Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140214_SF053_03 B20140214_SF053_03 TB464176.[MT7]-IC[CAM]VSPHNHTVK[MT7].3b4_1.heavy 527.292 / 604.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCL28 chemokine (C-C motif) ligand 28 3 1 B20140214_SF053_03 B20140214_SF053_03 TB464176.[MT7]-IC[CAM]VSPHNHTVK[MT7].3y4_1.heavy 527.292 / 628.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCL28 chemokine (C-C motif) ligand 28 5 1 B20140214_SF053_03 B20140214_SF053_03 TB464176.[MT7]-IC[CAM]VSPHNHTVK[MT7].3b3_1.heavy 527.292 / 517.292 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCL28 chemokine (C-C motif) ligand 28 7 1 B20140214_SF053_03 B20140214_SF053_03 TB464176.[MT7]-IC[CAM]VSPHNHTVK[MT7].3y5_1.heavy 527.292 / 742.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCL28 chemokine (C-C motif) ligand 28 9 2 B20140214_SF053_03 B20140214_SF053_03 TB246691.[MT7]-DEYDDLSDLTAAQQETLSDWESQFTFK[MT7].4b8_1.heavy 868.406 / 1097.44 8561.0 49.21904945373535 38 11 10 7 10 0.8318221040531342 71.20666712068144 0.029499053955078125 3 0.868101914732243 3.3600810742218283 8561.0 38.42452580099639 0.0 - - - - - - - 208.2 17 20 PGRMC1 progesterone receptor membrane component 1 11 2 B20140214_SF053_03 B20140214_SF053_03 TB246691.[MT7]-DEYDDLSDLTAAQQETLSDWESQFTFK[MT7].4b4_1.heavy 868.406 / 667.269 4538.0 49.21904945373535 38 11 10 7 10 0.8318221040531342 71.20666712068144 0.029499053955078125 3 0.868101914732243 3.3600810742218283 4538.0 35.645801660113584 0.0 - - - - - - - 203.34782608695653 9 23 PGRMC1 progesterone receptor membrane component 1 13 2 B20140214_SF053_03 B20140214_SF053_03 TB246691.[MT7]-DEYDDLSDLTAAQQETLSDWESQFTFK[MT7].4b5_1.heavy 868.406 / 782.296 11228.0 49.21904945373535 38 11 10 7 10 0.8318221040531342 71.20666712068144 0.029499053955078125 3 0.868101914732243 3.3600810742218283 11228.0 53.90147640650892 0.0 - - - - - - - 345.6666666666667 22 18 PGRMC1 progesterone receptor membrane component 1 15 2 B20140214_SF053_03 B20140214_SF053_03 TB246691.[MT7]-DEYDDLSDLTAAQQETLSDWESQFTFK[MT7].4y3_1.heavy 868.406 / 539.331 14596.0 49.21904945373535 38 11 10 7 10 0.8318221040531342 71.20666712068144 0.029499053955078125 3 0.868101914732243 3.3600810742218283 14596.0 38.65501202154086 0.0 - - - - - - - 781.8571428571429 29 7 PGRMC1 progesterone receptor membrane component 1 17 3 B20140214_SF053_03 B20140214_SF053_03 TB246692.[MT7]-GYLSGQSLAETMEQIQRETTIDPEEDLNK[MT7].4b8_1.heavy 896.697 / 950.506 2572.0 45.529598236083984 42 12 10 10 10 2.0564938182845567 48.6264530001923 0.0 3 0.8972439956233945 3.8165221757118397 2572.0 17.520457637600497 0.0 - - - - - - - 224.875 5 16 C3orf34 chromosome 3 open reading frame 34 19 3 B20140214_SF053_03 B20140214_SF053_03 TB246692.[MT7]-GYLSGQSLAETMEQIQRETTIDPEEDLNK[MT7].4b7_1.heavy 896.697 / 837.422 3747.0 45.529598236083984 42 12 10 10 10 2.0564938182845567 48.6264530001923 0.0 3 0.8972439956233945 3.8165221757118397 3747.0 9.066037852357283 0.0 - - - - - - - 642.75 7 8 C3orf34 chromosome 3 open reading frame 34 21 3 B20140214_SF053_03 B20140214_SF053_03 TB246692.[MT7]-GYLSGQSLAETMEQIQRETTIDPEEDLNK[MT7].4y7_1.heavy 896.697 / 988.507 11242.0 45.529598236083984 42 12 10 10 10 2.0564938182845567 48.6264530001923 0.0 3 0.8972439956233945 3.8165221757118397 11242.0 89.74440458180247 0.0 - - - - - - - 220.23076923076923 22 13 C3orf34 chromosome 3 open reading frame 34 23 3 B20140214_SF053_03 B20140214_SF053_03 TB246692.[MT7]-GYLSGQSLAETMEQIQRETTIDPEEDLNK[MT7].4b6_1.heavy 896.697 / 750.39 3233.0 45.529598236083984 42 12 10 10 10 2.0564938182845567 48.6264530001923 0.0 3 0.8972439956233945 3.8165221757118397 3233.0 8.11095423383361 0.0 - - - - - - - 661.1428571428571 6 7 C3orf34 chromosome 3 open reading frame 34 25 4 B20140214_SF053_03 B20140214_SF053_03 TB464170.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.3b4_1.heavy 769.426 / 599.388 30367.0 36.8890495300293 40 14 10 6 10 2.321836358354023 34.21895917888486 0.0384979248046875 3 0.9492065572767664 5.452590805441147 30367.0 34.138497834436855 0.0 - - - - - - - 721.5 60 8 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 27 4 B20140214_SF053_03 B20140214_SF053_03 TB464170.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.3y8_1.heavy 769.426 / 1052.63 32961.0 36.8890495300293 40 14 10 6 10 2.321836358354023 34.21895917888486 0.0384979248046875 3 0.9492065572767664 5.452590805441147 32961.0 79.89490169132884 0.0 - - - - - - - 669.4285714285714 65 7 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 29 4 B20140214_SF053_03 B20140214_SF053_03 TB464170.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.3y5_1.heavy 769.426 / 569.341 45760.0 36.8890495300293 40 14 10 6 10 2.321836358354023 34.21895917888486 0.0384979248046875 3 0.9492065572767664 5.452590805441147 45760.0 48.651196105930765 0.0 - - - - - - - 711.25 91 8 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 31 4 B20140214_SF053_03 B20140214_SF053_03 TB464170.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.3y9_1.heavy 769.426 / 1215.7 5354.0 36.8890495300293 40 14 10 6 10 2.321836358354023 34.21895917888486 0.0384979248046875 3 0.9492065572767664 5.452590805441147 5354.0 25.911631793187176 0.0 - - - - - - - 215.07142857142858 10 14 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 33 5 B20140214_SF053_03 B20140214_SF053_03 TB464279.[MT7]-SASLLSLQTELLLDLVAEAQSR.3b6_1.heavy 834.47 / 703.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 35 5 B20140214_SF053_03 B20140214_SF053_03 TB464279.[MT7]-SASLLSLQTELLLDLVAEAQSR.3b4_1.heavy 834.47 / 503.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 37 5 B20140214_SF053_03 B20140214_SF053_03 TB464279.[MT7]-SASLLSLQTELLLDLVAEAQSR.3b5_1.heavy 834.47 / 616.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 39 5 B20140214_SF053_03 B20140214_SF053_03 TB464279.[MT7]-SASLLSLQTELLLDLVAEAQSR.3y9_1.heavy 834.47 / 988.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 41 6 B20140214_SF053_03 B20140214_SF053_03 TB464079.[MT7]-HGESSLDIAR.2b7_1.heavy 614.824 / 870.407 2911.0 23.326200485229492 42 16 10 10 6 5.864478288762322 17.051815195841517 0.0 5 0.9604742679072991 6.187018922112019 2911.0 38.60175622662166 0.0 - - - - - - - 143.4 5 25 ANKRD22 ankyrin repeat domain 22 43 6 B20140214_SF053_03 B20140214_SF053_03 TB464079.[MT7]-HGESSLDIAR.2b9_1.heavy 614.824 / 1054.53 776.0 23.326200485229492 42 16 10 10 6 5.864478288762322 17.051815195841517 0.0 5 0.9604742679072991 6.187018922112019 776.0 0.7796036647075221 2.0 - - - - - - - 147.0 8 22 ANKRD22 ankyrin repeat domain 22 45 6 B20140214_SF053_03 B20140214_SF053_03 TB464079.[MT7]-HGESSLDIAR.2y9_1.heavy 614.824 / 947.479 5079.0 23.326200485229492 42 16 10 10 6 5.864478288762322 17.051815195841517 0.0 5 0.9604742679072991 6.187018922112019 5079.0 91.49138936738936 0.0 - - - - - - - 120.95652173913044 10 23 ANKRD22 ankyrin repeat domain 22 47 6 B20140214_SF053_03 B20140214_SF053_03 TB464079.[MT7]-HGESSLDIAR.2y7_1.heavy 614.824 / 761.415 1779.0 23.326200485229492 42 16 10 10 6 5.864478288762322 17.051815195841517 0.0 5 0.9604742679072991 6.187018922112019 1779.0 17.593012600229095 2.0 - - - - - - - 168.45833333333334 6 24 ANKRD22 ankyrin repeat domain 22 49 7 B20140214_SF053_03 B20140214_SF053_03 TB464273.[MT7]-EAPGPINFTVFLTMFGEK[MT7].4y4_1.heavy 572.307 / 624.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 51 7 B20140214_SF053_03 B20140214_SF053_03 TB464273.[MT7]-EAPGPINFTVFLTMFGEK[MT7].4b7_1.heavy 572.307 / 823.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 53 7 B20140214_SF053_03 B20140214_SF053_03 TB464273.[MT7]-EAPGPINFTVFLTMFGEK[MT7].4y6_1.heavy 572.307 / 856.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 55 7 B20140214_SF053_03 B20140214_SF053_03 TB464273.[MT7]-EAPGPINFTVFLTMFGEK[MT7].4b6_1.heavy 572.307 / 709.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 57 8 B20140214_SF053_03 B20140214_SF053_03 TB464274.[MT7]-IIVPLNNRENISDPTSPLR.3y18_2.heavy 764.765 / 1018.05 67874.0 35.33319854736328 42 12 10 10 10 2.2670208974711388 44.11075350542643 0.0 3 0.8816989046000153 3.552143636391008 67874.0 149.97313745424415 0.0 - - - - - - - 275.5 135 6 IGJ immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides 59 8 B20140214_SF053_03 B20140214_SF053_03 TB464274.[MT7]-IIVPLNNRENISDPTSPLR.3y6_1.heavy 764.765 / 670.388 215693.0 35.33319854736328 42 12 10 10 10 2.2670208974711388 44.11075350542643 0.0 3 0.8816989046000153 3.552143636391008 215693.0 118.55302640145875 0.0 - - - - - - - 331.0 431 1 IGJ immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides 61 8 B20140214_SF053_03 B20140214_SF053_03 TB464274.[MT7]-IIVPLNNRENISDPTSPLR.3y8_1.heavy 764.765 / 872.447 10582.0 35.33319854736328 42 12 10 10 10 2.2670208974711388 44.11075350542643 0.0 3 0.8816989046000153 3.552143636391008 10582.0 27.166155913978496 0.0 - - - - - - - 342.57142857142856 21 7 IGJ immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides 63 8 B20140214_SF053_03 B20140214_SF053_03 TB464274.[MT7]-IIVPLNNRENISDPTSPLR.3y16_2.heavy 764.765 / 911.974 140295.0 35.33319854736328 42 12 10 10 10 2.2670208974711388 44.11075350542643 0.0 3 0.8816989046000153 3.552143636391008 140295.0 115.88394428152492 0.0 - - - - - - - 281.2 280 5 IGJ immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides 65 9 B20140214_SF053_03 B20140214_SF053_03 TB464271.[MT7]-IAAGLPMAGIPFLTTDLTYR.3b5_1.heavy 755.753 / 570.373 41639.0 50.53960037231445 47 17 10 10 10 5.187794940043437 19.276012478465987 0.0 3 0.9718094453956304 7.333055893970069 41639.0 42.56631416386181 0.0 - - - - - - - 645.625 83 8 TMEM126A transmembrane protein 126A 67 9 B20140214_SF053_03 B20140214_SF053_03 TB464271.[MT7]-IAAGLPMAGIPFLTTDLTYR.3y4_1.heavy 755.753 / 552.314 5256.0 50.53960037231445 47 17 10 10 10 5.187794940043437 19.276012478465987 0.0 3 0.9718094453956304 7.333055893970069 5256.0 69.2467663484057 0.0 - - - - - - - 208.05 10 20 TMEM126A transmembrane protein 126A 69 9 B20140214_SF053_03 B20140214_SF053_03 TB464271.[MT7]-IAAGLPMAGIPFLTTDLTYR.3y8_1.heavy 755.753 / 982.52 7359.0 50.53960037231445 47 17 10 10 10 5.187794940043437 19.276012478465987 0.0 3 0.9718094453956304 7.333055893970069 7359.0 83.16493322283492 0.0 - - - - - - - 182.94736842105263 14 19 TMEM126A transmembrane protein 126A 71 9 B20140214_SF053_03 B20140214_SF053_03 TB464271.[MT7]-IAAGLPMAGIPFLTTDLTYR.3y10_1.heavy 755.753 / 1226.64 19425.0 50.53960037231445 47 17 10 10 10 5.187794940043437 19.276012478465987 0.0 3 0.9718094453956304 7.333055893970069 19425.0 76.23155737704917 0.0 - - - - - - - 240.0 38 16 TMEM126A transmembrane protein 126A 73 10 B20140214_SF053_03 B20140214_SF053_03 TB464275.[MT7]-C[CAM]PLEDPGWNAQITLGLVK[MT7].3y6_1.heavy 767.083 / 774.521 38333.0 43.53269958496094 44 14 10 10 10 2.0032439784272404 39.45363958246748 0.0 3 0.9351897679370507 4.821327608259705 38333.0 43.07921368170098 0.0 - - - - - - - 307.8 76 5 PHLDA3 pleckstrin homology-like domain, family A, member 3 75 10 B20140214_SF053_03 B20140214_SF053_03 TB464275.[MT7]-C[CAM]PLEDPGWNAQITLGLVK[MT7].3b5_1.heavy 767.083 / 759.346 54866.0 43.53269958496094 44 14 10 10 10 2.0032439784272404 39.45363958246748 0.0 3 0.9351897679370507 4.821327608259705 54866.0 75.64500793341136 0.0 - - - - - - - 739.25 109 8 PHLDA3 pleckstrin homology-like domain, family A, member 3 77 10 B20140214_SF053_03 B20140214_SF053_03 TB464275.[MT7]-C[CAM]PLEDPGWNAQITLGLVK[MT7].3y4_1.heavy 767.083 / 560.389 62565.0 43.53269958496094 44 14 10 10 10 2.0032439784272404 39.45363958246748 0.0 3 0.9351897679370507 4.821327608259705 62565.0 65.51777488087745 0.0 - - - - - - - 141.75 125 4 PHLDA3 pleckstrin homology-like domain, family A, member 3 79 10 B20140214_SF053_03 B20140214_SF053_03 TB464275.[MT7]-C[CAM]PLEDPGWNAQITLGLVK[MT7].3b7_1.heavy 767.083 / 913.421 24151.0 43.53269958496094 44 14 10 10 10 2.0032439784272404 39.45363958246748 0.0 3 0.9351897679370507 4.821327608259705 24151.0 58.059406529804065 0.0 - - - - - - - 243.0 48 8 PHLDA3 pleckstrin homology-like domain, family A, member 3 81 11 B20140214_SF053_03 B20140214_SF053_03 TB464276.[MT7]-YLPATVEFAVHTFNQQSK[MT7].4b4_1.heavy 592.819 / 589.347 22707.0 42.84652614593506 43 17 10 6 10 2.9312645044520766 34.11496978458189 0.030498504638671875 3 0.9742329779439569 7.671729450580375 22707.0 18.602350845948354 1.0 - - - - - - - 782.375 45 8 CST9L cystatin 9-like 83 11 B20140214_SF053_03 B20140214_SF053_03 TB464276.[MT7]-YLPATVEFAVHTFNQQSK[MT7].4b5_1.heavy 592.819 / 690.394 18134.0 42.84652614593506 43 17 10 6 10 2.9312645044520766 34.11496978458189 0.030498504638671875 3 0.9742329779439569 7.671729450580375 18134.0 42.65866259990068 0.0 - - - - - - - 687.7142857142857 36 7 CST9L cystatin 9-like 85 11 B20140214_SF053_03 B20140214_SF053_03 TB464276.[MT7]-YLPATVEFAVHTFNQQSK[MT7].4y7_1.heavy 592.819 / 996.523 8666.0 42.84652614593506 43 17 10 6 10 2.9312645044520766 34.11496978458189 0.030498504638671875 3 0.9742329779439569 7.671729450580375 8666.0 61.245961660268094 0.0 - - - - - - - 203.2 17 15 CST9L cystatin 9-like 87 11 B20140214_SF053_03 B20140214_SF053_03 TB464276.[MT7]-YLPATVEFAVHTFNQQSK[MT7].4y6_1.heavy 592.819 / 895.475 5857.0 42.84652614593506 43 17 10 6 10 2.9312645044520766 34.11496978458189 0.030498504638671875 3 0.9742329779439569 7.671729450580375 5857.0 13.87568578553616 1.0 - - - - - - - 229.8 11 15 CST9L cystatin 9-like 89 12 B20140214_SF053_03 B20140214_SF053_03 TB464270.[MT7]-MMDFETFLPMLQHISK[MT7].4y4_1.heavy 564.792 / 628.39 6255.0 49.27805137634277 42 17 10 7 8 3.8075130422632117 26.263862760285996 0.029499053955078125 4 0.9723757750196401 7.408195972623239 6255.0 49.02846534653465 0.0 - - - - - - - 178.8181818181818 12 22 MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 91 12 B20140214_SF053_03 B20140214_SF053_03 TB464270.[MT7]-MMDFETFLPMLQHISK[MT7].4b4_1.heavy 564.792 / 669.286 5246.0 49.27805137634277 42 17 10 7 8 3.8075130422632117 26.263862760285996 0.029499053955078125 4 0.9723757750196401 7.408195972623239 5246.0 27.042087065849444 0.0 - - - - - - - 180.14285714285714 10 21 MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 93 12 B20140214_SF053_03 B20140214_SF053_03 TB464270.[MT7]-MMDFETFLPMLQHISK[MT7].4b5_1.heavy 564.792 / 798.328 4641.0 49.27805137634277 42 17 10 7 8 3.8075130422632117 26.263862760285996 0.029499053955078125 4 0.9723757750196401 7.408195972623239 4641.0 43.29084387908989 1.0 - - - - - - - 138.625 9 16 MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 95 12 B20140214_SF053_03 B20140214_SF053_03 TB464270.[MT7]-MMDFETFLPMLQHISK[MT7].4b3_1.heavy 564.792 / 522.217 9180.0 49.27805137634277 42 17 10 7 8 3.8075130422632117 26.263862760285996 0.029499053955078125 4 0.9723757750196401 7.408195972623239 9180.0 7.603876206316294 1.0 - - - - - - - 642.875 18 8 MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 97 13 B20140214_SF053_03 B20140214_SF053_03 TB464189.[MT7]-FYGPEGPYGVFAGR.3y7_1.heavy 554.28 / 769.399 41793.0 39.6518497467041 46 20 10 6 10 13.378685625542317 7.47457581401584 0.034099578857421875 3 0.9960404232704361 19.606252081078104 41793.0 93.10521670504971 0.0 - - - - - - - 325.6666666666667 83 9 PGRMC1 progesterone receptor membrane component 1 99 13 B20140214_SF053_03 B20140214_SF053_03 TB464189.[MT7]-FYGPEGPYGVFAGR.3b6_1.heavy 554.28 / 795.379 44481.0 39.6518497467041 46 20 10 6 10 13.378685625542317 7.47457581401584 0.034099578857421875 3 0.9960404232704361 19.606252081078104 44481.0 136.44478527607362 1.0 - - - - - - - 253.33333333333334 88 9 PGRMC1 progesterone receptor membrane component 1 101 13 B20140214_SF053_03 B20140214_SF053_03 TB464189.[MT7]-FYGPEGPYGVFAGR.3b5_1.heavy 554.28 / 738.358 19226.0 39.6518497467041 46 20 10 6 10 13.378685625542317 7.47457581401584 0.034099578857421875 3 0.9960404232704361 19.606252081078104 19226.0 91.93335045473485 0.0 - - - - - - - 225.30769230769232 38 13 PGRMC1 progesterone receptor membrane component 1 103 13 B20140214_SF053_03 B20140214_SF053_03 TB464189.[MT7]-FYGPEGPYGVFAGR.3b3_1.heavy 554.28 / 512.263 60449.0 39.6518497467041 46 20 10 6 10 13.378685625542317 7.47457581401584 0.034099578857421875 3 0.9960404232704361 19.606252081078104 60449.0 87.03590152411402 0.0 - - - - - - - 1293.125 120 8 PGRMC1 progesterone receptor membrane component 1 105 14 B20140214_SF053_03 B20140214_SF053_03 TB464183.[MT7]-AMQRPETAATLK[MT7].3y3_1.heavy 535.639 / 505.347 18448.0 23.69807529449463 39 13 10 6 10 1.738380942335752 41.03573222921049 0.030300140380859375 3 0.9296772477534722 4.626322579091824 18448.0 13.75144063056964 0.0 - - - - - - - 1719.25 36 8 MRPS6 mitochondrial ribosomal protein S6 107 14 B20140214_SF053_03 B20140214_SF053_03 TB464183.[MT7]-AMQRPETAATLK[MT7].3y11_2.heavy 535.639 / 695.386 23890.0 23.69807529449463 39 13 10 6 10 1.738380942335752 41.03573222921049 0.030300140380859375 3 0.9296772477534722 4.626322579091824 23890.0 61.2061873214173 0.0 - - - - - - - 654.5 47 12 MRPS6 mitochondrial ribosomal protein S6 109 14 B20140214_SF053_03 B20140214_SF053_03 TB464183.[MT7]-AMQRPETAATLK[MT7].3y4_1.heavy 535.639 / 576.384 12646.0 23.69807529449463 39 13 10 6 10 1.738380942335752 41.03573222921049 0.030300140380859375 3 0.9296772477534722 4.626322579091824 12646.0 12.14996069919523 1.0 - - - - - - - 744.8571428571429 25 14 MRPS6 mitochondrial ribosomal protein S6 111 14 B20140214_SF053_03 B20140214_SF053_03 TB464183.[MT7]-AMQRPETAATLK[MT7].3y8_1.heavy 535.639 / 974.564 7529.0 23.69807529449463 39 13 10 6 10 1.738380942335752 41.03573222921049 0.030300140380859375 3 0.9296772477534722 4.626322579091824 7529.0 68.44159822211093 0.0 - - - - - - - 129.08695652173913 15 23 MRPS6 mitochondrial ribosomal protein S6 113 15 B20140214_SF053_03 B20140214_SF053_03 TB464182.[MT7]-AMQRPETAATLK[MT7].2y8_1.heavy 802.955 / 974.564 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS6 mitochondrial ribosomal protein S6 115 15 B20140214_SF053_03 B20140214_SF053_03 TB464182.[MT7]-AMQRPETAATLK[MT7].2b4_1.heavy 802.955 / 631.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS6 mitochondrial ribosomal protein S6 117 15 B20140214_SF053_03 B20140214_SF053_03 TB464182.[MT7]-AMQRPETAATLK[MT7].2b6_1.heavy 802.955 / 857.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS6 mitochondrial ribosomal protein S6 119 15 B20140214_SF053_03 B20140214_SF053_03 TB464182.[MT7]-AMQRPETAATLK[MT7].2y3_1.heavy 802.955 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS6 mitochondrial ribosomal protein S6 121 16 B20140214_SF053_03 B20140214_SF053_03 TB464282.[MT7]-GLIAAIC[CAM]AGPTALLAHEIGFGSK[MT7].4y5_1.heavy 639.612 / 639.358 N/A 48.574598948160805 37 18 2 7 10 6.409164846158969 15.602656882812163 0.027301788330078125 3 0.9858006240752659 10.3445714966575 58838.0 6.846313085491093 1.0 - - - - - - - 6897.0 514 2 PARK7 Parkinson disease (autosomal recessive, early onset) 7 123 16 B20140214_SF053_03 B20140214_SF053_03 TB464282.[MT7]-GLIAAIC[CAM]AGPTALLAHEIGFGSK[MT7].4y8_1.heavy 639.612 / 1018.54 15841.0 48.574598948160805 37 18 2 7 10 6.409164846158969 15.602656882812163 0.027301788330078125 3 0.9858006240752659 10.3445714966575 15841.0 62.4689465754663 0.0 - - - - - - - 205.4375 31 16 PARK7 Parkinson disease (autosomal recessive, early onset) 7 125 16 B20140214_SF053_03 B20140214_SF053_03 TB464282.[MT7]-GLIAAIC[CAM]AGPTALLAHEIGFGSK[MT7].4b5_1.heavy 639.612 / 570.373 115198.0 48.574598948160805 37 18 2 7 10 6.409164846158969 15.602656882812163 0.027301788330078125 3 0.9858006240752659 10.3445714966575 115198.0 263.7604716046301 0.0 - - - - - - - 395.0 230 6 PARK7 Parkinson disease (autosomal recessive, early onset) 7 127 16 B20140214_SF053_03 B20140214_SF053_03 TB464282.[MT7]-GLIAAIC[CAM]AGPTALLAHEIGFGSK[MT7].4y6_1.heavy 639.612 / 752.442 27587.0 48.574598948160805 37 18 2 7 10 6.409164846158969 15.602656882812163 0.027301788330078125 3 0.9858006240752659 10.3445714966575 27587.0 42.26650827866291 0.0 - - - - - - - 302.6923076923077 55 13 PARK7 Parkinson disease (autosomal recessive, early onset) 7 129 17 B20140214_SF053_03 B20140214_SF053_03 TB464283.[MT7]-LAGDMGELALEGAEGQVEGSAPDK[MT7].3b9_1.heavy 878.105 / 1002.5 38254.0 39.847999572753906 41 11 10 10 10 1.2481519301009694 63.81160010859888 0.0 3 0.8631574549403477 3.2973887186044104 38254.0 158.28265545008185 0.0 - - - - - - - 771.5 76 8 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 131 17 B20140214_SF053_03 B20140214_SF053_03 TB464283.[MT7]-LAGDMGELALEGAEGQVEGSAPDK[MT7].3y3_1.heavy 878.105 / 503.295 95269.0 39.847999572753906 41 11 10 10 10 1.2481519301009694 63.81160010859888 0.0 3 0.8631574549403477 3.2973887186044104 95269.0 122.80877889766748 0.0 - - - - - - - 284.3333333333333 190 6 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 133 17 B20140214_SF053_03 B20140214_SF053_03 TB464283.[MT7]-LAGDMGELALEGAEGQVEGSAPDK[MT7].3b4_1.heavy 878.105 / 501.279 25178.0 39.847999572753906 41 11 10 10 10 1.2481519301009694 63.81160010859888 0.0 3 0.8631574549403477 3.2973887186044104 25178.0 27.43479498359087 0.0 - - - - - - - 755.4 50 10 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 135 17 B20140214_SF053_03 B20140214_SF053_03 TB464283.[MT7]-LAGDMGELALEGAEGQVEGSAPDK[MT7].3b7_1.heavy 878.105 / 818.383 41909.0 39.847999572753906 41 11 10 10 10 1.2481519301009694 63.81160010859888 0.0 3 0.8631574549403477 3.2973887186044104 41909.0 174.29797507106557 0.0 - - - - - - - 766.0 83 7 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 137 18 B20140214_SF053_03 B20140214_SF053_03 TB246418.[MT7]-DTDNEEEIR.2y8_1.heavy 632.792 / 1005.45 8305.0 20.53600025177002 44 18 10 6 10 39.12624918389418 2.555828940566164 0.03840065002441406 3 0.9836625069047624 9.642210505958582 8305.0 68.70874026893134 0.0 - - - - - - - 107.05555555555556 16 18 CALML3 calmodulin-like 3 139 18 B20140214_SF053_03 B20140214_SF053_03 TB246418.[MT7]-DTDNEEEIR.2b4_1.heavy 632.792 / 590.254 2440.0 20.53600025177002 44 18 10 6 10 39.12624918389418 2.555828940566164 0.03840065002441406 3 0.9836625069047624 9.642210505958582 2440.0 10.210563309569235 0.0 - - - - - - - 219.38095238095238 4 21 CALML3 calmodulin-like 3 141 18 B20140214_SF053_03 B20140214_SF053_03 TB246418.[MT7]-DTDNEEEIR.2y6_1.heavy 632.792 / 789.374 10510.0 20.53600025177002 44 18 10 6 10 39.12624918389418 2.555828940566164 0.03840065002441406 3 0.9836625069047624 9.642210505958582 10510.0 41.88551982620269 0.0 - - - - - - - 230.47619047619048 21 21 CALML3 calmodulin-like 3 143 18 B20140214_SF053_03 B20140214_SF053_03 TB246418.[MT7]-DTDNEEEIR.2b5_1.heavy 632.792 / 719.296 4605.0 20.53600025177002 44 18 10 6 10 39.12624918389418 2.555828940566164 0.03840065002441406 3 0.9836625069047624 9.642210505958582 4605.0 20.059959240299406 0.0 - - - - - - - 164.35294117647058 9 17 CALML3 calmodulin-like 3 145 19 B20140214_SF053_03 B20140214_SF053_03 TB464284.[MT7]-LAAPQSYPVTWPGSGREAFTNPR.3y18_2.heavy 882.79 / 1011.49 5811.0 36.218525886535645 41 15 10 6 10 4.8212951031338465 20.74131490831165 0.039501190185546875 3 0.9561057579952319 5.868904823733579 5811.0 13.856930057893914 0.0 - - - - - - - 325.61538461538464 11 13 FAM163A family with sequence similarity 163, member A 147 19 B20140214_SF053_03 B20140214_SF053_03 TB464284.[MT7]-LAAPQSYPVTWPGSGREAFTNPR.3y6_1.heavy 882.79 / 705.368 2656.0 36.218525886535645 41 15 10 6 10 4.8212951031338465 20.74131490831165 0.039501190185546875 3 0.9561057579952319 5.868904823733579 2656.0 12.714666666666666 0.0 - - - - - - - 237.14285714285714 5 14 FAM163A family with sequence similarity 163, member A 149 19 B20140214_SF053_03 B20140214_SF053_03 TB464284.[MT7]-LAAPQSYPVTWPGSGREAFTNPR.3y20_2.heavy 882.79 / 1124.05 51136.0 36.218525886535645 41 15 10 6 10 4.8212951031338465 20.74131490831165 0.039501190185546875 3 0.9561057579952319 5.868904823733579 51136.0 75.1594921837304 0.0 - - - - - - - 324.45454545454544 102 11 FAM163A family with sequence similarity 163, member A 151 19 B20140214_SF053_03 B20140214_SF053_03 TB464284.[MT7]-LAAPQSYPVTWPGSGREAFTNPR.3y16_2.heavy 882.79 / 886.447 13282.0 36.218525886535645 41 15 10 6 10 4.8212951031338465 20.74131490831165 0.039501190185546875 3 0.9561057579952319 5.868904823733579 13282.0 31.920596068484464 0.0 - - - - - - - 215.8 26 15 FAM163A family with sequence similarity 163, member A 153 20 B20140214_SF053_03 B20140214_SF053_03 TB464285.[MT7]-LAAPQSYPVTWPGSGREAFTNPR.4y16_2.heavy 662.344 / 886.447 60900.0 36.19877529144287 39 13 10 6 10 1.9416600388143015 43.90684850442493 0.039501190185546875 3 0.9017154282488209 3.903882790020142 60900.0 49.497165432065934 0.0 - - - - - - - 290.5 121 8 FAM163A family with sequence similarity 163, member A 155 20 B20140214_SF053_03 B20140214_SF053_03 TB464285.[MT7]-LAAPQSYPVTWPGSGREAFTNPR.4y12_2.heavy 662.344 / 644.823 40075.0 36.19877529144287 39 13 10 6 10 1.9416600388143015 43.90684850442493 0.039501190185546875 3 0.9017154282488209 3.903882790020142 40075.0 12.606716799521518 0.0 - - - - - - - 1659.0 80 1 FAM163A family with sequence similarity 163, member A 157 20 B20140214_SF053_03 B20140214_SF053_03 TB464285.[MT7]-LAAPQSYPVTWPGSGREAFTNPR.4b5_1.heavy 662.344 / 625.379 11367.0 36.19877529144287 39 13 10 6 10 1.9416600388143015 43.90684850442493 0.039501190185546875 3 0.9017154282488209 3.903882790020142 11367.0 18.05267819590803 0.0 - - - - - - - 811.5555555555555 22 9 FAM163A family with sequence similarity 163, member A 159 20 B20140214_SF053_03 B20140214_SF053_03 TB464285.[MT7]-LAAPQSYPVTWPGSGREAFTNPR.4y14_2.heavy 662.344 / 788.387 26053.0 36.19877529144287 39 13 10 6 10 1.9416600388143015 43.90684850442493 0.039501190185546875 3 0.9017154282488209 3.903882790020142 26053.0 73.72427556379364 0.0 - - - - - - - 415.0 52 6 FAM163A family with sequence similarity 163, member A 161 21 B20140214_SF053_03 B20140214_SF053_03 TB464286.[MT7]-FLEELLTTQC[CAM]DRFSQEEIK[MT7].4b4_1.heavy 669.346 / 663.347 170588.0 44.60377502441406 43 17 10 6 10 3.738041153249734 26.751979419237582 0.038299560546875 3 0.9726362121222109 7.443529736591513 170588.0 132.0273735701528 0.0 - - - - - - - 757.0 341 3 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 163 21 B20140214_SF053_03 B20140214_SF053_03 TB464286.[MT7]-FLEELLTTQC[CAM]DRFSQEEIK[MT7].4y13_2.heavy 669.346 / 893.432 53511.0 44.60377502441406 43 17 10 6 10 3.738041153249734 26.751979419237582 0.038299560546875 3 0.9726362121222109 7.443529736591513 53511.0 131.5237434217059 0.0 - - - - - - - 228.27272727272728 107 11 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 165 21 B20140214_SF053_03 B20140214_SF053_03 TB464286.[MT7]-FLEELLTTQC[CAM]DRFSQEEIK[MT7].4b5_1.heavy 669.346 / 776.431 100618.0 44.60377502441406 43 17 10 6 10 3.738041153249734 26.751979419237582 0.038299560546875 3 0.9726362121222109 7.443529736591513 100618.0 157.00042319131404 0.0 - - - - - - - 347.14285714285717 201 7 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 167 21 B20140214_SF053_03 B20140214_SF053_03 TB464286.[MT7]-FLEELLTTQC[CAM]DRFSQEEIK[MT7].4b3_1.heavy 669.346 / 534.304 39404.0 44.60377502441406 43 17 10 6 10 3.738041153249734 26.751979419237582 0.038299560546875 3 0.9726362121222109 7.443529736591513 39404.0 108.67975346687211 0.0 - - - - - - - 346.09090909090907 78 11 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 169 22 B20140214_SF053_03 B20140214_SF053_03 TB464287.[MT7]-GLWPFASAAGGGGSEAAGAEQALVRPR.3b3_1.heavy 909.808 / 501.294 33187.0 40.853599548339844 48 18 10 10 10 9.660260358021446 10.351687873191171 0.0 3 0.9811766533889633 8.98111685790623 33187.0 96.51444298210126 0.0 - - - - - - - 772.8571428571429 66 7 TUSC2 tumor suppressor candidate 2 171 22 B20140214_SF053_03 B20140214_SF053_03 TB464287.[MT7]-GLWPFASAAGGGGSEAAGAEQALVRPR.3y24_2.heavy 909.808 / 1114.06 38840.0 40.853599548339844 48 18 10 10 10 9.660260358021446 10.351687873191171 0.0 3 0.9811766533889633 8.98111685790623 38840.0 133.09592414349794 0.0 - - - - - - - 230.71428571428572 77 7 TUSC2 tumor suppressor candidate 2 173 22 B20140214_SF053_03 B20140214_SF053_03 TB464287.[MT7]-GLWPFASAAGGGGSEAAGAEQALVRPR.3b24_2.heavy 909.808 / 1150.57 1130.0 40.853599548339844 48 18 10 10 10 9.660260358021446 10.351687873191171 0.0 3 0.9811766533889633 8.98111685790623 1130.0 4.342561983471074 1.0 - - - - - - - 204.11764705882354 2 17 TUSC2 tumor suppressor candidate 2 175 22 B20140214_SF053_03 B20140214_SF053_03 TB464287.[MT7]-GLWPFASAAGGGGSEAAGAEQALVRPR.3y19_2.heavy 909.808 / 877.451 4280.0 40.853599548339844 48 18 10 10 10 9.660260358021446 10.351687873191171 0.0 3 0.9811766533889633 8.98111685790623 4280.0 0.7571870853604601 0.0 - - - - - - - 279.46153846153845 8 13 TUSC2 tumor suppressor candidate 2 177 23 B20140214_SF053_03 B20140214_SF053_03 TB464288.[MT7]-AIVFRPFK[MT7]GEVVDAVVTQVNK[MT7].3y3_1.heavy 916.876 / 504.326 6362.0 38.215599060058594 43 13 10 10 10 1.4646868206025017 45.4254050965465 0.0 3 0.9262539245971676 4.516345078802456 6362.0 22.977546017409956 0.0 - - - - - - - 685.6 12 10 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 179 23 B20140214_SF053_03 B20140214_SF053_03 TB464288.[MT7]-AIVFRPFK[MT7]GEVVDAVVTQVNK[MT7].3b10_2.heavy 916.876 / 717.429 6362.0 38.215599060058594 43 13 10 10 10 1.4646868206025017 45.4254050965465 0.0 3 0.9262539245971676 4.516345078802456 6362.0 13.087493165664297 0.0 - - - - - - - 330.47058823529414 12 17 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 181 23 B20140214_SF053_03 B20140214_SF053_03 TB464288.[MT7]-AIVFRPFK[MT7]GEVVDAVVTQVNK[MT7].3y8_1.heavy 916.876 / 1002.61 5205.0 38.215599060058594 43 13 10 10 10 1.4646868206025017 45.4254050965465 0.0 3 0.9262539245971676 4.516345078802456 5205.0 50.538870967741936 0.0 - - - - - - - 211.16666666666666 10 18 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 183 23 B20140214_SF053_03 B20140214_SF053_03 TB464288.[MT7]-AIVFRPFK[MT7]GEVVDAVVTQVNK[MT7].3b13_2.heavy 916.876 / 874.011 14458.0 38.215599060058594 43 13 10 10 10 1.4646868206025017 45.4254050965465 0.0 3 0.9262539245971676 4.516345078802456 14458.0 31.621815198661718 0.0 - - - - - - - 295.8333333333333 28 12 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 185 24 B20140214_SF053_03 B20140214_SF053_03 TB464289.[MT7]-IAAVHNVPLSVLIRPLPSVLDPAK[MT7].4b7_1.heavy 702.683 / 849.506 23107.0 43.4921989440918 47 17 10 10 10 1.277704217105222 45.830843331572204 0.0 3 0.9742791515539236 7.678642266813682 23107.0 84.99854971599143 0.0 - - - - - - - 699.625 46 8 SRXN1 sulfiredoxin 1 187 24 B20140214_SF053_03 B20140214_SF053_03 TB464289.[MT7]-IAAVHNVPLSVLIRPLPSVLDPAK[MT7].4y3_1.heavy 702.683 / 459.305 311828.0 43.4921989440918 47 17 10 10 10 1.277704217105222 45.830843331572204 0.0 3 0.9742791515539236 7.678642266813682 311828.0 386.5094499680987 0.0 - - - - - - - 405.0 623 1 SRXN1 sulfiredoxin 1 189 24 B20140214_SF053_03 B20140214_SF053_03 TB464289.