_SF053_01 TB246679.[MT7]-DSLYNEGILIVWDPSVYHSDIPK[MT7].4b7_1.heavy 737.888 / 923.423 42636.0 46.40890121459961 50 20 10 10 10 5.112526163933476 19.559802100467298 0.0 3 0.9936342178835132 15.45986973287188 42636.0 123.47796785304247 0.0 - - - - - - - 729.5555555555555 85 9 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 1577 201 B20140214_SF053_01 B20140214_SF053_01 TB246679.[MT7]-DSLYNEGILIVWDPSVYHSDIPK[MT7].4b4_1.heavy 737.888 / 623.316 15419.0 46.40890121459961 50 20 10 10 10 5.112526163933476 19.559802100467298 0.0 3 0.9936342178835132 15.45986973287188 15419.0 26.644893913470856 0.0 - - - - - - - 718.8181818181819 30 11 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 1579 201 B20140214_SF053_01 B20140214_SF053_01 TB246679.[MT7]-DSLYNEGILIVWDPSVYHSDIPK[MT7].4b5_1.heavy 737.888 / 737.359 N/A 46.40890121459961 50 20 10 10 10 5.112526163933476 19.559802100467298 0.0 3 0.9936342178835132 15.45986973287188 21184.0 7.621761147742136 1.0 - - - - - - - 2748.5 42 2 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 1581 202 B20140214_SF053_01 B20140214_SF053_01 TB246677.[MT7]-IAAVHNVPLSVLIRPLPSVLDPAK[MT7].3b6_1.heavy 936.575 / 750.438 3225.0 43.788700103759766 42 12 10 10 10 1.4096552474835398 60.643533007243605 0.0 3 0.8879300831450303 3.651538575942216 3225.0 15.194132846625514 0.0 - - - - - - - 272.25 6 16 SRXN1 sulfiredoxin 1 1583 202 B20140214_SF053_01 B20140214_SF053_01 TB246677.[MT7]-IAAVHNVPLSVLIRPLPSVLDPAK[MT7].3y17_2.heavy 936.575 / 980.11 3870.0 43.788700103759766 42 12 10 10 10 1.4096552474835398 60.643533007243605 0.0 3 0.8879300831450303 3.651538575942216 3870.0 36.82668240850059 0.0 - - - - - - - 233.11111111111111 7 9 SRXN1 sulfiredoxin 1 1585 202 B20140214_SF053_01 B20140214_SF053_01 TB246677.[MT7]-IAAVHNVPLSVLIRPLPSVLDPAK[MT7].3y20_2.heavy 936.575 / 1155.19 3064.0 43.788700103759766 42 12 10 10 10 1.4096552474835398 60.643533007243605 0.0 3 0.8879300831450303 3.651538575942216 3064.0 15.446611570247935 0.0 - - - - - - - 188.33333333333334 6 12 SRXN1 sulfiredoxin 1 1587 202 B20140214_SF053_01 B20140214_SF053_01 TB246677.[MT7]-IAAVHNVPLSVLIRPLPSVLDPAK[MT7].3y10_1.heavy 936.575 / 1180.71 564.0 43.788700103759766 42 12 10 10 10 1.4096552474835398 60.643533007243605 0.0 3 0.8879300831450303 3.651538575942216 564.0 2.424032975821832 3.0 - - - - - - - 0.0 1 0 SRXN1 sulfiredoxin 1 1589 203 B20140214_SF053_01 B20140214_SF053_01 TB246281.[MT7]-VETYK[MT7].2b3_1.heavy 464.273 / 474.268 3440.0 21.40169906616211 39 13 10 10 6 2.5724438746142186 38.873540055367265 0.0 6 0.920273497379735 4.341426858508579 3440.0 3.986869529862404 2.0 - - - - - - - 787.7368421052631 13 19 PTHLH parathyroid hormone-like hormone 1591 203 B20140214_SF053_01 B20140214_SF053_01 TB246281.[MT7]-VETYK[MT7].2y4_1.heavy 464.273 / 684.369 37180.0 21.40169906616211 39 13 10 10 6 2.5724438746142186 38.873540055367265 0.0 6 0.920273497379735 4.341426858508579 37180.0 58.164206176223054 1.0 - - - - - - - 728.3 74 10 PTHLH parathyroid hormone-like hormone 1593 203 B20140214_SF053_01 B20140214_SF053_01 TB246281.[MT7]-VETYK[MT7].2b4_1.heavy 464.273 / 637.331 3257.0 21.40169906616211 39 13 10 10 6 2.5724438746142186 38.873540055367265 0.0 6 0.920273497379735 4.341426858508579 3257.0 3.8208347540983603 2.0 - - - - - - - 1207.5555555555557 7 9 PTHLH parathyroid hormone-like hormone 1595 203 B20140214_SF053_01 B20140214_SF053_01 TB246281.[MT7]-VETYK[MT7].2y3_1.heavy 464.273 / 555.326 7063.0 21.40169906616211 39 13 10 10 6 2.5724438746142186 38.873540055367265 0.0 6 0.920273497379735 4.341426858508579 7063.0 11.44936063053878 1.0 - - - - - - - 746.5333333333333 27 15 PTHLH parathyroid hormone-like hormone 1597 204 B20140214_SF053_01 B20140214_SF053_01 TB107880.[MT7]-EAFTIMDQNRDGFIDK[MT7].3y15_2.heavy 730.036 / 957.979 11948.0 36.37294960021973 36 10 10 6 10 0.7351554236726717 70.19767640791046 0.039302825927734375 3 0.8368436006045034 3.0128011522208604 11948.0 65.45008835341366 0.0 - - - - - - - 290.5 23 14 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1599 204 B20140214_SF053_01 B20140214_SF053_01 TB107880.[MT7]-EAFTIMDQNRDGFIDK[MT7].3y6_1.heavy 730.036 / 838.443 2572.0 36.37294960021973 36 10 10 6 10 0.7351554236726717 70.19767640791046 0.039302825927734375 3 0.8368436006045034 3.0128011522208604 2572.0 2.5987951807228913 1.0 - - - - - - - 285.8888888888889 5 18 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1601 204 B20140214_SF053_01 B20140214_SF053_01 TB107880.[MT7]-EAFTIMDQNRDGFIDK[MT7].3y9_2.heavy 730.036 / 618.826 14603.0 36.37294960021973 36 10 10 6 10 0.7351554236726717 70.19767640791046 0.039302825927734375 3 0.8368436006045034 3.0128011522208604 14603.0 38.34115787826631 0.0 - - - - - - - 788.5 29 8 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1603 204 B20140214_SF053_01 B20140214_SF053_01 TB107880.