[MT7]-IAAVHNVPLSVLIRPLPSVLDPAK[MT7].4y17_2.heavy 702.683 / 980.11 104429.0 43.4921989440918 47 17 10 10 10 1.277704217105222 45.830843331572204 0.0 3 0.9742791515539236 7.678642266813682 104429.0 568.2199766841422 0.0 - - - - - - - 294.54545454545456 208 11 SRXN1 sulfiredoxin 1 191 24 B20140214_SF053_03 B20140214_SF053_03 TB464289.[MT7]-IAAVHNVPLSVLIRPLPSVLDPAK[MT7].4b6_1.heavy 702.683 / 750.438 34539.0 43.4921989440918 47 17 10 10 10 1.277704217105222 45.830843331572204 0.0 3 0.9742791515539236 7.678642266813682 34539.0 99.46073293745954 0.0 - - - - - - - 317.25 69 12 SRXN1 sulfiredoxin 1 193 25 B20140214_SF053_03 B20140214_SF053_03 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1543340.0 31.097666422526043 24 -3 10 7 10 null 0.0 0.028299331665039062 3 0.0 0.0 1543340.0 388.8376843376246 0.0 - - - - - - - 729.0 3086 1 195 25 B20140214_SF053_03 B20140214_SF053_03 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 449571.0 31.097666422526043 24 -3 10 7 10 null 0.0 0.028299331665039062 3 0.0 0.0 449571.0 163.0312093712962 0.0 - - - - - - - 547.0 899 1 197 25 B20140214_SF053_03 B20140214_SF053_03 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 329363.0 31.097666422526043 24 -3 10 7 10 null 0.0 0.028299331665039062 3 0.0 0.0 329363.0 258.5445443914667 0.0 - - - - - - - 1777.0 658 1 199 26 B20140214_SF053_03 B20140214_SF053_03 TB464280.[MT7]-SASLLSLQTELLLDLVAEAQSR.4b4_1.heavy 626.104 / 503.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 201 26 B20140214_SF053_03 B20140214_SF053_03 TB464280.[MT7]-SASLLSLQTELLLDLVAEAQSR.4b5_1.heavy 626.104 / 616.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 203 26 B20140214_SF053_03 B20140214_SF053_03 TB464280.[MT7]-SASLLSLQTELLLDLVAEAQSR.4y6_1.heavy 626.104 / 661.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 205 26 B20140214_SF053_03 B20140214_SF053_03 TB464280.[MT7]-SASLLSLQTELLLDLVAEAQSR.4b6_1.heavy 626.104 / 703.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 207 27 B20140214_SF053_03 B20140214_SF053_03 TB107955.[MT7]-RRTVEGGSSSVFSMFDQTQIQEFK[MT7].4y5_1.heavy 763.89 / 808.469 8754.0 39.686500549316406 43 17 10 6 10 2.174133903744421 31.696489967235763 0.0352020263671875 3 0.9729724197054134 7.4898952277350155 8754.0 7.978800493667229 0.0 - - - - - - - 780.2307692307693 17 13 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 209 27 B20140214_SF053_03 B20140214_SF053_03 TB107955.[MT7]-RRTVEGGSSSVFSMFDQTQIQEFK[MT7].4y4_1.heavy 763.89 / 695.385 14889.0 39.686500549316406 43 17 10 6 10 2.174133903744421 31.696489967235763 0.0352020263671875 3 0.9729724197054134 7.4898952277350155 14889.0 11.98096256684492 0.0 - - - - - - - 838.625 29 8 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 211 27 B20140214_SF053_03 B20140214_SF053_03 TB107955.[MT7]-RRTVEGGSSSVFSMFDQTQIQEFK[MT7].4b16_2.heavy 763.89 / 944.461 13171.0 39.686500549316406 43 17 10 6 10 2.174133903744421 31.696489967235763 0.0352020263671875 3 0.9729724197054134 7.4898952277350155 13171.0 10.316537764839076 0.0 - - - - - - - 727.1111111111111 26 9 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 213 27 B20140214_SF053_03 B20140214_SF053_03 TB107955.[MT7]-RRTVEGGSSSVFSMFDQTQIQEFK[MT7].4y3_1.heavy 763.89 / 567.326 10308.0 39.686500549316406 43 17 10 6 10 2.174133903744421 31.696489967235763 0.0352020263671875 3 0.9729724197054134 7.4898952277350155 10308.0 7.988712161970834 0.0 - - - - - - - 743.6363636363636 20 11 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 215 28 B20140214_SF053_03 B20140214_SF053_03 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 201154.0 17.877099990844727 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 201154.0 483.99829908259557 0.0 - - - - - - - 667.0769230769231 402 13 217 28 B20140214_SF053_03 B20140214_SF053_03 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 392823.0 17.877099990844727 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 392823.0 1281.845192617073 0.0 - - - - - - - 259.75 785 12 219 28 B20140214_SF053_03 B20140214_SF053_03 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 152268.0 17.877099990844727 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 152268.0 404.92170715701155 0.0 - - - - - - - 298.15384615384613 304 13 221 29 B20140214_SF053_03 B20140214_SF053_03 TB107954.[MT7]-EISILQEQISHLQFVIHSQHQNLR.4y8_1.heavy 761.165 / 1019.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCDC68 coiled-coil domain containing 68 223 29 B20140214_SF053_03 B20140214_SF053_03 TB107954.[MT7]-EISILQEQISHLQFVIHSQHQNLR.4b4_1.heavy 761.165 / 587.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCDC68 coiled-coil domain containing 68 225 29 B20140214_SF053_03 B20140214_SF053_03 TB107954.[MT7]-EISILQEQISHLQFVIHSQHQNLR.4b5_1.heavy 761.165 / 700.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCDC68 coiled-coil domain containing 68 227 29 B20140214_SF053_03 B20140214_SF053_03 TB107954.[MT7]-EISILQEQISHLQFVIHSQHQNLR.4y7_1.heavy 761.165 / 882.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCDC68 coiled-coil domain containing 68 229 30 B20140214_SF053_03 B20140214_SF053_03 TB464056.[MT7]-LAC[CAM]TPSLIR.2y8_1.heavy 587.84 / 917.487 65050.0 32.920799255371094 50 20 10 10 10 9.795521256813274 10.208747179272876 0.0 3 0.9973456258977023 23.94887913734659 65050.0 191.17088075866195 0.0 - - - - - - - 252.71428571428572 130 7 ATP5G3 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) 231 30 B20140214_SF053_03 B20140214_SF053_03 TB464056.[MT7]-LAC[CAM]TPSLIR.2y5_1.heavy 587.84 / 585.372 29367.0 32.920799255371094 50 20 10 10 10 9.795521256813274 10.208747179272876 0.0 3 0.9973456258977023 23.94887913734659 29367.0 84.17173862603146 0.0 - - - - - - - 1081.5 58 8 ATP5G3 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) 233 30 B20140214_SF053_03 B20140214_SF053_03 TB464056.[MT7]-LAC[CAM]TPSLIR.2y6_1.heavy 587.84 / 686.42 15347.0 32.920799255371094 50 20 10 10 10 9.795521256813274 10.208747179272876 0.0 3 0.9973456258977023 23.94887913734659 15347.0 31.989788918205804 0.0 - - - - - - - 729.0909090909091 30 11 ATP5G3 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) 235 30 B20140214_SF053_03 B20140214_SF053_03 TB464056.[MT7]-LAC[CAM]TPSLIR.2y7_1.heavy 587.84 / 846.45 21599.0 32.920799255371094 50 20 10 10 10 9.795521256813274 10.208747179272876 0.0 3 0.9973456258977023 23.94887913734659 21599.0 67.5590132448601 0.0 - - - - - - - 655.125 43 8 ATP5G3 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) 237 31 B20140214_SF053_03 B20140214_SF053_03 TB246443.[MT7]-EEGDWNSSK[MT7].2y4_1.heavy 670.322 / 579.322 1895.0 22.523500442504883 48 18 10 10 10 5.2951651903116455 18.885152097420125 0.0 3 0.9892370730778851 11.88521054999389 1895.0 11.39746376811594 0.0 - - - - - - - 234.06896551724137 3 29 CLEC2B C-type lectin domain family 2, member B 239 31 B20140214_SF053_03 B20140214_SF053_03 TB246443.[MT7]-EEGDWNSSK[MT7].2y8_1.heavy 670.322 / 1066.49 2447.0 22.523500442504883 48 18 10 10 10 5.2951651903116455 18.885152097420125 0.0 3 0.9892370730778851 11.88521054999389 2447.0 17.40088888888889 0.0 - - - - - - - 139.38095238095238 4 21 CLEC2B C-type lectin domain family 2, member B 241 31 B20140214_SF053_03 B20140214_SF053_03 TB246443.[MT7]-EEGDWNSSK[MT7].2y5_1.heavy 670.322 / 765.401 5066.0 22.523500442504883 48 18 10 10 10 5.2951651903116455 18.885152097420125 0.0 3 0.9892370730778851 11.88521054999389 5066.0 27.290059523809525 0.0 - - - - - - - 201.7037037037037 10 27 CLEC2B C-type lectin domain family 2, member B 243 31 B20140214_SF053_03 B20140214_SF053_03 TB246443.[MT7]-EEGDWNSSK[MT7].2b4_1.heavy 670.322 / 575.243 7030.0 22.523500442504883 48 18 10 10 10 5.2951651903116455 18.885152097420125 0.0 3 0.9892370730778851 11.88521054999389 7030.0 37.99104306767778 0.0 - - - - - - - 244.04166666666666 14 24 CLEC2B C-type lectin domain family 2, member B 245 32 B20140214_SF053_03 B20140214_SF053_03 TB464259.[MT7]-GLAPDLPEDLY[MT7]HLIK[MT7].4y4_1.heavy 532.311 / 654.442 20547.0 40.78070068359375 50 20 10 10 10 8.69414805136073 11.501989546215388 0.0 3 0.9939895197089241 15.910726646573442 20547.0 14.247997243694037 0.0 - - - - - - - 1236.2857142857142 41 7 RPS13 ribosomal protein S13 247 32 B20140214_SF053_03 B20140214_SF053_03 TB464259.[MT7]-GLAPDLPEDLY[MT7]HLIK[MT7].4b5_1.heavy 532.311 / 598.332 227468.0 40.78070068359375 50 20 10 10 10 8.69414805136073 11.501989546215388 0.0 3 0.9939895197089241 15.910726646573442 227468.0 247.0648374152895 0.0 - - - - - - - 1236.2857142857142 454 7 RPS13 ribosomal protein S13 249 32 B20140214_SF053_03 B20140214_SF053_03 TB464259.[MT7]-GLAPDLPEDLY[MT7]HLIK[MT7].4y3_1.heavy 532.311 / 517.383 57029.0 40.78070068359375 50 20 10 10 10 8.69414805136073 11.501989546215388 0.0 3 0.9939895197089241 15.910726646573442 57029.0 47.26090372382073 1.0 - - - - - - - 1342.6 114 5 RPS13 ribosomal protein S13 251 32 B20140214_SF053_03 B20140214_SF053_03 TB464259.[MT7]-GLAPDLPEDLY[MT7]HLIK[MT7].4b6_1.heavy 532.311 / 711.416 45138.0 40.78070068359375 50 20 10 10 10 8.69414805136073 11.501989546215388 0.0 3 0.9939895197089241 15.910726646573442 45138.0 114.38786440660698 0.0 - - - - - - - 728.0 90 8 RPS13 ribosomal protein S13 253 33 B20140214_SF053_03 B20140214_SF053_03 TB464052.[MT7]-LLK[MT7]PQK[MT7].2y4_1.heavy 579.9 / 788.523 2569.0 23.240574836730957 43 17 10 6 10 5.324778596198826 18.780123566336922 0.030300140380859375 3 0.9761687703886821 7.978529774551532 2569.0 5.37906273867976 2.0 - - - - - - - 644.3636363636364 5 11 RBP7 retinol binding protein 7, cellular 255 33 B20140214_SF053_03 B20140214_SF053_03 TB464052.[MT7]-LLK[MT7]PQK[MT7].2b3_1.heavy 579.9 / 643.474 6212.0 23.240574836730957 43 17 10 6 10 5.324778596198826 18.780123566336922 0.030300140380859375 3 0.9761687703886821 7.978529774551532 6212.0 16.47656361282397 0.0 - - - - - - - 609.625 12 8 RBP7 retinol binding protein 7, cellular 257 33 B20140214_SF053_03 B20140214_SF053_03 TB464052.[MT7]-LLK[MT7]PQK[MT7].2y5_1.heavy 579.9 / 901.607 2277.0 23.240574836730957 43 17 10 6 10 5.324778596198826 18.780123566336922 0.030300140380859375 3 0.9761687703886821 7.978529774551532 2277.0 4.662798634812287 1.0 - - - - - - - 182.24 4 25 RBP7 retinol binding protein 7, cellular 259 33 B20140214_SF053_03 B20140214_SF053_03 TB464052.[MT7]-LLK[MT7]PQK[MT7].2y3_1.heavy 579.9 / 516.326 10375.0 23.240574836730957 43 17 10 6 10 5.324778596198826 18.780123566336922 0.030300140380859375 3 0.9761687703886821 7.978529774551532 10375.0 14.15463712468672 0.0 - - - - - - - 1161.4285714285713 20 7 RBP7 retinol binding protein 7, cellular 261 34 B20140214_SF053_03 B20140214_SF053_03 TB464258.[MT7]-EAFTVIDQNRDGIIDK[MT7].3y3_1.heavy 708.051 / 519.326 14302.0 33.72369956970215 38 12 10 6 10 1.3747954255431445 48.926639743133 0.035602569580078125 3 0.8946883084878593 3.7690935736819258 14302.0 15.266722084320484 0.0 - - - - - - - 732.1111111111111 28 9 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 263 34 B20140214_SF053_03 B20140214_SF053_03 TB464258.[MT7]-EAFTVIDQNRDGIIDK[MT7].3y9_2.heavy 708.051 / 601.834 45219.0 33.72369956970215 38 12 10 6 10 1.3747954255431445 48.926639743133 0.035602569580078125 3 0.8946883084878593 3.7690935736819258 45219.0 39.1069741664048 0.0 - - - - - - - 747.6666666666666 90 9 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 265 34 B20140214_SF053_03 B20140214_SF053_03 TB464258.[MT7]-EAFTVIDQNRDGIIDK[MT7].3y5_1.heavy 708.051 / 689.431 22645.0 33.72369956970215 38 12 10 6 10 1.3747954255431445 48.926639743133 0.035602569580078125 3 0.8946883084878593 3.7690935736819258 22645.0 23.776607506595738 0.0 - - - - - - - 708.7777777777778 45 9 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 267 34 B20140214_SF053_03 B20140214_SF053_03 TB464258.[MT7]-EAFTVIDQNRDGIIDK[MT7].3y13_2.heavy 708.051 / 815.948 26921.0 33.72369956970215 38 12 10 6 10 1.3747954255431445 48.926639743133 0.035602569580078125 3 0.8946883084878593 3.7690935736819258 26921.0 84.38355714176593 0.0 - - - - - - - 272.1764705882353 53 17 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 269 35 B20140214_SF053_03 B20140214_SF053_03 TB464257.[MT7]-SEPPLPPGGQELLELLLR.3y7_1.heavy 701.404 / 869.582 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 271 35 B20140214_SF053_03 B20140214_SF053_03 TB464257.[MT7]-SEPPLPPGGQELLELLLR.3y11_1.heavy 701.404 / 1240.73 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 273 35 B20140214_SF053_03 B20140214_SF053_03 TB464257.[MT7]-SEPPLPPGGQELLELLLR.3b5_1.heavy 701.404 / 668.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 275 35 B20140214_SF053_03 B20140214_SF053_03 TB464257.[MT7]-SEPPLPPGGQELLELLLR.3y13_2.heavy 701.404 / 717.919 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 277 36 B20140214_SF053_03 B20140214_SF053_03 TB464190.[MT7]-ARIAAGLPMAGIPFLTTDLTYR.3b11_1.heavy 831.465 / 1153.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 279 36 B20140214_SF053_03 B20140214_SF053_03 TB464190.[MT7]-ARIAAGLPMAGIPFLTTDLTYR.3y5_1.heavy 831.465 / 667.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 281 36 B20140214_SF053_03 B20140214_SF053_03 TB464190.[MT7]-ARIAAGLPMAGIPFLTTDLTYR.3b7_1.heavy 831.465 / 797.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 283 36 B20140214_SF053_03 B20140214_SF053_03 TB464190.[MT7]-ARIAAGLPMAGIPFLTTDLTYR.3y10_1.heavy 831.465 / 1226.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 285 37 B20140214_SF053_03 B20140214_SF053_03 TB246445.[MT7]-YQSALLPHK[MT7].3y3_1.heavy 448.934 / 525.326 97275.0 28.927624225616455 41 15 10 6 10 3.409006291981258 23.142006844754412 0.03429985046386719 3 0.9593903348285896 6.103330476764989 97275.0 65.00881162177552 0.0 - - - - - - - 943.0 194 1 TMEM126A transmembrane protein 126A 287 37 B20140214_SF053_03 B20140214_SF053_03 TB246445.[MT7]-YQSALLPHK[MT7].3b4_1.heavy 448.934 / 594.3 75908.0 28.927624225616455 41 15 10 6 10 3.409006291981258 23.142006844754412 0.03429985046386719 3 0.9593903348285896 6.103330476764989 75908.0 34.988937946735845 0.0 - - - - - - - 673.0 151 1 TMEM126A transmembrane protein 126A 289 37 B20140214_SF053_03 B20140214_SF053_03 TB246445.[MT7]-YQSALLPHK[MT7].3b5_1.heavy 448.934 / 707.385 49513.0 28.927624225616455 41 15 10 6 10 3.409006291981258 23.142006844754412 0.03429985046386719 3 0.9593903348285896 6.103330476764989 49513.0 79.80879753726474 0.0 - - - - - - - 336.625 99 8 TMEM126A transmembrane protein 126A 291 37 B20140214_SF053_03 B20140214_SF053_03 TB246445.[MT7]-YQSALLPHK[MT7].3b3_1.heavy 448.934 / 523.263 17597.0 28.927624225616455 41 15 10 6 10 3.409006291981258 23.142006844754412 0.03429985046386719 3 0.9593903348285896 6.103330476764989 17597.0 8.09547215496368 1.0 - - - - - - - 1321.0 35 7 TMEM126A transmembrane protein 126A 293 38 B20140214_SF053_03 B20140214_SF053_03 TB464256.[MT7]-GASSFPVPPPGAQGVAELLR.3y11_1.heavy 698.72 / 1110.63 28355.0 42.60799980163574 39 13 10 6 10 1.057555236010293 61.35622057288923 0.03240203857421875 3 0.9192258720613439 4.312793234315778 28355.0 10.726369882755963 1.0 - - - - - - - 1292.6666666666667 56 3 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 295 38 B20140214_SF053_03 B20140214_SF053_03 TB464256.[MT7]-GASSFPVPPPGAQGVAELLR.3b5_1.heavy 698.72 / 594.3 71170.0 42.60799980163574 39 13 10 6 10 1.057555236010293 61.35622057288923 0.03240203857421875 3 0.9192258720613439 4.312793234315778 71170.0 17.98937406335568 1.0 - - - - - - - 2343.0 142 1 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 297 38 B20140214_SF053_03 B20140214_SF053_03 TB464256.[MT7]-GASSFPVPPPGAQGVAELLR.3y12_1.heavy 698.72 / 1207.68 12845.0 42.60799980163574 39 13 10 6 10 1.057555236010293 61.35622057288923 0.03240203857421875 3 0.9192258720613439 4.312793234315778 12845.0 0.0 2.0 - - - - - - - 363.5 25 2 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 299 38 B20140214_SF053_03 B20140214_SF053_03 TB464256.[MT7]-GASSFPVPPPGAQGVAELLR.3y12_2.heavy 698.72 / 604.343 100737.0 42.60799980163574 39 13 10 6 10 1.057555236010293 61.35622057288923 0.03240203857421875 3 0.9192258720613439 4.312793234315778 100737.0 21.641052097682525 0.0 - - - - - - - 2908.0 201 1 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 301 39 B20140214_SF053_03 B20140214_SF053_03 TB464254.[MT7]-GASSFPVPPPGAQGVAELLR.2y12_1.heavy 1047.58 / 1207.68 N/A 42.59449895222982 34 8 10 6 10 0.46244286754104996 109.94144831330817 0.03240203857421875 3 0.7571693579975494 2.4518990263043237 0.0 0.0 31.0 - - - - - - - 332.4375 2 16 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 303 39 B20140214_SF053_03 B20140214_SF053_03 TB464254.[MT7]-GASSFPVPPPGAQGVAELLR.2b7_1.heavy 1047.58 / 790.422 18294.0 42.59449895222982 34 8 10 6 10 0.46244286754104996 109.94144831330817 0.03240203857421875 3 0.7571693579975494 2.4518990263043237 18294.0 20.84890125191219 1.0 - - - - - - - 282.0 36 2 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 305 39 B20140214_SF053_03 B20140214_SF053_03 TB464254.[MT7]-GASSFPVPPPGAQGVAELLR.2b5_1.heavy 1047.58 / 594.3 11524.0 42.59449895222982 34 8 10 6 10 0.46244286754104996 109.94144831330817 0.03240203857421875 3 0.7571693579975494 2.4518990263043237 11524.0 1.5767868673042629 1.0 - - - - - - - 161.33333333333334 23 3 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 307 39 B20140214_SF053_03 B20140214_SF053_03 TB464254.[MT7]-GASSFPVPPPGAQGVAELLR.2y11_1.heavy 1047.58 / 1110.63 1048.0 42.59449895222982 34 8 10 6 10 0.46244286754104996 109.94144831330817 0.03240203857421875 3 0.7571693579975494 2.4518990263043237 1048.0 1.5159263975659574 1.0 - - - - - - - 251.41176470588235 2 17 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 309 40 B20140214_SF053_03 B20140214_SF053_03 TB464251.[MT7]-NAVPDIQGDSEAVSVRK[MT7].4y4_1.heavy 519.035 / 633.416 31976.0 28.314599990844727 38 8 10 10 10 0.5610737260227705 85.46502368455447 0.0 3 0.7991820392169564 2.7065111068725867 31976.0 44.50411510201992 0.0 - - - - - - - 1318.75 63 8 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 311 40 B20140214_SF053_03 B20140214_SF053_03 TB464251.[MT7]-NAVPDIQGDSEAVSVRK[MT7].4y10_2.heavy 519.035 / 596.326 380160.0 28.314599990844727 38 8 10 10 10 0.5610737260227705 85.46502368455447 0.0 3 0.7991820392169564 2.7065111068725867 380160.0 74.50627405691597 0.0 - - - - - - - 1382.0 760 2 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 313 40 B20140214_SF053_03 B20140214_SF053_03 TB464251.[MT7]-NAVPDIQGDSEAVSVRK[MT7].4b5_1.heavy 519.035 / 641.338 328096.0 28.314599990844727 38 8 10 10 10 0.5610737260227705 85.46502368455447 0.0 3 0.7991820392169564 2.7065111068725867 328096.0 209.53528940037768 0.0 - - - - - - - 737.0 656 1 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 315 40 B20140214_SF053_03 B20140214_SF053_03 TB464251.[MT7]-NAVPDIQGDSEAVSVRK[MT7].4y6_1.heavy 519.035 / 803.522 21102.0 28.314599990844727 38 8 10 10 10 0.5610737260227705 85.46502368455447 0.0 3 0.7991820392169564 2.7065111068725867 21102.0 33.67243015591591 0.0 - - - - - - - 710.7857142857143 42 14 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 317 41 B20140214_SF053_03 B20140214_SF053_03 TB464250.[MT7]-NAVPDIQGDSEAVSVRK[MT7].3b5_1.heavy 691.711 / 641.338 19128.0 28.314599990844727 35 5 10 10 10 0.5383212154429123 100.70269676356656 0.0 3 0.6065175153668227 1.8989067749982822 19128.0 35.62192621518899 0.0 - - - - - - - 783.5833333333334 38 12 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 319 41 B20140214_SF053_03 B20140214_SF053_03 TB464250.[MT7]-NAVPDIQGDSEAVSVRK[MT7].3y14_2.heavy 691.711 / 822.937 101956.0 28.314599990844727 35 5 10 10 10 0.5383212154429123 100.70269676356656 0.0 3 0.6065175153668227 1.8989067749982822 101956.0 56.6015085120675 0.0 - - - - - - - 322.8333333333333 203 6 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 321 41 B20140214_SF053_03 B20140214_SF053_03 TB464250.[MT7]-NAVPDIQGDSEAVSVRK[MT7].3y8_1.heavy 691.711 / 1019.6 10463.0 28.314599990844727 35 5 10 10 10 0.5383212154429123 100.70269676356656 0.0 3 0.6065175153668227 1.8989067749982822 10463.0 43.201307887440265 0.0 - - - - - - - 209.6 20 20 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 323 41 B20140214_SF053_03 B20140214_SF053_03 TB464250.[MT7]-NAVPDIQGDSEAVSVRK[MT7].3y10_1.heavy 691.711 / 1191.65 18160.0 28.314599990844727 35 5 10 10 10 0.5383212154429123 100.70269676356656 0.0 3 0.6065175153668227 1.8989067749982822 18160.0 61.02517392289854 0.0 - - - - - - - 205.94117647058823 36 17 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 325 42 B20140214_SF053_03 B20140214_SF053_03 TB107956.[MT7]-WGEGFVLVYDITDRGSFEEVLPLK[MT7].4b7_1.heavy 765.16 / 933.495 6703.0 49.83570098876953 41 11 10 10 10 1.7534045623017318 57.03190361768413 0.0 3 0.8591696348354133 3.2492299402602858 6703.0 29.409120557491292 0.0 - - - - - - - 232.25 13 20 RERG RAS-like, estrogen-regulated, growth inhibitor 327 42 B20140214_SF053_03 B20140214_SF053_03 TB107956.[MT7]-WGEGFVLVYDITDRGSFEEVLPLK[MT7].4b4_1.heavy 765.16 / 574.274 2777.0 49.83570098876953 41 11 10 10 10 1.7534045623017318 57.03190361768413 0.0 3 0.8591696348354133 3.2492299402602858 2777.0 11.782263161181541 0.0 - - - - - - - 287.25 5 20 RERG RAS-like, estrogen-regulated, growth inhibitor 329 42 B20140214_SF053_03 B20140214_SF053_03 TB107956.[MT7]-WGEGFVLVYDITDRGSFEEVLPLK[MT7].4b5_1.heavy 765.16 / 721.343 7804.0 49.83570098876953 41 11 10 10 10 1.7534045623017318 57.03190361768413 0.0 3 0.8591696348354133 3.2492299402602858 7804.0 20.948449839936806 1.0 - - - - - - - 670.3 15 10 RERG RAS-like, estrogen-regulated, growth inhibitor 331 42 B20140214_SF053_03 B20140214_SF053_03 TB107956.[MT7]-WGEGFVLVYDITDRGSFEEVLPLK[MT7].4y3_1.heavy 765.16 / 501.352 57501.0 49.83570098876953 41 11 10 10 10 1.7534045623017318 57.03190361768413 0.0 3 0.8591696348354133 3.2492299402602858 57501.0 94.12940113235766 0.0 - - - - - - - 372.44444444444446 115 9 RERG RAS-like, estrogen-regulated, growth inhibitor 333 43 B20140214_SF053_03 B20140214_SF053_03 TB107958.[MT7]-IFYPEIEEVQALDDTERGSGGFGSTGK[MT7].4y5_1.heavy 798.4 / 593.338 3377.0 42.96860122680664 48 18 10 10 10 6.727251557782533 14.864911642008295 0.0 3 0.9895441987563662 12.058813395157268 3377.0 2.9401741293532337 0.0 - - - - - - - 402.0 6 5 DUT deoxyuridine triphosphatase 335 43 B20140214_SF053_03 B20140214_SF053_03 TB107958.[MT7]-IFYPEIEEVQALDDTERGSGGFGSTGK[MT7].4b5_1.heavy 798.4 / 794.42 11821.0 42.96860122680664 48 18 10 10 10 6.727251557782533 14.864911642008295 0.0 3 0.9895441987563662 12.058813395157268 11821.0 6.00959437533802 0.0 - - - - - - - 322.0 23 1 DUT deoxyuridine triphosphatase 337 43 B20140214_SF053_03 B20140214_SF053_03 TB107958.[MT7]-IFYPEIEEVQALDDTERGSGGFGSTGK[MT7].4b6_1.heavy 798.4 / 907.505 2814.0 42.96860122680664 48 18 10 10 10 6.727251557782533 14.864911642008295 0.0 3 0.9895441987563662 12.058813395157268 2814.0 1.077129186602871 0.0 - - - - - - - 257.2 5 5 DUT deoxyuridine triphosphatase 339 43 B20140214_SF053_03 B20140214_SF053_03 TB107958.[MT7]-IFYPEIEEVQALDDTERGSGGFGSTGK[MT7].4b3_1.heavy 798.4 / 568.325 10775.0 42.96860122680664 48 18 10 10 10 6.727251557782533 14.864911642008295 0.0 3 0.9895441987563662 12.058813395157268 10775.0 1.2182023742227248 0.0 - - - - - - - 322.0 21 1 DUT deoxyuridine triphosphatase 341 44 B20140214_SF053_03 B20140214_SF053_03 TB107959.[MT7]-IFYPEIEEVQALDDTERGSGGFGSTGK[MT7].3y11_1.heavy 1064.2 / 1154.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 343 44 B20140214_SF053_03 B20140214_SF053_03 TB107959.[MT7]-IFYPEIEEVQALDDTERGSGGFGSTGK[MT7].3b3_1.heavy 1064.2 / 568.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 345 44 B20140214_SF053_03 B20140214_SF053_03 TB107959.[MT7]-IFYPEIEEVQALDDTERGSGGFGSTGK[MT7].3y5_1.heavy 1064.2 / 593.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 347 44 B20140214_SF053_03 B20140214_SF053_03 TB107959.[MT7]-IFYPEIEEVQALDDTERGSGGFGSTGK[MT7].3y10_1.heavy 1064.2 / 998.502 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 349 45 B20140214_SF053_03 B20140214_SF053_03 TB107960.[MT7]-TVC[CAM]TYWEDFHSC[CAM]TVTALTDC[CAM]QEGAK[MT7].4y4_1.heavy 817.621 / 548.316 23432.0 39.473923683166504 35 9 10 6 10 1.6884712170894307 47.28026754641306 0.032901763916015625 3 0.8106265541932918 2.7899600373936644 23432.0 45.91816303895136 0.0 - - - - - - - 756.6 46 10 NRN1 neuritin 1 351 45 B20140214_SF053_03 B20140214_SF053_03 TB107960.[MT7]-TVC[CAM]TYWEDFHSC[CAM]TVTALTDC[CAM]QEGAK[MT7].4b8_1.heavy 817.621 / 1199.52 3618.0 39.473923683166504 35 9 10 6 10 1.6884712170894307 47.28026754641306 0.032901763916015625 3 0.8106265541932918 2.7899600373936644 3618.0 22.704048582995952 0.0 - - - - - - - 129.0 7 14 NRN1 neuritin 1 353 45 B20140214_SF053_03 B20140214_SF053_03 TB107960.[MT7]-TVC[CAM]TYWEDFHSC[CAM]TVTALTDC[CAM]QEGAK[MT7].4b4_1.heavy 817.621 / 606.304 4440.0 39.473923683166504 35 9 10 6 10 1.6884712170894307 47.28026754641306 0.032901763916015625 3 0.8106265541932918 2.7899600373936644 4440.0 8.848632218844985 0.0 - - - - - - - 815.5 8 12 NRN1 neuritin 1 355 45 B20140214_SF053_03 B20140214_SF053_03 TB107960.[MT7]-TVC[CAM]TYWEDFHSC[CAM]TVTALTDC[CAM]QEGAK[MT7].4y6_1.heavy 817.621 / 836.405 5673.0 39.473923683166504 35 9 10 6 10 1.6884712170894307 47.28026754641306 0.032901763916015625 3 0.8106265541932918 2.7899600373936644 5673.0 13.805409242914314 1.0 - - - - - - - 347.1111111111111 11 18 NRN1 neuritin 1 357 46 B20140214_SF053_03 B20140214_SF053_03 TB107965.[MT7]-RVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLR.4b8_1.heavy 1106.51 / 1013.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - CETN1 centrin, EF-hand protein, 1 359 46 B20140214_SF053_03 B20140214_SF053_03 TB107965.[MT7]-RVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLR.4y10_1.heavy 1106.51 / 1221.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - CETN1 centrin, EF-hand protein, 1 361 46 B20140214_SF053_03 B20140214_SF053_03 TB107965.[MT7]-RVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLR.4b5_1.heavy 1106.51 / 714.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - CETN1 centrin, EF-hand protein, 1 363 46 B20140214_SF053_03 B20140214_SF053_03 TB107965.[MT7]-RVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLR.4b9_1.heavy 1106.51 / 1127.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - CETN1 centrin, EF-hand protein, 1 365 47 B20140214_SF053_03 B20140214_SF053_03 TB107963.[MT7]-DEYDDLSDLTAAQQETLSDWESQFTFK[MT7].3b8_1.heavy 1157.54 / 1097.44 2388.0 49.22642421722412 40 15 10 7 8 3.9712752376930642 25.180828327096904 0.029499053955078125 4 0.9596437518799233 6.122594666690907 2388.0 63.67999999999999 0.0 - - - - - - - 129.85714285714286 4 21 PGRMC1 progesterone receptor membrane component 1 367 47 B20140214_SF053_03 B20140214_SF053_03 TB107963.[MT7]-DEYDDLSDLTAAQQETLSDWESQFTFK[MT7].3y8_1.heavy 1157.54 / 1216.61 764.0 49.22642421722412 40 15 10 7 8 3.9712752376930642 25.180828327096904 0.029499053955078125 4 0.9596437518799233 6.122594666690907 764.0 13.372663877266389 0.0 - - - - - - - 0.0 1 0 PGRMC1 progesterone receptor membrane component 1 369 47 B20140214_SF053_03 B20140214_SF053_03 TB107963.[MT7]-DEYDDLSDLTAAQQETLSDWESQFTFK[MT7].3b4_1.heavy 1157.54 / 667.269 812.0 49.22642421722412 40 15 10 7 8 3.9712752376930642 25.180828327096904 0.029499053955078125 4 0.9596437518799233 6.122594666690907 812.0 13.363280977312392 1.0 - - - - - - - 0.0 1 0 PGRMC1 progesterone receptor membrane component 1 371 47 B20140214_SF053_03 B20140214_SF053_03 TB107963.[MT7]-DEYDDLSDLTAAQQETLSDWESQFTFK[MT7].3b5_1.heavy 1157.54 / 782.296 2435.0 49.22642421722412 40 15 10 7 8 3.9712752376930642 25.180828327096904 0.029499053955078125 4 0.9596437518799233 6.122594666690907 2435.0 22.791833689323227 0.0 - - - - - - - 135.11764705882354 4 17 PGRMC1 progesterone receptor membrane component 1 373 48 B20140214_SF053_03 B20140214_SF053_03 TB464269.[MT7]-RGASSFPVPPPGAQGVAELLR.4y5_1.heavy 563.317 / 601.367 12939.0 39.643324851989746 37 11 10 6 10 0.9656271781514257 59.886317652001416 0.034099578857421875 3 0.8572482809324646 3.2267442770199315 12939.0 3.332362955787693 1.0 - - - - - - - 485.0 25 1 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 375 48 B20140214_SF053_03 B20140214_SF053_03 TB464269.[MT7]-RGASSFPVPPPGAQGVAELLR.4b5_1.heavy 563.317 / 603.333 2830.0 39.643324851989746 37 11 10 6 10 0.9656271781514257 59.886317652001416 0.034099578857421875 3 0.8572482809324646 3.2267442770199315 2830.0 0.0 6.0 - - - - - - - 1686.857142857143 9 7 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 377 48 B20140214_SF053_03 B20140214_SF053_03 TB464269.[MT7]-RGASSFPVPPPGAQGVAELLR.4y7_1.heavy 563.317 / 757.457 10675.0 39.643324851989746 37 11 10 6 10 0.9656271781514257 59.886317652001416 0.034099578857421875 3 0.8572482809324646 3.2267442770199315 10675.0 7.927170882659296 0.0 - - - - - - - 1652.142857142857 21 7 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 379 48 B20140214_SF053_03 B20140214_SF053_03 TB464269.[MT7]-RGASSFPVPPPGAQGVAELLR.4b6_1.heavy 563.317 / 750.401 9057.0 39.643324851989746 37 11 10 6 10 0.9656271781514257 59.886317652001416 0.034099578857421875 3 0.8572482809324646 3.2267442770199315 9057.0 0.4115600287562904 2.0 - - - - - - - 296.3333333333333 18 3 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 381 49 B20140214_SF053_03 B20140214_SF053_03 TB464268.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].4y5_1.heavy 562.791 / 665.41 8831.0 45.60919952392578 45 17 10 10 8 4.601575436916286 21.73168762979453 0.0 4 0.9754066803267 7.853435655736454 8831.0 21.082608641168903 0.0 - - - - - - - 784.8888888888889 17 9 BET1 blocked early in transport 1 homolog (S. cerevisiae) 383 49 B20140214_SF053_03 B20140214_SF053_03 TB464268.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].4b4_1.heavy 562.791 / 571.357 21596.0 45.60919952392578 45 17 10 10 8 4.601575436916286 21.73168762979453 0.0 4 0.9754066803267 7.853435655736454 21596.0 53.342705344572 0.0 - - - - - - - 388.0 43 6 BET1 blocked early in transport 1 homolog (S. cerevisiae) 385 49 B20140214_SF053_03 B20140214_SF053_03 TB464268.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].4b5_1.heavy 562.791 / 702.398 9313.0 45.60919952392578 45 17 10 10 8 4.601575436916286 21.73168762979453 0.0 4 0.9754066803267 7.853435655736454 9313.0 27.75889448373966 1.0 - - - - - - - 305.0 22 10 BET1 blocked early in transport 1 homolog (S. cerevisiae) 387 49 B20140214_SF053_03 B20140214_SF053_03 TB464268.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].4b6_1.heavy 562.791 / 817.425 8831.0 45.60919952392578 45 17 10 10 8 4.601575436916286 21.73168762979453 0.0 4 0.9754066803267 7.853435655736454 8831.0 110.56789980544747 0.0 - - - - - - - 277.27272727272725 17 11 BET1 blocked early in transport 1 homolog (S. cerevisiae) 389 50 B20140214_SF053_03 B20140214_SF053_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 306462.0 20.009700775146484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 306462.0 1597.412227554285 0.0 - - - - - - - 679.8571428571429 612 7 391 50 B20140214_SF053_03 B20140214_SF053_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 189469.0 20.009700775146484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 189469.0 1429.617692323271 0.0 - - - - - - - 275.2307692307692 378 13 393 50 B20140214_SF053_03 B20140214_SF053_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 162335.0 20.009700775146484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 162335.0 629.0555285830376 0.0 - - - - - - - 230.35714285714286 324 14 395 51 B20140214_SF053_03 B20140214_SF053_03 TB464264.[MT7]-GEPLALPLNVSEY[MT7]C[CAM]VPR.4b4_1.heavy 551.301 / 541.31 21000.0 37.442800521850586 38 14 10 6 8 2.2315861417234846 35.137313905003765 0.035198211669921875 4 0.9312898381255674 4.68094187858665 21000.0 15.640400857879015 1.0 - - - - - - - 1712.142857142857 46 7 BEX2 brain expressed X-linked 2 397 51 B20140214_SF053_03 B20140214_SF053_03 TB464264.[MT7]-GEPLALPLNVSEY[MT7]C[CAM]VPR.4b5_1.heavy 551.301 / 612.347 40130.0 37.442800521850586 38 14 10 6 8 2.2315861417234846 35.137313905003765 0.035198211669921875 4 0.9312898381255674 4.68094187858665 40130.0 67.75961229946525 0.0 - - - - - - - 1211.25 80 8 BEX2 brain expressed X-linked 2 399 51 B20140214_SF053_03 B20140214_SF053_03 TB464264.[MT7]-GEPLALPLNVSEY[MT7]C[CAM]VPR.4y7_1.heavy 551.301 / 1054.51 3486.0 37.442800521850586 38 14 10 6 8 2.2315861417234846 35.137313905003765 0.035198211669921875 4 0.9312898381255674 4.68094187858665 3486.0 9.569411764705881 1.0 - - - - - - - 154.54545454545453 6 11 BEX2 brain expressed X-linked 2 401 51 B20140214_SF053_03 B20140214_SF053_03 TB464264.[MT7]-GEPLALPLNVSEY[MT7]C[CAM]VPR.4b6_1.heavy 551.301 / 725.431 9437.0 37.442800521850586 38 14 10 6 8 2.2315861417234846 35.137313905003765 0.035198211669921875 4 0.9312898381255674 4.68094187858665 9437.0 16.21736554621849 0.0 - - - - - - - 637.5 18 8 BEX2 brain expressed X-linked 2 403 52 B20140214_SF053_03 B20140214_SF053_03 TB464265.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].4y4_1.heavy 552.799 / 516.326 64805.0 40.550899505615234 46 16 10 10 10 3.677034197976195 27.195830828834573 0.0 3 0.9652914012907273 6.605103283828537 64805.0 87.79102019033502 0.0 - - - - - - - 879.0 129 8 MCTS1 malignant T cell amplified sequence 1 405 52 B20140214_SF053_03 B20140214_SF053_03 TB464265.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].4b7_1.heavy 552.799 / 833.464 29006.0 40.550899505615234 46 16 10 10 10 3.677034197976195 27.195830828834573 0.0 3 0.9652914012907273 6.605103283828537 29006.0 63.5938380575362 0.0 - - - - - - - 283.6363636363636 58 11 MCTS1 malignant T cell amplified sequence 1 407 52 B20140214_SF053_03 B20140214_SF053_03 TB464265.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].4b5_1.heavy 552.799 / 648.384 17979.0 40.550899505615234 46 16 10 10 10 3.677034197976195 27.195830828834573 0.0 3 0.9652914012907273 6.605103283828537 17979.0 22.069893787600858 0.0 - - - - - - - 781.2222222222222 35 9 MCTS1 malignant T cell amplified sequence 1 409 52 B20140214_SF053_03 B20140214_SF053_03 TB464265.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].4b3_1.heavy 552.799 / 504.33 16701.0 40.550899505615234 46 16 10 10 10 3.677034197976195 27.195830828834573 0.0 3 0.9652914012907273 6.605103283828537 16701.0 21.31065318836331 0.0 - - - - - - - 709.0 33 8 MCTS1 malignant T cell amplified sequence 1 411 53 B20140214_SF053_03 B20140214_SF053_03 TB464266.[MT7]-TVHC[CAM]QPAIFVASLAAVEK[MT7].4y4_1.heavy 558.063 / 590.363 94346.0 40.08382606506348 30 12 4 6 8 9.557686697953583 10.46278280092726 0.03769683837890625 4 0.88159582717435 3.550565239782045 94346.0 84.34896926222427 0.0 - - - - - - - 1755.2857142857142 188 7 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 413 53 B20140214_SF053_03 B20140214_SF053_03 TB464266.[MT7]-TVHC[CAM]QPAIFVASLAAVEK[MT7].4b8_2.heavy 558.063 / 526.277 146006.0 40.08382606506348 30 12 4 6 8 9.557686697953583 10.46278280092726 0.03769683837890625 4 0.88159582717435 3.550565239782045 146006.0 190.31321313784395 0.0 - - - - - - - 323.0 292 2 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 415 53 B20140214_SF053_03 B20140214_SF053_03 TB464266.[MT7]-TVHC[CAM]QPAIFVASLAAVEK[MT7].4b5_1.heavy 558.063 / 770.374 24253.0 40.08382606506348 30 12 4 6 8 9.557686697953583 10.46278280092726 0.03769683837890625 4 0.88159582717435 3.550565239782045 24253.0 52.29201700154559 0.0 - - - - - - - 367.54545454545456 48 11 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 417 53 B20140214_SF053_03 B20140214_SF053_03 TB464266.[MT7]-TVHC[CAM]QPAIFVASLAAVEK[MT7].4y3_1.heavy 558.063 / 519.326 96852.0 40.08382606506348 30 12 4 6 8 9.557686697953583 10.46278280092726 0.03769683837890625 4 0.88159582717435 3.550565239782045 96852.0 30.19758832024867 1.0 - - - - - - - 970.0 568 1 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 419 54 B20140214_SF053_03 B20140214_SF053_03 TB464267.[MT7]-ENTEFSELELQEWYK[MT7].3y3_1.heavy 745.035 / 640.357 25241.0 41.45359992980957 40 14 10 6 10 1.264729819452972 52.71218061063961 0.036998748779296875 3 0.9340667594196891 4.779633273743434 25241.0 35.82311629611407 0.0 - - - - - - - 747.8461538461538 50 13 HPCA hippocalcin 421 54 B20140214_SF053_03 B20140214_SF053_03 TB464267.[MT7]-ENTEFSELELQEWYK[MT7].3b4_1.heavy 745.035 / 618.285 18108.0 41.45359992980957 40 14 10 6 10 1.264729819452972 52.71218061063961 0.036998748779296875 3 0.9340667594196891 4.779633273743434 18108.0 20.664208573381508 0.0 - - - - - - - 670.7777777777778 36 9 HPCA hippocalcin 423 54 B20140214_SF053_03 B20140214_SF053_03 TB464267.[MT7]-ENTEFSELELQEWYK[MT7].3b5_1.heavy 745.035 / 765.354 13718.0 41.45359992980957 40 14 10 6 10 1.264729819452972 52.71218061063961 0.036998748779296875 3 0.9340667594196891 4.779633273743434 13718.0 16.121702272524654 0.0 - - - - - - - 688.2222222222222 27 9 HPCA hippocalcin 425 54 B20140214_SF053_03 B20140214_SF053_03 TB464267.[MT7]-ENTEFSELELQEWYK[MT7].3b7_1.heavy 745.035 / 981.428 19519.0 41.45359992980957 40 14 10 6 10 1.264729819452972 52.71218061063961 0.036998748779296875 3 0.9340667594196891 4.779633273743434 19519.0 42.07142675508035 0.0 - - - - - - - 682.2 39 10 HPCA hippocalcin 427 55 B20140214_SF053_03 B20140214_SF053_03 TB464260.[MT7]-SLVIWDNDRLTC[CAM]IQK[MT7].4y9_2.heavy 538.047 / 646.349 71726.0 37.319400787353516 50 20 10 10 10 6.036494452018066 16.56590605605028 0.0 3 0.9905870018130961 12.710338742077408 71726.0 44.419496745820226 0.0 - - - - - - - 753.5 143 6 RBP7 retinol binding protein 7, cellular 429 55 B20140214_SF053_03 B20140214_SF053_03 TB464260.[MT7]-SLVIWDNDRLTC[CAM]IQK[MT7].4y10_2.heavy 538.047 / 703.863 99444.0 37.319400787353516 50 20 10 10 10 6.036494452018066 16.56590605605028 0.0 3 0.9905870018130961 12.710338742077408 99444.0 261.0988135261923 0.0 - - - - - - - 298.5 198 4 RBP7 retinol binding protein 7, cellular 431 55 B20140214_SF053_03 B20140214_SF053_03 TB464260.[MT7]-SLVIWDNDRLTC[CAM]IQK[MT7].4b4_1.heavy 538.047 / 557.378 114967.0 37.319400787353516 50 20 10 10 10 6.036494452018066 16.56590605605028 0.0 3 0.9905870018130961 12.710338742077408 114967.0 103.958592064309 0.0 - - - - - - - 938.0 229 1 RBP7 retinol binding protein 7, cellular 433 55 B20140214_SF053_03 B20140214_SF053_03 TB464260.[MT7]-SLVIWDNDRLTC[CAM]IQK[MT7].4y3_1.heavy 538.047 / 532.357 52963.0 37.319400787353516 50 20 10 10 10 6.036494452018066 16.56590605605028 0.0 3 0.9905870018130961 12.710338742077408 52963.0 13.674643122270384 0.0 - - - - - - - 1705.5 105 4 RBP7 retinol binding protein 7, cellular 435 56 B20140214_SF053_03 B20140214_SF053_03 TB464261.[MT7]-SLLSPGLLPHLLPALGFK[MT7].4b8_1.heavy 541.089 / 925.584 30420.0 49.53214931488037 40 14 10 6 10 1.2420575987486457 47.382253319835506 0.034999847412109375 3 0.9366402580527833 4.876806152288843 30420.0 309.1665306122449 0.0 - - - - - - - 175.58333333333334 60 12 MRPL36 mitochondrial ribosomal protein L36 437 56 B20140214_SF053_03 B20140214_SF053_03 TB464261.[MT7]-SLLSPGLLPHLLPALGFK[MT7].4b7_1.heavy 541.089 / 812.5 21554.0 49.53214931488037 40 14 10 6 10 1.2420575987486457 47.382253319835506 0.034999847412109375 3 0.9366402580527833 4.876806152288843 21554.0 191.12679591836735 0.0 - - - - - - - 199.76923076923077 43 13 MRPL36 mitochondrial ribosomal protein L36 439 56 B20140214_SF053_03 B20140214_SF053_03 TB464261.[MT7]-SLLSPGLLPHLLPALGFK[MT7].4b4_1.heavy 541.089 / 545.341 45948.0 49.53214931488037 40 14 10 6 10 1.2420575987486457 47.382253319835506 0.034999847412109375 3 0.9366402580527833 4.876806152288843 45948.0 225.5202857142857 0.0 - - - - - - - 229.92307692307693 91 13 MRPL36 mitochondrial ribosomal protein L36 441 56 B20140214_SF053_03 B20140214_SF053_03 TB464261.[MT7]-SLLSPGLLPHLLPALGFK[MT7].4b6_1.heavy 541.089 / 699.416 21211.0 49.53214931488037 40 14 10 6 10 1.2420575987486457 47.382253319835506 0.034999847412109375 3 0.9366402580527833 4.876806152288843 21211.0 176.3976020408163 0.0 - - - - - - - 180.6875 42 16 MRPL36 mitochondrial ribosomal protein L36 443 57 B20140214_SF053_03 B20140214_SF053_03 TB464262.[MT7]-C[CAM]HLIETNIRDQEELK[MT7].4y10_2.heavy 547.292 / 695.376 85383.0 28.276399612426758 45 15 10 10 10 1.8877683803959777 35.87892954948028 0.0 3 0.9598163661649508 6.135820380937598 85383.0 82.79555237468497 0.0 - - - - - - - 716.875 170 8 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 445 57 B20140214_SF053_03 B20140214_SF053_03 TB464262.[MT7]-C[CAM]HLIETNIRDQEELK[MT7].4y12_2.heavy 547.292 / 816.44 38998.0 28.276399612426758 45 15 10 10 10 1.8877683803959777 35.87892954948028 0.0 3 0.9598163661649508 6.135820380937598 38998.0 89.10596535417716 0.0 - - - - - - - 611.6666666666666 77 9 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 447 57 B20140214_SF053_03 B20140214_SF053_03 TB464262.[MT7]-C[CAM]HLIETNIRDQEELK[MT7].4y11_2.heavy 547.292 / 759.898 113645.0 28.276399612426758 45 15 10 10 10 1.8877683803959777 35.87892954948028 0.0 3 0.9598163661649508 6.135820380937598 113645.0 101.92465583798068 0.0 - - - - - - - 413.0 227 7 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 449 57 B20140214_SF053_03 B20140214_SF053_03 TB464262.[MT7]-C[CAM]HLIETNIRDQEELK[MT7].4b3_1.heavy 547.292 / 555.283 75427.0 28.276399612426758 45 15 10 10 10 1.8877683803959777 35.87892954948028 0.0 3 0.9598163661649508 6.135820380937598 75427.0 136.24164343740046 0.0 - - - - - - - 1258.5714285714287 150 7 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 451 58 B20140214_SF053_03 B20140214_SF053_03 TB464263.[MT7]-AGAVGAHLPASGLDIFGDLK[MT7].4y4_1.heavy 550.061 / 576.347 173398.0 42.47990036010742 37 7 10 10 10 0.5632191984678394 95.1929438617735 0.0 3 0.7070051543110873 2.2218156754547387 173398.0 101.30781270097899 0.0 - - - - - - - 701.75 346 4 SEC11C SEC11 homolog C (S. cerevisiae) 453 58 B20140214_SF053_03 B20140214_SF053_03 TB464263.[MT7]-AGAVGAHLPASGLDIFGDLK[MT7].4b7_1.heavy 550.061 / 708.391 62157.0 42.47990036010742 37 7 10 10 10 0.5632191984678394 95.1929438617735 0.0 3 0.7070051543110873 2.2218156754547387 62157.0 112.98727750652664 0.0 - - - - - - - 664.5714285714286 124 7 SEC11C SEC11 homolog C (S. cerevisiae) 455 58 B20140214_SF053_03 B20140214_SF053_03 TB464263.[MT7]-AGAVGAHLPASGLDIFGDLK[MT7].4b5_1.heavy 550.061 / 500.295 11710.0 42.47990036010742 37 7 10 10 10 0.5632191984678394 95.1929438617735 0.0 3 0.7070051543110873 2.2218156754547387 11710.0 11.200440305235627 0.0 - - - - - - - 365.44444444444446 23 9 SEC11C SEC11 homolog C (S. cerevisiae) 457 58 B20140214_SF053_03 B20140214_SF053_03 TB464263.[MT7]-AGAVGAHLPASGLDIFGDLK[MT7].4b6_1.heavy 550.061 / 571.332 36412.0 42.47990036010742 37 7 10 10 10 0.5632191984678394 95.1929438617735 0.0 3 0.7070051543110873 2.2218156754547387 36412.0 74.14702784980665 0.0 - - - - - - - 771.875 72 8 SEC11C SEC11 homolog C (S. cerevisiae) 459 59 B20140214_SF053_03 B20140214_SF053_03 TB463941.[MT7]-EIEGK[MT7].2b3_1.heavy 432.257 / 516.279 22013.0 19.623950481414795 28 14 2 6 6 2.1705584859642992 35.540371955192526 0.03660011291503906 5 0.9343038182407931 4.788345888019131 22013.0 14.095576473612072 0.0 - - - - - - - 747.3076923076923 44 13 EIF5A2 eukaryotic translation initiation factor 5A2 461 59 B20140214_SF053_03 B20140214_SF053_03 TB463941.[MT7]-EIEGK[MT7].2y4_1.heavy 432.257 / 590.363 69151.0 19.623950481414795 28 14 2 6 6 2.1705584859642992 35.540371955192526 0.03660011291503906 5 0.9343038182407931 4.788345888019131 69151.0 48.19572141714641 0.0 - - - - - - - 797.0 138 5 EIF5A2 eukaryotic translation initiation factor 5A2 463 59 B20140214_SF053_03 B20140214_SF053_03 TB463941.[MT7]-EIEGK[MT7].2b4_1.heavy 432.257 / 573.3 5313.0 19.623950481414795 28 14 2 6 6 2.1705584859642992 35.540371955192526 0.03660011291503906 5 0.9343038182407931 4.788345888019131 5313.0 7.688770746344197 3.0 - - - - - - - 1294.7777777777778 34 9 EIF5A2 eukaryotic translation initiation factor 5A2 465 59 B20140214_SF053_03 B20140214_SF053_03 TB463941.[MT7]-EIEGK[MT7].2y3_1.heavy 432.257 / 477.279 40724.0 19.623950481414795 28 14 2 6 6 2.1705584859642992 35.540371955192526 0.03660011291503906 5 0.9343038182407931 4.788345888019131 40724.0 47.55955925708446 2.0 - - - - - - - 304.0 383 1 EIF5A2 eukaryotic translation initiation factor 5A2 467 60 B20140214_SF053_03 B20140214_SF053_03 TB463943.[MT7]-ELSFAR.2b3_1.heavy 433.746 / 474.268 27577.0 29.729400634765625 48 18 10 10 10 6.359446969513702 15.724637767935794 0.0 3 0.9896141929176512 12.099450620758121 27577.0 23.41846513450375 0.0 - - - - - - - 1213.0 55 12 PHLDA3 pleckstrin homology-like domain, family A, member 3 469 60 B20140214_SF053_03 B20140214_SF053_03 TB463943.[MT7]-ELSFAR.2y4_1.heavy 433.746 / 480.257 45557.0 29.729400634765625 48 18 10 10 10 6.359446969513702 15.724637767935794 0.0 3 0.9896141929176512 12.099450620758121 45557.0 46.68559705817107 0.0 - - - - - - - 1166.5555555555557 91 9 PHLDA3 pleckstrin homology-like domain, family A, member 3 471 60 B20140214_SF053_03 B20140214_SF053_03 TB463943.[MT7]-ELSFAR.2y5_1.heavy 433.746 / 593.341 137978.0 29.729400634765625 48 18 10 10 10 6.359446969513702 15.724637767935794 0.0 3 0.9896141929176512 12.099450620758121 137978.0 95.86259054408683 0.0 - - - - - - - 466.0 275 3 PHLDA3 pleckstrin homology-like domain, family A, member 3 473 60 B20140214_SF053_03 B20140214_SF053_03 TB463943.[MT7]-ELSFAR.2b4_1.heavy 433.746 / 621.336 32940.0 29.729400634765625 48 18 10 10 10 6.359446969513702 15.724637767935794 0.0 3 0.9896141929176512 12.099450620758121 32940.0 70.25224379086383 0.0 - - - - - - - 703.0 65 10 PHLDA3 pleckstrin homology-like domain, family A, member 3 475 61 B20140214_SF053_03 B20140214_SF053_03 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 3303690.0 38.28519821166992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 3303690.0 486.7235626301914 0.0 - - - - - - - 246.75 6607 8 477 61 B20140214_SF053_03 B20140214_SF053_03 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 1617850.0 38.28519821166992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1617850.0 417.3315118026387 0.0 - - - - - - - 282.0 3235 7 479 61 B20140214_SF053_03 B20140214_SF053_03 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 2161840.0 38.28519821166992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2161840.0 910.0602013686894 0.0 - - - - - - - 370.0 4323 2 481 62 B20140214_SF053_03 B20140214_SF053_03 TB464034.[MT7]-DLENLGER.2b3_1.heavy 545.286 / 502.263 23428.0 27.709199905395508 33 17 0 10 6 6.554050606561115 15.257739984474977 0.0 6 0.975103603203782 7.805288308771759 23428.0 5.425973347604091 2.0 - - - - - - - 2442.0 85 2 MRPS6 mitochondrial ribosomal protein S6 483 62 B20140214_SF053_03 B20140214_SF053_03 TB464034.[MT7]-DLENLGER.2y5_1.heavy 545.286 / 588.31 30845.0 27.709199905395508 33 17 0 10 6 6.554050606561115 15.257739984474977 0.0 6 0.975103603203782 7.805288308771759 30845.0 9.882915997354248 1.0 - - - - - - - 678.3333333333334 297 6 MRPS6 mitochondrial ribosomal protein S6 485 62 B20140214_SF053_03 B20140214_SF053_03 TB464034.[MT7]-DLENLGER.2b4_1.heavy 545.286 / 616.306 17684.0 27.709199905395508 33 17 0 10 6 6.554050606561115 15.257739984474977 0.0 6 0.975103603203782 7.805288308771759 17684.0 19.6068832167975 0.0 - - - - - - - 1609.0 35 7 MRPS6 mitochondrial ribosomal protein S6 487 62 B20140214_SF053_03 B20140214_SF053_03 TB464034.[MT7]-DLENLGER.2y7_1.heavy 545.286 / 830.437 39845.0 27.709199905395508 33 17 0 10 6 6.554050606561115 15.257739984474977 0.0 6 0.975103603203782 7.805288308771759 39845.0 90.35010691516115 0.0 - - - - - - - 678.4545454545455 79 11 MRPS6 mitochondrial ribosomal protein S6 489 63 B20140214_SF053_03 B20140214_SF053_03 TB107930.[MT7]-LPTALDGFSLEAMLTIYQLHK[MT7].4y5_1.heavy 663.12 / 832.48 5461.0 51.144798278808594 48 18 10 10 10 3.1852364537808593 25.29531122153494 0.0 3 0.983918259940107 9.71878801695986 5461.0 42.33130354174658 0.0 - - - - - - - 162.77777777777777 10 18 NTS neurotensin 491 63 B20140214_SF053_03 B20140214_SF053_03 TB107930.[MT7]-LPTALDGFSLEAMLTIYQLHK[MT7].4b7_1.heavy 663.12 / 812.463 3720.0 51.144798278808594 48 18 10 10 10 3.1852364537808593 25.29531122153494 0.0 3 0.983918259940107 9.71878801695986 3720.0 14.83119940705431 0.0 - - - - - - - 774.4285714285714 7 7 NTS neurotensin 493 63 B20140214_SF053_03 B20140214_SF053_03 TB107930.[MT7]-LPTALDGFSLEAMLTIYQLHK[MT7].4b4_1.heavy 663.12 / 527.331 6292.0 51.144798278808594 48 18 10 10 10 3.1852364537808593 25.29531122153494 0.0 3 0.983918259940107 9.71878801695986 6292.0 70.67357340047931 0.0 - - - - - - - 164.15 12 20 NTS neurotensin 495 63 B20140214_SF053_03 B20140214_SF053_03 TB107930.[MT7]-LPTALDGFSLEAMLTIYQLHK[MT7].4y3_1.heavy 663.12 / 541.358 3166.0 51.144798278808594 48 18 10 10 10 3.1852364537808593 25.29531122153494 0.0 3 0.983918259940107 9.71878801695986 3166.0 16.62826752802584 0.0 - - - - - - - 155.94117647058823 6 17 NTS neurotensin 497 64 B20140214_SF053_03 B20140214_SF053_03 TB463946.[MT7]-DIDVIR.2y4_1.heavy 437.759 / 502.298 35801.0 29.039100646972656 44 14 10 10 10 1.811684377440799 44.635924967465655 0.0 3 0.9497934658394667 5.4846415985361 35801.0 25.781214586223335 0.0 - - - - - - - 1747.3333333333333 71 9 MRPS6 mitochondrial ribosomal protein S6 499 64 B20140214_SF053_03 B20140214_SF053_03 TB463946.[MT7]-DIDVIR.2b3_1.heavy 437.759 / 488.247 188581.0 29.039100646972656 44 14 10 10 10 1.811684377440799 44.635924967465655 0.0 3 0.9497934658394667 5.4846415985361 188581.0 189.28231423048493 0.0 - - - - - - - 1786.5 377 8 MRPS6 mitochondrial ribosomal protein S6 501 64 B20140214_SF053_03 B20140214_SF053_03 TB463946.[MT7]-DIDVIR.2y5_1.heavy 437.759 / 615.382 85710.0 29.039100646972656 44 14 10 10 10 1.811684377440799 44.635924967465655 0.0 3 0.9497934658394667 5.4846415985361 85710.0 118.6999885564345 0.0 - - - - - - - 1231.5 171 8 MRPS6 mitochondrial ribosomal protein S6 503 64 B20140214_SF053_03 B20140214_SF053_03 TB463946.[MT7]-DIDVIR.2b4_1.heavy 437.759 / 587.316 130161.0 29.039100646972656 44 14 10 10 10 1.811684377440799 44.635924967465655 0.0 3 0.9497934658394667 5.4846415985361 130161.0 75.93149516291736 0.0 - - - - - - - 1313.6 260 5 MRPS6 mitochondrial ribosomal protein S6 505 65 B20140214_SF053_03 B20140214_SF053_03 TB107932.[MT7]-ATDLRPIYISVQPPSLHVLEQR.4y5_1.heavy 669.879 / 644.373 56340.0 39.09880065917969 47 17 10 10 10 3.4954386146469223 24.07420274976572 0.0 3 0.9750766591197962 7.80105042612288 56340.0 48.933237044410085 0.0 - - - - - - - 1220.2857142857142 112 7 GUK1 guanylate kinase 1 507 65 B20140214_SF053_03 B20140214_SF053_03 TB107932.[MT7]-ATDLRPIYISVQPPSLHVLEQR.4y9_1.heavy 669.879 / 1078.6 31948.0 39.09880065917969 47 17 10 10 10 3.4954386146469223 24.07420274976572 0.0 3 0.9750766591197962 7.80105042612288 31948.0 179.7456139978791 0.0 - - - - - - - 205.28571428571428 63 14 GUK1 guanylate kinase 1 509 65 B20140214_SF053_03 B20140214_SF053_03 TB107932.[MT7]-ATDLRPIYISVQPPSLHVLEQR.4y6_1.heavy 669.879 / 781.432 33508.0 39.09880065917969 47 17 10 10 10 3.4954386146469223 24.07420274976572 0.0 3 0.9750766591197962 7.80105042612288 33508.0 88.28487611955505 0.0 - - - - - - - 429.1111111111111 67 9 GUK1 guanylate kinase 1 511 65 B20140214_SF053_03 B20140214_SF053_03 TB107932.[MT7]-ATDLRPIYISVQPPSLHVLEQR.4b10_2.heavy 669.879 / 637.865 75230.0 39.09880065917969 47 17 10 10 10 3.4954386146469223 24.07420274976572 0.0 3 0.9750766591197962 7.80105042612288 75230.0 95.10240121097647 0.0 - - - - - - - 704.0 150 7 GUK1 guanylate kinase 1 513 66 B20140214_SF053_03 B20140214_SF053_03 TB107933.[MT7]-RLVQQWSVAVFLLSYAVPSC[CAM]GR.3b9_2.heavy 894.155 / 606.852 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTHLH parathyroid hormone-like hormone 515 66 B20140214_SF053_03 B20140214_SF053_03 TB107933.[MT7]-RLVQQWSVAVFLLSYAVPSC[CAM]GR.3b9_1.heavy 894.155 / 1212.7 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTHLH parathyroid hormone-like hormone 517 66 B20140214_SF053_03 B20140214_SF053_03 TB107933.[MT7]-RLVQQWSVAVFLLSYAVPSC[CAM]GR.3y5_1.heavy 894.155 / 576.256 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTHLH parathyroid hormone-like hormone 519 66 B20140214_SF053_03 B20140214_SF053_03 TB107933.[MT7]-RLVQQWSVAVFLLSYAVPSC[CAM]GR.3y9_1.heavy 894.155 / 996.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTHLH parathyroid hormone-like hormone 521 67 B20140214_SF053_03 B20140214_SF053_03 TB464130.[MT7]-RYQQC[CAM]VQK[MT7].2y4_1.heavy 699.382 / 678.372 1546.0 18.925249576568604 43 17 10 6 10 3.635667827318993 27.505263062973988 0.03539848327636719 3 0.9794704738026822 8.598587318956234 1546.0 4.658954409434958 0.0 - - - - - - - 198.88 3 25 TRIAP1 TP53 regulated inhibitor of apoptosis 1 523 67 B20140214_SF053_03 B20140214_SF053_03 TB464130.[MT7]-RYQQC[CAM]VQK[MT7].2b7_1.heavy 699.382 / 1107.55 2040.0 18.925249576568604 43 17 10 6 10 3.635667827318993 27.505263062973988 0.03539848327636719 3 0.9794704738026822 8.598587318956234 2040.0 80.36363636363637 0.0 - - - - - - - 82.42857142857143 4 14 TRIAP1 TP53 regulated inhibitor of apoptosis 1 525 67 B20140214_SF053_03 B20140214_SF053_03 TB464130.[MT7]-RYQQC[CAM]VQK[MT7].2b6_1.heavy 699.382 / 979.49 1119.0 18.925249576568604 43 17 10 6 10 3.635667827318993 27.505263062973988 0.03539848327636719 3 0.9794704738026822 8.598587318956234 1119.0 44.08181818181818 0.0 - - - - - - - 106.22222222222223 2 9 TRIAP1 TP53 regulated inhibitor of apoptosis 1 527 67 B20140214_SF053_03 B20140214_SF053_03 TB464130.[MT7]-RYQQC[CAM]VQK[MT7].2y7_1.heavy 699.382 / 1097.55 1481.0 18.925249576568604 43 17 10 6 10 3.635667827318993 27.505263062973988 0.03539848327636719 3 0.9794704738026822 8.598587318956234 1481.0 86.16727272727272 0.0 - - - - - - - 136.42857142857142 2 7 TRIAP1 TP53 regulated inhibitor of apoptosis 1 529 68 B20140214_SF053_03 B20140214_SF053_03 TB107938.[MT7]-MEAQRSEPPLPPGGQELLELLLR.4y5_1.heavy 680.125 / 643.414 4491.0 50.65689945220947 30 7 10 3 10 0.619403021878022 87.95282421551158 0.07819747924804688 3 0.7303868991516698 2.32120021013723 4491.0 10.7331348556455 0.0 - - - - - - - 221.64285714285714 8 14 GPSM3 G-protein signaling modulator 3 531 68 B20140214_SF053_03 B20140214_SF053_03 TB107938.[MT7]-MEAQRSEPPLPPGGQELLELLLR.4b8_2.heavy 680.125 / 537.262 6575.0 50.65689945220947 30 7 10 3 10 0.619403021878022 87.95282421551158 0.07819747924804688 3 0.7303868991516698 2.32120021013723 6575.0 19.887345679012345 0.0 - - - - - - - 222.875 13 16 GPSM3 G-protein signaling modulator 3 533 68 B20140214_SF053_03 B20140214_SF053_03 TB107938.[MT7]-MEAQRSEPPLPPGGQELLELLLR.4b7_1.heavy 680.125 / 976.464 1296.0 50.65689945220947 30 7 10 3 10 0.619403021878022 87.95282421551158 0.07819747924804688 3 0.7303868991516698 2.32120021013723 1296.0 30.960900844541758 0.0 - - - - - - - 185.33333333333334 2 15 GPSM3 G-protein signaling modulator 3 535 68 B20140214_SF053_03 B20140214_SF053_03 TB107938.[MT7]-MEAQRSEPPLPPGGQELLELLLR.4b10_2.heavy 680.125 / 642.33 12363.0 50.65689945220947 30 7 10 3 10 0.619403021878022 87.95282421551158 0.07819747924804688 3 0.7303868991516698 2.32120021013723 12363.0 45.84485933660934 0.0 - - - - - - - 707.8571428571429 24 7 GPSM3 G-protein signaling modulator 3 537 69 B20140214_SF053_03 B20140214_SF053_03 TB246527.[MT7]-TRSERGDGSDVK[MT7].3y3_1.heavy 532.284 / 505.31 1137.0 16.139249801635742 40 13 10 7 10 2.2781489573553797 43.895285985200175 0.0298004150390625 3 0.9033493774515896 3.9372995192763054 1137.0 1.6989010989010989 1.0 - - - - - - - 183.66666666666666 2 27 PAGE4 P antigen family, member 4 (prostate associated) 539 69 B20140214_SF053_03 B20140214_SF053_03 TB246527.[MT7]-TRSERGDGSDVK[MT7].3b4_1.heavy 532.284 / 618.333 1031.0 16.139249801635742 40 13 10 7 10 2.2781489573553797 43.895285985200175 0.0298004150390625 3 0.9033493774515896 3.9372995192763054 1031.0 4.245422765262399 2.0 - - - - - - - 254.12 3 25 PAGE4 P antigen family, member 4 (prostate associated) 541 69 B20140214_SF053_03 B20140214_SF053_03 TB246527.[MT7]-TRSERGDGSDVK[MT7].3b10_2.heavy 532.284 / 603.285 15784.0 16.139249801635742 40 13 10 7 10 2.2781489573553797 43.895285985200175 0.0298004150390625 3 0.9033493774515896 3.9372995192763054 15784.0 43.35198520162782 0.0 - - - - - - - 221.08333333333334 31 24 PAGE4 P antigen family, member 4 (prostate associated) 543 69 B20140214_SF053_03 B20140214_SF053_03 TB246527.[MT7]-TRSERGDGSDVK[MT7].3y5_1.heavy 532.284 / 649.364 6353.0 16.139249801635742 40 13 10 7 10 2.2781489573553797 43.895285985200175 0.0298004150390625 3 0.9033493774515896 3.9372995192763054 6353.0 56.690585065715226 0.0 - - - - - - - 117.26086956521739 12 23 PAGE4 P antigen family, member 4 (prostate associated) 545 70 B20140214_SF053_03 B20140214_SF053_03 TB107935.[MT7]-NQLIEQFPGIEPWLNQIMPK[MT7].3b6_1.heavy 895.156 / 870.48 15072.0 50.08209991455078 46 16 10 10 10 2.6117462262976474 30.68337347527074 0.0 3 0.9611097418325741 6.237697751742361 15072.0 72.11983881294016 0.0 - - - - - - - 311.4117647058824 30 17 MCTS1 malignant T cell amplified sequence 1 547 70 B20140214_SF053_03 B20140214_SF053_03 TB107935.[MT7]-NQLIEQFPGIEPWLNQIMPK[MT7].3b4_1.heavy 895.156 / 613.379 14834.0 50.08209991455078 46 16 10 10 10 2.6117462262976474 30.68337347527074 0.0 3 0.9611097418325741 6.237697751742361 14834.0 38.813698410740834 0.0 - - - - - - - 626.8571428571429 29 7 MCTS1 malignant T cell amplified sequence 1 549 70 B20140214_SF053_03 B20140214_SF053_03 TB107935.[MT7]-NQLIEQFPGIEPWLNQIMPK[MT7].3b3_1.heavy 895.156 / 500.295 15025.0 50.08209991455078 46 16 10 10 10 2.6117462262976474 30.68337347527074 0.0 3 0.9611097418325741 6.237697751742361 15025.0 79.708291532119 0.0 - - - - - - - 299.85714285714283 30 14 MCTS1 malignant T cell amplified sequence 1 551 70 B20140214_SF053_03 B20140214_SF053_03 TB107935.[MT7]-NQLIEQFPGIEPWLNQIMPK[MT7].3b7_1.heavy 895.156 / 1017.55 10446.0 50.08209991455078 46 16 10 10 10 2.6117462262976474 30.68337347527074 0.0 3 0.9611097418325741 6.237697751742361 10446.0 78.88058999823706 0.0 - - - - - - - 217.625 20 16 MCTS1 malignant T cell amplified sequence 1 553 71 B20140214_SF053_03 B20140214_SF053_03 TB107936.[MT7]-MEAQRSEPPLPPGGQELLELLLR.3y11_1.heavy 906.497 / 1240.73 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 555 71 B20140214_SF053_03 B20140214_SF053_03 TB107936.[MT7]-MEAQRSEPPLPPGGQELLELLLR.3b7_1.heavy 906.497 / 976.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 557 71 B20140214_SF053_03 B20140214_SF053_03 TB107936.[MT7]-MEAQRSEPPLPPGGQELLELLLR.3y13_2.heavy 906.497 / 717.919 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 559 71 B20140214_SF053_03 B20140214_SF053_03 TB107936.[MT7]-MEAQRSEPPLPPGGQELLELLLR.3b8_2.heavy 906.497 / 537.262 N/A N/A - - - - - - - - - 0.0 - - - - - - - GPSM3 G-protein signaling modulator 3 561 72 B20140214_SF053_03 B20140214_SF053_03 TB464039.[MT7]-RILNVTK[MT7].2y4_1.heavy 566.376 / 605.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 563 72 B20140214_SF053_03 B20140214_SF053_03 TB464039.[MT7]-RILNVTK[MT7].2y5_1.heavy 566.376 / 718.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 565 72 B20140214_SF053_03 B20140214_SF053_03 TB464039.[MT7]-RILNVTK[MT7].2b4_1.heavy 566.376 / 641.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 567 72 B20140214_SF053_03 B20140214_SF053_03 TB464039.[MT7]-RILNVTK[MT7].2y6_1.heavy 566.376 / 831.542 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 569 73 B20140214_SF053_03 B20140214_SF053_03 TB464038.[MT7]-NTEISFK[MT7].2y4_1.heavy 563.821 / 638.399 12456.0 29.05625057220459 42 16 10 6 10 2.382468361218867 33.25834565146452 0.03429985046386719 3 0.9620489296287632 6.314910540183336 12456.0 18.392212232398492 0.0 - - - - - - - 1204.2857142857142 24 7 FABP3;PMP2 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor);peripheral myelin protein 2 571 73 B20140214_SF053_03 B20140214_SF053_03 TB464038.[MT7]-NTEISFK[MT7].2b4_1.heavy 563.821 / 602.327 10443.0 29.05625057220459 42 16 10 6 10 2.382468361218867 33.25834565146452 0.03429985046386719 3 0.9620489296287632 6.314910540183336 10443.0 23.230677855569983 0.0 - - - - - - - 738.2941176470588 20 17 FABP3;PMP2 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor);peripheral myelin protein 2 573 73 B20140214_SF053_03 B20140214_SF053_03 TB464038.[MT7]-NTEISFK[MT7].2y3_1.heavy 563.821 / 525.315 24350.0 29.05625057220459 42 16 10 6 10 2.382468361218867 33.25834565146452 0.03429985046386719 3 0.9620489296287632 6.314910540183336 24350.0 26.73624089805825 0.0 - - - - - - - 1246.875 48 8 FABP3;PMP2 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor);peripheral myelin protein 2 575 73 B20140214_SF053_03 B20140214_SF053_03 TB464038.[MT7]-NTEISFK[MT7].2y6_1.heavy 563.821 / 868.49 14798.0 29.05625057220459 42 16 10 6 10 2.382468361218867 33.25834565146452 0.03429985046386719 3 0.9620489296287632 6.314910540183336 14798.0 75.49281833911539 0.0 - - - - - - - 245.7 29 20 FABP3;PMP2 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor);peripheral myelin protein 2 577 74 B20140214_SF053_03 B20140214_SF053_03 TB463950.[MT7]-ISAHSQQHNR.3y6_1.heavy 441.233 / 769.37 10603.0 16.116899490356445 46 16 10 10 10 1.6704779842736521 47.23051264832161 0.0 3 0.9643540465000614 6.517164257830496 10603.0 202.92949228471878 0.0 - - - - - - - 67.0 21 20 MRPS6 mitochondrial ribosomal protein S6 579 74 B20140214_SF053_03 B20140214_SF053_03 TB463950.