[MT7]-EAFTIMDQNRDGFIDK[MT7].3y5_1.heavy 730.036 / 723.416 7052.0 36.37294960021973 36 10 10 6 10 0.7351554236726717 70.19767640791046 0.039302825927734375 3 0.8368436006045034 3.0128011522208604 7052.0 11.387205182393226 0.0 - - - - - - - 774.6666666666666 14 12 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1605 205 B20140214_SF053_01 B20140214_SF053_01 TB107881.[MT7]-EAFTIMDQNRDGFIDK[MT7].4y10_2.heavy 547.779 / 676.34 65663.0 36.35329818725586 47 17 10 10 10 2.4403966719073136 28.477357849064553 0.0 3 0.9704651255887652 7.163414264276898 65663.0 26.395901089231188 0.0 - - - - - - - 954.5 131 2 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1607 205 B20140214_SF053_01 B20140214_SF053_01 TB107881.[MT7]-EAFTIMDQNRDGFIDK[MT7].4y11_2.heavy 547.779 / 741.86 49227.0 36.35329818725586 47 17 10 10 10 2.4403966719073136 28.477357849064553 0.0 3 0.9704651255887652 7.163414264276898 49227.0 60.22209453197405 0.0 - - - - - - - 675.8571428571429 98 7 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1609 205 B20140214_SF053_01 B20140214_SF053_01 TB107881.[MT7]-EAFTIMDQNRDGFIDK[MT7].4b4_1.heavy 547.779 / 593.305 48480.0 36.35329818725586 47 17 10 10 10 2.4403966719073136 28.477357849064553 0.0 3 0.9704651255887652 7.163414264276898 48480.0 77.46016682113068 0.0 - - - - - - - 1304.2857142857142 96 7 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1611 205 B20140214_SF053_01 B20140214_SF053_01 TB107881.[MT7]-EAFTIMDQNRDGFIDK[MT7].4y3_1.heavy 547.779 / 519.326 24157.0 36.35329818725586 47 17 10 10 10 2.4403966719073136 28.477357849064553 0.0 3 0.9704651255887652 7.163414264276898 24157.0 10.072584798379506 0.0 - - - - - - - 1812.1666666666667 48 6 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1613 206 B20140214_SF053_01 B20140214_SF053_01 TB246487.[MT7]-EILK[MT7]EQENR.3b6_2.heavy 482.943 / 515.313 130187.0 22.824399948120117 43 13 10 10 10 1.1019121428177547 53.33288262642522 0.0 3 0.9178751675892745 4.276683724181973 130187.0 122.99804048569439 0.0 - - - - - - - 790.2727272727273 260 11 PARK7 Parkinson disease (autosomal recessive, early onset) 7 1615 206 B20140214_SF053_01 B20140214_SF053_01 TB246487.[MT7]-EILK[MT7]EQENR.3y8_2.heavy 482.943 / 587.339 297783.0 22.824399948120117 43 13 10 10 10 1.1019121428177547 53.33288262642522 0.0 3 0.9178751675892745 4.276683724181973 297783.0 546.1959092282087 0.0 - - - - - - - 1750.7142857142858 595 7 PARK7 Parkinson disease (autosomal recessive, early onset) 7 1617 206 B20140214_SF053_01 B20140214_SF053_01 TB246487.[MT7]-EILK[MT7]EQENR.3b7_1.heavy 482.943 / 1158.66 N/A 22.824399948120117 43 13 10 10 10 1.1019121428177547 53.33288262642522 0.0 3 0.9178751675892745 4.276683724181973 34.0 1.2 6.0 - - - - - - - 0.0 0 0 PARK7 Parkinson disease (autosomal recessive, early onset) 7 1619 206 B20140214_SF053_01 B20140214_SF053_01 TB246487.[MT7]-EILK[MT7]EQENR.3b4_1.heavy 482.943 / 772.517 184706.0 22.824399948120117 43 13 10 10 10 1.1019121428177547 53.33288262642522 0.0 3 0.9178751675892745 4.276683724181973 184706.0 565.0577416361706 0.0 - - - - - - - 708.75 369 8 PARK7 Parkinson disease (autosomal recessive, early onset) 7 1621 207 B20140214_SF053_01 B20140214_SF053_01 TB107886.[MT7]-IFYPEIEEVQALDDTER.3y7_1.heavy 737.703 / 819.384 23471.0 45.017398834228516 48 18 10 10 10 4.180302059261097 23.92171632154157 0.0 3 0.9881831089272269 11.341804487264804 23471.0 66.67779107618854 0.0 - - - - - - - 294.44444444444446 46 9 DUT deoxyuridine triphosphatase 1623 207 B20140214_SF053_01 B20140214_SF053_01 TB107886.[MT7]-IFYPEIEEVQALDDTER.3b5_1.heavy 737.703 / 794.42 29907.0 45.017398834228516 48 18 10 10 10 4.180302059261097 23.92171632154157 0.0 3 0.9881831089272269 11.341804487264804 29907.0 79.79613830009761 0.0 - - - - - - - 315.4 59 5 DUT deoxyuridine triphosphatase 1625 207 B20140214_SF053_01 B20140214_SF053_01 TB107886.[MT7]-IFYPEIEEVQALDDTER.3y4_1.heavy 737.703 / 520.236 13124.0 45.017398834228516 48 18 10 10 10 4.180302059261097 23.92171632154157 0.0 3 0.9881831089272269 11.341804487264804 13124.0 23.296197508866886 0.0 - - - - - - - 605.8 26 10 DUT deoxyuridine triphosphatase 1627 207 B20140214_SF053_01 B20140214_SF053_01 TB107886.[MT7]-IFYPEIEEVQALDDTER.3b3_1.heavy 737.703 / 568.325 34639.0 45.017398834228516 48 18 10 10 10 4.180302059261097 23.92171632154157 0.0 3 0.9881831089272269 11.341804487264804 34639.0 19.27521906762922 0.0 - - - - - - - 189.0 69 1 DUT deoxyuridine triphosphatase 1629 208 B20140214_SF053_01 B20140214_SF053_01 TB246587.