[MT7]-ISAHSQQHNR.3b3_1.heavy 441.233 / 416.263 27742.0 16.116899490356445 46 16 10 10 10 1.6704779842736521 47.23051264832161 0.0 3 0.9643540465000614 6.517164257830496 27742.0 41.95100791958575 0.0 - - - - - - - 741.8 55 15 MRPS6 mitochondrial ribosomal protein S6 581 74 B20140214_SF053_03 B20140214_SF053_03 TB463950.[MT7]-ISAHSQQHNR.3y4_1.heavy 441.233 / 554.279 20308.0 16.116899490356445 46 16 10 10 10 1.6704779842736521 47.23051264832161 0.0 3 0.9643540465000614 6.517164257830496 20308.0 163.92547798066596 0.0 - - - - - - - 196.0 40 20 MRPS6 mitochondrial ribosomal protein S6 583 74 B20140214_SF053_03 B20140214_SF053_03 TB463950.[MT7]-ISAHSQQHNR.3y5_1.heavy 441.233 / 682.338 9215.0 16.116899490356445 46 16 10 10 10 1.6704779842736521 47.23051264832161 0.0 3 0.9643540465000614 6.517164257830496 9215.0 169.4576295133438 0.0 - - - - - - - 105.92 18 25 MRPS6 mitochondrial ribosomal protein S6 585 75 B20140214_SF053_03 B20140214_SF053_03 TB464043.[MT7]-AFRLFDDDETGK[MT7].3b5_1.heavy 567.961 / 779.469 29592.0 35.01470184326172 47 17 10 10 10 7.485836706538987 13.35856016103698 0.0 3 0.9753858249211752 7.850094104754817 29592.0 22.72586636527866 0.0 - - - - - - - 758.6666666666666 59 3 CETN1 centrin, EF-hand protein, 1 587 75 B20140214_SF053_03 B20140214_SF053_03 TB464043.[MT7]-AFRLFDDDETGK[MT7].3y5_1.heavy 567.961 / 693.354 12716.0 35.01470184326172 47 17 10 10 10 7.485836706538987 13.35856016103698 0.0 3 0.9753858249211752 7.850094104754817 12716.0 15.485210797694872 0.0 - - - - - - - 418.6666666666667 25 3 CETN1 centrin, EF-hand protein, 1 589 75 B20140214_SF053_03 B20140214_SF053_03 TB464043.[MT7]-AFRLFDDDETGK[MT7].3b7_2.heavy 567.961 / 505.265 25275.0 35.01470184326172 47 17 10 10 10 7.485836706538987 13.35856016103698 0.0 3 0.9753858249211752 7.850094104754817 25275.0 17.667243593267727 0.0 - - - - - - - 1229.4444444444443 50 9 CETN1 centrin, EF-hand protein, 1 591 75 B20140214_SF053_03 B20140214_SF053_03 TB464043.[MT7]-AFRLFDDDETGK[MT7].3b8_2.heavy 567.961 / 562.778 34459.0 35.01470184326172 47 17 10 10 10 7.485836706538987 13.35856016103698 0.0 3 0.9753858249211752 7.850094104754817 34459.0 41.291470196430446 0.0 - - - - - - - 392.5 68 2 CETN1 centrin, EF-hand protein, 1 593 76 B20140214_SF053_03 B20140214_SF053_03 TB107943.[MT7]-AIVFRPFK[MT7]GEVVDAVVTQVNK[MT7].4b14_2.heavy 687.909 / 909.529 121562.0 38.215599060058594 41 11 10 10 10 1.402635489942754 47.73957538866782 0.0 3 0.8539340521220392 3.1889964034560263 121562.0 72.194889982141 0.0 - - - - - - - 636.2857142857143 243 7 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 595 76 B20140214_SF053_03 B20140214_SF053_03 TB107943.[MT7]-AIVFRPFK[MT7]GEVVDAVVTQVNK[MT7].4b13_2.heavy 687.909 / 874.011 124366.0 38.215599060058594 41 11 10 10 10 1.402635489942754 47.73957538866782 0.0 3 0.8539340521220392 3.1889964034560263 124366.0 322.6476415094339 0.0 - - - - - - - 329.8 248 5 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 597 76 B20140214_SF053_03 B20140214_SF053_03 TB107943.[MT7]-AIVFRPFK[MT7]GEVVDAVVTQVNK[MT7].4y3_1.heavy 687.909 / 504.326 135747.0 38.215599060058594 41 11 10 10 10 1.402635489942754 47.73957538866782 0.0 3 0.8539340521220392 3.1889964034560263 135747.0 70.52900812844847 0.0 - - - - - - - 247.0 271 1 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 599 76 B20140214_SF053_03 B20140214_SF053_03 TB107943.[MT7]-AIVFRPFK[MT7]GEVVDAVVTQVNK[MT7].4b10_2.heavy 687.909 / 717.429 27463.0 38.215599060058594 41 11 10 10 10 1.402635489942754 47.73957538866782 0.0 3 0.8539340521220392 3.1889964034560263 27463.0 52.718540088182394 0.0 - - - - - - - 806.6666666666666 54 9 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 601 77 B20140214_SF053_03 B20140214_SF053_03 TB107941.[MT7]-EPGLFDVVIINDSLDQAYAELK[MT7].3b6_1.heavy 913.156 / 803.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - GUK1 guanylate kinase 1 603 77 B20140214_SF053_03 B20140214_SF053_03 TB107941.[MT7]-EPGLFDVVIINDSLDQAYAELK[MT7].3y4_1.heavy 913.156 / 604.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - GUK1 guanylate kinase 1 605 77 B20140214_SF053_03 B20140214_SF053_03 TB107941.[MT7]-EPGLFDVVIINDSLDQAYAELK[MT7].3b8_1.heavy 913.156 / 1001.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - GUK1 guanylate kinase 1 607 77 B20140214_SF053_03 B20140214_SF053_03 TB107941.[MT7]-EPGLFDVVIINDSLDQAYAELK[MT7].3b7_1.heavy 913.156 / 902.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - GUK1 guanylate kinase 1 609 78 B20140214_SF053_03 B20140214_SF053_03 TB107942.[MT7]-EPGLFDVVIINDSLDQAYAELK[MT7].4b8_1.heavy 685.119 / 1001.54 2934.0 51.803001403808594 43 13 10 10 10 1.1636464539584563 49.55799426244914 0.0 3 0.9286485314931466 4.592447038604722 2934.0 57.14293432835821 0.0 - - - - - - - 92.38461538461539 5 13 GUK1 guanylate kinase 1 611 78 B20140214_SF053_03 B20140214_SF053_03 TB107942.[MT7]-EPGLFDVVIINDSLDQAYAELK[MT7].4y4_1.heavy 685.119 / 604.379 9936.0 51.803001403808594 43 13 10 10 10 1.1636464539584563 49.55799426244914 0.0 3 0.9286485314931466 4.592447038604722 9936.0 78.3642898037643 0.0 - - - - - - - 176.21428571428572 19 14 GUK1 guanylate kinase 1 613 78 B20140214_SF053_03 B20140214_SF053_03 TB107942.[MT7]-EPGLFDVVIINDSLDQAYAELK[MT7].4b7_1.heavy 685.119 / 902.474 5735.0 51.803001403808594 43 13 10 10 10 1.1636464539584563 49.55799426244914 0.0 3 0.9286485314931466 4.592447038604722 5735.0 73.8118127340824 0.0 - - - - - - - 187.23076923076923 11 13 GUK1 guanylate kinase 1 615 78 B20140214_SF053_03 B20140214_SF053_03 TB107942.[MT7]-EPGLFDVVIINDSLDQAYAELK[MT7].4b6_1.heavy 685.119 / 803.406 9503.0 51.803001403808594 43 13 10 10 10 1.1636464539584563 49.55799426244914 0.0 3 0.9286485314931466 4.592447038604722 9503.0 158.99795522388058 0.0 - - - - - - - 190.8181818181818 19 11 GUK1 guanylate kinase 1 617 79 B20140214_SF053_03 B20140214_SF053_03 TB246511.[MT7]-LLTHNLLSSHVR.4y4_1.heavy 384.23 / 498.278 53447.0 31.142374992370605 40 13 10 7 10 1.7244358027021458 45.043154465352345 0.028301239013671875 3 0.9021344176938308 3.9123723835190276 53447.0 87.67372221450402 0.0 - - - - - - - 1171.5714285714287 106 7 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 619 79 B20140214_SF053_03 B20140214_SF053_03 TB246511.[MT7]-LLTHNLLSSHVR.4y5_1.heavy 384.23 / 585.31 125541.0 31.142374992370605 40 13 10 7 10 1.7244358027021458 45.043154465352345 0.028301239013671875 3 0.9021344176938308 3.9123723835190276 125541.0 224.29442132826767 0.0 - - - - - - - 1199.2857142857142 251 7 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 621 79 B20140214_SF053_03 B20140214_SF053_03 TB246511.[MT7]-LLTHNLLSSHVR.4b5_2.heavy 384.23 / 362.217 200513.0 31.142374992370605 40 13 10 7 10 1.7244358027021458 45.043154465352345 0.028301239013671875 3 0.9021344176938308 3.9123723835190276 200513.0 113.75911753399956 0.0 - - - - - - - 1293.5 401 4 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 623 79 B20140214_SF053_03 B20140214_SF053_03 TB246511.[MT7]-LLTHNLLSSHVR.4y6_1.heavy 384.23 / 698.394 53350.0 31.142374992370605 40 13 10 7 10 1.7244358027021458 45.043154465352345 0.028301239013671875 3 0.9021344176938308 3.9123723835190276 53350.0 250.63558131701208 0.0 - - - - - - - 229.7058823529412 106 17 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 625 80 B20140214_SF053_03 B20140214_SF053_03 TB246510.[MT7]-LLTHNLLSSHVR.3y7_1.heavy 511.971 / 811.479 51293.0 31.135299682617188 48 18 10 10 10 5.6479614624969185 17.705503244668176 0.0 3 0.9845899017007468 9.928882536766736 51293.0 154.40239795918367 0.0 - - - - - - - 637.0 102 7 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 627 80 B20140214_SF053_03 B20140214_SF053_03 TB246510.[MT7]-LLTHNLLSSHVR.3y6_1.heavy 511.971 / 698.394 166468.0 31.135299682617188 48 18 10 10 10 5.6479614624969185 17.705503244668176 0.0 3 0.9845899017007468 9.928882536766736 166468.0 240.43220758017492 0.0 - - - - - - - 1246.0 332 7 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 629 80 B20140214_SF053_03 B20140214_SF053_03 TB246510.[MT7]-LLTHNLLSSHVR.3y8_1.heavy 511.971 / 925.521 26406.0 31.135299682617188 48 18 10 10 10 5.6479614624969185 17.705503244668176 0.0 3 0.9845899017007468 9.928882536766736 26406.0 208.82295918367345 0.0 - - - - - - - 215.17391304347825 52 23 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 631 80 B20140214_SF053_03 B20140214_SF053_03 TB246510.[MT7]-LLTHNLLSSHVR.3y5_1.heavy 511.971 / 585.31 277921.0 31.135299682617188 48 18 10 10 10 5.6479614624969185 17.705503244668176 0.0 3 0.9845899017007468 9.928882536766736 277921.0 295.54982140520247 0.0 - - - - - - - 1316.875 555 8 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 633 81 B20140214_SF053_03 B20140214_SF053_03 TB246319.[MT7]-THSTFK[MT7].2b3_1.heavy 504.789 / 470.248 N/A 18.696699142456055 38 18 0 10 10 2.7025656520182455 29.288414973379815 0.0 3 0.9806347226584272 8.854155701192017 3244.0 1.0987375020979817 19.0 - - - - - - - 2742.4285714285716 133 7 FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) 635 81 B20140214_SF053_03 B20140214_SF053_03 TB246319.[MT7]-THSTFK[MT7].2y4_1.heavy 504.789 / 626.363 7391.0 18.696699142456055 38 18 0 10 10 2.7025656520182455 29.288414973379815 0.0 3 0.9806347226584272 8.854155701192017 7391.0 24.020692035009567 0.0 - - - - - - - 602.0 14 8 FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) 637 81 B20140214_SF053_03 B20140214_SF053_03 TB246319.[MT7]-THSTFK[MT7].2y5_1.heavy 504.789 / 763.422 5652.0 18.696699142456055 38 18 0 10 10 2.7025656520182455 29.288414973379815 0.0 3 0.9806347226584272 8.854155701192017 5652.0 14.984062643942885 0.0 - - - - - - - 211.1818181818182 11 22 FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) 639 81 B20140214_SF053_03 B20140214_SF053_03 TB246319.[MT7]-THSTFK[MT7].2y3_1.heavy 504.789 / 539.331 4348.0 18.696699142456055 38 18 0 10 10 2.7025656520182455 29.288414973379815 0.0 3 0.9806347226584272 8.854155701192017 4348.0 15.1722740956374 0.0 - - - - - - - 254.8095238095238 8 21 FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) 641 82 B20140214_SF053_03 B20140214_SF053_03 TB107948.[MT7]-EGPYDVVVLPGGNLGAQNLSESAAVK[MT7].4b8_1.heavy 718.888 / 1003.52 10536.0 39.52417469024658 42 16 10 6 10 3.183736174280115 31.409637773334445 0.034099578857421875 3 0.9616251399766601 6.279719704920862 10536.0 0.0 1.0 - - - - - - - 752.1428571428571 21 7 PARK7 Parkinson disease (autosomal recessive, early onset) 7 643 82 B20140214_SF053_03 B20140214_SF053_03 TB107948.[MT7]-EGPYDVVVLPGGNLGAQNLSESAAVK[MT7].4b7_1.heavy 718.888 / 904.453 19370.0 39.52417469024658 42 16 10 6 10 3.183736174280115 31.409637773334445 0.034099578857421875 3 0.9616251399766601 6.279719704920862 19370.0 35.93110878173771 0.0 - - - - - - - 299.7 38 10 PARK7 Parkinson disease (autosomal recessive, early onset) 7 645 82 B20140214_SF053_03 B20140214_SF053_03 TB107948.[MT7]-EGPYDVVVLPGGNLGAQNLSESAAVK[MT7].4b5_1.heavy 718.888 / 706.316 22368.0 39.52417469024658 42 16 10 6 10 3.183736174280115 31.409637773334445 0.034099578857421875 3 0.9616251399766601 6.279719704920862 22368.0 19.569043168384248 0.0 - - - - - - - 729.0 44 7 PARK7 Parkinson disease (autosomal recessive, early onset) 7 647 82 B20140214_SF053_03 B20140214_SF053_03 TB107948.[MT7]-EGPYDVVVLPGGNLGAQNLSESAAVK[MT7].4b6_1.heavy 718.888 / 805.385 21882.0 39.52417469024658 42 16 10 6 10 3.183736174280115 31.409637773334445 0.034099578857421875 3 0.9616251399766601 6.279719704920862 21882.0 39.179678388867856 0.0 - - - - - - - 291.6 43 5 PARK7 Parkinson disease (autosomal recessive, early onset) 7 649 83 B20140214_SF053_03 B20140214_SF053_03 TB107945.[MT7]-TMHHLLLEVEVIEGTLQC[CAM]PESGR.3b4_1.heavy 931.478 / 651.315 2365.0 45.28609848022461 38 8 10 10 10 0.7622430017482129 75.76900202822604 0.0 3 0.7913311485878067 2.653229578224955 2365.0 9.646368038740919 1.0 - - - - - - - 176.47058823529412 5 17 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 651 83 B20140214_SF053_03 B20140214_SF053_03 TB107945.[MT7]-TMHHLLLEVEVIEGTLQC[CAM]PESGR.3b3_1.heavy 931.478 / 514.256 3288.0 45.28609848022461 38 8 10 10 10 0.7622430017482129 75.76900202822604 0.0 3 0.7913311485878067 2.653229578224955 3288.0 5.113872832369942 0.0 - - - - - - - 234.3125 6 16 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 653 83 B20140214_SF053_03 B20140214_SF053_03 TB107945.[MT7]-TMHHLLLEVEVIEGTLQC[CAM]PESGR.3b8_2.heavy 931.478 / 560.309 12749.0 45.28609848022461 38 8 10 10 10 0.7622430017482129 75.76900202822604 0.0 3 0.7913311485878067 2.653229578224955 12749.0 61.879629696531794 0.0 - - - - - - - 284.0769230769231 25 13 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 655 83 B20140214_SF053_03 B20140214_SF053_03 TB107945.[MT7]-TMHHLLLEVEVIEGTLQC[CAM]PESGR.3y10_1.heavy 931.478 / 1104.51 6403.0 45.28609848022461 38 8 10 10 10 0.7622430017482129 75.76900202822604 0.0 3 0.7913311485878067 2.653229578224955 6403.0 35.71615606936416 0.0 - - - - - - - 180.66666666666666 12 15 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 657 84 B20140214_SF053_03 B20140214_SF053_03 TB464149.[MT7]-ESYSIYIYK[MT7].2b3_1.heavy 727.394 / 524.247 9205.0 35.09339904785156 44 14 10 10 10 9.064542373319922 11.03199652906191 0.0 3 0.9474343441927034 5.3590808342688305 9205.0 13.102705960368231 0.0 - - - - - - - 788.2666666666667 18 15 HIST1H2BA histone cluster 1, H2ba 659 84 B20140214_SF053_03 B20140214_SF053_03 TB464149.[MT7]-ESYSIYIYK[MT7].2y4_1.heavy 727.394 / 730.426 15316.0 35.09339904785156 44 14 10 10 10 9.064542373319922 11.03199652906191 0.0 3 0.9474343441927034 5.3590808342688305 15316.0 26.528312421748048 0.0 - - - - - - - 777.6 30 10 HIST1H2BA histone cluster 1, H2ba 661 84 B20140214_SF053_03 B20140214_SF053_03 TB464149.[MT7]-ESYSIYIYK[MT7].2b4_1.heavy 727.394 / 611.279 7539.0 35.09339904785156 44 14 10 10 10 9.064542373319922 11.03199652906191 0.0 3 0.9474343441927034 5.3590808342688305 7539.0 12.621548154815482 0.0 - - - - - - - 309.3 15 10 HIST1H2BA histone cluster 1, H2ba 663 84 B20140214_SF053_03 B20140214_SF053_03 TB464149.[MT7]-ESYSIYIYK[MT7].2y3_1.heavy 727.394 / 567.362 11507.0 35.09339904785156 44 14 10 10 10 9.064542373319922 11.03199652906191 0.0 3 0.9474343441927034 5.3590808342688305 11507.0 10.83403328529041 0.0 - - - - - - - 396.75 23 4 HIST1H2BA histone cluster 1, H2ba 665 85 B20140214_SF053_03 B20140214_SF053_03 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1508520.0 35.55400085449219 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1508520.0 79.04846452805154 0.0 - - - - - - - 289.0 3017 10 667 85 B20140214_SF053_03 B20140214_SF053_03 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 362178.0 35.55400085449219 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 362178.0 66.02325059131348 0.0 - - - - - - - 259.42857142857144 724 7 669 85 B20140214_SF053_03 B20140214_SF053_03 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 507230.0 35.55400085449219 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 507230.0 48.44475123853985 0.0 - - - - - - - 330.0 1014 1 671 86 B20140214_SF053_03 B20140214_SF053_03 TB464010.[MT7]-DIDVIRGNIVK[MT7].3y10_2.heavy 510.647 / 635.902 44060.0 31.205949783325195 37 10 10 7 10 0.7975261123779986 75.55500791981308 0.028301239013671875 3 0.8379329760396775 3.0232018389990727 44060.0 95.48205041064854 0.0 - - - - - - - 831.0909090909091 88 11 MRPS6 mitochondrial ribosomal protein S6 673 86 B20140214_SF053_03 B20140214_SF053_03 TB464010.[MT7]-DIDVIRGNIVK[MT7].3b4_1.heavy 510.647 / 587.316 23903.0 31.205949783325195 37 10 10 7 10 0.7975261123779986 75.55500791981308 0.028301239013671875 3 0.8379329760396775 3.0232018389990727 23903.0 23.827560379703645 0.0 - - - - - - - 1573.4285714285713 47 7 MRPS6 mitochondrial ribosomal protein S6 675 86 B20140214_SF053_03 B20140214_SF053_03 TB464010.[MT7]-DIDVIRGNIVK[MT7].3y8_2.heavy 510.647 / 521.846 82010.0 31.205949783325195 37 10 10 7 10 0.7975261123779986 75.55500791981308 0.028301239013671875 3 0.8379329760396775 3.0232018389990727 82010.0 117.37488568142287 0.0 - - - - - - - 1752.0 164 7 MRPS6 mitochondrial ribosomal protein S6 677 86 B20140214_SF053_03 B20140214_SF053_03 TB464010.[MT7]-DIDVIRGNIVK[MT7].3y5_1.heavy 510.647 / 674.432 15742.0 31.205949783325195 37 10 10 7 10 0.7975261123779986 75.55500791981308 0.028301239013671875 3 0.8379329760396775 3.0232018389990727 15742.0 27.573086504925072 0.0 - - - - - - - 758.1578947368421 31 19 MRPS6 mitochondrial ribosomal protein S6 679 87 B20140214_SF053_03 B20140214_SF053_03 TB246400.[MT7]-RNANVNLK[MT7].3y3_1.heavy 406.25 / 518.342 20266.0 20.009700775146484 37 11 8 10 8 0.7486515097948173 70.51907180177356 0.0 4 0.8525496182671721 3.1736029722651966 20266.0 16.878353400365917 1.0 - - - - - - - 1174.857142857143 70 7 ANKRD22 ankyrin repeat domain 22 681 87 B20140214_SF053_03 B20140214_SF053_03 TB246400.[MT7]-RNANVNLK[MT7].3b4_1.heavy 406.25 / 600.333 20227.0 20.009700775146484 37 11 8 10 8 0.7486515097948173 70.51907180177356 0.0 4 0.8525496182671721 3.1736029722651966 20227.0 45.52542806632905 1.0 - - - - - - - 756.5555555555555 40 9 ANKRD22 ankyrin repeat domain 22 683 87 B20140214_SF053_03 B20140214_SF053_03 TB246400.[MT7]-RNANVNLK[MT7].3b5_1.heavy 406.25 / 699.402 2518.0 20.009700775146484 37 11 8 10 8 0.7486515097948173 70.51907180177356 0.0 4 0.8525496182671721 3.1736029722651966 2518.0 3.264816035342393 1.0 - - - - - - - 244.3684210526316 5 19 ANKRD22 ankyrin repeat domain 22 685 87 B20140214_SF053_03 B20140214_SF053_03 TB246400.[MT7]-RNANVNLK[MT7].3b4_2.heavy 406.25 / 300.67 26090.0 20.009700775146484 37 11 8 10 8 0.7486515097948173 70.51907180177356 0.0 4 0.8525496182671721 3.1736029722651966 26090.0 29.704861446475796 0.0 - - - - - - - 1202.2222222222222 52 9 ANKRD22 ankyrin repeat domain 22 687 88 B20140214_SF053_03 B20140214_SF053_03 TB464152.[MT7]-WYQNPDYNFFNNYK[MT7].3b6_1.heavy 734.349 / 948.433 25104.0 41.024298667907715 42 16 10 6 10 1.8205397221141368 43.273676536835545 0.035999298095703125 3 0.9685352074794592 6.939122562320838 25104.0 16.14128670568565 0.0 - - - - - - - 1638.0 50 9 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 689 88 B20140214_SF053_03 B20140214_SF053_03 TB464152.[MT7]-WYQNPDYNFFNNYK[MT7].3b4_1.heavy 734.349 / 736.354 63650.0 41.024298667907715 42 16 10 6 10 1.8205397221141368 43.273676536835545 0.035999298095703125 3 0.9685352074794592 6.939122562320838 63650.0 22.453099228518223 0.0 - - - - - - - 1215.0 127 1 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 691 88 B20140214_SF053_03 B20140214_SF053_03 TB464152.[MT7]-WYQNPDYNFFNNYK[MT7].3y4_1.heavy 734.349 / 682.364 43000.0 41.024298667907715 42 16 10 6 10 1.8205397221141368 43.273676536835545 0.035999298095703125 3 0.9685352074794592 6.939122562320838 43000.0 36.85547210450814 0.0 - - - - - - - 749.25 86 4 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 693 88 B20140214_SF053_03 B20140214_SF053_03 TB464152.[MT7]-WYQNPDYNFFNNYK[MT7].3b3_1.heavy 734.349 / 622.311 28829.0 41.024298667907715 42 16 10 6 10 1.8205397221141368 43.273676536835545 0.035999298095703125 3 0.9685352074794592 6.939122562320838 28829.0 16.87082312354765 0.0 - - - - - - - 324.0 57 1 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 695 89 B20140214_SF053_03 B20140214_SF053_03 TB464156.[MT7]-SLHVGTQC[CAM]ALTR.3y6_1.heavy 496.269 / 748.377 30519.0 25.71739959716797 47 17 10 10 10 3.071419906025808 32.55823139122409 0.0 3 0.9773605076316291 8.186650586341921 30519.0 36.113191357788644 1.0 - - - - - - - 691.875 222 8 MLANA melan-A 697 89 B20140214_SF053_03 B20140214_SF053_03 TB464156.[MT7]-SLHVGTQC[CAM]ALTR.3b3_1.heavy 496.269 / 482.284 105176.0 25.71739959716797 47 17 10 10 10 3.071419906025808 32.55823139122409 0.0 3 0.9773605076316291 8.186650586341921 105176.0 64.81462332542455 0.0 - - - - - - - 1476.0 210 1 MLANA melan-A 699 89 B20140214_SF053_03 B20140214_SF053_03 TB464156.[MT7]-SLHVGTQC[CAM]ALTR.3y8_1.heavy 496.269 / 906.446 34690.0 25.71739959716797 47 17 10 10 10 3.071419906025808 32.55823139122409 0.0 3 0.9773605076316291 8.186650586341921 34690.0 261.3948507488863 0.0 - - - - - - - 147.66666666666666 69 21 MLANA melan-A 701 89 B20140214_SF053_03 B20140214_SF053_03 TB464156.[MT7]-SLHVGTQC[CAM]ALTR.3y5_1.heavy 496.269 / 620.318 88754.0 25.71739959716797 47 17 10 10 10 3.071419906025808 32.55823139122409 0.0 3 0.9773605076316291 8.186650586341921 88754.0 129.7915110117945 0.0 - - - - - - - 1228.4285714285713 177 7 MLANA melan-A 703 90 B20140214_SF053_03 B20140214_SF053_03 TB464154.[MT7]-LSDEEVDEMIR.2y4_1.heavy 740.359 / 548.286 27001.0 35.68519973754883 48 18 10 10 10 4.075974303594323 20.579928206129377 0.0 3 0.9860545451941112 10.438546502784893 27001.0 57.974724428465436 0.0 - - - - - - - 777.25 54 8 CALML3 calmodulin-like 3 705 90 B20140214_SF053_03 B20140214_SF053_03 TB464154.[MT7]-LSDEEVDEMIR.2y8_1.heavy 740.359 / 1020.47 17592.0 35.68519973754883 48 18 10 10 10 4.075974303594323 20.579928206129377 0.0 3 0.9860545451941112 10.438546502784893 17592.0 109.5056134923407 0.0 - - - - - - - 201.8 35 15 CALML3 calmodulin-like 3 707 90 B20140214_SF053_03 B20140214_SF053_03 TB464154.[MT7]-LSDEEVDEMIR.2y10_1.heavy 740.359 / 1222.53 20864.0 35.68519973754883 48 18 10 10 10 4.075974303594323 20.579928206129377 0.0 3 0.9860545451941112 10.438546502784893 20864.0 20.227806288569983 1.0 - - - - - - - 141.45454545454547 47 11 CALML3 calmodulin-like 3 709 90 B20140214_SF053_03 B20140214_SF053_03 TB464154.[MT7]-LSDEEVDEMIR.2b5_1.heavy 740.359 / 718.338 9655.0 35.68519973754883 48 18 10 10 10 4.075974303594323 20.579928206129377 0.0 3 0.9860545451941112 10.438546502784893 9655.0 10.942743103301929 0.0 - - - - - - - 1236.4444444444443 19 9 CALML3 calmodulin-like 3 711 91 B20140214_SF053_03 B20140214_SF053_03 TB107911.[MT7]-YYRVC[CAM]TLAIIDPGDSDIIR.3b8_1.heavy 795.418 / 1171.6 7670.0 40.522549629211426 37 11 10 6 10 1.4298983210225376 69.9350426039306 0.037799835205078125 3 0.8737129594001575 3.435601907806493 7670.0 3.3397997496871095 1.0 - - - - - - - 707.5714285714286 15 7 RPL30 ribosomal protein L30 713 91 B20140214_SF053_03 B20140214_SF053_03 TB107911.[MT7]-YYRVC[CAM]TLAIIDPGDSDIIR.3y8_1.heavy 795.418 / 872.447 50093.0 40.522549629211426 37 11 10 6 10 1.4298983210225376 69.9350426039306 0.037799835205078125 3 0.8737129594001575 3.435601907806493 50093.0 55.606323562494296 0.0 - - - - - - - 1188.5 100 8 RPL30 ribosomal protein L30 715 91 B20140214_SF053_03 B20140214_SF053_03 TB107911.[MT7]-YYRVC[CAM]TLAIIDPGDSDIIR.3y5_1.heavy 795.418 / 603.346 7909.0 40.522549629211426 37 11 10 6 10 1.4298983210225376 69.9350426039306 0.037799835205078125 3 0.8737129594001575 3.435601907806493 7909.0 8.996518557829852 0.0 - - - - - - - 1198.5714285714287 15 7 RPL30 ribosomal protein L30 717 91 B20140214_SF053_03 B20140214_SF053_03 TB107911.[MT7]-YYRVC[CAM]TLAIIDPGDSDIIR.3b8_2.heavy 795.418 / 586.306 48415.0 40.522549629211426 37 11 10 6 10 1.4298983210225376 69.9350426039306 0.037799835205078125 3 0.8737129594001575 3.435601907806493 48415.0 42.50952692309684 0.0 - - - - - - - 1697.875 96 8 RPL30 ribosomal protein L30 719 92 B20140214_SF053_03 B20140214_SF053_03 TB464155.[MT7]-GQPGPAATDRNPR.3b4_1.heavy 494.263 / 484.264 44811.0 17.28689956665039 43 13 10 10 10 2.3648552671808876 42.28588590083513 0.0 3 0.9007229953618766 3.8839876328860687 44811.0 80.94724906736485 0.0 - - - - - - - 1172.0 89 8 FGF5 fibroblast growth factor 5 721 92 B20140214_SF053_03 B20140214_SF053_03 TB464155.[MT7]-GQPGPAATDRNPR.3y11_2.heavy 494.263 / 576.299 137040.0 17.28689956665039 43 13 10 10 10 2.3648552671808876 42.28588590083513 0.0 3 0.9007229953618766 3.8839876328860687 137040.0 161.34899931083953 0.0 - - - - - - - 274.3636363636364 274 11 FGF5 fibroblast growth factor 5 723 92 B20140214_SF053_03 B20140214_SF053_03 TB464155.[MT7]-GQPGPAATDRNPR.3y4_1.heavy 494.263 / 542.316 11510.0 17.28689956665039 43 13 10 10 10 2.3648552671808876 42.28588590083513 0.0 3 0.9007229953618766 3.8839876328860687 11510.0 40.65016644809846 0.0 - - - - - - - 714.4285714285714 23 7 FGF5 fibroblast growth factor 5 725 92 B20140214_SF053_03 B20140214_SF053_03 TB464155.[MT7]-GQPGPAATDRNPR.3y12_2.heavy 494.263 / 640.329 23774.0 17.28689956665039 43 13 10 10 10 2.3648552671808876 42.28588590083513 0.0 3 0.9007229953618766 3.8839876328860687 23774.0 61.76338144329897 0.0 - - - - - - - 692.375 47 8 FGF5 fibroblast growth factor 5 727 93 B20140214_SF053_03 B20140214_SF053_03 TB464292.[MT7]-DSLYNEGILIVWDPSVYHSDIPK[MT7].3b4_1.heavy 983.514 / 623.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 729 93 B20140214_SF053_03 B20140214_SF053_03 TB464292.[MT7]-DSLYNEGILIVWDPSVYHSDIPK[MT7].3b5_1.heavy 983.514 / 737.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 731 93 B20140214_SF053_03 B20140214_SF053_03 TB464292.[MT7]-DSLYNEGILIVWDPSVYHSDIPK[MT7].3b8_1.heavy 983.514 / 1036.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 733 93 B20140214_SF053_03 B20140214_SF053_03 TB464292.[MT7]-DSLYNEGILIVWDPSVYHSDIPK[MT7].3b7_1.heavy 983.514 / 923.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 735 94 B20140214_SF053_03 B20140214_SF053_03 TB107913.[MT7]-DTDNEEEIREAFRVFDK[MT7].4y4_1.heavy 601.052 / 652.379 8149.0 39.02159881591797 50 20 10 10 10 9.988621500197612 10.011391461576718 0.0 3 0.996213759072391 20.050311448608685 8149.0 16.263730506395653 0.0 - - - - - - - 740.7777777777778 16 9 CALML3 calmodulin-like 3 737 94 B20140214_SF053_03 B20140214_SF053_03 TB107913.[MT7]-DTDNEEEIREAFRVFDK[MT7].4b4_1.heavy 601.052 / 590.254 14404.0 39.02159881591797 50 20 10 10 10 9.988621500197612 10.011391461576718 0.0 3 0.996213759072391 20.050311448608685 14404.0 10.096261682242991 0.0 - - - - - - - 845.5454545454545 28 11 CALML3 calmodulin-like 3 739 94 B20140214_SF053_03 B20140214_SF053_03 TB107913.[MT7]-DTDNEEEIREAFRVFDK[MT7].4b5_1.heavy 601.052 / 719.296 12593.0 39.02159881591797 50 20 10 10 10 9.988621500197612 10.011391461576718 0.0 3 0.996213759072391 20.050311448608685 12593.0 35.7886170212766 0.0 - - - - - - - 740.5 25 8 CALML3 calmodulin-like 3 741 94 B20140214_SF053_03 B20140214_SF053_03 TB107913.[MT7]-DTDNEEEIREAFRVFDK[MT7].4y3_1.heavy 601.052 / 553.31 11359.0 39.02159881591797 50 20 10 10 10 9.988621500197612 10.011391461576718 0.0 3 0.996213759072391 20.050311448608685 11359.0 10.516381019341907 1.0 - - - - - - - 1286.25 25 8 CALML3 calmodulin-like 3 743 95 B20140214_SF053_03 B20140214_SF053_03 TB107912.[MT7]-GIGIENIHYLNDGLWHMK[MT7].4b7_1.heavy 600.32 / 841.49 9606.0 39.78455066680908 39 13 10 6 10 1.2061495250808176 54.817151164729225 0.036197662353515625 3 0.9076226643197023 4.028824032126102 9606.0 30.092506142506146 0.0 - - - - - - - 278.0833333333333 19 12 MCTS1 malignant T cell amplified sequence 1 745 95 B20140214_SF053_03 B20140214_SF053_03 TB107912.[MT7]-GIGIENIHYLNDGLWHMK[MT7].4b5_1.heavy 600.32 / 614.363 9931.0 39.78455066680908 39 13 10 6 10 1.2061495250808176 54.817151164729225 0.036197662353515625 3 0.9076226643197023 4.028824032126102 9931.0 14.126080161452176 0.0 - - - - - - - 763.125 19 8 MCTS1 malignant T cell amplified sequence 1 747 95 B20140214_SF053_03 B20140214_SF053_03 TB107912.[MT7]-GIGIENIHYLNDGLWHMK[MT7].4y3_1.heavy 600.32 / 559.314 19618.0 39.78455066680908 39 13 10 6 10 1.2061495250808176 54.817151164729225 0.036197662353515625 3 0.9076226643197023 4.028824032126102 19618.0 16.07091866588648 0.0 - - - - - - - 1720.857142857143 39 7 MCTS1 malignant T cell amplified sequence 1 749 95 B20140214_SF053_03 B20140214_SF053_03 TB107912.[MT7]-GIGIENIHYLNDGLWHMK[MT7].4b6_1.heavy 600.32 / 728.406 16281.0 39.78455066680908 39 13 10 6 10 1.2061495250808176 54.817151164729225 0.036197662353515625 3 0.9076226643197023 4.028824032126102 16281.0 15.930114033915043 0.0 - - - - - - - 295.0 32 8 MCTS1 malignant T cell amplified sequence 1 751 96 B20140214_SF053_03 B20140214_SF053_03 TB464291.[MT7]-K[MT7]FLEELLTTQC[CAM]DRFSQEEIK[MT7].4b4_1.heavy 737.396 / 806.501 3896.0 40.844624519348145 31 5 10 6 10 0.41505598893712775 111.72002472310936 0.035900115966796875 3 0.6591722512864664 2.0507257045983036 3896.0 7.018572915432026 1.0 - - - - - - - 765.2857142857143 7 7 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 753 96 B20140214_SF053_03 B20140214_SF053_03 TB464291.[MT7]-K[MT7]FLEELLTTQC[CAM]DRFSQEEIK[MT7].4y13_2.heavy 737.396 / 893.432 19640.0 40.844624519348145 31 5 10 6 10 0.41505598893712775 111.72002472310936 0.035900115966796875 3 0.6591722512864664 2.0507257045983036 19640.0 32.82117097540916 0.0 - - - - - - - 779.1 39 10 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 755 96 B20140214_SF053_03 B20140214_SF053_03 TB464291.[MT7]-K[MT7]FLEELLTTQC[CAM]DRFSQEEIK[MT7].4b5_1.heavy 737.396 / 935.544 9090.0 40.844624519348145 31 5 10 6 10 0.41505598893712775 111.72002472310936 0.035900115966796875 3 0.6591722512864664 2.0507257045983036 9090.0 18.247167487684727 0.0 - - - - - - - 289.7857142857143 18 14 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 757 96 B20140214_SF053_03 B20140214_SF053_03 TB464291.[MT7]-K[MT7]FLEELLTTQC[CAM]DRFSQEEIK[MT7].4b6_2.heavy 737.396 / 524.818 28243.0 40.844624519348145 31 5 10 6 10 0.41505598893712775 111.72002472310936 0.035900115966796875 3 0.6591722512864664 2.0507257045983036 28243.0 95.13044984702418 0.0 - - - - - - - 360.77777777777777 56 9 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 759 97 B20140214_SF053_03 B20140214_SF053_03 TB107915.[MT7]-FFDSAC[CAM]TMGAYHPLLYEK[MT7].3y6_1.heavy 813.397 / 906.542 20137.0 39.27884864807129 42 16 10 6 10 4.102278231190648 24.376698596325078 0.03820037841796875 3 0.9651078996007371 6.58760983600995 20137.0 10.082940122431536 0.0 - - - - - - - 421.25 40 8 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 761 97 B20140214_SF053_03 B20140214_SF053_03 TB107915.[MT7]-FFDSAC[CAM]TMGAYHPLLYEK[MT7].3b5_1.heavy 813.397 / 712.342 4274.0 39.27884864807129 42 16 10 6 10 4.102278231190648 24.376698596325078 0.03820037841796875 3 0.9651078996007371 6.58760983600995 4274.0 8.574572500256911 0.0 - - - - - - - 731.7 8 10 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 763 97 B20140214_SF053_03 B20140214_SF053_03 TB107915.[MT7]-FFDSAC[CAM]TMGAYHPLLYEK[MT7].3y4_1.heavy 813.397 / 696.405 5014.0 39.27884864807129 42 16 10 6 10 4.102278231190648 24.376698596325078 0.03820037841796875 3 0.9651078996007371 6.58760983600995 5014.0 8.560899405841067 0.0 - - - - - - - 790.3076923076923 10 13 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 765 97 B20140214_SF053_03 B20140214_SF053_03 TB107915.[MT7]-FFDSAC[CAM]TMGAYHPLLYEK[MT7].3b3_1.heavy 813.397 / 554.273 9123.0 39.27884864807129 42 16 10 6 10 4.102278231190648 24.376698596325078 0.03820037841796875 3 0.9651078996007371 6.58760983600995 9123.0 8.40626219051354 0.0 - - - - - - - 378.1 18 10 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 767 98 B20140214_SF053_03 B20140214_SF053_03 TB464290.