[MT7]-VGIGFHLQIYPDGK[MT7].3b6_1.heavy 611.348 / 755.432 5865.0 38.53889846801758 43 13 10 10 10 1.5715411930805832 50.559705588484405 0.0 3 0.9108273346813094 4.101711717903052 5865.0 11.93164121961345 0.0 - - - - - - - 349.7647058823529 11 17 FGF5 fibroblast growth factor 5 1631 208 B20140214_SF053_01 B20140214_SF053_01 TB246587.[MT7]-VGIGFHLQIYPDGK[MT7].3b5_1.heavy 611.348 / 618.373 13279.0 38.53889846801758 43 13 10 10 10 1.5715411930805832 50.559705588484405 0.0 3 0.9108273346813094 4.101711717903052 13279.0 22.11813242891096 0.0 - - - - - - - 682.25 26 8 FGF5 fibroblast growth factor 5 1633 208 B20140214_SF053_01 B20140214_SF053_01 TB246587.[MT7]-VGIGFHLQIYPDGK[MT7].3y4_1.heavy 611.348 / 560.316 30305.0 38.53889846801758 43 13 10 10 10 1.5715411930805832 50.559705588484405 0.0 3 0.9108273346813094 4.101711717903052 30305.0 37.891263547449114 0.0 - - - - - - - 1181.375 60 8 FGF5 fibroblast growth factor 5 1635 208 B20140214_SF053_01 B20140214_SF053_01 TB246587.[MT7]-VGIGFHLQIYPDGK[MT7].3y5_1.heavy 611.348 / 723.379 11649.0 38.53889846801758 43 13 10 10 10 1.5715411930805832 50.559705588484405 0.0 3 0.9108273346813094 4.101711717903052 11649.0 17.050126232471516 0.0 - - - - - - - 725.1 23 10 FGF5 fibroblast growth factor 5 1637 209 B20140214_SF053_01 B20140214_SF053_01 TB107887.[MT7]-IFYPEIEEVQALDDTER.2b3_1.heavy 1106.05 / 568.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 1639 209 B20140214_SF053_01 B20140214_SF053_01 TB107887.[MT7]-IFYPEIEEVQALDDTER.2y4_1.heavy 1106.05 / 520.236 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 1641 209 B20140214_SF053_01 B20140214_SF053_01 TB107887.[MT7]-IFYPEIEEVQALDDTER.2y9_1.heavy 1106.05 / 1046.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 1643 209 B20140214_SF053_01 B20140214_SF053_01 TB107887.[MT7]-IFYPEIEEVQALDDTER.2y10_1.heavy 1106.05 / 1175.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 1645 210 B20140214_SF053_01 B20140214_SF053_01 TB107889.[MT7]-TVHC[CAM]QPAIFVASLAAVEK[MT7].3y3_1.heavy 743.748 / 519.326 16328.0 40.33610153198242 42 12 10 10 10 3.928131132300986 25.45739860304075 0.0 3 0.892753756315909 3.7343180260696616 16328.0 44.86432791608517 0.0 - - - - - - - 357.85714285714283 32 7 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 1647 210 B20140214_SF053_01 B20140214_SF053_01 TB107889.[MT7]-TVHC[CAM]QPAIFVASLAAVEK[MT7].3b5_1.heavy 743.748 / 770.374 12044.0 40.33610153198242 42 12 10 10 10 3.928131132300986 25.45739860304075 0.0 3 0.892753756315909 3.7343180260696616 12044.0 42.30639472266925 0.0 - - - - - - - 286.45454545454544 24 11 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 1649 210 B20140214_SF053_01 B20140214_SF053_01 TB107889.[MT7]-TVHC[CAM]QPAIFVASLAAVEK[MT7].3y4_1.heavy 743.748 / 590.363 30151.0 40.33610153198242 42 12 10 10 10 3.928131132300986 25.45739860304075 0.0 3 0.892753756315909 3.7343180260696616 30151.0 35.07173429621312 0.0 - - - - - - - 754.1111111111111 60 9 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 1651 210 B20140214_SF053_01 B20140214_SF053_01 TB107889.[MT7]-TVHC[CAM]QPAIFVASLAAVEK[MT7].3y5_1.heavy 743.748 / 661.4 30797.0 40.33610153198242 42 12 10 10 10 3.928131132300986 25.45739860304075 0.0 3 0.892753756315909 3.7343180260696616 30797.0 78.7333107456133 0.0 - - - - - - - 717.5 61 8 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 1653 211 B20140214_SF053_01 B20140214_SF053_01 TB246481.[MT7]-REYDQC[CAM]FNR.3b4_1.heavy 477.89 / 708.343 63449.0 22.552400588989258 44 14 10 10 10 1.5948175579141326 42.8116838663595 0.0 3 0.9410159942626205 5.056349312359478 63449.0 216.0867032280729 0.0 - - - - - - - 825.5714285714286 126 7 TRIAP1 TP53 regulated inhibitor of apoptosis 1 1655 211 B20140214_SF053_01 B20140214_SF053_01 TB246481.[MT7]-REYDQC[CAM]FNR.3b5_1.heavy 477.89 / 836.402 13566.0 22.552400588989258 44 14 10 10 10 1.5948175579141326 42.8116838663595 0.0 3 0.9410159942626205 5.056349312359478 13566.0 80.84777430423179 0.0 - - - - - - - 172.32 27 25 TRIAP1 TP53 regulated inhibitor of apoptosis 1 1657 211 B20140214_SF053_01 B20140214_SF053_01 TB246481.[MT7]-REYDQC[CAM]FNR.3y4_1.heavy 477.89 / 596.261 87494.0 22.552400588989258 44 14 10 10 10 1.5948175579141326 42.8116838663595 0.0 3 0.9410159942626205 5.056349312359478 87494.0 102.51038632045598 0.0 - - - - - - - 742.6153846153846 174 13 TRIAP1 TP53 regulated inhibitor of apoptosis 1 1659 211 B20140214_SF053_01 B20140214_SF053_01 TB246481.[MT7]-REYDQC[CAM]FNR.3y5_1.heavy 477.89 / 724.32 82434.0 22.552400588989258 44 14 10 10 10 1.5948175579141326 42.8116838663595 0.0 3 0.9410159942626205 5.056349312359478 82434.0 257.4767254002558 0.0 - - - - - - - 277.53333333333336 164 15 TRIAP1 TP53 regulated inhibitor of apoptosis 1 1661 212 B20140214_SF053_01 B20140214_SF053_01 TB246676.