[MT7]-VFQSLPHENK[MT7]PLTLSNYQTNK[MT7].4y5_1.heavy 723.4 / 797.427 5098.0 32.2568998336792 38 11 10 7 10 1.233632511772809 51.4989036229413 0.029201507568359375 3 0.8600389898848586 3.259554507293667 5098.0 6.0481406145230245 1.0 - - - - - - - 716.8 10 10 CSTB cystatin B (stefin B) 769 98 B20140214_SF053_03 B20140214_SF053_03 TB464290.[MT7]-VFQSLPHENK[MT7]PLTLSNYQTNK[MT7].4b4_1.heavy 723.4 / 606.337 9590.0 32.2568998336792 38 11 10 7 10 1.233632511772809 51.4989036229413 0.029201507568359375 3 0.8600389898848586 3.259554507293667 9590.0 10.396919590621621 0.0 - - - - - - - 1226.4 19 10 CSTB cystatin B (stefin B) 771 98 B20140214_SF053_03 B20140214_SF053_03 TB464290.[MT7]-VFQSLPHENK[MT7]PLTLSNYQTNK[MT7].4y3_1.heavy 723.4 / 506.306 32454.0 32.2568998336792 38 11 10 7 10 1.233632511772809 51.4989036229413 0.029201507568359375 3 0.8600389898848586 3.259554507293667 32454.0 51.1246961690885 0.0 - - - - - - - 688.3636363636364 64 11 CSTB cystatin B (stefin B) 773 98 B20140214_SF053_03 B20140214_SF053_03 TB464290.[MT7]-VFQSLPHENK[MT7]PLTLSNYQTNK[MT7].4b3_1.heavy 723.4 / 519.305 5804.0 32.2568998336792 38 11 10 7 10 1.233632511772809 51.4989036229413 0.029201507568359375 3 0.8600389898848586 3.259554507293667 5804.0 10.77009591955594 0.0 - - - - - - - 768.5555555555555 11 9 CSTB cystatin B (stefin B) 775 99 B20140214_SF053_03 B20140214_SF053_03 TB107914.[MT7]-YGFVIAVTTIDNIGAGVIQPGR.3b6_1.heavy 802.448 / 795.452 10752.0 51.182098388671875 41 11 10 10 10 0.925301365288643 62.023091599880665 0.0 3 0.8518666878960719 3.1660883902102426 10752.0 45.560084354832654 0.0 - - - - - - - 244.08333333333334 21 12 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 777 99 B20140214_SF053_03 B20140214_SF053_03 TB107914.[MT7]-YGFVIAVTTIDNIGAGVIQPGR.3b4_1.heavy 802.448 / 611.331 7322.0 51.182098388671875 41 11 10 10 10 0.925301365288643 62.023091599880665 0.0 3 0.8518666878960719 3.1660883902102426 7322.0 18.340017499619574 0.0 - - - - - - - 597.8571428571429 14 7 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 779 99 B20140214_SF053_03 B20140214_SF053_03 TB107914.[MT7]-YGFVIAVTTIDNIGAGVIQPGR.3b3_1.heavy 802.448 / 512.263 3514.0 51.182098388671875 41 11 10 10 10 0.925301365288643 62.023091599880665 0.0 3 0.8518666878960719 3.1660883902102426 3514.0 26.44419942723249 0.0 - - - - - - - 214.5 7 16 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 781 99 B20140214_SF053_03 B20140214_SF053_03 TB107914.[MT7]-YGFVIAVTTIDNIGAGVIQPGR.3y9_1.heavy 802.448 / 854.484 17196.0 51.182098388671875 41 11 10 10 10 0.925301365288643 62.023091599880665 0.0 3 0.8518666878960719 3.1660883902102426 17196.0 65.07302850946034 0.0 - - - - - - - 245.875 34 8 POLR2G polymerase (RNA) II (DNA directed) polypeptide G 783 100 B20140214_SF053_03 B20140214_SF053_03 TB246605.[MT7]-RLVQSPNSYFMDVK[MT7].3y3_1.heavy 658.024 / 505.31 32934.0 34.38119888305664 40 14 10 6 10 1.620267418520476 41.145471361475856 0.037200927734375 3 0.933125962713931 4.745512417127883 32934.0 39.201420442247496 0.0 - - - - - - - 755.875 65 8 RPS27L;RPS27 ribosomal protein S27-like;ribosomal protein S27 785 100 B20140214_SF053_03 B20140214_SF053_03 TB246605.[MT7]-RLVQSPNSYFMDVK[MT7].3b5_1.heavy 658.024 / 728.453 8830.0 34.38119888305664 40 14 10 6 10 1.620267418520476 41.145471361475856 0.037200927734375 3 0.933125962713931 4.745512417127883 8830.0 14.112738896521277 0.0 - - - - - - - 716.0 17 7 RPS27L;RPS27 ribosomal protein S27-like;ribosomal protein S27 787 100 B20140214_SF053_03 B20140214_SF053_03 TB246605.[MT7]-RLVQSPNSYFMDVK[MT7].3y4_1.heavy 658.024 / 636.351 22115.0 34.38119888305664 40 14 10 6 10 1.620267418520476 41.145471361475856 0.037200927734375 3 0.933125962713931 4.745512417127883 22115.0 16.645359170409662 0.0 - - - - - - - 199.0 44 2 RPS27L;RPS27 ribosomal protein S27-like;ribosomal protein S27 789 100 B20140214_SF053_03 B20140214_SF053_03 TB246605.[MT7]-RLVQSPNSYFMDVK[MT7].3y5_1.heavy 658.024 / 783.419 16865.0 34.38119888305664 40 14 10 6 10 1.620267418520476 41.145471361475856 0.037200927734375 3 0.933125962713931 4.745512417127883 16865.0 36.109818604681784 0.0 - - - - - - - 291.55555555555554 33 9 RPS27L;RPS27 ribosomal protein S27-like;ribosomal protein S27 791 101 B20140214_SF053_03 B20140214_SF053_03 TB107916.[MT7]-AAGYDLYSAYDYTIPPMEK[MT7].3b6_1.heavy 819.403 / 735.379 14387.0 40.40420150756836 40 10 10 10 10 0.7607136239776433 71.93881675580461 0.0 3 0.8341709162893834 2.9877151228376437 14387.0 25.806404271175516 0.0 - - - - - - - 275.1666666666667 28 6 DUT deoxyuridine triphosphatase 793 101 B20140214_SF053_03 B20140214_SF053_03 TB107916.[MT7]-AAGYDLYSAYDYTIPPMEK[MT7].3b5_1.heavy 819.403 / 622.295 12422.0 40.40420150756836 40 10 10 10 10 0.7607136239776433 71.93881675580461 0.0 3 0.8341709162893834 2.9877151228376437 12422.0 25.434725962464835 0.0 - - - - - - - 1778.75 24 8 DUT deoxyuridine triphosphatase 795 101 B20140214_SF053_03 B20140214_SF053_03 TB107916.[MT7]-AAGYDLYSAYDYTIPPMEK[MT7].3b7_1.heavy 819.403 / 898.443 6840.0 40.40420150756836 40 10 10 10 10 0.7607136239776433 71.93881675580461 0.0 3 0.8341709162893834 2.9877151228376437 6840.0 24.19732168981117 0.0 - - - - - - - 209.66666666666666 13 9 DUT deoxyuridine triphosphatase 797 101 B20140214_SF053_03 B20140214_SF053_03 TB107916.[MT7]-AAGYDLYSAYDYTIPPMEK[MT7].3y5_1.heavy 819.403 / 745.404 45363.0 40.40420150756836 40 10 10 10 10 0.7607136239776433 71.93881675580461 0.0 3 0.8341709162893834 2.9877151228376437 45363.0 22.124473179182463 0.0 - - - - - - - 865.0 90 1 DUT deoxyuridine triphosphatase 799 102 B20140214_SF053_03 B20140214_SF053_03 TB107919.[MT7]-GLIAAIC[CAM]AGPTALLAHEIGFGSK[MT7].3y7_1.heavy 852.48 / 881.485 8541.0 48.5723237991333 47 20 10 7 10 4.3247312687399395 18.32093363688007 0.027301788330078125 3 0.9933008151825571 15.069839960750999 8541.0 12.125826804123712 1.0 - - - - - - - 212.47368421052633 17 19 PARK7 Parkinson disease (autosomal recessive, early onset) 7 801 102 B20140214_SF053_03 B20140214_SF053_03 TB107919.[MT7]-GLIAAIC[CAM]AGPTALLAHEIGFGSK[MT7].3y6_1.heavy 852.48 / 752.442 15179.0 48.5723237991333 47 20 10 7 10 4.3247312687399395 18.32093363688007 0.027301788330078125 3 0.9933008151825571 15.069839960750999 15179.0 25.79020809018568 0.0 - - - - - - - 663.9 30 10 PARK7 Parkinson disease (autosomal recessive, early onset) 7 803 102 B20140214_SF053_03 B20140214_SF053_03 TB107919.[MT7]-GLIAAIC[CAM]AGPTALLAHEIGFGSK[MT7].3b5_1.heavy 852.48 / 570.373 28594.0 48.5723237991333 47 20 10 7 10 4.3247312687399395 18.32093363688007 0.027301788330078125 3 0.9933008151825571 15.069839960750999 28594.0 65.7441947475584 0.0 - - - - - - - 723.4166666666666 57 12 PARK7 Parkinson disease (autosomal recessive, early onset) 7 805 102 B20140214_SF053_03 B20140214_SF053_03 TB107919.[MT7]-GLIAAIC[CAM]AGPTALLAHEIGFGSK[MT7].3y5_1.heavy 852.48 / 639.358 20656.0 48.5723237991333 47 20 10 7 10 4.3247312687399395 18.32093363688007 0.027301788330078125 3 0.9933008151825571 15.069839960750999 20656.0 139.6577958643507 0.0 - - - - - - - 663.0 41 7 PARK7 Parkinson disease (autosomal recessive, early onset) 7 807 103 B20140214_SF053_03 B20140214_SF053_03 TB107918.[MT7]-ADGTVNQIEGEATPVNLTEPAK[MT7].3b6_1.heavy 848.113 / 702.354 12930.0 33.50299835205078 43 13 10 10 10 2.460264715733562 40.64603266489704 0.0 3 0.9198198052451297 4.328958021384744 12930.0 39.12089407191448 0.0 - - - - - - - 640.2857142857143 25 7 APOD apolipoprotein D 809 103 B20140214_SF053_03 B20140214_SF053_03 TB107918.[MT7]-ADGTVNQIEGEATPVNLTEPAK[MT7].3y5_1.heavy 848.113 / 689.395 22481.0 33.50299835205078 43 13 10 10 10 2.460264715733562 40.64603266489704 0.0 3 0.9198198052451297 4.328958021384744 22481.0 52.20078004535147 0.0 - - - - - - - 734.8 44 10 APOD apolipoprotein D 811 103 B20140214_SF053_03 B20140214_SF053_03 TB107918.[MT7]-ADGTVNQIEGEATPVNLTEPAK[MT7].3b7_1.heavy 848.113 / 830.412 34897.0 33.50299835205078 43 13 10 10 10 2.460264715733562 40.64603266489704 0.0 3 0.9198198052451297 4.328958021384744 34897.0 21.818087035405114 0.0 - - - - - - - 1947.0 69 2 APOD apolipoprotein D 813 103 B20140214_SF053_03 B20140214_SF053_03 TB107918.[MT7]-ADGTVNQIEGEATPVNLTEPAK[MT7].3y9_1.heavy 848.113 / 1112.64 26375.0 33.50299835205078 43 13 10 10 10 2.460264715733562 40.64603266489704 0.0 3 0.9198198052451297 4.328958021384744 26375.0 53.826530612244895 0.0 - - - - - - - 271.15384615384613 52 13 APOD apolipoprotein D 815 104 B20140214_SF053_03 B20140214_SF053_03 TB107854.[MT7]-AADTDGDGQVNYEEFVR.2y4_1.heavy 1015.46 / 550.298 3625.0 33.98855018615723 40 15 10 5 10 3.488620710926216 28.66462372558992 0.040897369384765625 3 0.9529047199415195 5.66440545679632 3625.0 52.44178082191781 0.0 - - - - - - - 181.625 7 16 CALML3 calmodulin-like 3 817 104 B20140214_SF053_03 B20140214_SF053_03 TB107854.[MT7]-AADTDGDGQVNYEEFVR.2b7_1.heavy 1015.46 / 790.333 12616.0 33.98855018615723 40 15 10 5 10 3.488620710926216 28.66462372558992 0.040897369384765625 3 0.9529047199415195 5.66440545679632 12616.0 46.0965278305729 0.0 - - - - - - - 189.84615384615384 25 13 CALML3 calmodulin-like 3 819 104 B20140214_SF053_03 B20140214_SF053_03 TB107854.[MT7]-AADTDGDGQVNYEEFVR.2y10_1.heavy 1015.46 / 1240.6 10658.0 33.98855018615723 40 15 10 5 10 3.488620710926216 28.66462372558992 0.040897369384765625 3 0.9529047199415195 5.66440545679632 10658.0 71.1882020457661 0.0 - - - - - - - 177.55555555555554 21 9 CALML3 calmodulin-like 3 821 104 B20140214_SF053_03 B20140214_SF053_03 TB107854.[MT7]-AADTDGDGQVNYEEFVR.2b5_1.heavy 1015.46 / 618.285 21244.0 33.98855018615723 40 15 10 5 10 3.488620710926216 28.66462372558992 0.040897369384765625 3 0.9529047199415195 5.66440545679632 21244.0 82.38322834645669 0.0 - - - - - - - 217.8181818181818 42 11 CALML3 calmodulin-like 3 823 105 B20140214_SF053_03 B20140214_SF053_03 TB107853.[MT7]-EDPDSVPPIDVLWIK[MT7].3b6_1.heavy 671.038 / 787.359 6104.0 46.636600494384766 45 15 10 10 10 1.7569432714820628 45.36777672806322 0.0 3 0.954173856462181 5.742924386857305 6104.0 15.226558323786868 0.0 - - - - - - - 328.93333333333334 12 15 SRXN1 sulfiredoxin 1 825 105 B20140214_SF053_03 B20140214_SF053_03 TB107853.[MT7]-EDPDSVPPIDVLWIK[MT7].3y3_1.heavy 671.038 / 590.378 6714.0 46.636600494384766 45 15 10 10 10 1.7569432714820628 45.36777672806322 0.0 3 0.954173856462181 5.742924386857305 6714.0 7.419528178243774 1.0 - - - - - - - 705.875 13 8 SRXN1 sulfiredoxin 1 827 105 B20140214_SF053_03 B20140214_SF053_03 TB107853.[MT7]-EDPDSVPPIDVLWIK[MT7].3b4_1.heavy 671.038 / 601.259 2950.0 46.636600494384766 45 15 10 10 10 1.7569432714820628 45.36777672806322 0.0 3 0.954173856462181 5.742924386857305 2950.0 9.019276532064177 0.0 - - - - - - - 310.77777777777777 5 18 SRXN1 sulfiredoxin 1 829 105 B20140214_SF053_03 B20140214_SF053_03 TB107853.[MT7]-EDPDSVPPIDVLWIK[MT7].3b5_1.heavy 671.038 / 688.291 3154.0 46.636600494384766 45 15 10 10 10 1.7569432714820628 45.36777672806322 0.0 3 0.954173856462181 5.742924386857305 3154.0 10.524889268848721 0.0 - - - - - - - 693.7272727272727 6 11 SRXN1 sulfiredoxin 1 831 106 B20140214_SF053_03 B20140214_SF053_03 TB464299.[MT7]-LRPEMLQDLRENTEFSELELQEWYK[MT7].4y4_1.heavy 871.947 / 769.4 8338.0 44.119099617004395 28 5 10 3 10 1.4134240681176362 44.78385302217785 0.0796966552734375 3 0.6300211320106042 1.962773320271431 8338.0 26.840703767275684 0.0 - - - - - - - 261.0 16 18 HPCA hippocalcin 833 106 B20140214_SF053_03 B20140214_SF053_03 TB464299.[MT7]-LRPEMLQDLRENTEFSELELQEWYK[MT7].4b8_1.heavy 871.947 / 1127.6 2186.0 44.119099617004395 28 5 10 3 10 1.4134240681176362 44.78385302217785 0.0796966552734375 3 0.6300211320106042 1.962773320271431 2186.0 10.795061728395062 0.0 - - - - - - - 200.11764705882354 4 17 HPCA hippocalcin 835 106 B20140214_SF053_03 B20140214_SF053_03 TB464299.[MT7]-LRPEMLQDLRENTEFSELELQEWYK[MT7].4b14_2.heavy 871.947 / 935.484 3562.0 44.119099617004395 28 5 10 3 10 1.4134240681176362 44.78385302217785 0.0796966552734375 3 0.6300211320106042 1.962773320271431 3562.0 19.0559670781893 0.0 - - - - - - - 264.6 7 15 HPCA hippocalcin 837 106 B20140214_SF053_03 B20140214_SF053_03 TB464299.[MT7]-LRPEMLQDLRENTEFSELELQEWYK[MT7].4b17_2.heavy 871.947 / 1117.06 8177.0 44.119099617004395 28 5 10 3 10 1.4134240681176362 44.78385302217785 0.0796966552734375 3 0.6300211320106042 1.962773320271431 8177.0 80.42399176954731 0.0 - - - - - - - 179.35714285714286 16 14 HPCA hippocalcin 839 107 B20140214_SF053_03 B20140214_SF053_03 TB464297.[MT7]-ITTVFSHAQTVVLC[CAM]VGC[CAM]STVLC[CAM]QPTGGK[MT7].4y5_1.heavy 827.932 / 603.358 43081.0 42.51532459259033 41 18 10 3 10 14.257894157468469 7.013658461450895 0.07030105590820312 3 0.9890372603455544 11.776202495718538 43081.0 38.61872951393753 0.0 - - - - - - - 1141.0 86 7 RPS27L;RPS27 ribosomal protein S27-like;ribosomal protein S27 841 107 B20140214_SF053_03 B20140214_SF053_03 TB464297.[MT7]-ITTVFSHAQTVVLC[CAM]VGC[CAM]STVLC[CAM]QPTGGK[MT7].4b11_2.heavy 827.932 / 665.368 13070.0 42.51532459259033 41 18 10 3 10 14.257894157468469 7.013658461450895 0.07030105590820312 3 0.9890372603455544 11.776202495718538 13070.0 13.499974393608644 0.0 - - - - - - - 740.6363636363636 26 11 RPS27L;RPS27 ribosomal protein S27-like;ribosomal protein S27 843 107 B20140214_SF053_03 B20140214_SF053_03 TB464297.[MT7]-ITTVFSHAQTVVLC[CAM]VGC[CAM]STVLC[CAM]QPTGGK[MT7].4y7_1.heavy 827.932 / 891.448 8794.0 42.51532459259033 41 18 10 3 10 14.257894157468469 7.013658461450895 0.07030105590820312 3 0.9890372603455544 11.776202495718538 8794.0 16.864358754727483 0.0 - - - - - - - 703.0 17 7 RPS27L;RPS27 ribosomal protein S27-like;ribosomal protein S27 845 107 B20140214_SF053_03 B20140214_SF053_03 TB464297.[MT7]-ITTVFSHAQTVVLC[CAM]VGC[CAM]STVLC[CAM]QPTGGK[MT7].4b10_2.heavy 827.932 / 615.834 7019.0 42.51532459259033 41 18 10 3 10 14.257894157468469 7.013658461450895 0.07030105590820312 3 0.9890372603455544 11.776202495718538 7019.0 11.03758066682931 0.0 - - - - - - - 762.8181818181819 14 11 RPS27L;RPS27 ribosomal protein S27-like;ribosomal protein S27 847 108 B20140214_SF053_03 B20140214_SF053_03 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 130866.0 24.07196617126465 24 -3 10 7 10 null 0.0 0.0260009765625 3 0.0 0.0 130866.0 306.1484365167969 0.0 - - - - - - - 1272.8181818181818 261 11 849 108 B20140214_SF053_03 B20140214_SF053_03 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 239275.0 24.07196617126465 24 -3 10 7 10 null 0.0 0.0260009765625 3 0.0 0.0 239275.0 1069.5702764976959 0.0 - - - - - - - 625.0 478 10 851 108 B20140214_SF053_03 B20140214_SF053_03 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 798430.0 24.07196617126465 24 -3 10 7 10 null 0.0 0.0260009765625 3 0.0 0.0 798430.0 1882.6843629116186 0.0 - - - - - - - 1179.2857142857142 1596 7 853 109 B20140214_SF053_03 B20140214_SF053_03 TB107852.[MT7]-HLNQGTDEDIYLLGK[MT7].3b9_2.heavy 668.693 / 577.763 112058.0 33.777099609375 37 7 10 10 10 0.9897967933412072 59.568170299352644 0.0 3 0.7401840715362319 2.366701345205725 112058.0 161.87488125885858 0.0 - - - - - - - 712.625 224 8 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 855 109 B20140214_SF053_03 B20140214_SF053_03 TB107852.[MT7]-HLNQGTDEDIYLLGK[MT7].3b9_1.heavy 668.693 / 1154.52 30337.0 33.777099609375 37 7 10 10 10 0.9897967933412072 59.568170299352644 0.0 3 0.7401840715362319 2.366701345205725 30337.0 181.87822274881515 0.0 - - - - - - - 197.9375 60 16 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 857 109 B20140214_SF053_03 B20140214_SF053_03 TB107852.[MT7]-HLNQGTDEDIYLLGK[MT7].3y4_1.heavy 668.693 / 574.404 53073.0 33.777099609375 37 7 10 10 10 0.9897967933412072 59.568170299352644 0.0 3 0.7401840715362319 2.366701345205725 53073.0 78.06627460020401 0.0 - - - - - - - 821.2222222222222 106 9 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 859 109 B20140214_SF053_03 B20140214_SF053_03 TB107852.[MT7]-HLNQGTDEDIYLLGK[MT7].3y5_1.heavy 668.693 / 737.468 39277.0 33.777099609375 37 7 10 10 10 0.9897967933412072 59.568170299352644 0.0 3 0.7401840715362319 2.366701345205725 39277.0 87.46523870038548 0.0 - - - - - - - 677.25 78 8 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 861 110 B20140214_SF053_03 B20140214_SF053_03 TB464016.[MT7]-EVAAQVK[MT7].2y4_1.heavy 516.818 / 589.379 23248.0 21.00937557220459 43 17 10 6 10 9.244380499322814 10.817382517663068 0.034099578857421875 3 0.9791918549138283 8.540626404189126 23248.0 59.22494296577946 0.0 - - - - - - - 661.0 46 10 PARK7 Parkinson disease (autosomal recessive, early onset) 7 863 110 B20140214_SF053_03 B20140214_SF053_03 TB464016.[MT7]-EVAAQVK[MT7].2y5_1.heavy 516.818 / 660.416 28544.0 21.00937557220459 43 17 10 6 10 9.244380499322814 10.817382517663068 0.034099578857421875 3 0.9791918549138283 8.540626404189126 28544.0 77.19280941345875 0.0 - - - - - - - 335.77777777777777 57 18 PARK7 Parkinson disease (autosomal recessive, early onset) 7 865 110 B20140214_SF053_03 B20140214_SF053_03 TB464016.[MT7]-EVAAQVK[MT7].2b4_1.heavy 516.818 / 515.295 13333.0 21.00937557220459 43 17 10 6 10 9.244380499322814 10.817382517663068 0.034099578857421875 3 0.9791918549138283 8.540626404189126 13333.0 40.59580276953402 1.0 - - - - - - - 665.1428571428571 26 7 PARK7 Parkinson disease (autosomal recessive, early onset) 7 867 110 B20140214_SF053_03 B20140214_SF053_03 TB464016.[MT7]-EVAAQVK[MT7].2y6_1.heavy 516.818 / 759.484 26140.0 21.00937557220459 43 17 10 6 10 9.244380499322814 10.817382517663068 0.034099578857421875 3 0.9791918549138283 8.540626404189126 26140.0 58.979756918781305 0.0 - - - - - - - 756.4285714285714 52 7 PARK7 Parkinson disease (autosomal recessive, early onset) 7 869 111 B20140214_SF053_03 B20140214_SF053_03 TB246408.[MT7]-MREENMER.3y3_1.heavy 413.529 / 435.202 10787.0 19.476799964904785 32 10 8 6 8 2.10801448836818 47.43800412748125 0.03240013122558594 4 0.8417708894183352 3.060686964730879 10787.0 18.774770223051185 0.0 - - - - - - - 770.5454545454545 21 11 BEX1;BEX2 brain expressed, X-linked 1;brain expressed X-linked 2 871 111 B20140214_SF053_03 B20140214_SF053_03 TB246408.[MT7]-MREENMER.3b5_1.heavy 413.529 / 804.379 2348.0 19.476799964904785 32 10 8 6 8 2.10801448836818 47.43800412748125 0.03240013122558594 4 0.8417708894183352 3.060686964730879 2348.0 20.01573770491803 0.0 - - - - - - - 154.5 4 14 BEX1;BEX2 brain expressed, X-linked 1;brain expressed X-linked 2 873 111 B20140214_SF053_03 B20140214_SF053_03 TB246408.[MT7]-MREENMER.3y4_1.heavy 413.529 / 549.245 9723.0 19.476799964904785 32 10 8 6 8 2.10801448836818 47.43800412748125 0.03240013122558594 4 0.8417708894183352 3.060686964730879 9723.0 23.087814796541963 1.0 - - - - - - - 748.1538461538462 30 13 BEX1;BEX2 brain expressed, X-linked 1;brain expressed X-linked 2 875 111 B20140214_SF053_03 B20140214_SF053_03 TB246408.[MT7]-MREENMER.3y5_1.heavy 413.529 / 678.288 3412.0 19.476799964904785 32 10 8 6 8 2.10801448836818 47.43800412748125 0.03240013122558594 4 0.8417708894183352 3.060686964730879 3412.0 19.984064414223525 0.0 - - - - - - - 240.91304347826087 6 23 BEX1;BEX2 brain expressed, X-linked 1;brain expressed X-linked 2 877 112 B20140214_SF053_03 B20140214_SF053_03 TB464294.[MT7]-GTEFAESADAALQGDPALQDAGDSSRK[MT7].4b4_1.heavy 749.618 / 579.289 42588.0 34.316200256347656 46 16 10 10 10 1.8810489463592723 37.95568735912987 0.0 3 0.9670002646828391 6.774941497282704 42588.0 55.529700448772445 0.0 - - - - - - - 1745.857142857143 85 7 GYPC glycophorin C (Gerbich blood group) 879 112 B20140214_SF053_03 B20140214_SF053_03 TB464294.[MT7]-GTEFAESADAALQGDPALQDAGDSSRK[MT7].4b5_1.heavy 749.618 / 650.327 54295.0 34.316200256347656 46 16 10 10 10 1.8810489463592723 37.95568735912987 0.0 3 0.9670002646828391 6.774941497282704 54295.0 24.894419597420914 0.0 - - - - - - - 1463.0 108 1 GYPC glycophorin C (Gerbich blood group) 881 112 B20140214_SF053_03 B20140214_SF053_03 TB464294.[MT7]-GTEFAESADAALQGDPALQDAGDSSRK[MT7].4b9_1.heavy 749.618 / 1052.47 33441.0 34.316200256347656 46 16 10 10 10 1.8810489463592723 37.95568735912987 0.0 3 0.9670002646828391 6.774941497282704 33441.0 67.37708229491085 0.0 - - - - - - - 777.5 66 8 GYPC glycophorin C (Gerbich blood group) 883 112 B20140214_SF053_03 B20140214_SF053_03 TB464294.[MT7]-GTEFAESADAALQGDPALQDAGDSSRK[MT7].4b6_1.heavy 749.618 / 779.369 67467.0 34.316200256347656 46 16 10 10 10 1.8810489463592723 37.95568735912987 0.0 3 0.9670002646828391 6.774941497282704 67467.0 34.504331588276514 0.0 - - - - - - - 878.0 134 3 GYPC glycophorin C (Gerbich blood group) 885 113 B20140214_SF053_03 B20140214_SF053_03 TB107851.[MT7]-QVASMTK[MT7]PTTIIEK[MT7].3y7_1.heavy 660.391 / 945.574 9459.0 29.50469970703125 47 17 10 10 10 2.8487645092976517 35.10293661467107 0.0 3 0.9773778447995126 8.189798959703685 9459.0 24.190693919058607 0.0 - - - - - - - 285.15 18 20 FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) 887 113 B20140214_SF053_03 B20140214_SF053_03 TB107851.[MT7]-QVASMTK[MT7]PTTIIEK[MT7].3b6_1.heavy 660.391 / 762.394 1771.0 29.50469970703125 47 17 10 10 10 2.8487645092976517 35.10293661467107 0.0 3 0.9773778447995126 8.189798959703685 1771.0 4.094797687861272 4.0 - - - - - - - 291.7083333333333 7 24 FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) 889 113 B20140214_SF053_03 B20140214_SF053_03 TB107851.[MT7]-QVASMTK[MT7]PTTIIEK[MT7].3y3_1.heavy 660.391 / 533.341 5485.0 29.50469970703125 47 17 10 10 10 2.8487645092976517 35.10293661467107 0.0 3 0.9773778447995126 8.189798959703685 5485.0 10.58053810459988 0.0 - - - - - - - 707.8333333333334 10 18 FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) 891 113 B20140214_SF053_03 B20140214_SF053_03 TB107851.[MT7]-QVASMTK[MT7]PTTIIEK[MT7].3y4_1.heavy 660.391 / 646.426 4621.0 29.50469970703125 47 17 10 10 10 2.8487645092976517 35.10293661467107 0.0 3 0.9773778447995126 8.189798959703685 4621.0 5.030831230428573 1.0 - - - - - - - 1265.8461538461538 9 13 FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) 893 114 B20140214_SF053_03 B20140214_SF053_03 TB464293.[MT7]-ARGLWPFASAAGGGGSEAAGAEQALVRPR.4b4_1.heavy 739.392 / 542.353 9991.0 37.68370056152344 38 8 10 10 10 0.6014340838347902 86.93308077709898 0.0 3 0.7592126045813009 2.4627406994453573 9991.0 10.674917825775566 0.0 - - - - - - - 1256.2857142857142 19 7 TUSC2 tumor suppressor candidate 2 895 114 B20140214_SF053_03 B20140214_SF053_03 TB464293.[MT7]-ARGLWPFASAAGGGGSEAAGAEQALVRPR.4b5_1.heavy 739.392 / 728.432 63103.0 37.68370056152344 38 8 10 10 10 0.6014340838347902 86.93308077709898 0.0 3 0.7592126045813009 2.4627406994453573 63103.0 67.14025166707889 0.0 - - - - - - - 725.75 126 4 TUSC2 tumor suppressor candidate 2 897 114 B20140214_SF053_03 B20140214_SF053_03 TB464293.[MT7]-ARGLWPFASAAGGGGSEAAGAEQALVRPR.4y19_2.heavy 739.392 / 877.451 85646.0 37.68370056152344 38 8 10 10 10 0.6014340838347902 86.93308077709898 0.0 3 0.7592126045813009 2.4627406994453573 85646.0 130.3744730679157 0.0 - - - - - - - 719.7142857142857 171 7 TUSC2 tumor suppressor candidate 2 899 114 B20140214_SF053_03 B20140214_SF053_03 TB464293.[MT7]-ARGLWPFASAAGGGGSEAAGAEQALVRPR.4y18_2.heavy 739.392 / 841.932 141491.0 37.68370056152344 38 8 10 10 10 0.6014340838347902 86.93308077709898 0.0 3 0.7592126045813009 2.4627406994453573 141491.0 128.62978527964256 0.0 - - - - - - - 299.0 282 2 TUSC2 tumor suppressor candidate 2 901 115 B20140214_SF053_03 B20140214_SF053_03 TB107868.[MT7]-IAPASNVSHTVVLRPLK[MT7].4y8_1.heavy 523.323 / 1069.72 2860.0 30.436500549316406 37 7 10 10 10 0.43676075066256986 117.83752806618529 0.0 3 0.7035867378020441 2.208260204290559 2860.0 66.83695652173913 0.0 - - - - - - - 110.5 5 10 SSR2 signal sequence receptor, beta (translocon-associated protein beta) 903 115 B20140214_SF053_03 B20140214_SF053_03 TB107868.[MT7]-IAPASNVSHTVVLRPLK[MT7].4y7_1.heavy 523.323 / 968.674 28049.0 30.436500549316406 37 7 10 10 10 0.43676075066256986 117.83752806618529 0.0 3 0.7035867378020441 2.208260204290559 28049.0 98.33124052998858 0.0 - - - - - - - 235.77777777777777 56 18 SSR2 signal sequence receptor, beta (translocon-associated protein beta) 905 115 B20140214_SF053_03 B20140214_SF053_03 TB107868.[MT7]-IAPASNVSHTVVLRPLK[MT7].4y3_1.heavy 523.323 / 501.352 N/A 30.436500549316406 37 7 10 10 10 0.43676075066256986 117.83752806618529 0.0 3 0.7035867378020441 2.208260204290559 55084.0 14.705635473516569 4.0 - - - - - - - 3091.0 113 1 SSR2 signal sequence receptor, beta (translocon-associated protein beta) 907 115 B20140214_SF053_03 B20140214_SF053_03 TB107868.[MT7]-IAPASNVSHTVVLRPLK[MT7].4b6_1.heavy 523.323 / 698.395 154271.0 30.436500549316406 37 7 10 10 10 0.43676075066256986 117.83752806618529 0.0 3 0.7035867378020441 2.208260204290559 154271.0 98.53846554506009 0.0 - - - - - - - 853.5 308 2 SSR2 signal sequence receptor, beta (translocon-associated protein beta) 909 116 B20140214_SF053_03 B20140214_SF053_03 TB107869.[MT7]-FFLHHLIAEIHTAEIR.4y5_1.heavy 523.546 / 589.33 100565.0 40.33300018310547 44 14 10 10 10 2.0432473817963035 40.79998804062695 0.0 3 0.9495023453979768 5.468674014683759 100565.0 121.38101671744116 0.0 - - - - - - - 318.0 201 1 PTHLH parathyroid hormone-like hormone 911 116 B20140214_SF053_03 B20140214_SF053_03 TB107869.[MT7]-FFLHHLIAEIHTAEIR.4b4_1.heavy 523.546 / 689.389 36302.0 40.33300018310547 44 14 10 10 10 2.0432473817963035 40.79998804062695 0.0 3 0.9495023453979768 5.468674014683759 36302.0 88.6811356758422 0.0 - - - - - - - 684.875 72 8 PTHLH parathyroid hormone-like hormone 913 116 B20140214_SF053_03 B20140214_SF053_03 TB107869.[MT7]-FFLHHLIAEIHTAEIR.4y6_1.heavy 523.546 / 726.389 25578.0 40.33300018310547 44 14 10 10 10 2.0432473817963035 40.79998804062695 0.0 3 0.9495023453979768 5.468674014683759 25578.0 113.092907827698 0.0 - - - - - - - 734.5 51 8 PTHLH parathyroid hormone-like hormone 915 116 B20140214_SF053_03 B20140214_SF053_03 TB107869.[MT7]-FFLHHLIAEIHTAEIR.4b3_1.heavy 523.546 / 552.33 66010.0 40.33300018310547 44 14 10 10 10 2.0432473817963035 40.79998804062695 0.0 3 0.9495023453979768 5.468674014683759 66010.0 150.74581836261137 0.0 - - - - - - - 278.0 132 4 PTHLH parathyroid hormone-like hormone 917 117 B20140214_SF053_03 B20140214_SF053_03 TB464021.[MT7]-FAEHVFR.2y4_1.heavy 525.286 / 558.315 11819.0 29.03052568435669 40 18 8 6 8 4.80892603895485 20.79466375443228 0.03429985046386719 4 0.9865560723489204 10.631915855499752 11819.0 11.914581210041252 0.0 - - - - - - - 1233.4 23 10 HPCA;HPCAL1;NCALD hippocalcin;hippocalcin-like 1;neurocalcin delta 919 117 B20140214_SF053_03 B20140214_SF053_03 TB464021.[MT7]-FAEHVFR.2y5_1.heavy 525.286 / 687.357 4737.0 29.03052568435669 40 18 8 6 8 4.80892603895485 20.79466375443228 0.03429985046386719 4 0.9865560723489204 10.631915855499752 4737.0 4.923471636695693 0.0 - - - - - - - 1177.5555555555557 9 9 HPCA;HPCAL1;NCALD hippocalcin;hippocalcin-like 1;neurocalcin delta 921 117 B20140214_SF053_03 B20140214_SF053_03 TB464021.[MT7]-FAEHVFR.2b4_1.heavy 525.286 / 629.316 8630.0 29.03052568435669 40 18 8 6 8 4.80892603895485 20.79466375443228 0.03429985046386719 4 0.9865560723489204 10.631915855499752 8630.0 7.010910653786976 2.0 - - - - - - - 1246.75 54 12 HPCA;HPCAL1;NCALD hippocalcin;hippocalcin-like 1;neurocalcin delta 923 117 B20140214_SF053_03 B20140214_SF053_03 TB464021.[MT7]-FAEHVFR.2y6_1.heavy 525.286 / 758.394 20401.0 29.03052568435669 40 18 8 6 8 4.80892603895485 20.79466375443228 0.03429985046386719 4 0.9865560723489204 10.631915855499752 20401.0 49.02903092510867 0.0 - - - - - - - 756.1875 40 16 HPCA;HPCAL1;NCALD hippocalcin;hippocalcin-like 1;neurocalcin delta 925 118 B20140214_SF053_03 B20140214_SF053_03 TB107922.[MT7]-AFQHWELIQEDILDTGNDK[MT7].3y6_1.heavy 854.102 / 793.381 N/A N/A - - - - - - - - - 0.0 - - - - - - - NTS neurotensin 927 118 B20140214_SF053_03 B20140214_SF053_03 TB107922.[MT7]-AFQHWELIQEDILDTGNDK[MT7].3b6_1.heavy 854.102 / 943.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - NTS neurotensin 929 118 B20140214_SF053_03 B20140214_SF053_03 TB107922.[MT7]-AFQHWELIQEDILDTGNDK[MT7].3b4_1.heavy 854.102 / 628.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - NTS neurotensin 931 118 B20140214_SF053_03 B20140214_SF053_03 TB107922.[MT7]-AFQHWELIQEDILDTGNDK[MT7].3y5_1.heavy 854.102 / 678.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - NTS neurotensin 933 119 B20140214_SF053_03 B20140214_SF053_03 TB463937.[MT7]-DISLTR.2b3_1.heavy 424.752 / 460.252 29743.0 26.300374507904053 44 18 10 6 10 5.577105958608713 17.93044649719124 0.03289985656738281 3 0.9866961830514718 10.687880258979787 29743.0 22.72274788527791 0.0 - - - - - - - 1237.7272727272727 59 11 LGALS14 lectin, galactoside-binding, soluble, 14 935 119 B20140214_SF053_03 B20140214_SF053_03 TB463937.[MT7]-DISLTR.2y4_1.heavy 424.752 / 476.283 48707.0 26.300374507904053 44 18 10 6 10 5.577105958608713 17.93044649719124 0.03289985656738281 3 0.9866961830514718 10.687880258979787 48707.0 46.701519094085356 0.0 - - - - - - - 1302.4285714285713 97 7 LGALS14 lectin, galactoside-binding, soluble, 14 937 119 B20140214_SF053_03 B20140214_SF053_03 TB463937.[MT7]-DISLTR.2y5_1.heavy 424.752 / 589.367 84082.0 26.300374507904053 44 18 10 6 10 5.577105958608713 17.93044649719124 0.03289985656738281 3 0.9866961830514718 10.687880258979787 84082.0 145.8950274683898 0.0 - - - - - - - 729.2222222222222 168 9 LGALS14 lectin, galactoside-binding, soluble, 14 939 119 B20140214_SF053_03 B20140214_SF053_03 TB463937.[MT7]-DISLTR.2b4_1.heavy 424.752 / 573.336 23664.0 26.300374507904053 44 18 10 6 10 5.577105958608713 17.93044649719124 0.03289985656738281 3 0.9866961830514718 10.687880258979787 23664.0 50.472125479872766 0.0 - - - - - - - 1190.375 47 8 LGALS14 lectin, galactoside-binding, soluble, 14 941 120 B20140214_SF053_03 B20140214_SF053_03 TB107926.[MT7]-RMPGQC[CAM]SVLLFPGQGSQVVGMGR.3y11_1.heavy 869.114 / 1075.53 3749.0 37.67407512664795 46 20 10 6 10 4.090124976819395 18.154848709785018 0.038501739501953125 3 0.9964392918843815 20.675938515324244 3749.0 21.85747913669065 0.0 - - - - - - - 184.26315789473685 7 19 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 943 120 B20140214_SF053_03 B20140214_SF053_03 TB107926.[MT7]-RMPGQC[CAM]SVLLFPGQGSQVVGMGR.3y12_1.heavy 869.114 / 1172.58 19913.0 37.67407512664795 46 20 10 6 10 4.090124976819395 18.154848709785018 0.038501739501953125 3 0.9964392918843815 20.675938515324244 19913.0 42.48106666666666 0.0 - - - - - - - 227.73333333333332 39 15 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 945 120 B20140214_SF053_03 B20140214_SF053_03 TB107926.[MT7]-RMPGQC[CAM]SVLLFPGQGSQVVGMGR.3b8_1.heavy 869.114 / 1060.51 3499.0 37.67407512664795 46 20 10 6 10 4.090124976819395 18.154848709785018 0.038501739501953125 3 0.9964392918843815 20.675938515324244 3499.0 23.684249101796404 0.0 - - - - - - - 179.78947368421052 6 19 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 947 120 B20140214_SF053_03 B20140214_SF053_03 TB107926.[MT7]-RMPGQC[CAM]SVLLFPGQGSQVVGMGR.3y9_1.heavy 869.114 / 890.451 5249.0 37.67407512664795 46 20 10 6 10 4.090124976819395 18.154848709785018 0.038501739501953125 3 0.9964392918843815 20.675938515324244 5249.0 15.635867700797972 0.0 - - - - - - - 651.4545454545455 10 11 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 949 121 B20140214_SF053_03 B20140214_SF053_03 TB107925.[MT7]-HFYWTSDSC[CAM]PRPGVVLLTFR.4y15_2.heavy 646.333 / 852.448 5762.0 40.16193389892578 33 7 10 6 10 0.409526097063267 112.70244329193626 0.036701202392578125 3 0.7110174344805072 2.238025517150055 5762.0 14.248267138375276 0.0 - - - - - - - 338.0833333333333 11 12 CCL22 chemokine (C-C motif) ligand 22 951 121 B20140214_SF053_03 B20140214_SF053_03 TB107925.[MT7]-HFYWTSDSC[CAM]PRPGVVLLTFR.4y9_1.heavy 646.333 / 1001.61 1461.0 40.16193389892578 33 7 10 6 10 0.409526097063267 112.70244329193626 0.036701202392578125 3 0.7110174344805072 2.238025517150055 1461.0 4.180707692307692 0.0 - - - - - - - 156.0 2 13 CCL22 chemokine (C-C motif) ligand 22 953 121 B20140214_SF053_03 B20140214_SF053_03 TB107925.[MT7]-HFYWTSDSC[CAM]PRPGVVLLTFR.4y13_2.heavy 646.333 / 751.419 7629.0 40.16193389892578 33 7 10 6 10 0.409526097063267 112.70244329193626 0.036701202392578125 3 0.7110174344805072 2.238025517150055 7629.0 21.098543460632506 0.0 - - - - - - - 279.55555555555554 15 18 CCL22 chemokine (C-C motif) ligand 22 955 121 B20140214_SF053_03 B20140214_SF053_03 TB107925.[MT7]-HFYWTSDSC[CAM]PRPGVVLLTFR.4b3_1.heavy 646.333 / 592.3 N/A 40.16193389892578 33 7 10 6 10 0.409526097063267 112.70244329193626 0.036701202392578125 3 0.7110174344805072 2.238025517150055 6330.0 7.281840591618733 0.0 - - - - - - - 885.6363636363636 12 11 CCL22 chemokine (C-C motif) ligand 22 957 122 B20140214_SF053_03 B20140214_SF053_03 TB107923.[MT7]-RVLGYDLLELSLHGPQETLDR.4y8_1.heavy 642.853 / 915.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 959 122 B20140214_SF053_03 B20140214_SF053_03 TB107923.[MT7]-RVLGYDLLELSLHGPQETLDR.4b7_1.heavy 642.853 / 961.559 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 961 122 B20140214_SF053_03 B20140214_SF053_03 TB107923.[MT7]-RVLGYDLLELSLHGPQETLDR.4y7_1.heavy 642.853 / 858.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 963 122 B20140214_SF053_03 B20140214_SF053_03 TB107923.[MT7]-RVLGYDLLELSLHGPQETLDR.4b6_1.heavy 642.853 / 848.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 965 123 B20140214_SF053_03 B20140214_SF053_03 TB107867.[MT7]-EAFDLFDVDGSGTIDAK[MT7].2y8_1.heavy 1044.52 / 892.486 5685.0 43.37419891357422 44 14 10 10 10 2.5231357970520434 39.633221532046356 0.0 3 0.9369858784874401 4.890306237334842 5685.0 17.548553054662378 0.0 - - - - - - - 220.83333333333334 11 6 CETN1 centrin, EF-hand protein, 1 967 123 B20140214_SF053_03 B20140214_SF053_03 TB107867.[MT7]-EAFDLFDVDGSGTIDAK[MT7].2b4_1.heavy 1044.52 / 607.284 13472.0 43.37419891357422 44 14 10 10 10 2.5231357970520434 39.633221532046356 0.0 3 0.9369858784874401 4.890306237334842 13472.0 7.314045534150612 0.0 - - - - - - - 350.25 26 4 CETN1 centrin, EF-hand protein, 1 969 123 B20140214_SF053_03 B20140214_SF053_03 TB107867.[MT7]-EAFDLFDVDGSGTIDAK[MT7].2b5_1.heavy 1044.52 / 720.369 8332.0 43.37419891357422 44 14 10 10 10 2.5231357970520434 39.633221532046356 0.0 3 0.9369858784874401 4.890306237334842 8332.0 8.750058343057177 0.0 - - - - - - - 266.7142857142857 16 7 CETN1 centrin, EF-hand protein, 1 971 123 B20140214_SF053_03 B20140214_SF053_03 TB107867.[MT7]-EAFDLFDVDGSGTIDAK[MT7].2y11_1.heavy 1044.52 / 1221.61 2881.0 43.37419891357422 44 14 10 10 10 2.5231357970520434 39.633221532046356 0.0 3 0.9369858784874401 4.890306237334842 2881.0 4.318415417558886 0.0 - - - - - - - 243.25 5 8 CETN1 centrin, EF-hand protein, 1 973 124 B20140214_SF053_03 B20140214_SF053_03 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 696400.0 33.059600830078125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 696400.0 1404.132511255841 0.0 - - - - - - - 738.3846153846154 1392 13 975 124 B20140214_SF053_03 B20140214_SF053_03 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 669256.0 33.059600830078125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 669256.0 878.3379185097156 0.0 - - - - - - - 798.9230769230769 1338 13 977 124 B20140214_SF053_03 B20140214_SF053_03 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1153420.0 33.059600830078125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1153420.0 1022.095367133901 0.0 - - - - - - - 2254.222222222222 2306 9 979 125 B20140214_SF053_03 B20140214_SF053_03 TB107865.[MT7]-NDLRDTFAALGRVNVK[MT7].4y4_1.heavy 520.049 / 603.395 11238.0 36.90829849243164 43 13 10 10 10 1.6340826954890875 49.550648324979306 0.0 3 0.908698784214061 4.052873459638162 11238.0 15.481726786916816 0.0 - - - - - - - 1816.375 22 8 MYL2 myosin, light chain 2, regulatory, cardiac, slow 981 125 B20140214_SF053_03 B20140214_SF053_03 TB107865.[MT7]-NDLRDTFAALGRVNVK[MT7].4b8_2.heavy 520.049 / 539.276 N/A 36.90829849243164 43 13 10 10 10 1.6340826954890875 49.550648324979306 0.0 3 0.908698784214061 4.052873459638162 25771.0 4.2332567511254435 0.0 - - - - - - - 591.0 51 1 MYL2 myosin, light chain 2, regulatory, cardiac, slow 983 125 B20140214_SF053_03 B20140214_SF053_03 TB107865.[MT7]-NDLRDTFAALGRVNVK[MT7].4y9_2.heavy 520.049 / 536.341 35826.0 36.90829849243164 43 13 10 10 10 1.6340826954890875 49.550648324979306 0.0 3 0.908698784214061 4.052873459638162 35826.0 53.70366863905325 0.0 - - - - - - - 657.1111111111111 71 9 MYL2 myosin, light chain 2, regulatory, cardiac, slow 985 125 B20140214_SF053_03 B20140214_SF053_03 TB107865.[MT7]-NDLRDTFAALGRVNVK[MT7].4y3_1.heavy 520.049 / 504.326 19941.0 36.90829849243164 43 13 10 10 10 1.6340826954890875 49.550648324979306 0.0 3 0.908698784214061 4.052873459638162 19941.0 13.320183287631693 0.0 - - - - - - - 887.0 39 2 MYL2 myosin, light chain 2, regulatory, cardiac, slow 987 126 B20140214_SF053_03 B20140214_SF053_03 TB107863.[MT7]-NAVPDIQGDSEAVSVRK[MT7].2y8_1.heavy 1037.06 / 1019.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 989 126 B20140214_SF053_03 B20140214_SF053_03 TB107863.[MT7]-NAVPDIQGDSEAVSVRK[MT7].2y6_1.heavy 1037.06 / 803.522 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 991 126 B20140214_SF053_03 B20140214_SF053_03 TB107863.[MT7]-NAVPDIQGDSEAVSVRK[MT7].2y10_1.heavy 1037.06 / 1191.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 993 126 B20140214_SF053_03 B20140214_SF053_03 TB107863.[MT7]-NAVPDIQGDSEAVSVRK[MT7].2b5_1.heavy 1037.06 / 641.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 995 127 B20140214_SF053_03 B20140214_SF053_03 TB464027.[MT7]-FNLMEK[MT7].2y4_1.heavy 535.301 / 664.382 15482.0 33.52533213297526 46 20 10 6 10 7.6547296155784155 13.063818713659906 0.03350067138671875 3 0.9965009554078517 20.857435786197914 15482.0 17.827757575757573 0.0 - - - - - - - 1204.2222222222222 30 9 SF3B5 splicing factor 3b, subunit 5, 10kDa 997 127 B20140214_SF053_03 B20140214_SF053_03 TB464027.[MT7]-FNLMEK[MT7].2b3_1.heavy 535.301 / 519.305 N/A 33.52533213297526 46 20 10 6 10 7.6547296155784155 13.063818713659906 0.03350067138671875 3 0.9965009554078517 20.857435786197914 23030.0 8.521185868074767 0.0 - - - - - - - 1677.0 46 1 SF3B5 splicing factor 3b, subunit 5, 10kDa 999 127 B20140214_SF053_03 B20140214_SF053_03 TB464027.[MT7]-FNLMEK[MT7].2y5_1.heavy 535.301 / 778.425 32319.0 33.52533213297526 46 20 10 6 10 7.6547296155784155 13.063818713659906 0.03350067138671875 3 0.9965009554078517 20.857435786197914 32319.0 95.02430232558139 0.0 - - - - - - - 717.0 64 9 SF3B5 splicing factor 3b, subunit 5, 10kDa 1001 127 B20140214_SF053_03 B20140214_SF053_03 TB464027.[MT7]-FNLMEK[MT7].2y3_1.heavy 535.301 / 551.298 31738.0 33.52533213297526 46 20 10 6 10 7.6547296155784155 13.063818713659906 0.03350067138671875 3 0.9965009554078517 20.857435786197914 31738.0 36.79694759340376 0.0 - - - - - - - 1161.25 63 12 SF3B5 splicing factor 3b, subunit 5, 10kDa 1003 128 B20140214_SF053_03 B20140214_SF053_03 TB107862.[MT7]-LFENYQTQSEEVRK[MT7].3y6_1.heavy 687.028 / 891.502 8864.0 30.372100830078125 46 16 10 10 10 2.219160289148944 35.577998957068274 0.0 3 0.9681013616003086 6.891520232042228 8864.0 22.202697495183045 0.0 - - - - - - - 249.1904761904762 17 21 CCDC68 coiled-coil domain containing 68 1005 128 B20140214_SF053_03 B20140214_SF053_03 TB107862.[MT7]-LFENYQTQSEEVRK[MT7].3b4_1.heavy 687.028 / 648.347 17339.0 30.372100830078125 46 16 10 10 10 2.219160289148944 35.577998957068274 0.0 3 0.9681013616003086 6.891520232042228 17339.0 37.76518167319124 0.0 - - - - - - - 699.6363636363636 34 11 CCDC68 coiled-coil domain containing 68 1007 128 B20140214_SF053_03 B20140214_SF053_03 TB107862.[MT7]-LFENYQTQSEEVRK[MT7].3b3_1.heavy 687.028 / 534.304 10896.0 30.372100830078125 46 16 10 10 10 2.219160289148944 35.577998957068274 0.0 3 0.9681013616003086 6.891520232042228 10896.0 25.938572608234047 0.0 - - - - - - - 660.3636363636364 21 11 CCDC68 coiled-coil domain containing 68 1009 128 B20140214_SF053_03 B20140214_SF053_03 TB107862.[MT7]-LFENYQTQSEEVRK[MT7].3y8_1.heavy 687.028 / 1120.61 8821.0 30.372100830078125 46 16 10 10 10 2.219160289148944 35.577998957068274 0.0 3 0.9681013616003086 6.891520232042228 8821.0 87.49223966207202 0.0 - - - - - - - 170.44444444444446 17 18 CCDC68 coiled-coil domain containing 68 1011 129 B20140214_SF053_03 B20140214_SF053_03 TB464028.[MT7]-ITC[CAM]SSSK[MT7].2b3_1.heavy 535.791 / 519.272 1262.0 18.950249671936035 40 16 10 6 8 3.2616776619042405 30.659068849132616 0.03230094909667969 4 0.9698858469798447 7.093835417230222 1262.0 0.6 26.0 - - - - - - - 1175.7692307692307 4 13 JTB jumping translocation breakpoint 1013 129 B20140214_SF053_03 B20140214_SF053_03 TB464028.[MT7]-ITC[CAM]SSSK[MT7].2y4_1.heavy 535.791 / 552.311 1945.0 18.950249671936035 40 16 10 6 8 3.2616776619042405 30.659068849132616 0.03230094909667969 4 0.9698858469798447 7.093835417230222 1945.0 5.322815478372434 0.0 - - - - - - - 204.65217391304347 3 23 JTB jumping translocation breakpoint 1015 129 B20140214_SF053_03 B20140214_SF053_03 TB464028.[MT7]-ITC[CAM]SSSK[MT7].2y5_1.heavy 535.791 / 712.342 2866.0 18.950249671936035 40 16 10 6 8 3.2616776619042405 30.659068849132616 0.03230094909667969 4 0.9698858469798447 7.093835417230222 2866.0 7.303569007752586 2.0 - - - - - - - 329.73333333333335 12 15 JTB jumping translocation breakpoint 1017 129 B20140214_SF053_03 B20140214_SF053_03 TB464028.[MT7]-ITC[CAM]SSSK[MT7].2y6_1.heavy 535.791 / 813.389 10269.0 18.950249671936035 40 16 10 6 8 3.2616776619042405 30.659068849132616 0.03230094909667969 4 0.9698858469798447 7.093835417230222 10269.0 66.2295118425442 0.0 - - - - - - - 125.76923076923077 20 13 JTB jumping translocation breakpoint 1019 130 B20140214_SF053_03 B20140214_SF053_03 TB107860.[MT7]-GYLSGQSLAETMEQIQR.2y4_1.heavy 1028.02 / 544.32 2382.0 40.75294876098633 46 20 10 6 10 19.375969825709966 5.161031984438273 0.0370025634765625 3 0.9984527151117925 31.370483603699913 2382.0 12.693509433962266 0.0 - - - - - - - 207.33333333333334 4 18 C3orf34 chromosome 3 open reading frame 34 1021 130 B20140214_SF053_03 B20140214_SF053_03 TB107860.[MT7]-GYLSGQSLAETMEQIQR.2y8_1.heavy 1028.02 / 1034.49 1906.0 40.75294876098633 46 20 10 6 10 19.375969825709966 5.161031984438273 0.0370025634765625 3 0.9984527151117925 31.370483603699913 1906.0 4.79496855345912 1.0 - - - - - - - 115.76923076923077 3 13 C3orf34 chromosome 3 open reading frame 34 1023 130 B20140214_SF053_03 B20140214_SF053_03 TB107860.[MT7]-GYLSGQSLAETMEQIQR.2y9_1.heavy 1028.02 / 1105.53 3256.0 40.75294876098633 46 20 10 6 10 19.375969825709966 5.161031984438273 0.0370025634765625 3 0.9984527151117925 31.370483603699913 3256.0 41.710464844165514 0.0 - - - - - - - 142.8 6 15 C3orf34 chromosome 3 open reading frame 34 1025 130 B20140214_SF053_03 B20140214_SF053_03 TB107860.[MT7]-GYLSGQSLAETMEQIQR.2y7_1.heavy 1028.02 / 905.451 2700.0 40.75294876098633 46 20 10 6 10 19.375969825709966 5.161031984438273 0.0370025634765625 3 0.9984527151117925 31.370483603699913 2700.0 8.901381415875703 0.0 - - - - - - - 226.71428571428572 5 14 C3orf34 chromosome 3 open reading frame 34 1027 131 B20140214_SF053_03 B20140214_SF053_03 TB246618.[MT7]-GEPLALPLNVSEYC[CAM]VPR.2b3_1.heavy 1029.54 / 428.226 2258.0 41.65979862213135 31 5 10 6 10 0.3778680901532638 117.86998783781695 0.035999298095703125 3 0.6957654432833652 2.178091407376882 2258.0 12.618011459386587 0.0 - - - - - - - 184.5 4 14 BEX2 brain expressed X-linked 2 1029 131 B20140214_SF053_03 B20140214_SF053_03 TB246618.[MT7]-GEPLALPLNVSEYC[CAM]VPR.2b4_1.heavy 1029.54 / 541.31 6533.0 41.65979862213135 31 5 10 6 10 0.3778680901532638 117.86998783781695 0.035999298095703125 3 0.6957654432833652 2.178091407376882 6533.0 57.55994731073207 0.0 - - - - - - - 236.6 13 15 BEX2 brain expressed X-linked 2 1031 131 B20140214_SF053_03 B20140214_SF053_03 TB246618.[MT7]-GEPLALPLNVSEYC[CAM]VPR.2b6_1.heavy 1029.54 / 725.431 22826.0 41.65979862213135 31 5 10 6 10 0.3778680901532638 117.86998783781695 0.035999298095703125 3 0.6957654432833652 2.178091407376882 22826.0 131.3550909090909 0.0 - - - - - - - 253.5 45 14 BEX2 brain expressed X-linked 2 1033 131 B20140214_SF053_03 B20140214_SF053_03 TB246618.[MT7]-GEPLALPLNVSEYC[CAM]VPR.2b5_1.heavy 1029.54 / 612.347 21213.0 41.65979862213135 31 5 10 6 10 0.3778680901532638 117.86998783781695 0.035999298095703125 3 0.6957654432833652 2.178091407376882 21213.0 60.42092879256966 1.0 - - - - - - - 310.3076923076923 42 13 BEX2 brain expressed X-linked 2 1035 132 B20140214_SF053_03 B20140214_SF053_03 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 464981.0 27.757867177327473 23 -3 10 6 10 null 0.0 0.0364990234375 3 0.0 0.0 464981.0 1068.5156558532615 0.0 - - - - - - - 1850.3333333333333 929 3 1037 132 B20140214_SF053_03 B20140214_SF053_03 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 719087.0 27.757867177327473 23 -3 10 6 10 null 0.0 0.0364990234375 3 0.0 0.0 719087.0 1558.5895448905187 0.0 - - - - - - - 2744.3333333333335 1438 3 1039 132 B20140214_SF053_03 B20140214_SF053_03 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 755296.0 27.757867177327473 23 -3 10 6 10 null 0.0 0.0364990234375 3 0.0 0.0 755296.0 2335.196814563733 0.0 - - - - - - - 2636.0 1510 1 1041 133 B20140214_SF053_03 B20140214_SF053_03 TB246369.[MT7]-C[CAM]YTERK[MT7].2y4_1.heavy 572.805 / 677.406 564.0 17.707300186157227 41 11 10 10 10 0.7345788132617393 71.82806147601414 0.0 3 0.8645909061049617 3.3152129165990036 564.0 3.0693877551020408 0.0 - - - - - - - 0.0 1 0 CLEC2B C-type lectin domain family 2, member B 1043 133 B20140214_SF053_03 B20140214_SF053_03 TB246369.[MT7]-C[CAM]YTERK[MT7].2y5_1.heavy 572.805 / 840.47 1399.0 17.707300186157227 41 11 10 10 10 0.7345788132617393 71.82806147601414 0.0 3 0.8645909061049617 3.3152129165990036 1399.0 13.437496844891804 0.0 - - - - - - - 87.65217391304348 2 23 CLEC2B C-type lectin domain family 2, member B 1045 133 B20140214_SF053_03 B20140214_SF053_03 TB246369.[MT7]-C[CAM]YTERK[MT7].2b4_1.heavy 572.805 / 698.294 810.0 17.707300186157227 41 11 10 10 10 0.7345788132617393 71.82806147601414 0.0 3 0.8645909061049617 3.3152129165990036 810.0 6.436187157789945 0.0 - - - - - - - 0.0 1 0 CLEC2B C-type lectin domain family 2, member B 1047 133 B20140214_SF053_03 B20140214_SF053_03 TB246369.[MT7]-C[CAM]YTERK[MT7].2y3_1.heavy 572.805 / 576.359 147.0 17.707300186157227 41 11 10 10 10 0.7345788132617393 71.82806147601414 0.0 3 0.8645909061049617 3.3152129165990036 147.0 1.078048780487805 12.0 - - - - - - - 0.0 0 0 CLEC2B C-type lectin domain family 2, member B 1049 134 B20140214_SF053_03 B20140214_SF053_03 TB463987.[MT7]-QNEALVR.2y4_1.heavy 487.281 / 458.309 7899.0 21.84600019454956 41 17 10 6 8 15.490272442071774 6.455664377367485 0.030000686645507812 4 0.9780936620753812 8.32302996351848 7899.0 5.563121832144512 1.0 - - - - - - - 2244.7272727272725 17 11 ANKRD22 ankyrin repeat domain 22 1051 134 B20140214_SF053_03 B20140214_SF053_03 TB463987.[MT7]-QNEALVR.2b3_1.heavy 487.281 / 516.253 7045.0 21.84600019454956 41 17 10 6 8 15.490272442071774 6.455664377367485 0.030000686645507812 4 0.9780936620753812 8.32302996351848 7045.0 14.281037658348001 1.0 - - - - - - - 1174.4285714285713 14 7 ANKRD22 ankyrin repeat domain 22 1053 134 B20140214_SF053_03 B20140214_SF053_03 TB463987.[MT7]-QNEALVR.2y6_1.heavy 487.281 / 701.394 15406.0 21.84600019454956 41 17 10 6 8 15.490272442071774 6.455664377367485 0.030000686645507812 4 0.9780936620753812 8.32302996351848 15406.0 11.029215659131962 0.0 - - - - - - - 1320.875 30 8 ANKRD22 ankyrin repeat domain 22 1055 134 B20140214_SF053_03 B20140214_SF053_03 TB463987.[MT7]-QNEALVR.2b5_1.heavy 487.281 / 700.375 11634.0 21.84600019454956 41 17 10 6 8 15.490272442071774 6.455664377367485 0.030000686645507812 4 0.9780936620753812 8.32302996351848 11634.0 16.65913226513746 1.0 - - - - - - - 676.0 23 11 ANKRD22 ankyrin repeat domain 22 1057 135 B20140214_SF053_03 B20140214_SF053_03 TB464005.[MT7]-K[MT7]DDAK[MT7].2b3_1.heavy 504.806 / 647.36 6312.0 15.191300392150879 50 20 10 10 10 5.180072239768777 19.304750082879867 0.0 3 0.9951495421501977 17.713129675381353 6312.0 48.675873015873016 0.0 - - - - - - - 105.375 12 24 MYL3;NASP;VPS18;SAFB myosin, light chain 3, alkali; ventricular, skeletal, slow;nuclear autoantigenic sperm protein (histone-binding);vacuolar protein sorting 18 homolog (S. cerevisiae);scaffold attachment factor B 1059 135 B20140214_SF053_03 B20140214_SF053_03 TB464005.[MT7]-K[MT7]DDAK[MT7].2y4_1.heavy 504.806 / 592.306 848.0 15.191300392150879 50 20 10 10 10 5.180072239768777 19.304750082879867 0.0 3 0.9951495421501977 17.713129675381353 848.0 11.62426966292135 0.0 - - - - - - - 0.0 1 0 MYL3;NASP;VPS18;SAFB myosin, light chain 3, alkali; ventricular, skeletal, slow;nuclear autoantigenic sperm protein (histone-binding);vacuolar protein sorting 18 homolog (S. cerevisiae);scaffold attachment factor B 1061 135 B20140214_SF053_03 B20140214_SF053_03 TB464005.[MT7]-K[MT7]DDAK[MT7].2b4_1.heavy 504.806 / 718.397 483.0 15.191300392150879 50 20 10 10 10 5.180072239768777 19.304750082879867 0.0 3 0.9951495421501977 17.713129675381353 483.0 3.7698206216623307 2.0 - - - - - - - 0.0 1 0 MYL3;NASP;VPS18;SAFB myosin, light chain 3, alkali; ventricular, skeletal, slow;nuclear autoantigenic sperm protein (histone-binding);vacuolar protein sorting 18 homolog (S. cerevisiae);scaffold attachment factor B 1063 135 B20140214_SF053_03 B20140214_SF053_03 TB464005.[MT7]-K[MT7]DDAK[MT7].2y3_1.heavy 504.806 / 477.279 1836.0 15.191300392150879 50 20 10 10 10 5.180072239768777 19.304750082879867 0.0 3 0.9951495421501977 17.713129675381353 1836.0 4.767727272727273 0.0 - - - - - - - 206.1153846153846 3 26 MYL3;NASP;VPS18;SAFB myosin, light chain 3, alkali; ventricular, skeletal, slow;nuclear autoantigenic sperm protein (histone-binding);vacuolar protein sorting 18 homolog (S. cerevisiae);scaffold attachment factor B 1065 136 B20140214_SF053_03 B20140214_SF053_03 TB107909.[MT7]-GLTPSQIGVILRDSHGVAQVR.4y8_1.heavy 587.589 / 853.464 2732.0 37.10459899902344 44 14 10 10 10 2.7004295490176453 32.37443166269481 0.0 3 0.9377062972347538 4.918805089184685 2732.0 35.63778492647059 0.0 - - - - - - - 210.66666666666666 5 15 RPS13 ribosomal protein S13 1067 136 B20140214_SF053_03 B20140214_SF053_03 TB107909.[MT7]-GLTPSQIGVILRDSHGVAQVR.4y6_1.heavy 587.589 / 629.373 12893.0 37.10459899902344 44 14 10 10 10 2.7004295490176453 32.37443166269481 0.0 3 0.9377062972347538 4.918805089184685 12893.0 17.002576787622175 0.0 - - - - - - - 844.1111111111111 25 9 RPS13 ribosomal protein S13 1069 136 B20140214_SF053_03 B20140214_SF053_03 TB107909.[MT7]-GLTPSQIGVILRDSHGVAQVR.4b6_1.heavy 587.589 / 728.406 13235.0 37.10459899902344 44 14 10 10 10 2.7004295490176453 32.37443166269481 0.0 3 0.9377062972347538 4.918805089184685 13235.0 12.548522030117121 0.0 - - - - - - - 1256.2857142857142 26 7 RPS13 ribosomal protein S13 1071 136 B20140214_SF053_03 B20140214_SF053_03 TB107909.[MT7]-GLTPSQIGVILRDSHGVAQVR.4y14_2.heavy 587.589 / 753.929 54048.0 37.10459899902344 44 14 10 10 10 2.7004295490176453 32.37443166269481 0.0 3 0.9377062972347538 4.918805089184685 54048.0 150.91481996487119 0.0 - - - - - - - 271.6363636363636 108 11 RPS13 ribosomal protein S13 1073 137 B20140214_SF053_03 B20140214_SF053_03 TB464109.[MT7]-AVPPFVFTRR.3b5_1.heavy 445.267 / 656.389 13132.0 34.732001304626465 40 16 10 6 8 4.574626614530242 21.859707562224457 0.035198211669921875 4 0.9652663009775396 6.602702273800999 13132.0 10.288761583824769 1.0 - - - - - - - 666.8571428571429 27 7 TUSC2 tumor suppressor candidate 2 1075 137 B20140214_SF053_03 B20140214_SF053_03 TB464109.[MT7]-AVPPFVFTRR.3y7_2.heavy 445.267 / 461.767 11787.0 34.732001304626465 40 16 10 6 8 4.574626614530242 21.859707562224457 0.035198211669921875 4 0.9652663009775396 6.602702273800999 11787.0 3.447023399496887 1.0 - - - - - - - 791.0 38 1 TUSC2 tumor suppressor candidate 2 1077 137 B20140214_SF053_03 B20140214_SF053_03 TB464109.[MT7]-AVPPFVFTRR.3y4_1.heavy 445.267 / 579.336 12657.0 34.732001304626465 40 16 10 6 8 4.574626614530242 21.859707562224457 0.035198211669921875 4 0.9652663009775396 6.602702273800999 12657.0 26.11338947368421 1.0 - - - - - - - 379.8 25 5 TUSC2 tumor suppressor candidate 2 1079 137 B20140214_SF053_03 B20140214_SF053_03 TB464109.[MT7]-AVPPFVFTRR.3y8_2.heavy 445.267 / 510.293 46989.0 34.732001304626465 40 16 10 6 8 4.574626614530242 21.859707562224457 0.035198211669921875 4 0.9652663009775396 6.602702273800999 46989.0 42.80537972792213 0.0 - - - - - - - 411.6 93 5 TUSC2 tumor suppressor candidate 2 1081 138 B20140214_SF053_03 B20140214_SF053_03 TB107905.[MT7]-C[CAM]PLEDPGWNAQITLGLVK[MT7].2y4_1.heavy 1150.12 / 560.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHLDA3 pleckstrin homology-like domain, family A, member 3 1083 138 B20140214_SF053_03 B20140214_SF053_03 TB107905.[MT7]-C[CAM]PLEDPGWNAQITLGLVK[MT7].2y6_1.heavy 1150.12 / 774.521 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHLDA3 pleckstrin homology-like domain, family A, member 3 1085 138 B20140214_SF053_03 B20140214_SF053_03 TB107905.[MT7]-C[CAM]PLEDPGWNAQITLGLVK[MT7].2y10_1.heavy 1150.12 / 1200.74 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHLDA3 pleckstrin homology-like domain, family A, member 3 1087 138 B20140214_SF053_03 B20140214_SF053_03 TB107905.[MT7]-C[CAM]PLEDPGWNAQITLGLVK[MT7].2b5_1.heavy 1150.12 / 759.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHLDA3 pleckstrin homology-like domain, family A, member 3 1089 139 B20140214_SF053_03 B20140214_SF053_03 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 602811.0 37.75859832763672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 602811.0 116.061719258985 0.0 - - - - - - - 396.55555555555554 1205 9 1091 139 B20140214_SF053_03 B20140214_SF053_03 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 1368540.0 37.75859832763672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1368540.0 264.132215683704 0.0 - - - - - - - 356.9 2737 10 1093 139 B20140214_SF053_03 B20140214_SF053_03 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 1380340.0 37.75859832763672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1380340.0 207.82668542524576 0.0 - - - - - - - 373.5 2760 2 1095 140 B20140214_SF053_03 B20140214_SF053_03 TB464300.[MT7]-LSASTSNLPC[CAM]WLVEEFVVAEEC[CAM]SPC[CAM]SNFR.3y6_1.heavy 1178.21 / 780.346 2924.0 51.949501037597656 42 12 10 10 10 1.077715854833651 61.33508007224184 0.0 3 0.8846977271876781 3.5989795868869487 2924.0 25.737291666666664 0.0 - - - - - - - 154.61111111111111 5 18 JTB jumping translocation breakpoint 1097 140 B20140214_SF053_03 B20140214_SF053_03 TB464300.[MT7]-LSASTSNLPC[CAM]WLVEEFVVAEEC[CAM]SPC[CAM]SNFR.3b7_1.heavy 1178.21 / 805.417 1917.0 51.949501037597656 42 12 10 10 10 1.077715854833651 61.33508007224184 0.0 3 0.8846977271876781 3.5989795868869487 1917.0 10.175027914733178 0.0 - - - - - - - 205.57142857142858 3 14 JTB jumping translocation breakpoint 1099 140 B20140214_SF053_03 B20140214_SF053_03 TB464300.[MT7]-LSASTSNLPC[CAM]WLVEEFVVAEEC[CAM]SPC[CAM]SNFR.3b13_2.heavy 1178.21 / 787.412 1630.0 51.949501037597656 42 12 10 10 10 1.077715854833651 61.33508007224184 0.0 3 0.8846977271876781 3.5989795868869487 1630.0 20.827777777777776 0.0 - - - - - - - 126.54545454545455 3 11 JTB jumping translocation breakpoint 1101 140 B20140214_SF053_03 B20140214_SF053_03 TB464300.[MT7]-LSASTSNLPC[CAM]WLVEEFVVAEEC[CAM]SPC[CAM]SNFR.3b3_1.heavy 1178.21 / 416.263 1246.0 51.949501037597656 42 12 10 10 10 1.077715854833651 61.33508007224184 0.0 3 0.8846977271876781 3.5989795868869487 1246.0 12.113888888888889 0.0 - - - - - - - 136.0 2 12 JTB jumping translocation breakpoint 1103 141 B20140214_SF053_03 B20140214_SF053_03 TB107906.[MT7]-TYGTSGLDNRPLFGETSAK[MT7].3y11_2.heavy 768.069 / 682.376 20677.0 32.18400001525879 37 10 10 7 10 1.6803459235837035 49.79955344720372 0.02919769287109375 3 0.845840133971248 3.1019352997787903 20677.0 11.266910993377483 0.0 - - - - - - - 668.4166666666666 41 12 C7orf23 chromosome 7 open reading frame 23 1105 141 B20140214_SF053_03 B20140214_SF053_03 TB107906.[MT7]-TYGTSGLDNRPLFGETSAK[MT7].3y4_1.heavy 768.069 / 550.332 3385.0 32.18400001525879 37 10 10 7 10 1.6803459235837035 49.79955344720372 0.02919769287109375 3 0.845840133971248 3.1019352997787903 3385.0 5.927744065471623 0.0 - - - - - - - 667.6363636363636 6 11 C7orf23 chromosome 7 open reading frame 23 1107 141 B20140214_SF053_03 B20140214_SF053_03 TB107906.[MT7]-TYGTSGLDNRPLFGETSAK[MT7].3b8_1.heavy 768.069 / 939.454 6354.0 32.18400001525879 37 10 10 7 10 1.6803459235837035 49.79955344720372 0.02919769287109375 3 0.845840133971248 3.1019352997787903 6354.0 13.158882711864408 0.0 - - - - - - - 251.34782608695653 12 23 C7orf23 chromosome 7 open reading frame 23 1109 141 B20140214_SF053_03 B20140214_SF053_03 TB107906.[MT7]-TYGTSGLDNRPLFGETSAK[MT7].3y9_1.heavy 768.069 / 1093.6 2708.0 32.18400001525879 37 10 10 7 10 1.6803459235837035 49.79955344720372 0.02919769287109375 3 0.845840133971248 3.1019352997787903 2708.0 11.540595516257145 0.0 - - - - - - - 191.6818181818182 5 22 C7orf23 chromosome 7 open reading frame 23 1111 142 B20140214_SF053_03 B20140214_SF053_03 TB246350.[MT7]-IIVPLNNR.2b3_1.heavy 541.844 / 470.346 19854.0 33.14225101470947 43 17 10 6 10 2.9930142517688236 33.41113392323528 0.037799835205078125 3 0.979071209125744 8.515887964806474 19854.0 9.077416584204128 0.0 - - - - - - - 735.3333333333334 39 3 IGJ immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides 1113 142 B20140214_SF053_03 B20140214_SF053_03 TB246350.[MT7]-IIVPLNNR.2y5_1.heavy 541.844 / 613.342 45076.0 33.14225101470947 43 17 10 6 10 2.9930142517688236 33.41113392323528 0.037799835205078125 3 0.979071209125744 8.515887964806474 45076.0 30.64459008665619 0.0 - - - - - - - 147.0 90 1 IGJ immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides 1115 142 B20140214_SF053_03 B20140214_SF053_03 TB246350.[MT7]-IIVPLNNR.2y6_1.heavy 541.844 / 712.41 14265.0 33.14225101470947 43 17 10 6 10 2.9930142517688236 33.41113392323528 0.037799835205078125 3 0.979071209125744 8.515887964806474 14265.0 18.59938776342624 0.0 - - - - - - - 1166.0 28 7 IGJ immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides 1117 142 B20140214_SF053_03 B20140214_SF053_03 TB246350.[MT7]-IIVPLNNR.2y7_1.heavy 541.844 / 825.494 22428.0 33.14225101470947 43 17 10 6 10 2.9930142517688236 33.41113392323528 0.037799835205078125 3 0.979071209125744 8.515887964806474 22428.0 35.60332460972733 0.0 - - - - - - - 346.7142857142857 44 7 IGJ immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides 1119 143 B20140214_SF053_03 B20140214_SF053_03 TB107908.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.4y5_1.heavy 577.321 / 569.341 95589.0 36.86980056762695 38 8 10 10 10 0.6051692931151609 94.97125061928978 0.0 3 0.7688724093052668 2.515896686706716 95589.0 69.21859781804297 0.0 - - - - - - - 767.0 191 1 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 1121 143 B20140214_SF053_03 B20140214_SF053_03 TB107908.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.4y8_1.heavy 577.321 / 1052.63 19424.0 36.86980056762695 38 8 10 10 10 0.6051692931151609 94.97125061928978 0.0 3 0.7688724093052668 2.515896686706716 19424.0 130.82560809878058 0.0 - - - - - - - 170.35714285714286 38 14 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 1123 143 B20140214_SF053_03 B20140214_SF053_03 TB107908.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.4y8_2.heavy 577.321 / 526.82 245788.0 36.86980056762695 38 8 10 10 10 0.6051692931151609 94.97125061928978 0.0 3 0.7688724093052668 2.515896686706716 245788.0 106.34080910142957 0.0 - - - - - - - 695.8333333333334 491 6 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 1125 143 B20140214_SF053_03 B20140214_SF053_03 TB107908.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.4b4_1.heavy 577.321 / 599.388 158378.0 36.86980056762695 38 8 10 10 10 0.6051692931151609 94.97125061928978 0.0 3 0.7688724093052668 2.515896686706716 158378.0 78.55180005623352 0.0 - - - - - - - 767.0 316 1 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 1127 144 B20140214_SF053_03 B20140214_SF053_03 TB107901.[MT7]-DTGTYEDFVEGLRVFDK[MT7].3y3_1.heavy 760.386 / 553.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 1129 144 B20140214_SF053_03 B20140214_SF053_03 TB107901.[MT7]-DTGTYEDFVEGLRVFDK[MT7].3b4_1.heavy 760.386 / 519.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 1131 144 B20140214_SF053_03 B20140214_SF053_03 TB107901.[MT7]-DTGTYEDFVEGLRVFDK[MT7].3y4_1.heavy 760.386 / 652.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 1133 144 B20140214_SF053_03 B20140214_SF053_03 TB107901.[MT7]-DTGTYEDFVEGLRVFDK[MT7].3y8_1.heavy 760.386 / 1107.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 1135 145 B20140214_SF053_03 B20140214_SF053_03 TB107902.[MT7]-IQRADGDC[CAM]DLAAVILHVK[MT7].4b11_2.heavy 571.319 / 680.326 35729.0 38.6150016784668 42 12 10 10 10 1.1126104296926835 55.53956400943722 0.0 3 0.8994696148080298 3.859281014273692 35729.0 43.486688187873106 0.0 - - - - - - - 816.0 71 9 CCL28 chemokine (C-C motif) ligand 28 1137 145 B20140214_SF053_03 B20140214_SF053_03 TB107902.