[MT7]-TMHHLLLEVEVIEGTLQC[CAM]PESGR.4y5_1.heavy 698.86 / 545.268 42406.0 45.50195026397705 43 17 10 6 10 3.466387953871449 22.954696672582152 0.039798736572265625 3 0.9702090811370312 7.132410220800354 42406.0 81.19903254023794 0.0 - - - - - - - 741.1428571428571 84 7 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 1663 212 B20140214_SF053_01 B20140214_SF053_01 TB246676.[MT7]-TMHHLLLEVEVIEGTLQC[CAM]PESGR.4b8_2.heavy 698.86 / 560.309 25113.0 45.50195026397705 43 17 10 6 10 3.466387953871449 22.954696672582152 0.039798736572265625 3 0.9702090811370312 7.132410220800354 25113.0 53.73451404058768 0.0 - - - - - - - 752.0 50 8 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 1665 212 B20140214_SF053_01 B20140214_SF053_01 TB246676.[MT7]-TMHHLLLEVEVIEGTLQC[CAM]PESGR.4y6_1.heavy 698.86 / 705.299 32030.0 45.50195026397705 43 17 10 6 10 3.466387953871449 22.954696672582152 0.039798736572265625 3 0.9702090811370312 7.132410220800354 32030.0 78.18184821281308 0.0 - - - - - - - 275.77777777777777 64 9 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 1667 212 B20140214_SF053_01 B20140214_SF053_01 TB246676.[MT7]-TMHHLLLEVEVIEGTLQC[CAM]PESGR.4b10_2.heavy 698.86 / 674.364 55113.0 45.50195026397705 43 17 10 6 10 3.466387953871449 22.954696672582152 0.039798736572265625 3 0.9702090811370312 7.132410220800354 55113.0 64.91094579403023 0.0 - - - - - - - 761.25 110 8 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 1669 213 B20140214_SF053_01 B20140214_SF053_01 TB107882.[MT7]-AGAVGAHLPASGLDIFGDLK[MT7].3y6_1.heavy 733.079 / 836.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEC11C SEC11 homolog C (S. cerevisiae) 1671 213 B20140214_SF053_01 B20140214_SF053_01 TB107882.[MT7]-AGAVGAHLPASGLDIFGDLK[MT7].3b6_1.heavy 733.079 / 571.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEC11C SEC11 homolog C (S. cerevisiae) 1673 213 B20140214_SF053_01 B20140214_SF053_01 TB107882.[MT7]-AGAVGAHLPASGLDIFGDLK[MT7].3b5_1.heavy 733.079 / 500.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEC11C SEC11 homolog C (S. cerevisiae) 1675 213 B20140214_SF053_01 B20140214_SF053_01 TB107882.[MT7]-AGAVGAHLPASGLDIFGDLK[MT7].3b7_1.heavy 733.079 / 708.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEC11C SEC11 homolog C (S. cerevisiae) 1677 214 B20140214_SF053_01 B20140214_SF053_01 TB246674.[MT7]-TVEGGSSSVFSMFDQTQIQEFK[MT7].4y4_1.heavy 685.84 / 695.385 15213.0 44.92855167388916 39 13 10 6 10 1.3442621231958691 50.148363257648555 0.038600921630859375 3 0.9098900812564913 4.079994991625786 15213.0 23.754579781781416 0.0 - - - - - - - 678.0714285714286 30 14 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 1679 214 B20140214_SF053_01 B20140214_SF053_01 TB246674.[MT7]-TVEGGSSSVFSMFDQTQIQEFK[MT7].4b5_1.heavy 685.84 / 588.311 8613.0 44.92855167388916 39 13 10 6 10 1.3442621231958691 50.148363257648555 0.038600921630859375 3 0.9098900812564913 4.079994991625786 8613.0 11.288589210081128 0.0 - - - - - - - 813.7777777777778 17 9 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 1681 214 B20140214_SF053_01 B20140214_SF053_01 TB246674.[MT7]-TVEGGSSSVFSMFDQTQIQEFK[MT7].4y3_1.heavy 685.84 / 567.326 13603.0 44.92855167388916 39 13 10 6 10 1.3442621231958691 50.148363257648555 0.038600921630859375 3 0.9098900812564913 4.079994991625786 13603.0 15.857685096307044 0.0 - - - - - - - 687.7272727272727 27 11 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 1683 214 B20140214_SF053_01 B20140214_SF053_01 TB246674.[MT7]-TVEGGSSSVFSMFDQTQIQEFK[MT7].4b6_1.heavy 685.84 / 675.343 4991.0 44.92855167388916 39 13 10 6 10 1.3442621231958691 50.148363257648555 0.038600921630859375 3 0.9098900812564913 4.079994991625786 4991.0 10.966249999999999 0.0 - - - - - - - 784.75 9 8 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 1685 215 B20140214_SF053_01 B20140214_SF053_01 TB107884.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].3b6_1.heavy 736.73 / 719.421 21735.0 40.8567008972168 47 17 10 10 10 5.023411643479984 19.906789866562615 0.0 3 0.9793989057539818 8.583587028393987 21735.0 19.392766816808543 0.0 - - - - - - - 1241.9 43 10 MCTS1 malignant T cell amplified sequence 1 1687 215 B20140214_SF053_01 B20140214_SF053_01 TB107884.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].3b3_1.heavy 736.73 / 504.33 15843.0 40.8567008972168 47 17 10 10 10 5.023411643479984 19.906789866562615 0.0 3 0.9793989057539818 8.583587028393987 15843.0 27.330071618553017 0.0 - - - - - - - 756.4 31 10 MCTS1 malignant T cell amplified sequence 1 1689 215 B20140214_SF053_01 B20140214_SF053_01 TB107884.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].3y4_1.heavy 736.73 / 516.326 81684.0 40.8567008972168 47 17 10 10 10 5.023411643479984 19.906789866562615 0.0 3 0.9793989057539818 8.583587028393987 81684.0 55.11469085833915 0.0 - - - - - - - 398.0 163 2 MCTS1 malignant T cell amplified sequence 1 1691 215 B20140214_SF053_01 B20140214_SF053_01 TB107884.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].3b7_1.heavy 736.73 / 833.464 49201.0 40.8567008972168 47 17 10 10 10 5.023411643479984 19.906789866562615 0.0 3 0.9793989057539818 8.583587028393987 49201.0 39.64329377990431 0.0 - - - - - - - 443.7142857142857 98 7 MCTS1 malignant T cell amplified sequence 1 1693 216 B20140214_SF053_01 B20140214_SF053_01 TB246673.[MT7]-GLWPFASAAGGGGSEAAGAEQALVRPR.4b24_2.heavy 682.608 / 1150.57 3228.0 41.201900482177734 33 12 9 6 6 1.9661757505354491 50.860153255764125 0.0370025634765625 5 0.8827963995164017 3.569077247465496 3228.0 13.608490718321226 0.0 - - - - - - - 199.26666666666668 6 15 TUSC2 tumor suppressor candidate 2 1695 216 B20140214_SF053_01 B20140214_SF053_01 TB246673.[MT7]-GLWPFASAAGGGGSEAAGAEQALVRPR.4b4_1.heavy 682.608 / 598.347 6614.0 41.201900482177734 33 12 9 6 6 1.9661757505354491 50.860153255764125 0.0370025634765625 5 0.8827963995164017 3.569077247465496 6614.0 3.9202370872142254 1.0 - - - - - - - 1163.5555555555557 13 9 TUSC2 tumor suppressor candidate 2 1697 216 B20140214_SF053_01 B20140214_SF053_01 TB246673.[MT7]-GLWPFASAAGGGGSEAAGAEQALVRPR.4y18_2.heavy 682.608 / 841.932 64412.0 41.201900482177734 33 12 9 6 6 1.9661757505354491 50.860153255764125 0.0370025634765625 5 0.8827963995164017 3.569077247465496 64412.0 73.78372286374133 1.0 - - - - - - - 747.875 158 8 TUSC2 tumor suppressor candidate 2 1699 216 B20140214_SF053_01 B20140214_SF053_01 TB246673.[MT7]-GLWPFASAAGGGGSEAAGAEQALVRPR.4b3_1.heavy 682.608 / 501.294 67798.0 41.201900482177734 33 12 9 6 6 1.9661757505354491 50.860153255764125 0.0370025634765625 5 0.8827963995164017 3.569077247465496 67798.0 65.29723522857567 0.0 - - - - - - - 472.0 135 1 TUSC2 tumor suppressor candidate 2 1701 217 B20140214_SF053_01 B20140214_SF053_01 TB107885.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].2b3_1.heavy 1104.59 / 504.33 3196.0 40.8387508392334 39 13 10 6 10 2.1395015982427807 41.86684392262606 0.035900115966796875 3 0.9295569211210856 4.62232210597452 3196.0 32.09316666666667 0.0 - - - - - - - 184.8125 6 16 MCTS1 malignant T cell amplified sequence 1 1703 217 B20140214_SF053_01 B20140214_SF053_01 TB107885.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].2y4_1.heavy 1104.59 / 516.326 5672.0 40.8387508392334 39 13 10 6 10 2.1395015982427807 41.86684392262606 0.035900115966796875 3 0.9295569211210856 4.62232210597452 5672.0 28.54602265951103 0.0 - - - - - - - 153.33333333333334 11 12 MCTS1 malignant T cell amplified sequence 1 1705 217 B20140214_SF053_01 B20140214_SF053_01 TB107885.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].2y9_1.heavy 1104.59 / 971.564 4394.0 40.8387508392334 39 13 10 6 10 2.1395015982427807 41.86684392262606 0.035900115966796875 3 0.9295569211210856 4.62232210597452 4394.0 25.814749999999997 0.0 - - - - - - - 149.9375 8 16 MCTS1 malignant T cell amplified sequence 1 1707 217 B20140214_SF053_01 B20140214_SF053_01 TB107885.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].2y10_1.heavy 1104.59 / 1131.59 1917.0 40.8387508392334 39 13 10 6 10 2.1395015982427807 41.86684392262606 0.035900115966796875 3 0.9295569211210856 4.62232210597452 1917.0 22.4049375 0.0 - - - - - - - 190.69230769230768 3 13 MCTS1 malignant T cell amplified sequence 1 1709 218 B20140214_SF053_01 B20140214_SF053_01 TB246373.[MT7]-VTTHPLAK[MT7].3y3_1.heavy 385.576 / 475.336 351590.0 22.295499801635742 44 18 10 6 10 5.220390690862074 19.155654417789638 0.030200958251953125 3 0.9864035381591408 10.571974626423895 351590.0 365.6753904060281 0.0 - - - - - - - 1241.2857142857142 703 7 PARK7 Parkinson disease (autosomal recessive, early onset) 7 1711 218 B20140214_SF053_01 B20140214_SF053_01 TB246373.[MT7]-VTTHPLAK[MT7].3b4_1.heavy 385.576 / 583.332 125256.0 22.295499801635742 44 18 10 6 10 5.220390690862074 19.155654417789638 0.030200958251953125 3 0.9864035381591408 10.571974626423895 125256.0 376.4434923957132 0.0 - - - - - - - 819.4285714285714 250 7 PARK7 Parkinson disease (autosomal recessive, early onset) 7 1713 218 B20140214_SF053_01 B20140214_SF053_01 TB246373.[MT7]-VTTHPLAK[MT7].3b3_1.heavy 385.576 / 446.273 202979.0 22.295499801635742 44 18 10 6 10 5.220390690862074 19.155654417789638 0.030200958251953125 3 0.9864035381591408 10.571974626423895 202979.0 239.12207982885076 0.0 - - - - - - - 1260.4 405 10 PARK7 Parkinson disease (autosomal recessive, early onset) 7 1715 218 B20140214_SF053_01 B20140214_SF053_01 TB246373.