[MT7]-IQRADGDC[CAM]DLAAVILHVK[MT7].4b9_1.heavy 571.319 / 1175.52 N/A 38.6150016784668 42 12 10 10 10 1.1126104296926835 55.53956400943722 0.0 3 0.8994696148080298 3.859281014273692 330.0 0.0 2.0 - - - - - - - 0.0 0 0 CCL28 chemokine (C-C motif) ligand 28 1139 145 B20140214_SF053_03 B20140214_SF053_03 TB107902.[MT7]-IQRADGDC[CAM]DLAAVILHVK[MT7].4b9_2.heavy 571.319 / 588.265 34986.0 38.6150016784668 42 12 10 10 10 1.1126104296926835 55.53956400943722 0.0 3 0.8994696148080298 3.859281014273692 34986.0 40.46360606060606 0.0 - - - - - - - 797.6666666666666 69 9 CCL28 chemokine (C-C motif) ligand 28 1141 145 B20140214_SF053_03 B20140214_SF053_03 TB107902.[MT7]-IQRADGDC[CAM]DLAAVILHVK[MT7].4b10_2.heavy 571.319 / 644.807 23847.0 38.6150016784668 42 12 10 10 10 1.1126104296926835 55.53956400943722 0.0 3 0.8994696148080298 3.859281014273692 23847.0 32.68804277018978 0.0 - - - - - - - 742.625 47 8 CCL28 chemokine (C-C motif) ligand 28 1143 146 B20140214_SF053_03 B20140214_SF053_03 TB246622.[MT7]-EAFDLFDVDGSGTIDAK[MT7].3y6_1.heavy 696.684 / 748.432 55145.0 43.37419891357422 45 15 10 10 10 3.3978885454833776 29.43004123337841 0.0 3 0.9506434694024681 5.5320665788592365 55145.0 89.36573921914483 0.0 - - - - - - - 776.2857142857143 110 7 CETN1 centrin, EF-hand protein, 1 1145 146 B20140214_SF053_03 B20140214_SF053_03 TB246622.[MT7]-EAFDLFDVDGSGTIDAK[MT7].3b4_1.heavy 696.684 / 607.284 152458.0 43.37419891357422 45 15 10 10 10 3.3978885454833776 29.43004123337841 0.0 3 0.9506434694024681 5.5320665788592365 152458.0 48.628445011611696 0.0 - - - - - - - 770.5 304 2 CETN1 centrin, EF-hand protein, 1 1147 146 B20140214_SF053_03 B20140214_SF053_03 TB246622.[MT7]-EAFDLFDVDGSGTIDAK[MT7].3b5_1.heavy 696.684 / 720.369 118561.0 43.37419891357422 45 15 10 10 10 3.3978885454833776 29.43004123337841 0.0 3 0.9506434694024681 5.5320665788592365 118561.0 123.30705091224758 0.0 - - - - - - - 568.0 237 2 CETN1 centrin, EF-hand protein, 1 1149 146 B20140214_SF053_03 B20140214_SF053_03 TB246622.[MT7]-EAFDLFDVDGSGTIDAK[MT7].3b7_1.heavy 696.684 / 982.464 97719.0 43.37419891357422 45 15 10 10 10 3.3978885454833776 29.43004123337841 0.0 3 0.9506434694024681 5.5320665788592365 97719.0 160.67661952875608 0.0 - - - - - - - 757.0 195 9 CETN1 centrin, EF-hand protein, 1 1151 147 B20140214_SF053_03 B20140214_SF053_03 TB107903.[MT7]-EAPGPINFTVFLTMFGEK[MT7].3y6_1.heavy 762.741 / 856.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 1153 147 B20140214_SF053_03 B20140214_SF053_03 TB107903.[MT7]-EAPGPINFTVFLTMFGEK[MT7].3b6_1.heavy 762.741 / 709.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 1155 147 B20140214_SF053_03 B20140214_SF053_03 TB107903.[MT7]-EAPGPINFTVFLTMFGEK[MT7].3y5_1.heavy 762.741 / 755.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 1157 147 B20140214_SF053_03 B20140214_SF053_03 TB107903.[MT7]-EAPGPINFTVFLTMFGEK[MT7].3b7_1.heavy 762.741 / 823.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 1159 148 B20140214_SF053_03 B20140214_SF053_03 TB246624.[MT7]-RFIWEYDPTLESTYR.3b5_1.heavy 707.357 / 876.485 23736.0 40.07440185546875 45 15 10 10 10 1.7708124269121612 44.82929111357336 0.0 3 0.9570289257045825 5.932075777422576 23736.0 96.36732275132275 0.0 - - - - - - - 310.5 47 12 RERG RAS-like, estrogen-regulated, growth inhibitor 1161 148 B20140214_SF053_03 B20140214_SF053_03 TB246624.[MT7]-RFIWEYDPTLESTYR.3y8_1.heavy 707.357 / 966.489 60110.0 40.07440185546875 45 15 10 10 10 1.7708124269121612 44.82929111357336 0.0 3 0.9570289257045825 5.932075777422576 60110.0 224.94868827160494 0.0 - - - - - - - 279.8181818181818 120 11 RERG RAS-like, estrogen-regulated, growth inhibitor 1163 148 B20140214_SF053_03 B20140214_SF053_03 TB246624.[MT7]-RFIWEYDPTLESTYR.3y5_1.heavy 707.357 / 655.305 48849.0 40.07440185546875 45 15 10 10 10 1.7708124269121612 44.82929111357336 0.0 3 0.9570289257045825 5.932075777422576 48849.0 78.71703703703703 0.0 - - - - - - - 666.0 97 9 RERG RAS-like, estrogen-regulated, growth inhibitor 1165 148 B20140214_SF053_03 B20140214_SF053_03 TB246624.[MT7]-RFIWEYDPTLESTYR.3b7_1.heavy 707.357 / 1154.58 27625.0 40.07440185546875 45 15 10 10 10 1.7708124269121612 44.82929111357336 0.0 3 0.9570289257045825 5.932075777422576 27625.0 87.39390432098764 0.0 - - - - - - - 192.375 55 16 RERG RAS-like, estrogen-regulated, growth inhibitor 1167 149 B20140214_SF053_03 B20140214_SF053_03 TB464102.[MT7]-SAPPSPPPPGTR.2y9_1.heavy 652.858 / 905.484 3650.0 20.111849784851074 40 15 10 5 10 1.8512752418018847 37.331408852958496 0.04089927673339844 3 0.9562992366040334 5.881978712507206 3650.0 2.4800349288558996 1.0 - - - - - - - 723.1428571428571 7 7 GPSM3 G-protein signaling modulator 3 1169 149 B20140214_SF053_03 B20140214_SF053_03 TB464102.[MT7]-SAPPSPPPPGTR.2y6_1.heavy 652.858 / 624.346 1491.0 20.111849784851074 40 15 10 5 10 1.8512752418018847 37.331408852958496 0.04089927673339844 3 0.9562992366040334 5.881978712507206 1491.0 2.4418264397213156 2.0 - - - - - - - 657.125 5 8 GPSM3 G-protein signaling modulator 3 1171 149 B20140214_SF053_03 B20140214_SF053_03 TB464102.[MT7]-SAPPSPPPPGTR.2y10_1.heavy 652.858 / 1002.54 4082.0 20.111849784851074 40 15 10 5 10 1.8512752418018847 37.331408852958496 0.04089927673339844 3 0.9562992366040334 5.881978712507206 4082.0 5.631578438476885 1.0 - - - - - - - 796.0 8 7 GPSM3 G-protein signaling modulator 3 1173 149 B20140214_SF053_03 B20140214_SF053_03 TB464102.[MT7]-SAPPSPPPPGTR.2y7_1.heavy 652.858 / 721.399 5181.0 20.111849784851074 40 15 10 5 10 1.8512752418018847 37.331408852958496 0.04089927673339844 3 0.9562992366040334 5.881978712507206 5181.0 6.84375 0.0 - - - - - - - 686.75 10 8 GPSM3 G-protein signaling modulator 3 1175 150 B20140214_SF053_03 B20140214_SF053_03 TB246620.[MT7]-NDLRDTFAALGRVNVK[MT7].3y7_1.heavy 693.063 / 929.601 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2 myosin, light chain 2, regulatory, cardiac, slow 1177 150 B20140214_SF053_03 B20140214_SF053_03 TB246620.[MT7]-NDLRDTFAALGRVNVK[MT7].3b9_1.heavy 693.063 / 1148.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2 myosin, light chain 2, regulatory, cardiac, slow 1179 150 B20140214_SF053_03 B20140214_SF053_03 TB246620.[MT7]-NDLRDTFAALGRVNVK[MT7].3y3_1.heavy 693.063 / 504.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2 myosin, light chain 2, regulatory, cardiac, slow 1181 150 B20140214_SF053_03 B20140214_SF053_03 TB246620.[MT7]-NDLRDTFAALGRVNVK[MT7].3y4_1.heavy 693.063 / 603.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL2 myosin, light chain 2, regulatory, cardiac, slow 1183 151 B20140214_SF053_03 B20140214_SF053_03 TB246491.[MT7]-RK[MT7]IPYILK[MT7].3b6_2.heavy 488.333 / 530.349 5836.0 28.627399444580078 30 14 2 10 4 1.420158745339794 46.49424684988351 0.0 7 0.94227308301983 5.111654735210748 5836.0 4.197665158283256 2.0 - - - - - - - 1741.6666666666667 26 12 NTS neurotensin 1185 151 B20140214_SF053_03 B20140214_SF053_03 TB246491.[MT7]-RK[MT7]IPYILK[MT7].3y3_1.heavy 488.333 / 517.383 9772.0 28.627399444580078 30 14 2 10 4 1.420158745339794 46.49424684988351 0.0 7 0.94227308301983 5.111654735210748 9772.0 4.042211423699914 2.0 - - - - - - - 1673.75 59 4 NTS neurotensin 1187 151 B20140214_SF053_03 B20140214_SF053_03 TB246491.[MT7]-RK[MT7]IPYILK[MT7].3y4_1.heavy 488.333 / 680.446 2850.0 28.627399444580078 30 14 2 10 4 1.420158745339794 46.49424684988351 0.0 7 0.94227308301983 5.111654735210748 2850.0 5.022038361817367 1.0 - - - - - - - 1215.142857142857 5 7 NTS neurotensin 1189 151 B20140214_SF053_03 B20140214_SF053_03 TB246491.[MT7]-RK[MT7]IPYILK[MT7].3y5_1.heavy 488.333 / 777.499 4841.0 28.627399444580078 30 14 2 10 4 1.420158745339794 46.49424684988351 0.0 7 0.94227308301983 5.111654735210748 4841.0 20.597403024440688 1.0 - - - - - - - 296.44444444444446 9 18 NTS neurotensin 1191 152 B20140214_SF053_03 B20140214_SF053_03 TB464204.[MT7]-RAVSEHQLLHDK[MT7].3b6_1.heavy 574.328 / 824.45 2030.0 21.277000427246094 38 10 10 10 8 0.7002467271759547 73.10582223724103 0.0 4 0.8489703963597758 3.134782480062826 2030.0 3.5338491295938104 1.0 - - - - - - - 111.0 4 18 PTHLH parathyroid hormone-like hormone 1193 152 B20140214_SF053_03 B20140214_SF053_03 TB464204.[MT7]-RAVSEHQLLHDK[MT7].3y3_1.heavy 574.328 / 543.301 7162.0 21.277000427246094 38 10 10 10 8 0.7002467271759547 73.10582223724103 0.0 4 0.8489703963597758 3.134782480062826 7162.0 10.744433671604378 0.0 - - - - - - - 714.7142857142857 14 14 PTHLH parathyroid hormone-like hormone 1195 152 B20140214_SF053_03 B20140214_SF053_03 TB464204.[MT7]-RAVSEHQLLHDK[MT7].3b5_1.heavy 574.328 / 687.391 2473.0 21.277000427246094 38 10 10 10 8 0.7002467271759547 73.10582223724103 0.0 4 0.8489703963597758 3.134782480062826 2473.0 19.481416300020953 1.0 - - - - - - - 218.43478260869566 9 23 PTHLH parathyroid hormone-like hormone 1197 152 B20140214_SF053_03 B20140214_SF053_03 TB464204.[MT7]-RAVSEHQLLHDK[MT7].3y4_1.heavy 574.328 / 656.385 4578.0 21.277000427246094 38 10 10 10 8 0.7002467271759547 73.10582223724103 0.0 4 0.8489703963597758 3.134782480062826 4578.0 32.79843770599868 0.0 - - - - - - - 219.41176470588235 9 17 PTHLH parathyroid hormone-like hormone 1199 153 B20140214_SF053_03 B20140214_SF053_03 TB246499.[MT7]-TTVYVVEDQRR.3b4_1.heavy 503.943 / 609.336 88316.0 25.136499404907227 48 18 10 10 10 4.779694487927701 20.92183930428497 0.0 3 0.9878747569660139 11.19637246975168 88316.0 110.07320979884037 0.0 - - - - - - - 1144.5714285714287 176 7 C5orf32 chromosome 5 open reading frame 32 1201 153 B20140214_SF053_03 B20140214_SF053_03 TB246499.[MT7]-TTVYVVEDQRR.3b5_1.heavy 503.943 / 708.405 45974.0 25.136499404907227 48 18 10 10 10 4.779694487927701 20.92183930428497 0.0 3 0.9878747569660139 11.19637246975168 45974.0 106.5174266106373 0.0 - - - - - - - 622.25 91 8 C5orf32 chromosome 5 open reading frame 32 1203 153 B20140214_SF053_03 B20140214_SF053_03 TB246499.[MT7]-TTVYVVEDQRR.3b3_1.heavy 503.943 / 446.273 62446.0 25.136499404907227 48 18 10 10 10 4.779694487927701 20.92183930428497 0.0 3 0.9878747569660139 11.19637246975168 62446.0 50.26069715362455 0.0 - - - - - - - 1717.375 124 8 C5orf32 chromosome 5 open reading frame 32 1205 153 B20140214_SF053_03 B20140214_SF053_03 TB246499.[MT7]-TTVYVVEDQRR.3y8_2.heavy 503.943 / 532.778 21265.0 25.136499404907227 48 18 10 10 10 4.779694487927701 20.92183930428497 0.0 3 0.9878747569660139 11.19637246975168 21265.0 15.645452485240344 0.0 - - - - - - - 790.0 42 10 C5orf32 chromosome 5 open reading frame 32 1207 154 B20140214_SF053_03 B20140214_SF053_03 TB463996.[MT7]-IVSFLLR.2y5_1.heavy 496.325 / 635.388 69322.0 44.18880081176758 48 18 10 10 10 3.990728104883394 25.058083981625185 0.0 3 0.9847996681651535 9.997333441827152 69322.0 198.5345789897002 0.0 - - - - - - - 324.0 138 10 ANKRD22 ankyrin repeat domain 22 1209 154 B20140214_SF053_03 B20140214_SF053_03 TB463996.[MT7]-IVSFLLR.2b4_1.heavy 496.325 / 591.362 22621.0 44.18880081176758 48 18 10 10 10 3.990728104883394 25.058083981625185 0.0 3 0.9847996681651535 9.997333441827152 22621.0 27.440864405313043 0.0 - - - - - - - 283.5 45 6 ANKRD22 ankyrin repeat domain 22 1211 154 B20140214_SF053_03 B20140214_SF053_03 TB463996.[MT7]-IVSFLLR.2y6_1.heavy 496.325 / 734.456 133292.0 44.18880081176758 48 18 10 10 10 3.990728104883394 25.058083981625185 0.0 3 0.9847996681651535 9.997333441827152 133292.0 681.3520092823267 0.0 - - - - - - - 261.0 266 9 ANKRD22 ankyrin repeat domain 22 1213 154 B20140214_SF053_03 B20140214_SF053_03 TB463996.[MT7]-IVSFLLR.2b5_1.heavy 496.325 / 704.446 37053.0 44.18880081176758 48 18 10 10 10 3.990728104883394 25.058083981625185 0.0 3 0.9847996681651535 9.997333441827152 37053.0 126.0956066312846 0.0 - - - - - - - 310.5 74 12 ANKRD22 ankyrin repeat domain 22 1215 155 B20140214_SF053_03 B20140214_SF053_03 TB463997.[MT7]-IEASLC[CAM]R.2y4_1.heavy 496.769 / 535.266 38573.0 27.27079963684082 44 18 10 6 10 7.339086405867189 13.625674160213674 0.0373992919921875 3 0.9855462246198572 10.252911952749212 38573.0 28.724416350058956 1.0 - - - - - - - 926.0 77 2 GNG3 guanine nucleotide binding protein (G protein), gamma 3 1217 155 B20140214_SF053_03 B20140214_SF053_03 TB463997.[MT7]-IEASLC[CAM]R.2y5_1.heavy 496.769 / 606.303 90380.0 27.27079963684082 44 18 10 6 10 7.339086405867189 13.625674160213674 0.0373992919921875 3 0.9855462246198572 10.252911952749212 90380.0 111.97893862144727 0.0 - - - - - - - 858.3333333333334 180 6 GNG3 guanine nucleotide binding protein (G protein), gamma 3 1219 155 B20140214_SF053_03 B20140214_SF053_03 TB463997.[MT7]-IEASLC[CAM]R.2b4_1.heavy 496.769 / 545.305 29178.0 27.27079963684082 44 18 10 6 10 7.339086405867189 13.625674160213674 0.0373992919921875 3 0.9855462246198572 10.252911952749212 29178.0 24.110806014810443 0.0 - - - - - - - 1236.375 58 8 GNG3 guanine nucleotide binding protein (G protein), gamma 3 1221 155 B20140214_SF053_03 B20140214_SF053_03 TB463997.[MT7]-IEASLC[CAM]R.2y6_1.heavy 496.769 / 735.345 251717.0 27.27079963684082 44 18 10 6 10 7.339086405867189 13.625674160213674 0.0373992919921875 3 0.9855462246198572 10.252911952749212 251717.0 172.23727674480887 0.0 - - - - - - - 271.0 503 1 GNG3 guanine nucleotide binding protein (G protein), gamma 3 1223 156 B20140214_SF053_03 B20140214_SF053_03 TB463998.[MT7]-DIPIVHR.2y4_1.heavy 497.302 / 524.33 2212.0 26.0415997505188 46 20 10 6 10 13.464251240825169 7.427074718925953 0.03159904479980469 3 0.9981880732444336 28.988547367203765 2212.0 3.3246922146026625 1.0 - - - - - - - 1106.0 4 10 SEC11C SEC11 homolog C (S. cerevisiae) 1225 156 B20140214_SF053_03 B20140214_SF053_03 TB463998.[MT7]-DIPIVHR.2y5_1.heavy 497.302 / 621.383 18983.0 26.0415997505188 46 20 10 6 10 13.464251240825169 7.427074718925953 0.03159904479980469 3 0.9981880732444336 28.988547367203765 18983.0 16.01656281627842 0.0 - - - - - - - 1242.3333333333333 37 9 SEC11C SEC11 homolog C (S. cerevisiae) 1227 156 B20140214_SF053_03 B20140214_SF053_03 TB463998.[MT7]-DIPIVHR.2b4_1.heavy 497.302 / 583.357 2896.0 26.0415997505188 46 20 10 6 10 13.464251240825169 7.427074718925953 0.03159904479980469 3 0.9981880732444336 28.988547367203765 2896.0 2.7609533678756475 0.0 - - - - - - - 1137.0 5 11 SEC11C SEC11 homolog C (S. cerevisiae) 1229 156 B20140214_SF053_03 B20140214_SF053_03 TB463998.[MT7]-DIPIVHR.2y6_1.heavy 497.302 / 734.467 7199.0 26.0415997505188 46 20 10 6 10 13.464251240825169 7.427074718925953 0.03159904479980469 3 0.9981880732444336 28.988547367203765 7199.0 10.937707182320441 0.0 - - - - - - - 647.1818181818181 14 11 SEC11C SEC11 homolog C (S. cerevisiae) 1231 157 B20140214_SF053_03 B20140214_SF053_03 TB463999.[MT7]-DTFAALGR.2b4_1.heavy 497.776 / 579.289 12667.0 31.953924655914307 42 17 10 7 8 6.4434697666663485 15.519588610056736 0.027898788452148438 4 0.9700185094599055 7.1095920152265935 12667.0 3.9909587955625994 0.0 - - - - - - - 1132.9 25 10 MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 1233 157 B20140214_SF053_03 B20140214_SF053_03 TB463999.[MT7]-DTFAALGR.2y6_1.heavy 497.776 / 634.367 15153.0 31.953924655914307 42 17 10 7 8 6.4434697666663485 15.519588610056736 0.027898788452148438 4 0.9700185094599055 7.1095920152265935 15153.0 20.921024550083175 2.0 - - - - - - - 1641.0 41 9 MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 1235 157 B20140214_SF053_03 B20140214_SF053_03 TB463999.[MT7]-DTFAALGR.2b5_1.heavy 497.776 / 650.327 17686.0 31.953924655914307 42 17 10 7 8 6.4434697666663485 15.519588610056736 0.027898788452148438 4 0.9700185094599055 7.1095920152265935 17686.0 13.81904168520991 0.0 - - - - - - - 1195.0 35 9 MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 1237 157 B20140214_SF053_03 B20140214_SF053_03 TB463999.[MT7]-DTFAALGR.2y7_1.heavy 497.776 / 735.415 33460.0 31.953924655914307 42 17 10 7 8 6.4434697666663485 15.519588610056736 0.027898788452148438 4 0.9700185094599055 7.1095920152265935 33460.0 34.2487327245683 0.0 - - - - - - - 1238.1 66 10 MYL2;MYL10 myosin, light chain 2, regulatory, cardiac, slow;myosin, light chain 10, regulatory 1239 158 B20140214_SF053_03 B20140214_SF053_03 TB246346.[MT7]-FSFVC[CAM]K[MT7].2b3_1.heavy 538.296 / 526.278 9780.0 33.63682460784912 29 16 4 3 6 3.1758089301209225 31.488040433273923 0.06689834594726562 5 0.9604230707491077 6.182989060385266 9780.0 5.548147140649149 2.0 - - - - - - - 1195.0 93 4 REG1A;REG1B regenerating islet-derived 1 alpha;regenerating islet-derived 1 beta 1241 158 B20140214_SF053_03 B20140214_SF053_03 TB246346.[MT7]-FSFVC[CAM]K[MT7].2y4_1.heavy 538.296 / 697.382 8089.0 33.63682460784912 29 16 4 3 6 3.1758089301209225 31.488040433273923 0.06689834594726562 5 0.9604230707491077 6.182989060385266 8089.0 7.78439330543933 1.0 - - - - - - - 751.7777777777778 16 9 REG1A;REG1B regenerating islet-derived 1 alpha;regenerating islet-derived 1 beta 1243 158 B20140214_SF053_03 B20140214_SF053_03 TB246346.[MT7]-FSFVC[CAM]K[MT7].2y5_1.heavy 538.296 / 784.414 26840.0 33.63682460784912 29 16 4 3 6 3.1758089301209225 31.488040433273923 0.06689834594726562 5 0.9604230707491077 6.182989060385266 26840.0 82.06399577306652 0.0 - - - - - - - 710.8333333333334 53 12 REG1A;REG1B regenerating islet-derived 1 alpha;regenerating islet-derived 1 beta 1245 158 B20140214_SF053_03 B20140214_SF053_03 TB246346.[MT7]-FSFVC[CAM]K[MT7].2y3_1.heavy 538.296 / 550.314 11251.0 33.63682460784912 29 16 4 3 6 3.1758089301209225 31.488040433273923 0.06689834594726562 5 0.9604230707491077 6.182989060385266 11251.0 12.390632222977565 0.0 - - - - - - - 1375.2 22 10 REG1A;REG1B regenerating islet-derived 1 alpha;regenerating islet-derived 1 beta 1247 159 B20140214_SF053_03 B20140214_SF053_03 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 234696.0 40.439701080322266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 234696.0 280.6494950791034 0.0 - - - - - - - 1137.0 469 7 1249 159 B20140214_SF053_03 B20140214_SF053_03 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 413351.0 40.439701080322266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 413351.0 236.101023126071 0.0 - - - - - - - 788.0 826 5 1251 159 B20140214_SF053_03 B20140214_SF053_03 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 545157.0 40.439701080322266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 545157.0 186.4877468536753 0.0 - - - - - - - 739.8 1090 5 1253 160 B20140214_SF053_03 B20140214_SF053_03 TB246348.[MT7]-RPYILK[MT7].3y3_1.heavy 359.906 / 517.383 48870.0 26.50339984893799 40 14 10 6 10 2.372918329302313 42.142200498490006 0.031200408935546875 3 0.9371204691667516 4.895593384311819 48870.0 60.811572170139485 0.0 - - - - - - - 777.7777777777778 97 9 NTS neurotensin 1255 160 B20140214_SF053_03 B20140214_SF053_03 TB246348.[MT7]-RPYILK[MT7].3b4_1.heavy 359.906 / 674.411 25519.0 26.50339984893799 40 14 10 6 10 2.372918329302313 42.142200498490006 0.031200408935546875 3 0.9371204691667516 4.895593384311819 25519.0 73.29590447358586 0.0 - - - - - - - 233.27777777777777 51 18 NTS neurotensin 1257 160 B20140214_SF053_03 B20140214_SF053_03 TB246348.[MT7]-RPYILK[MT7].3y4_1.heavy 359.906 / 680.446 9666.0 26.50339984893799 40 14 10 6 10 2.372918329302313 42.142200498490006 0.031200408935546875 3 0.9371204691667516 4.895593384311819 9666.0 89.12209846966215 0.0 - - - - - - - 140.1578947368421 19 19 NTS neurotensin 1259 160 B20140214_SF053_03 B20140214_SF053_03 TB246348.[MT7]-RPYILK[MT7].3b3_1.heavy 359.906 / 561.326 49186.0 26.50339984893799 40 14 10 6 10 2.372918329302313 42.142200498490006 0.031200408935546875 3 0.9371204691667516 4.895593384311819 49186.0 96.73834430799302 0.0 - - - - - - - 354.7142857142857 98 7 NTS neurotensin 1261 161 B20140214_SF053_03 B20140214_SF053_03 TB463969.[MT7]-ELYAAAR.2b3_1.heavy 469.265 / 550.299 18216.0 25.035175323486328 47 20 10 7 10 8.64841928962968 11.562806641429837 0.027099609375 3 0.9911963171363418 13.143500427315795 18216.0 14.182347711161842 0.0 - - - - - - - 1242.857142857143 36 7 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 1263 161 B20140214_SF053_03 B20140214_SF053_03 TB463969.[MT7]-ELYAAAR.2y5_1.heavy 469.265 / 551.294 45202.0 25.035175323486328 47 20 10 7 10 8.64841928962968 11.562806641429837 0.027099609375 3 0.9911963171363418 13.143500427315795 45202.0 15.500213298733476 1.0 - - - - - - - 730.5714285714286 90 7 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 1265 161 B20140214_SF053_03 B20140214_SF053_03 TB463969.[MT7]-ELYAAAR.2b4_1.heavy 469.265 / 621.336 26063.0 25.035175323486328 47 20 10 7 10 8.64841928962968 11.562806641429837 0.027099609375 3 0.9911963171363418 13.143500427315795 26063.0 46.728865626189574 0.0 - - - - - - - 772.9411764705883 52 17 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 1267 161 B20140214_SF053_03 B20140214_SF053_03 TB463969.[MT7]-ELYAAAR.2y6_1.heavy 469.265 / 664.378 83053.0 25.035175323486328 47 20 10 7 10 8.64841928962968 11.562806641429837 0.027099609375 3 0.9911963171363418 13.143500427315795 83053.0 101.79030686265565 0.0 - - - - - - - 803.7272727272727 166 11 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 1269 162 B20140214_SF053_03 B20140214_SF053_03 TB463966.[MT7]-ALGFEPR.2y5_1.heavy 467.267 / 605.304 N/A 30.1200008392334 43 13 10 10 10 1.65558478474548 49.78059346253355 0.0 3 0.9232842658908121 4.42694183498037 689678.0 60.05656848667917 1.0 - - - - - - - 1782.8 2018 5 CETN1 centrin, EF-hand protein, 1 1271 162 B20140214_SF053_03 B20140214_SF053_03 TB463966.[MT7]-ALGFEPR.2b4_1.heavy 467.267 / 533.32 93464.0 30.1200008392334 43 13 10 10 10 1.65558478474548 49.78059346253355 0.0 3 0.9232842658908121 4.42694183498037 93464.0 46.721643156446916 0.0 - - - - - - - 1190.0 186 6 CETN1 centrin, EF-hand protein, 1 1273 162 B20140214_SF053_03 B20140214_SF053_03 TB463966.[MT7]-ALGFEPR.2y6_1.heavy 467.267 / 718.388 201510.0 30.1200008392334 43 13 10 10 10 1.65558478474548 49.78059346253355 0.0 3 0.9232842658908121 4.42694183498037 201510.0 332.0178115485504 0.0 - - - - - - - 714.125 403 8 CETN1 centrin, EF-hand protein, 1 1275 162 B20140214_SF053_03 B20140214_SF053_03 TB463966.[MT7]-ALGFEPR.2b5_1.heavy 467.267 / 662.363 280868.0 30.1200008392334 43 13 10 10 10 1.65558478474548 49.78059346253355 0.0 3 0.9232842658908121 4.42694183498037 280868.0 509.0743523999916 0.0 - - - - - - - 724.0 561 11 CETN1 centrin, EF-hand protein, 1 1277 163 B20140214_SF053_03 B20140214_SF053_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 1937450.0 35.50979995727539 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 1937450.0 182.61660395643167 0.0 - - - - - - - 804.8571428571429 3874 7 1279 163 B20140214_SF053_03 B20140214_SF053_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 301495.0 35.50979995727539 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 301495.0 198.3674236174202 1.0 - - - - - - - 276.0 926 3 1281 163 B20140214_SF053_03 B20140214_SF053_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 232047.0 35.50979995727539 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 232047.0 134.49553323156627 0.0 - - - - - - - 1284.5 464 4 1283 164 B20140214_SF053_03 B20140214_SF053_03 TB246248.[MT7]-IAGEASR.2y5_1.heavy 424.241 / 519.252 30628.0 19.128400802612305 50 20 10 10 10 16.154356745798545 6.190280527635877 0.0 3 0.9975387327100251 24.871035265425203 30628.0 52.08295238095238 0.0 - - - - - - - 737.9166666666666 61 12 HIST1H2BD;HIST1H2BB;HIST2H2BF;HIST1H2BG;HIST1H2BN;HIST1H2BM;HIST1H2BF;HIST1H2BE;HIST1H2BH;HIST1H2BI;HIST1H2BC;HIST1H2BO;HIST2H2BE;HIST1H2BK;HIST1H2BJ histone cluster 1, H2bd;histone cluster 1, H2bb;histone cluster 2, H2bf;histone cluster 1, H2bg;histone cluster 1, H2bn;histone cluster 1, H2bm;histone cluster 1, H2bf;histone cluster 1, H2be;histone cluster 1, H2bh;histone cluster 1, H2bi;histone cluster 1, H2bc;histone cluster 1, H2bo;histone cluster 2, H2be;histone cluster 1, H2bk;histone cluster 1, H2bj 1285 164 B20140214_SF053_03 B20140214_SF053_03 TB246248.[MT7]-IAGEASR.2b4_1.heavy 424.241 / 515.295 32308.0 19.128400802612305 50 20 10 10 10 16.154356745798545 6.190280527635877 0.0 3 0.9975387327100251 24.871035265425203 32308.0 41.603076657160145 0.0 - - - - - - - 1239.0 64 10 HIST1H2BD;HIST1H2BB;HIST2H2BF;HIST1H2BG;HIST1H2BN;HIST1H2BM;HIST1H2BF;HIST1H2BE;HIST1H2BH;HIST1H2BI;HIST1H2BC;HIST1H2BO;HIST2H2BE;HIST1H2BK;HIST1H2BJ histone cluster 1, H2bd;histone cluster 1, H2bb;histone cluster 2, H2bf;histone cluster 1, H2bg;histone cluster 1, H2bn;histone cluster 1, H2bm;histone cluster 1, H2bf;histone cluster 1, H2be;histone cluster 1, H2bh;histone cluster 1, H2bi;histone cluster 1, H2bc;histone cluster 1, H2bo;histone cluster 2, H2be;histone cluster 1, H2bk;histone cluster 1, H2bj 1287 164 B20140214_SF053_03 B20140214_SF053_03 TB246248.[MT7]-IAGEASR.2y6_1.heavy 424.241 / 590.289 188984.0 19.128400802612305 50 20 10 10 10 16.154356745798545 6.190280527635877 0.0 3 0.9975387327100251 24.871035265425203 188984.0 404.5071406698564 0.0 - - - - - - - 350.0 377 6 HIST1H2BD;HIST1H2BB;HIST2H2BF;HIST1H2BG;HIST1H2BN;HIST1H2BM;HIST1H2BF;HIST1H2BE;HIST1H2BH;HIST1H2BI;HIST1H2BC;HIST1H2BO;HIST2H2BE;HIST1H2BK;HIST1H2BJ histone cluster 1, H2bd;histone cluster 1, H2bb;histone cluster 2, H2bf;histone cluster 1, H2bg;histone cluster 1, H2bn;histone cluster 1, H2bm;histone cluster 1, H2bf;histone cluster 1, H2be;histone cluster 1, H2bh;histone cluster 1, H2bi;histone cluster 1, H2bc;histone cluster 1, H2bo;histone cluster 2, H2be;histone cluster 1, H2bk;histone cluster 1, H2bj 1289 164 B20140214_SF053_03 B20140214_SF053_03 TB246248.[MT7]-IAGEASR.2b5_1.heavy 424.241 / 586.332 19672.0 19.128400802612305 50 20 10 10 10 16.154356745798545 6.190280527635877 0.0 3 0.9975387327100251 24.871035265425203 19672.0 35.14472249589491 0.0 - - - - - - - 696.1111111111111 39 9 HIST1H2BD;HIST1H2BB;HIST2H2BF;HIST1H2BG;HIST1H2BN;HIST1H2BM;HIST1H2BF;HIST1H2BE;HIST1H2BH;HIST1H2BI;HIST1H2BC;HIST1H2BO;HIST2H2BE;HIST1H2BK;HIST1H2BJ histone cluster 1, H2bd;histone cluster 1, H2bb;histone cluster 2, H2bf;histone cluster 1, H2bg;histone cluster 1, H2bn;histone cluster 1, H2bm;histone cluster 1, H2bf;histone cluster 1, H2be;histone cluster 1, H2bh;histone cluster 1, H2bi;histone cluster 1, H2bc;histone cluster 1, H2bo;histone cluster 2, H2be;histone cluster 1, H2bk;histone cluster 1, H2bj 1291 165 B20140214_SF053_03 B20140214_SF053_03 TB246230.[MT7]-NVAQR.2y4_1.heavy 366.218 / 473.283 8948.0 15.915200233459473 47 17 10 10 10 3.41581661754614 23.151971614062873 0.0 3 0.9771730158614337 8.152831862607716 8948.0 12.6001727284351 1.0 - - - - - - - 732.2 17 15 CCDC68 coiled-coil domain containing 68 1293 165 B20140214_SF053_03 B20140214_SF053_03 TB246230.[MT7]-NVAQR.2b3_1.heavy 366.218 / 429.258 6028.0 15.915200233459473 47 17 10 10 10 3.41581661754614 23.151971614062873 0.0 3 0.9771730158614337 8.152831862607716 6028.0 6.027285160882283 0.0 - - - - - - - 744.4545454545455 12 11 CCDC68 coiled-coil domain containing 68 1295 165 B20140214_SF053_03 B20140214_SF053_03 TB246230.[MT7]-NVAQR.2y3_1.heavy 366.218 / 374.215 4234.0 15.915200233459473 47 17 10 10 10 3.41581661754614 23.151971614062873 0.0 3 0.9771730158614337 8.152831862607716 4234.0 11.387967698944895 0.0 - - - - - - - 636.4545454545455 8 11 CCDC68 coiled-coil domain containing 68 1297 166 B20140214_SF053_03 B20140214_SF053_03 TB463970.[MT7]-MLQVFR.2y4_1.heavy 469.274 / 549.314 23074.0 36.744524002075195 42 16 10 6 10 1.3788797441471108 46.24538984386062 0.03749847412109375 3 0.9674546185583287 6.822330249948759 23074.0 11.288980392156862 1.0 - - - - - - - 913.0 46 4 LGALS14 lectin, galactoside-binding, soluble, 14 1299 166 B20140214_SF053_03 B20140214_SF053_03 TB463970.[MT7]-MLQVFR.2b3_1.heavy 469.274 / 517.292 28469.0 36.744524002075195 42 16 10 6 10 1.3788797441471108 46.24538984386062 0.03749847412109375 3 0.9674546185583287 6.822330249948759 28469.0 15.045296198054817 0.0 - - - - - - - 1280.5714285714287 56 7 LGALS14 lectin, galactoside-binding, soluble, 14 1301 166 B20140214_SF053_03 B20140214_SF053_03 TB463970.[MT7]-MLQVFR.2y5_1.heavy 469.274 / 662.398 60425.0 36.744524002075195 42 16 10 6 10 1.3788797441471108 46.24538984386062 0.03749847412109375 3 0.9674546185583287 6.822330249948759 60425.0 43.85756792351592 0.0 - - - - - - - 332.0 120 7 LGALS14 lectin, galactoside-binding, soluble, 14 1303 166 B20140214_SF053_03 B20140214_SF053_03 TB463970.[MT7]-MLQVFR.2b4_1.heavy 469.274 / 616.361 31042.0 36.744524002075195 42 16 10 6 10 1.3788797441471108 46.24538984386062 0.03749847412109375 3 0.9674546185583287 6.822330249948759 31042.0 17.881875 0.0 - - - - - - - 415.0 62 1 LGALS14 lectin, galactoside-binding, soluble, 14 1305 167 B20140214_SF053_03 B20140214_SF053_03 TB246235.[MT7]-AGGTLGR.2y5_1.heavy 388.231 / 503.294 11055.0 18.7632999420166 48 18 10 10 10 2.7586854377691195 36.24914918928471 0.0 3 0.9855575175389341 10.256929370802917 11055.0 10.764604208141984 3.0 - - - - - - - 802.25 35 4 SRXN1 sulfiredoxin 1 1307 167 B20140214_SF053_03 B20140214_SF053_03 TB246235.[MT7]-AGGTLGR.2b4_1.heavy 388.231 / 431.237 26421.0 18.7632999420166 48 18 10 10 10 2.7586854377691195 36.24914918928471 0.0 3 0.9855575175389341 10.256929370802917 26421.0 34.93850145020947 0.0 - - - - - - - 1090.0 52 8 SRXN1 sulfiredoxin 1 1309 167 B20140214_SF053_03 B20140214_SF053_03 TB246235.[MT7]-AGGTLGR.2y6_1.heavy 388.231 / 560.315 106365.0 18.7632999420166 48 18 10 10 10 2.7586854377691195 36.24914918928471 0.0 3 0.9855575175389341 10.256929370802917 106365.0 199.2016415215769 0.0 - - - - - - - 1162.4285714285713 212 7 SRXN1 sulfiredoxin 1 1311 167 B20140214_SF053_03 B20140214_SF053_03 TB246235.[MT7]-AGGTLGR.2b5_1.heavy 388.231 / 544.321 23795.0 18.7632999420166 48 18 10 10 10 2.7586854377691195 36.24914918928471 0.0 3 0.9855575175389341 10.256929370802917 23795.0 15.963151137658453 0.0 - - - - - - - 1241.142857142857 47 7 SRXN1 sulfiredoxin 1 1313 168 B20140214_SF053_03 B20140214_SF053_03 TB246645.[MT7]-TYGTSGLDNRPLFGETSAK[MT7].4b8_1.heavy 576.303 / 939.454 5228.0 32.16940116882324 43 16 10 7 10 10.34660142769867 9.665009394514037 0.02919769287109375 3 0.9647753866352112 6.556259239899324 5228.0 11.058769424254614 0.0 - - - - - - - 251.78947368421052 10 19 C7orf23 chromosome 7 open reading frame 23 1315 168 B20140214_SF053_03 B20140214_SF053_03 TB246645.[MT7]-TYGTSGLDNRPLFGETSAK[MT7].4y4_1.heavy 576.303 / 550.332 24249.0 32.16940116882324 43 16 10 7 10 10.34660142769867 9.665009394514037 0.02919769287109375 3 0.9647753866352112 6.556259239899324 24249.0 11.225124284797108 0.0 - - - - - - - 1215.5714285714287 48 7 C7orf23 chromosome 7 open reading frame 23 1317 168 B20140214_SF053_03 B20140214_SF053_03 TB246645.