[MT7]-VTTHPLAK[MT7].3y4_1.heavy 385.576 / 572.389 206998.0 22.295499801635742 44 18 10 6 10 5.220390690862074 19.155654417789638 0.030200958251953125 3 0.9864035381591408 10.571974626423895 206998.0 416.4788701392099 0.0 - - - - - - - 386.25 413 8 PARK7 Parkinson disease (autosomal recessive, early onset) 7 1717 219 B20140214_SF053_01 B20140214_SF053_01 TB107879.[MT7]-C[CAM]HLIETNIRDQEELK[MT7].3y14_2.heavy 729.387 / 941.511 7404.0 28.489200592041016 48 18 10 10 10 4.0505867677491265 20.038402483236396 0.0 3 0.9866422074109206 10.666216606789162 7404.0 31.97152641313143 0.0 - - - - - - - 214.23809523809524 14 21 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 1719 219 B20140214_SF053_01 B20140214_SF053_01 TB107879.[MT7]-C[CAM]HLIETNIRDQEELK[MT7].3b3_1.heavy 729.387 / 555.283 5717.0 28.489200592041016 48 18 10 10 10 4.0505867677491265 20.038402483236396 0.0 3 0.9866422074109206 10.666216606789162 5717.0 5.638334293443782 0.0 - - - - - - - 777.8666666666667 11 15 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 1721 219 B20140214_SF053_01 B20140214_SF053_01 TB107879.[MT7]-C[CAM]HLIETNIRDQEELK[MT7].3y12_2.heavy 729.387 / 816.44 6936.0 28.489200592041016 48 18 10 10 10 4.0505867677491265 20.038402483236396 0.0 3 0.9866422074109206 10.666216606789162 6936.0 45.02590358974359 0.0 - - - - - - - 178.52380952380952 13 21 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 1723 219 B20140214_SF053_01 B20140214_SF053_01 TB107879.[MT7]-C[CAM]HLIETNIRDQEELK[MT7].3y13_2.heavy 729.387 / 872.982 6139.0 28.489200592041016 48 18 10 10 10 4.0505867677491265 20.038402483236396 0.0 3 0.9866422074109206 10.666216606789162 6139.0 33.35712673784104 0.0 - - - - - - - 149.57142857142858 12 21 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 1725 220 B20140214_SF053_01 B20140214_SF053_01 TB246371.[MT7]-QEELNTK[MT7].2b3_1.heavy 575.321 / 531.253 N/A 20.20669937133789 36 16 0 10 10 2.5236281296000267 31.92325580556136 0.0 3 0.9610275637322608 6.231074520062947 5029.0 1.6689892758332512 15.0 - - - - - - - 1973.0 50 2 MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 1727 220 B20140214_SF053_01 B20140214_SF053_01 TB246371.[MT7]-QEELNTK[MT7].2y5_1.heavy 575.321 / 748.432 2708.0 20.20669937133789 36 16 0 10 10 2.5236281296000267 31.92325580556136 0.0 3 0.9610275637322608 6.231074520062947 2708.0 32.76408898776418 0.0 - - - - - - - 127.7 5 20 MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 1729 220 B20140214_SF053_01 B20140214_SF053_01 TB246371.[MT7]-QEELNTK[MT7].2y3_1.heavy 575.321 / 506.306 3637.0 20.20669937133789 36 16 0 10 10 2.5236281296000267 31.92325580556136 0.0 3 0.9610275637322608 6.231074520062947 3637.0 9.904891727626744 0.0 - - - - - - - 258.8125 7 16 MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 1731 220 B20140214_SF053_01 B20140214_SF053_01 TB246371.[MT7]-QEELNTK[MT7].2y6_1.heavy 575.321 / 877.475 5687.0 20.20669937133789 36 16 0 10 10 2.5236281296000267 31.92325580556136 0.0 3 0.9610275637322608 6.231074520062947 5687.0 25.469488268084 0.0 - - - - - - - 202.64705882352942 11 17 MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 1733 221 B20140214_SF053_01 B20140214_SF053_01 TB246278.[MT7]-EEILK[MT7].2b3_1.heavy 460.289 / 516.279 37441.0 26.47327470779419 44 18 10 6 10 4.452964163426209 22.45695144401472 0.031099319458007812 3 0.9806387764316246 8.855085588778309 37441.0 38.72171600374921 0.0 - - - - - - - 1684.0 74 8 CETN1;CETN2;RBM33;EIF2C3;ITPR1;ITPR2;ITPR3;PRKDC;TCN2;LOC731751;MCTP1 centrin, EF-hand protein, 1;centrin, EF-hand protein, 2;RNA binding motif protein 33;eukaryotic translation initiation factor 2C, 3;inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-triphosphate receptor, type 2;inositol 1,4,5-triphosphate receptor, type 3;protein kinase, DNA-activated, catalytic polypeptide;transcobalamin II;DNA-dependent protein kinase catalytic subunit-like;multiple C2 domains, transmembrane 1 1735 221 B20140214_SF053_01 B20140214_SF053_01 TB246278.[MT7]-EEILK[MT7].2y4_1.heavy 460.289 / 646.426 71368.0 26.47327470779419 44 18 10 6 10 4.452964163426209 22.45695144401472 0.031099319458007812 3 0.9806387764316246 8.855085588778309 71368.0 78.73399685140967 0.0 - - - - - - - 1296.857142857143 142 7 CETN1;CETN2;RBM33;EIF2C3;ITPR1;ITPR2;ITPR3;PRKDC;TCN2;LOC731751;MCTP1 centrin, EF-hand protein, 1;centrin, EF-hand protein, 2;RNA binding motif protein 33;eukaryotic translation initiation factor 2C, 3;inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-triphosphate receptor, type 2;inositol 1,4,5-triphosphate receptor, type 3;protein kinase, DNA-activated, catalytic polypeptide;transcobalamin II;DNA-dependent protein kinase catalytic subunit-like;multiple C2 domains, transmembrane 1 1737 221 B20140214_SF053_01 B20140214_SF053_01 TB246278.[MT7]-EEILK[MT7].2b4_1.heavy 460.289 / 629.363 19536.0 26.47327470779419 44 18 10 6 10 4.452964163426209 22.45695144401472 0.031099319458007812 3 0.9806387764316246 8.855085588778309 19536.0 37.25541850083218 1.0 - - - - - - - 1243.6363636363637 39 11 CETN1;CETN2;RBM33;EIF2C3;ITPR1;ITPR2;ITPR3;PRKDC;TCN2;LOC731751;MCTP1 centrin, EF-hand protein, 1;centrin, EF-hand protein, 2;RNA binding motif protein 33;eukaryotic translation initiation factor 2C, 3;inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-triphosphate receptor, type 2;inositol 1,4,5-triphosphate receptor, type 3;protein kinase, DNA-activated, catalytic polypeptide;transcobalamin II;DNA-dependent protein kinase catalytic subunit-like;multiple C2 domains, transmembrane 1 1739 221 B20140214_SF053_01 B20140214_SF053_01 TB246278.[MT7]-EEILK[MT7].2y3_1.heavy 460.289 / 517.383 36437.0 26.47327470779419 44 18 10 6 10 4.452964163426209 22.45695144401472 0.031099319458007812 3 0.9806387764316246 8.855085588778309 36437.0 33.428773133544624 0.0 - - - - - - - 1757.125 72 8 CETN1;CETN2;RBM33;EIF2C3;ITPR1;ITPR2;ITPR3;PRKDC;TCN2;LOC731751;MCTP1 centrin, EF-hand protein, 1;centrin, EF-hand protein, 2;RNA binding motif protein 33;eukaryotic translation initiation factor 2C, 3;inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-triphosphate receptor, type 2;inositol 1,4,5-triphosphate receptor, type 3;protein kinase, DNA-activated, catalytic polypeptide;transcobalamin II;DNA-dependent protein kinase catalytic subunit-like;multiple C2 domains, transmembrane 1 1741 222 B20140214_SF053_01 B20140214_SF053_01 TB246473.[MT7]-WEWLVNQHR.3b4_1.heavy 471.25 / 759.395 69963.0 37.31187629699707 44 18 10 6 10 6.141007287285708 16.283973511485517 0.03530120849609375 3 0.988584376092381 11.539806616580723 69963.0 268.6719922771455 0.0 - - - - - - - 608.875 139 8 SF3B5 splicing factor 3b, subunit 5, 10kDa 1743 222 B20140214_SF053_01 B20140214_SF053_01 TB246473.[MT7]-WEWLVNQHR.3b3_1.heavy 471.25 / 646.311 150347.0 37.31187629699707 44 18 10 6 10 6.141007287285708 16.283973511485517 0.03530120849609375 3 0.988584376092381 11.539806616580723 150347.0 157.85143609078247 0.0 - - - - - - - 768.8571428571429 300 7 SF3B5 splicing factor 3b, subunit 5, 10kDa 1745 222 B20140214_SF053_01 B20140214_SF053_01 TB246473.[MT7]-WEWLVNQHR.3y4_1.heavy 471.25 / 554.279 213732.0 37.31187629699707 44 18 10 6 10 6.141007287285708 16.283973511485517 0.03530120849609375 3 0.988584376092381 11.539806616580723 213732.0 203.87131950882974 0.0 - - - - - - - 854.4285714285714 427 7 SF3B5 splicing factor 3b, subunit 5, 10kDa 1747 222 B20140214_SF053_01 B20140214_SF053_01 TB246473.[MT7]-WEWLVNQHR.3y5_1.heavy 471.25 / 653.348 92429.0 37.31187629699707 44 18 10 6 10 6.141007287285708 16.283973511485517 0.03530120849609375 3 0.988584376092381 11.539806616580723 92429.0 160.36436988942114 0.0 - - - - - - - 692.8888888888889 184 9 SF3B5 splicing factor 3b, subunit 5, 10kDa 1749 223 B20140214_SF053_01 B20140214_SF053_01 TB464229.[MT7]-GGYFLVDFYAPTAAVESMVEHLSR.3b4_1.heavy 935.134 / 569.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS6 mitochondrial ribosomal protein S6 1751 223 B20140214_SF053_01 B20140214_SF053_01 TB464229.[MT7]-GGYFLVDFYAPTAAVESMVEHLSR.3b5_1.heavy 935.134 / 682.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS6 mitochondrial ribosomal protein S6 1753 223 B20140214_SF053_01 B20140214_SF053_01 TB464229.[MT7]-GGYFLVDFYAPTAAVESMVEHLSR.3b7_1.heavy 935.134 / 896.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS6 mitochondrial ribosomal protein S6 1755 223 B20140214_SF053_01 B20140214_SF053_01 TB464229.[MT7]-GGYFLVDFYAPTAAVESMVEHLSR.3y9_1.heavy 935.134 / 1087.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS6 mitochondrial ribosomal protein S6 1757 224 B20140214_SF053_01 B20140214_SF053_01 TB246681.[MT7]-GTEFAESADAALQGDPALQDAGDSSRK[MT7].3b9_1.heavy 999.154 / 1052.47 4114.0 34.68092632293701 44 18 10 6 10 4.853803611311411 20.602399274448967 0.036701202392578125 3 0.984478014012227 9.89293968654067 4114.0 32.98143459915612 0.0 - - - - - - - 171.25 8 12 GYPC glycophorin C (Gerbich blood group) 1759 224 B20140214_SF053_01 B20140214_SF053_01 TB246681.[MT7]-GTEFAESADAALQGDPALQDAGDSSRK[MT7].3b6_1.heavy 999.154 / 779.369 7278.0 34.68092632293701 44 18 10 6 10 4.853803611311411 20.602399274448967 0.036701202392578125 3 0.984478014012227 9.89293968654067 7278.0 58.50037974683545 0.0 - - - - - - - 197.5625 14 16 GYPC glycophorin C (Gerbich blood group) 1761 224 B20140214_SF053_01 B20140214_SF053_01 TB246681.[MT7]-GTEFAESADAALQGDPALQDAGDSSRK[MT7].3b4_1.heavy 999.154 / 579.289 4667.0 34.68092632293701 44 18 10 6 10 4.853803611311411 20.602399274448967 0.036701202392578125 3 0.984478014012227 9.89293968654067 4667.0 17.67564842105263 0.0 - - - - - - - 265.2352941176471 9 17 GYPC glycophorin C (Gerbich blood group) 1763 224 B20140214_SF053_01 B20140214_SF053_01 TB246681.[MT7]-GTEFAESADAALQGDPALQDAGDSSRK[MT7].3b5_1.heavy 999.154 / 650.327 4430.0 34.68092632293701 44 18 10 6 10 4.853803611311411 20.602399274448967 0.036701202392578125 3 0.984478014012227 9.89293968654067 4430.0 30.981962025316456 0.0 - - - - - - - 237.15384615384616 8 13 GYPC glycophorin C (Gerbich blood group) 1765 225 B20140214_SF053_01 B20140214_SF053_01 TB107878.[MT7]-SLLSPGLLPHLLPALGFK[MT7].3b6_1.heavy 721.117 / 699.416 14234.0 49.70289993286133 43 13 10 10 10 3.3103278445759092 30.20848831146848 0.0 3 0.9248407767872665 4.473143682928028 14234.0 55.81569798391777 0.0 - - - - - - - 312.5625 28 16 MRPL36 mitochondrial ribosomal protein L36 1767 225 B20140214_SF053_01 B20140214_SF053_01 TB107878.[MT7]-SLLSPGLLPHLLPALGFK[MT7].3y6_1.heavy 721.117 / 776.479 86124.0 49.70289993286133 43 13 10 10 10 3.3103278445759092 30.20848831146848 0.0 3 0.9248407767872665 4.473143682928028 86124.0 269.6592808759868 0.0 - - - - - - - 255.1 172 10 MRPL36 mitochondrial ribosomal protein L36 1769 225 B20140214_SF053_01 B20140214_SF053_01 TB107878.[MT7]-SLLSPGLLPHLLPALGFK[MT7].3b4_1.heavy 721.117 / 545.341 21110.0 49.70289993286133 43 13 10 10 10 3.3103278445759092 30.20848831146848 0.0 3 0.9248407767872665 4.473143682928028 21110.0 60.18124549784551 0.0 - - - - - - - 288.52941176470586 42 17 MRPL36 mitochondrial ribosomal protein L36 1771 225 B20140214_SF053_01 B20140214_SF053_01 TB107878.[MT7]-SLLSPGLLPHLLPALGFK[MT7].3b8_1.heavy 721.117 / 925.584 19812.0 49.70289993286133 43 13 10 10 10 3.3103278445759092 30.20848831146848 0.0 3 0.9248407767872665 4.473143682928028 19812.0 33.4928596187175 1.0 - - - - - - - 199.73684210526315 39 19 MRPL36 mitochondrial ribosomal protein L36 1773 226 B20140214_SF053_01 B20140214_SF053_01 TB246683.[MT7]-VQSLVDTIREDPDSVPPIDVLWIK[MT7].4b11_2.heavy 756.423 / 700.879 73925.0 47.7111759185791 38 11 10 7 10 1.3131488108343619 60.29176935460646 0.02429962158203125 3 0.8674826306506176 3.3520387991961798 73925.0 168.04743628750435 0.0 - - - - - - - 1228.6 147 10 SRXN1 sulfiredoxin 1 1775 226 B20140214_SF053_01 B20140214_SF053_01 TB246683.[MT7]-VQSLVDTIREDPDSVPPIDVLWIK[MT7].4y9_2.heavy 756.423 / 612.877 239180.0 47.7111759185791 38 11 10 7 10 1.3131488108343619 60.29176935460646 0.02429962158203125 3 0.8674826306506176 3.3520387991961798 239180.0 101.53737779361151 0.0 - - - - - - - 485.0 478 1 SRXN1 sulfiredoxin 1 1777 226 B20140214_SF053_01 B20140214_SF053_01 TB246683.[MT7]-VQSLVDTIREDPDSVPPIDVLWIK[MT7].4b14_2.heavy 756.423 / 850.435 99196.0 47.7111759185791 38 11 10 7 10 1.3131488108343619 60.29176935460646 0.02429962158203125 3 0.8674826306506176 3.3520387991961798 99196.0 60.90214103328256 0.0 - - - - - - - 377.2 198 5 SRXN1 sulfiredoxin 1 1779 226 B20140214_SF053_01 B20140214_SF053_01 TB246683.[MT7]-VQSLVDTIREDPDSVPPIDVLWIK[MT7].4y3_1.heavy 756.423 / 590.378 138798.0 47.7111759185791 38 11 10 7 10 1.3131488108343619 60.29176935460646 0.02429962158203125 3 0.8674826306506176 3.3520387991961798 138798.0 85.363683680594 0.0 - - - - - - - 485.0 277 2 SRXN1 sulfiredoxin 1 1781 227 B20140214_SF053_01 B20140214_SF053_01 TB107875.[MT7]-SLVIWDNDRLTC[CAM]IQK[MT7].3b4_1.heavy 717.061 / 557.378 22026.0 37.646400451660156 50 20 10 10 10 9.362294905939095 10.681141857277288 0.0 3 0.996992842587224 22.499631014685626 22026.0 37.863000950168924 0.0 - - - - - - - 1131.125 44 8 RBP7 retinol binding protein 7, cellular 1783 227 B20140214_SF053_01 B20140214_SF053_01 TB107875.[MT7]-SLVIWDNDRLTC[CAM]IQK[MT7].3y11_2.heavy 717.061 / 796.902 31076.0 37.646400451660156 50 20 10 10 10 9.362294905939095 10.681141857277288 0.0 3 0.996992842587224 22.499631014685626 31076.0 56.13565417756763 0.0 - - - - - - - 711.4444444444445 62 9 RBP7 retinol binding protein 7, cellular 1785 227 B20140214_SF053_01 B20140214_SF053_01 TB107875.[MT7]-SLVIWDNDRLTC[CAM]IQK[MT7].3y12_2.heavy 717.061 / 853.444 30478.0 37.646400451660156 50 20 10 10 10 9.362294905939095 10.681141857277288 0.0 3 0.996992842587224 22.499631014685626 30478.0 73.56899873032577 0.0 - - - - - - - 744.0 60 7 RBP7 retinol binding protein 7, cellular 1787 227 B20140214_SF053_01 B20140214_SF053_01 TB107875.[MT7]-SLVIWDNDRLTC[CAM]IQK[MT7].3y9_2.heavy 717.061 / 646.349 28515.0 37.646400451660156 50 20 10 10 10 9.362294905939095 10.681141857277288 0.0 3 0.996992842587224 22.499631014685626 28515.0 17.019953631859835 0.0 - - - - - - - 2317.1428571428573 57 7 RBP7 retinol binding protein 7, cellular