[MT7]-TYGTSGLDNRPLFGETSAK[MT7].4b14_2.heavy 576.303 / 812.416 16296.0 32.16940116882324 43 16 10 7 10 10.34660142769867 9.665009394514037 0.02919769287109375 3 0.9647753866352112 6.556259239899324 16296.0 35.83044290211411 0.0 - - - - - - - 656.3333333333334 32 15 C7orf23 chromosome 7 open reading frame 23 1319 168 B20140214_SF053_03 B20140214_SF053_03 TB246645.[MT7]-TYGTSGLDNRPLFGETSAK[MT7].4b6_1.heavy 576.303 / 711.343 21468.0 32.16940116882324 43 16 10 7 10 10.34660142769867 9.665009394514037 0.02919769287109375 3 0.9647753866352112 6.556259239899324 21468.0 21.703456569893945 0.0 - - - - - - - 636.5 42 18 C7orf23 chromosome 7 open reading frame 23 1321 169 B20140214_SF053_03 B20140214_SF053_03 TB464127.[MT7]-GLSQSALPYRR.3b6_1.heavy 464.601 / 688.375 112082.0 26.62030029296875 42 12 10 10 10 1.6569984139391538 40.36593733925541 0.0 3 0.8876235047614933 3.6464570447281655 112082.0 261.1454891454225 0.0 - - - - - - - 773.8 224 10 RPS13 ribosomal protein S13 1323 169 B20140214_SF053_03 B20140214_SF053_03 TB464127.[MT7]-GLSQSALPYRR.3b4_1.heavy 464.601 / 530.305 66536.0 26.62030029296875 42 12 10 10 10 1.6569984139391538 40.36593733925541 0.0 3 0.8876235047614933 3.6464570447281655 66536.0 62.247554589860684 0.0 - - - - - - - 1823.375 133 8 RPS13 ribosomal protein S13 1325 169 B20140214_SF053_03 B20140214_SF053_03 TB464127.[MT7]-GLSQSALPYRR.3b5_1.heavy 464.601 / 617.338 78003.0 26.62030029296875 42 12 10 10 10 1.6569984139391538 40.36593733925541 0.0 3 0.8876235047614933 3.6464570447281655 78003.0 74.56291179600261 0.0 - - - - - - - 1301.111111111111 156 9 RPS13 ribosomal protein S13 1327 169 B20140214_SF053_03 B20140214_SF053_03 TB464127.[MT7]-GLSQSALPYRR.3y4_1.heavy 464.601 / 591.336 150293.0 26.62030029296875 42 12 10 10 10 1.6569984139391538 40.36593733925541 0.0 3 0.8876235047614933 3.6464570447281655 150293.0 96.07963270189431 0.0 - - - - - - - 1666.25 300 8 RPS13 ribosomal protein S13 1329 170 B20140214_SF053_03 B20140214_SF053_03 TB246647.[MT7]-SRPQLGRPMSSGAHGEEGSAR.4y5_1.heavy 578.542 / 519.252 6854.0 19.596500396728516 50 20 10 10 10 5.793053340167933 17.262054072007064 0.0 3 0.9926545395179891 14.390856965750123 6854.0 11.797620993455439 0.0 - - - - - - - 749.4615384615385 13 13 COX6A1 cytochrome c oxidase subunit VIa polypeptide 1 1331 170 B20140214_SF053_03 B20140214_SF053_03 TB246647.[MT7]-SRPQLGRPMSSGAHGEEGSAR.4y11_2.heavy 578.542 / 529.237 N/A 19.596500396728516 50 20 10 10 10 5.793053340167933 17.262054072007064 0.0 3 0.9926545395179891 14.390856965750123 1309.0 0.24721435316336168 21.0 - - - - - - - 1164.75 30 12 COX6A1 cytochrome c oxidase subunit VIa polypeptide 1 1333 170 B20140214_SF053_03 B20140214_SF053_03 TB246647.[MT7]-SRPQLGRPMSSGAHGEEGSAR.4y7_1.heavy 578.542 / 705.316 16558.0 19.596500396728516 50 20 10 10 10 5.793053340167933 17.262054072007064 0.0 3 0.9926545395179891 14.390856965750123 16558.0 142.81151521298176 0.0 - - - - - - - 154.25 33 20 COX6A1 cytochrome c oxidase subunit VIa polypeptide 1 1335 170 B20140214_SF053_03 B20140214_SF053_03 TB246647.[MT7]-SRPQLGRPMSSGAHGEEGSAR.4y6_1.heavy 578.542 / 648.295 4082.0 19.596500396728516 50 20 10 10 10 5.793053340167933 17.262054072007064 0.0 3 0.9926545395179891 14.390856965750123 4082.0 21.91203463203463 0.0 - - - - - - - 188.85 8 20 COX6A1 cytochrome c oxidase subunit VIa polypeptide 1 1337 171 B20140214_SF053_03 B20140214_SF053_03 TB246640.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].2y6_1.heavy 1124.57 / 766.458 665.0 45.60919952392578 44 14 10 10 10 2.2402889189361903 35.436286920812265 0.0 3 0.9411193524742849 5.0608298417679425 665.0 5.331981981981982 1.0 - - - - - - - 0.0 1 0 BET1 blocked early in transport 1 homolog (S. cerevisiae) 1339 171 B20140214_SF053_03 B20140214_SF053_03 TB246640.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].2b3_1.heavy 1124.57 / 442.315 1478.0 45.60919952392578 44 14 10 10 10 2.2402889189361903 35.436286920812265 0.0 3 0.9411193524742849 5.0608298417679425 1478.0 4.793513513513513 0.0 - - - - - - - 208.94117647058823 2 17 BET1 blocked early in transport 1 homolog (S. cerevisiae) 1341 171 B20140214_SF053_03 B20140214_SF053_03 TB246640.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].2b4_1.heavy 1124.57 / 571.357 2587.0 45.60919952392578 44 14 10 10 10 2.2402889189361903 35.436286920812265 0.0 3 0.9411193524742849 5.0608298417679425 2587.0 16.314414414414415 0.0 - - - - - - - 244.76923076923077 5 13 BET1 blocked early in transport 1 homolog (S. cerevisiae) 1343 171 B20140214_SF053_03 B20140214_SF053_03 TB246640.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].2b6_1.heavy 1124.57 / 817.425 1774.0 45.60919952392578 44 14 10 10 10 2.2402889189361903 35.436286920812265 0.0 3 0.9411193524742849 5.0608298417679425 1774.0 6.328864864864865 0.0 - - - - - - - 199.23076923076923 3 13 BET1 blocked early in transport 1 homolog (S. cerevisiae) 1345 172 B20140214_SF053_03 B20140214_SF053_03 TB464123.[MT7]-GEPLALPLNVSEYC[CAM]VPR.3y7_1.heavy 686.699 / 910.409 108506.0 41.65979862213135 42 16 10 6 10 3.926003249751214 20.01870945529301 0.035999298095703125 3 0.9644311099824675 6.524262928704786 108506.0 141.16237617569124 0.0 - - - - - - - 240.0 217 4 BEX2 brain expressed X-linked 2 1347 172 B20140214_SF053_03 B20140214_SF053_03 TB464123.[MT7]-GEPLALPLNVSEYC[CAM]VPR.3b6_1.heavy 686.699 / 725.431 140171.0 41.65979862213135 42 16 10 6 10 3.926003249751214 20.01870945529301 0.035999298095703125 3 0.9644311099824675 6.524262928704786 140171.0 366.9171204914436 0.0 - - - - - - - 280.0 280 4 BEX2 brain expressed X-linked 2 1349 172 B20140214_SF053_03 B20140214_SF053_03 TB464123.[MT7]-GEPLALPLNVSEYC[CAM]VPR.3b4_1.heavy 686.699 / 541.31 61650.0 41.65979862213135 42 16 10 6 10 3.926003249751214 20.01870945529301 0.035999298095703125 3 0.9644311099824675 6.524262928704786 61650.0 109.46121810905453 0.0 - - - - - - - 765.7142857142857 123 7 BEX2 brain expressed X-linked 2 1351 172 B20140214_SF053_03 B20140214_SF053_03 TB464123.[MT7]-GEPLALPLNVSEYC[CAM]VPR.3b5_1.heavy 686.699 / 612.347 232845.0 41.65979862213135 42 16 10 6 10 3.926003249751214 20.01870945529301 0.035999298095703125 3 0.9644311099824675 6.524262928704786 232845.0 172.71060899319372 0.0 - - - - - - - 800.0 465 3 BEX2 brain expressed X-linked 2 1353 173 B20140214_SF053_03 B20140214_SF053_03 TB463977.[MT7]-LAYTVSR.2b3_1.heavy 477.28 / 492.294 26649.0 27.289499282836914 50 20 10 10 10 14.328051276746047 6.979316172765007 0.0 3 0.9991254231445168 41.728399022761295 26649.0 31.902319085574508 0.0 - - - - - - - 1224.6666666666667 53 9 NNAT neuronatin 1355 173 B20140214_SF053_03 B20140214_SF053_03 TB463977.[MT7]-LAYTVSR.2y5_1.heavy 477.28 / 625.33 61969.0 27.289499282836914 50 20 10 10 10 14.328051276746047 6.979316172765007 0.0 3 0.9991254231445168 41.728399022761295 61969.0 108.61725092250921 0.0 - - - - - - - 1168.0 123 7 NNAT neuronatin 1357 173 B20140214_SF053_03 B20140214_SF053_03 TB463977.[MT7]-LAYTVSR.2b4_1.heavy 477.28 / 593.341 17389.0 27.289499282836914 50 20 10 10 10 14.328051276746047 6.979316172765007 0.0 3 0.9991254231445168 41.728399022761295 17389.0 18.92709150492882 1.0 - - - - - - - 1272.909090909091 34 11 NNAT neuronatin 1359 173 B20140214_SF053_03 B20140214_SF053_03 TB463977.[MT7]-LAYTVSR.2y6_1.heavy 477.28 / 696.367 210208.0 27.289499282836914 50 20 10 10 10 14.328051276746047 6.979316172765007 0.0 3 0.9991254231445168 41.728399022761295 210208.0 366.3030679204305 0.0 - - - - - - - 800.2857142857143 420 7 NNAT neuronatin 1361 174 B20140214_SF053_03 B20140214_SF053_03 TB464232.[MT7]-LFQEDNDIPLYLK[MT7].2b3_1.heavy 948.521 / 533.32 5320.0 42.44419860839844 48 18 10 10 10 3.4931390917048244 28.627545990788203 0.0 3 0.9850497335176616 10.080808053255183 5320.0 12.540942928039701 0.0 - - - - - - - 293.7142857142857 10 14 COX7A1 cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) 1363 174 B20140214_SF053_03 B20140214_SF053_03 TB464232.[MT7]-LFQEDNDIPLYLK[MT7].2b4_1.heavy 948.521 / 662.363 5562.0 42.44419860839844 48 18 10 10 10 3.4931390917048244 28.627545990788203 0.0 3 0.9850497335176616 10.080808053255183 5562.0 20.23457949674959 0.0 - - - - - - - 326.5 11 20 COX7A1 cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) 1365 174 B20140214_SF053_03 B20140214_SF053_03 TB464232.[MT7]-LFQEDNDIPLYLK[MT7].2y3_1.heavy 948.521 / 567.362 7174.0 42.44419860839844 48 18 10 10 10 3.4931390917048244 28.627545990788203 0.0 3 0.9850497335176616 10.080808053255183 7174.0 24.040531914893617 0.0 - - - - - - - 237.11764705882354 14 17 COX7A1 cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) 1367 174 B20140214_SF053_03 B20140214_SF053_03 TB464232.[MT7]-LFQEDNDIPLYLK[MT7].2b7_1.heavy 948.521 / 1006.46 10720.0 42.44419860839844 48 18 10 10 10 3.4931390917048244 28.627545990788203 0.0 3 0.9850497335176616 10.080808053255183 10720.0 30.791927733999614 0.0 - - - - - - - 294.0 21 17 COX7A1 cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) 1369 175 B20140214_SF053_03 B20140214_SF053_03 TB246463.[MT7]-GLSQSALPYRR.2b4_1.heavy 696.397 / 530.305 1040.0 26.628100395202637 33 7 10 6 10 0.8493126245358641 71.62195324830725 0.031200408935546875 3 0.7194236010293583 2.2730843720011427 1040.0 1.5350553505535056 2.0 - - - - - - - 215.77272727272728 2 22 RPS13 ribosomal protein S13 1371 175 B20140214_SF053_03 B20140214_SF053_03 TB246463.[MT7]-GLSQSALPYRR.2b6_1.heavy 696.397 / 688.375 8005.0 26.628100395202637 33 7 10 6 10 0.8493126245358641 71.62195324830725 0.031200408935546875 3 0.7194236010293583 2.2730843720011427 8005.0 8.45141221736652 0.0 - - - - - - - 1379.25 16 8 RPS13 ribosomal protein S13 1373 175 B20140214_SF053_03 B20140214_SF053_03 TB246463.[MT7]-GLSQSALPYRR.2b7_1.heavy 696.397 / 801.459 1719.0 26.628100395202637 33 7 10 6 10 0.8493126245358641 71.62195324830725 0.031200408935546875 3 0.7194236010293583 2.2730843720011427 1719.0 6.2414705035217715 0.0 - - - - - - - 196.7 3 20 RPS13 ribosomal protein S13 1375 175 B20140214_SF053_03 B20140214_SF053_03 TB246463.[MT7]-GLSQSALPYRR.2b10_1.heavy 696.397 / 1217.68 2035.0 26.628100395202637 33 7 10 6 10 0.8493126245358641 71.62195324830725 0.031200408935546875 3 0.7194236010293583 2.2730843720011427 2035.0 42.923634131368935 0.0 - - - - - - - 128.3684210526316 4 19 RPS13 ribosomal protein S13 1377 176 B20140214_SF053_03 B20140214_SF053_03 TB246654.[MT7]-ADGTVNQIEGEATPVNLTEPAK[MT7].4y5_1.heavy 636.336 / 689.395 12548.0 33.47667407989502 41 15 10 6 10 2.5193857522208516 39.692214624874126 0.035099029541015625 3 0.9588551523532185 6.06323215447894 12548.0 19.606628664959022 0.0 - - - - - - - 765.5 25 8 APOD apolipoprotein D 1379 176 B20140214_SF053_03 B20140214_SF053_03 TB246654.[MT7]-ADGTVNQIEGEATPVNLTEPAK[MT7].4b7_1.heavy 636.336 / 830.412 15723.0 33.47667407989502 41 15 10 6 10 2.5193857522208516 39.692214624874126 0.035099029541015625 3 0.9588551523532185 6.06323215447894 15723.0 43.22587586320954 0.0 - - - - - - - 702.0 31 7 APOD apolipoprotein D 1381 176 B20140214_SF053_03 B20140214_SF053_03 TB246654.[MT7]-ADGTVNQIEGEATPVNLTEPAK[MT7].4y3_1.heavy 636.336 / 459.305 58585.0 33.47667407989502 41 15 10 6 10 2.5193857522208516 39.692214624874126 0.035099029541015625 3 0.9588551523532185 6.06323215447894 58585.0 61.10837142300545 0.0 - - - - - - - 1252.4285714285713 117 7 APOD apolipoprotein D 1383 176 B20140214_SF053_03 B20140214_SF053_03 TB246654.[MT7]-ADGTVNQIEGEATPVNLTEPAK[MT7].4b6_1.heavy 636.336 / 702.354 11566.0 33.47667407989502 41 15 10 6 10 2.5193857522208516 39.692214624874126 0.035099029541015625 3 0.9588551523532185 6.06323215447894 11566.0 23.935758394094876 0.0 - - - - - - - 774.875 23 8 APOD apolipoprotein D 1385 177 B20140214_SF053_03 B20140214_SF053_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 180236.0 43.69960021972656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 180236.0 405.52317274540184 0.0 - - - - - - - 324.0 360 5 1387 177 B20140214_SF053_03 B20140214_SF053_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 317096.0 43.69960021972656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 317096.0 286.60619203165123 0.0 - - - - - - - 1195.75 634 4 1389 177 B20140214_SF053_03 B20140214_SF053_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 274692.0 43.69960021972656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 274692.0 396.624451027329 0.0 - - - - - - - 351.0 549 3 1391 178 B20140214_SF053_03 B20140214_SF053_03 TB246669.[MT7]-NQLIEQFPGIEPWLNQIMPK[MT7].4b4_1.heavy 671.618 / 613.379 24918.0 50.08209991455078 37 13 6 10 8 1.830987443649306 50.18339443637005 0.0 4 0.9265534371845504 4.525660560757279 24918.0 40.020372173681054 0.0 - - - - - - - 758.7142857142857 49 7 MCTS1 malignant T cell amplified sequence 1 1393 178 B20140214_SF053_03 B20140214_SF053_03 TB246669.[MT7]-NQLIEQFPGIEPWLNQIMPK[MT7].4b5_1.heavy 671.618 / 742.422 14857.0 50.08209991455078 37 13 6 10 8 1.830987443649306 50.18339443637005 0.0 4 0.9265534371845504 4.525660560757279 14857.0 47.86174849972722 0.0 - - - - - - - 267.3125 29 16 MCTS1 malignant T cell amplified sequence 1 1395 178 B20140214_SF053_03 B20140214_SF053_03 TB246669.[MT7]-NQLIEQFPGIEPWLNQIMPK[MT7].4y3_1.heavy 671.618 / 519.308 25106.0 50.08209991455078 37 13 6 10 8 1.830987443649306 50.18339443637005 0.0 4 0.9265534371845504 4.525660560757279 25106.0 50.49741447642887 0.0 - - - - - - - 713.5454545454545 50 11 MCTS1 malignant T cell amplified sequence 1 1397 178 B20140214_SF053_03 B20140214_SF053_03 TB246669.[MT7]-NQLIEQFPGIEPWLNQIMPK[MT7].4b3_1.heavy 671.618 / 500.295 27786.0 50.08209991455078 37 13 6 10 8 1.830987443649306 50.18339443637005 0.0 4 0.9265534371845504 4.525660560757279 27786.0 35.101994680851064 1.0 - - - - - - - 781.9090909090909 85 11 MCTS1 malignant T cell amplified sequence 1 1399 179 B20140214_SF053_03 B20140214_SF053_03 TB246257.[MT7]-SASSNVR.2y5_1.heavy 432.736 / 562.294 2411.0 15.768400192260742 46 16 10 10 10 3.085276374466832 25.05710232916377 0.0 3 0.9685114381555456 6.936489149071755 2411.0 12.080533084951641 0.0 - - - - - - - 275.60869565217394 4 23 C1orf21 chromosome 1 open reading frame 21 1401 179 B20140214_SF053_03 B20140214_SF053_03 TB246257.[MT7]-SASSNVR.2b6_1.heavy 432.736 / 690.354 2423.0 15.768400192260742 46 16 10 10 10 3.085276374466832 25.05710232916377 0.0 3 0.9685114381555456 6.936489149071755 2423.0 16.57026391225036 0.0 - - - - - - - 235.1304347826087 4 23 C1orf21 chromosome 1 open reading frame 21 1403 179 B20140214_SF053_03 B20140214_SF053_03 TB246257.[MT7]-SASSNVR.2y6_1.heavy 432.736 / 633.331 8057.0 15.768400192260742 46 16 10 10 10 3.085276374466832 25.05710232916377 0.0 3 0.9685114381555456 6.936489149071755 8057.0 107.61447552447551 0.0 - - - - - - - 196.9 16 20 C1orf21 chromosome 1 open reading frame 21 1405 179 B20140214_SF053_03 B20140214_SF053_03 TB246257.[MT7]-SASSNVR.2b5_1.heavy 432.736 / 591.286 4798.0 15.768400192260742 46 16 10 10 10 3.085276374466832 25.05710232916377 0.0 3 0.9685114381555456 6.936489149071755 4798.0 28.795480317006625 0.0 - - - - - - - 274.5652173913044 9 23 C1orf21 chromosome 1 open reading frame 21 1407 180 B20140214_SF053_03 B20140214_SF053_03 TB464245.[MT7]-FQPPAIILIYESEIK[MT7].2y4_1.heavy 1025.1 / 620.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf34 chromosome 3 open reading frame 34 1409 180 B20140214_SF053_03 B20140214_SF053_03 TB464245.[MT7]-FQPPAIILIYESEIK[MT7].2y8_1.heavy 1025.1 / 1138.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf34 chromosome 3 open reading frame 34 1411 180 B20140214_SF053_03 B20140214_SF053_03 TB464245.[MT7]-FQPPAIILIYESEIK[MT7].2y5_1.heavy 1025.1 / 749.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf34 chromosome 3 open reading frame 34 1413 180 B20140214_SF053_03 B20140214_SF053_03 TB464245.[MT7]-FQPPAIILIYESEIK[MT7].2y6_1.heavy 1025.1 / 912.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf34 chromosome 3 open reading frame 34 1415 181 B20140214_SF053_03 B20140214_SF053_03 TB464244.[MT7]-AADTDGDGQVNYEEFVR.3y7_1.heavy 677.312 / 956.447 65506.0 33.98855018615723 43 18 10 5 10 5.078763934273609 19.68983030007724 0.040897369384765625 3 0.9879430992922023 11.228124150663236 65506.0 183.60393460860126 0.0 - - - - - - - 313.7142857142857 131 14 CALML3 calmodulin-like 3 1417 181 B20140214_SF053_03 B20140214_SF053_03 TB464244.[MT7]-AADTDGDGQVNYEEFVR.3y6_1.heavy 677.312 / 842.404 36896.0 33.98855018615723 43 18 10 5 10 5.078763934273609 19.68983030007724 0.040897369384765625 3 0.9879430992922023 11.228124150663236 36896.0 75.06671362315033 0.0 - - - - - - - 739.5555555555555 73 9 CALML3 calmodulin-like 3 1419 181 B20140214_SF053_03 B20140214_SF053_03 TB464244.[MT7]-AADTDGDGQVNYEEFVR.3b5_1.heavy 677.312 / 618.285 54742.0 33.98855018615723 43 18 10 5 10 5.078763934273609 19.68983030007724 0.040897369384765625 3 0.9879430992922023 11.228124150663236 54742.0 73.40767449183885 0.0 - - - - - - - 770.0 109 8 CALML3 calmodulin-like 3 1421 181 B20140214_SF053_03 B20140214_SF053_03 TB464244.[MT7]-AADTDGDGQVNYEEFVR.3b7_1.heavy 677.312 / 790.333 42491.0 33.98855018615723 43 18 10 5 10 5.078763934273609 19.68983030007724 0.040897369384765625 3 0.9879430992922023 11.228124150663236 42491.0 124.8866833998006 0.0 - - - - - - - 768.8571428571429 84 7 CALML3 calmodulin-like 3 1423 182 B20140214_SF053_03 B20140214_SF053_03 TB464243.[MT7]-HLNQGTDEDIYLLGK[MT7].2y4_1.heavy 1002.54 / 574.404 1858.0 33.777099609375 48 18 10 10 10 5.593122619996289 17.879100244018314 0.0 3 0.9895343610999043 12.053134526474759 1858.0 14.39370744860128 0.0 - - - - - - - 151.46666666666667 3 15 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 1425 182 B20140214_SF053_03 B20140214_SF053_03 TB464243.[MT7]-HLNQGTDEDIYLLGK[MT7].2y5_1.heavy 1002.54 / 737.468 1308.0 33.777099609375 48 18 10 10 10 5.593122619996289 17.879100244018314 0.0 3 0.9895343610999043 12.053134526474759 1308.0 11.863335968379447 0.0 - - - - - - - 148.23076923076923 2 13 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 1427 182 B20140214_SF053_03 B20140214_SF053_03 TB464243.[MT7]-HLNQGTDEDIYLLGK[MT7].2b9_1.heavy 1002.54 / 1154.52 1652.0 33.777099609375 48 18 10 10 10 5.593122619996289 17.879100244018314 0.0 3 0.9895343610999043 12.053134526474759 1652.0 17.034869846630084 0.0 - - - - - - - 160.75 3 12 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 1429 182 B20140214_SF053_03 B20140214_SF053_03 TB464243.[MT7]-HLNQGTDEDIYLLGK[MT7].2b4_1.heavy 1002.54 / 637.354 1514.0 33.777099609375 48 18 10 10 10 5.593122619996289 17.879100244018314 0.0 3 0.9895343610999043 12.053134526474759 1514.0 9.373913043478261 1.0 - - - - - - - 167.6875 3 16 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 1431 183 B20140214_SF053_03 B20140214_SF053_03 TB246254.[MT7]-MVQGK[MT7].2b3_1.heavy 425.757 / 503.277 5224.0 19.562000274658203 50 20 10 10 10 5.960386838770696 16.777434536551752 0.0 3 0.995417451512459 18.223963958938665 5224.0 3.771903724191881 0.0 - - - - - - - 1211.4 10 10 RERG RAS-like, estrogen-regulated, growth inhibitor 1433 183 B20140214_SF053_03 B20140214_SF053_03 TB246254.[MT7]-MVQGK[MT7].2y4_1.heavy 425.757 / 575.363 19231.0 19.562000274658203 50 20 10 10 10 5.960386838770696 16.777434536551752 0.0 3 0.995417451512459 18.223963958938665 19231.0 42.66031690140846 0.0 - - - - - - - 648.375 38 8 RERG RAS-like, estrogen-regulated, growth inhibitor 1435 183 B20140214_SF053_03 B20140214_SF053_03 TB246254.[MT7]-MVQGK[MT7].2y3_1.heavy 425.757 / 476.295 10638.0 19.562000274658203 50 20 10 10 10 5.960386838770696 16.777434536551752 0.0 3 0.995417451512459 18.223963958938665 10638.0 14.972377508564227 0.0 - - - - - - - 749.6 21 10 RERG RAS-like, estrogen-regulated, growth inhibitor 1437 184 B20140214_SF053_03 B20140214_SF053_03 TB246393.[MT7]-K[MT7]FPVFK[MT7].2y4_1.heavy 599.39 / 634.404 13169.0 30.70170021057129 50 20 10 10 10 7.6582507360593555 13.057812214105725 0.0 3 0.9946206705172348 16.81912585248228 13169.0 30.19942746677207 0.0 - - - - - - - 610.5 26 10 CSTB cystatin B (stefin B) 1439 184 B20140214_SF053_03 B20140214_SF053_03 TB246393.[MT7]-K[MT7]FPVFK[MT7].2y5_1.heavy 599.39 / 781.473 8658.0 30.70170021057129 50 20 10 10 10 7.6582507360593555 13.057812214105725 0.0 3 0.9946206705172348 16.81912585248228 8658.0 29.04986842105263 0.0 - - - - - - - 249.72 17 25 CSTB cystatin B (stefin B) 1441 184 B20140214_SF053_03 B20140214_SF053_03 TB246393.[MT7]-K[MT7]FPVFK[MT7].2b4_1.heavy 599.39 / 760.496 3281.0 30.70170021057129 50 20 10 10 10 7.6582507360593555 13.057812214105725 0.0 3 0.9946206705172348 16.81912585248228 3281.0 6.717836970474967 1.0 - - - - - - - 671.1818181818181 6 11 CSTB cystatin B (stefin B) 1443 184 B20140214_SF053_03 B20140214_SF053_03 TB246393.[MT7]-K[MT7]FPVFK[MT7].2y3_1.heavy 599.39 / 537.352 2051.0 30.70170021057129 50 20 10 10 10 7.6582507360593555 13.057812214105725 0.0 3 0.9946206705172348 16.81912585248228 2051.0 2.51403712950275 5.0 - - - - - - - 1184.6666666666667 4 12 CSTB cystatin B (stefin B) 1445 185 B20140214_SF053_03 B20140214_SF053_03 TB464242.[MT7]-GLAPDLPEDLYHLIK[MT7].3b6_1.heavy 661.378 / 711.416 40962.0 45.40890121459961 44 14 10 10 10 1.8472514710415775 43.28179335175074 0.0 3 0.9424365145430176 5.118977202054558 40962.0 85.09014492753623 0.0 - - - - - - - 321.9 81 10 RPS13 ribosomal protein S13 1447 185 B20140214_SF053_03 B20140214_SF053_03 TB464242.[MT7]-GLAPDLPEDLYHLIK[MT7].3y3_1.heavy 661.378 / 517.383 50056.0 45.40890121459961 44 14 10 10 10 1.8472514710415775 43.28179335175074 0.0 3 0.9424365145430176 5.118977202054558 50056.0 64.16771566597654 0.0 - - - - - - - 692.0 100 10 RPS13 ribosomal protein S13 1449 185 B20140214_SF053_03 B20140214_SF053_03 TB464242.[MT7]-GLAPDLPEDLYHLIK[MT7].3b5_1.heavy 661.378 / 598.332 41043.0 45.40890121459961 44 14 10 10 10 1.8472514710415775 43.28179335175074 0.0 3 0.9424365145430176 5.118977202054558 41043.0 105.99354389935782 0.0 - - - - - - - 643.5714285714286 82 7 RPS13 ribosomal protein S13 1451 185 B20140214_SF053_03 B20140214_SF053_03 TB464242.[MT7]-GLAPDLPEDLYHLIK[MT7].3y4_1.heavy 661.378 / 654.442 32432.0 45.40890121459961 44 14 10 10 10 1.8472514710415775 43.28179335175074 0.0 3 0.9424365145430176 5.118977202054558 32432.0 80.25409192546584 0.0 - - - - - - - 643.7142857142857 64 7 RPS13 ribosomal protein S13 1453 186 B20140214_SF053_03 B20140214_SF053_03 TB464248.[MT7]-LYPAAVDTIVAIMAEGK[MT7].4y5_1.heavy 513.293 / 679.357 12155.0 51.803001403808594 41 11 10 10 10 1.0872236376572797 60.254071439968044 0.0 3 0.8593645348139752 3.251536341033402 12155.0 -2.1835329341317404 0.0 - - - - - - - 222.66666666666666 24 6 MCTS1 malignant T cell amplified sequence 1 1455 186 B20140214_SF053_03 B20140214_SF053_03 TB464248.[MT7]-LYPAAVDTIVAIMAEGK[MT7].4y4_1.heavy 513.293 / 548.316 20687.0 51.803001403808594 41 11 10 10 10 1.0872236376572797 60.254071439968044 0.0 3 0.8593645348139752 3.251536341033402 20687.0 -4.954970059880239 0.0 - - - - - - - 173.0 41 8 MCTS1 malignant T cell amplified sequence 1 1457 186 B20140214_SF053_03 B20140214_SF053_03 TB464248.[MT7]-LYPAAVDTIVAIMAEGK[MT7].4b4_1.heavy 513.293 / 589.347 9962.0 51.803001403808594 41 11 10 10 10 1.0872236376572797 60.254071439968044 0.0 3 0.8593645348139752 3.251536341033402 9962.0 -15.647120418848168 0.0 - - - - - - - 180.11111111111111 19 9 MCTS1 malignant T cell amplified sequence 1 1459 186 B20140214_SF053_03 B20140214_SF053_03 TB464248.[MT7]-LYPAAVDTIVAIMAEGK[MT7].4b5_1.heavy 513.293 / 660.384 12917.0 51.803001403808594 41 11 10 10 10 1.0872236376572797 60.254071439968044 0.0 3 0.8593645348139752 3.251536341033402 12917.0 -0.6762827225130934 0.0 - - - - - - - 124.0 25 5 MCTS1 malignant T cell amplified sequence 1 1461 187 B20140214_SF053_03 B20140214_SF053_03 TB464246.[MT7]-FQPPAIILIYESEIK[MT7].3b6_1.heavy 683.734 / 798.463 131472.0 49.4567985534668 45 15 10 10 10 1.570183818812195 50.631518281363086 0.0 3 0.9517617040405622 5.596350941621493 131472.0 150.43599374595232 0.0 - - - - - - - 764.25 262 4 C3orf34 chromosome 3 open reading frame 34 1463 187 B20140214_SF053_03 B20140214_SF053_03 TB464246.[MT7]-FQPPAIILIYESEIK[MT7].3b5_1.heavy 683.734 / 685.379 74092.0 49.4567985534668 45 15 10 10 10 1.570183818812195 50.631518281363086 0.0 3 0.9517617040405622 5.596350941621493 74092.0 150.98936679816362 0.0 - - - - - - - 320.25 148 4 C3orf34 chromosome 3 open reading frame 34 1465 187 B20140214_SF053_03 B20140214_SF053_03 TB464246.[MT7]-FQPPAIILIYESEIK[MT7].3y4_1.heavy 683.734 / 620.374 103817.0 49.4567985534668 45 15 10 10 10 1.570183818812195 50.631518281363086 0.0 3 0.9517617040405622 5.596350941621493 103817.0 106.88853322236093 0.0 - - - - - - - 468.5 207 2 C3orf34 chromosome 3 open reading frame 34 1467 187 B20140214_SF053_03 B20140214_SF053_03 TB464246.[MT7]-FQPPAIILIYESEIK[MT7].3b7_1.heavy 683.734 / 911.547 78528.0 49.4567985534668 45 15 10 10 10 1.570183818812195 50.631518281363086 0.0 3 0.9517617040405622 5.596350941621493 78528.0 55.69471195362618 0.0 - - - - - - - 369.5 157 2 C3orf34 chromosome 3 open reading frame 34 1469 188 B20140214_SF053_03 B20140214_SF053_03 TB464247.[MT7]-LYPAAVDTIVAIMAEGK[MT7].3b4_1.heavy 684.055 / 589.347 22125.0 51.803001403808594 39 9 10 10 10 1.234429998705084 63.36544964480915 0.0 3 0.8188539604236976 2.8547151098848538 22125.0 -9.267015706806276 0.0 - - - - - - - 233.22222222222223 44 9 MCTS1 malignant T cell amplified sequence 1 1471 188 B20140214_SF053_03 B20140214_SF053_03 TB464247.[MT7]-LYPAAVDTIVAIMAEGK[MT7].3b5_1.heavy 684.055 / 660.384 53023.0 51.803001403808594 39 9 10 10 10 1.234429998705084 63.36544964480915 0.0 3 0.8188539604236976 2.8547151098848538 53023.0 -13.36714285714288 0.0 - - - - - - - 204.28571428571428 106 7 MCTS1 malignant T cell amplified sequence 1 1473 188 B20140214_SF053_03 B20140214_SF053_03 TB464247.[MT7]-LYPAAVDTIVAIMAEGK[MT7].3y4_1.heavy 684.055 / 548.316 102709.0 51.803001403808594 39 9 10 10 10 1.234429998705084 63.36544964480915 0.0 3 0.8188539604236976 2.8547151098848538 102709.0 -18.450718562874272 0.0 - - - - - - - 262.125 205 8 MCTS1 malignant T cell amplified sequence 1 1475 188 B20140214_SF053_03 B20140214_SF053_03 TB464247.[MT7]-LYPAAVDTIVAIMAEGK[MT7].3b7_1.heavy 684.055 / 874.479 25892.0 51.803001403808594 39 9 10 10 10 1.234429998705084 63.36544964480915 0.0 3 0.8188539604236976 2.8547151098848538 25892.0 -14.48503496503497 0.0 - - - - - - - 174.88888888888889 51 9 MCTS1 malignant T cell amplified sequence 1 1477 189 B20140214_SF053_03 B20140214_SF053_03 TB107891.[MT7]-ALNNLIVENVNQENDEK[MT7].3b6_1.heavy 748.729 / 783.484 119685.0 35.291099548339844 43 13 10 10 10 1.0436780743924987 59.46550968450458 0.0 3 0.9212789025901178 4.369439748738568 119685.0 98.3427921549191 0.0 - - - - - - - 754.4 239 5 BEX2 brain expressed X-linked 2 1479 189 B20140214_SF053_03 B20140214_SF053_03 TB107891.[MT7]-ALNNLIVENVNQENDEK[MT7].3b4_1.heavy 748.729 / 557.316 100093.0 35.291099548339844 43 13 10 10 10 1.0436780743924987 59.46550968450458 0.0 3 0.9212789025901178 4.369439748738568 100093.0 71.83766781561962 0.0 - - - - - - - 779.0 200 2 BEX2 brain expressed X-linked 2 1481 189 B20140214_SF053_03 B20140214_SF053_03 TB107891.[MT7]-ALNNLIVENVNQENDEK[MT7].3b5_1.heavy 748.729 / 670.4 138786.0 35.291099548339844 43 13 10 10 10 1.0436780743924987 59.46550968450458 0.0 3 0.9212789025901178 4.369439748738568 138786.0 58.05294836963884 0.0 - - - - - - - 1312.0 277 1 BEX2 brain expressed X-linked 2 1483 189 B20140214_SF053_03 B20140214_SF053_03 TB107891.[MT7]-ALNNLIVENVNQENDEK[MT7].3y4_1.heavy 748.729 / 649.327 45989.0 35.291099548339844 43 13 10 10 10 1.0436780743924987 59.46550968450458 0.0 3 0.9212789025901178 4.369439748738568 45989.0 57.34063496391516 0.0 - - - - - - - 369.0 91 2 BEX2 brain expressed X-linked 2 1485 190 B20140214_SF053_03 B20140214_SF053_03 TB107892.[MT7]-RFFLHHLIAEIHTAEIR.4y5_1.heavy 562.571 / 589.33 25507.0 36.716400146484375 34 11 10 3 10 1.3400755860409912 58.815453415693085 0.0749969482421875 3 0.859771085668564 3.2563627004379847 25507.0 39.94846323529411 0.0 - - - - - - - 1275.0 51 12 PTHLH parathyroid hormone-like hormone 1487 190 B20140214_SF053_03 B20140214_SF053_03 TB107892.[MT7]-RFFLHHLIAEIHTAEIR.4b4_1.heavy 562.571 / 708.431 11988.0 36.716400146484375 34 11 10 3 10 1.3400755860409912 58.815453415693085 0.0749969482421875 3 0.859771085668564 3.2563627004379847 11988.0 24.681176470588234 0.0 - - - - - - - 722.5 23 10 PTHLH parathyroid hormone-like hormone 1489 190 B20140214_SF053_03 B20140214_SF053_03 TB107892.[MT7]-RFFLHHLIAEIHTAEIR.4b5_1.heavy 562.571 / 845.49 13094.0 36.716400146484375 34 11 10 3 10 1.3400755860409912 58.815453415693085 0.0749969482421875 3 0.859771085668564 3.2563627004379847 13094.0 46.56072352941176 0.0 - - - - - - - 255.0 26 14 PTHLH parathyroid hormone-like hormone 1491 190 B20140214_SF053_03 B20140214_SF053_03 TB107892.[MT7]-RFFLHHLIAEIHTAEIR.4y6_1.heavy 562.571 / 726.389 8162.0 36.716400146484375 34 11 10 3 10 1.3400755860409912 58.815453415693085 0.0749969482421875 3 0.859771085668564 3.2563627004379847 8162.0 2.9545701357466068 1.0 - - - - - - - 658.75 16 8 PTHLH parathyroid hormone-like hormone 1493 191 B20140214_SF053_03 B20140214_SF053_03 TB107890.[MT7]-K[MT7]VPQYPC[CAM]LWVNVSAAGR.3y7_1.heavy 745.077 / 674.358 23806.0 37.53310012817383 45 15 10 10 10 4.499487479914825 22.224753473898545 0.0 3 0.9528434238880924 5.6606934218391824 23806.0 24.73430844165202 0.0 - - - - - - - 1190.0 47 11 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 1495 191 B20140214_SF053_03 B20140214_SF053_03 TB107890.[MT7]-K[MT7]VPQYPC[CAM]LWVNVSAAGR.3b4_1.heavy 745.077 / 741.486 7057.0 37.53310012817383 45 15 10 10 10 4.499487479914825 22.224753473898545 0.0 3 0.9528434238880924 5.6606934218391824 7057.0 4.0200866873065015 1.0 - - - - - - - 727.2222222222222 16 9 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 1497 191 B20140214_SF053_03 B20140214_SF053_03 TB107890.[MT7]-K[MT7]VPQYPC[CAM]LWVNVSAAGR.3y8_1.heavy 745.077 / 773.426 18535.0 37.53310012817383 45 15 10 10 10 4.499487479914825 22.224753473898545 0.0 3 0.9528434238880924 5.6606934218391824 18535.0 25.21175350140056 0.0 - - - - - - - 303.57142857142856 37 7 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 1499 191 B20140214_SF053_03 B20140214_SF053_03 TB107890.[MT7]-K[MT7]VPQYPC[CAM]LWVNVSAAGR.3y9_1.heavy 745.077 / 959.506 14624.0 37.53310012817383 45 15 10 10 10 4.499487479914825 22.224753473898545 0.0 3 0.9528434238880924 5.6606934218391824 14624.0 47.85202196078431 0.0 - - - - - - - 276.25 29 8 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 1501 192 B20140214_SF053_03 B20140214_SF053_03 TB246592.[MT7]-ANMHISESQQEFFR.3y7_1.heavy 623.301 / 941.448 8059.0 31.88634967803955 47 20 10 7 10 12.558220808285474 7.962911428824655 0.026599884033203125 3 0.9981943467372676 29.03887724529792 8059.0 33.492662199306075 0.0 - - - - - - - 232.96153846153845 16 26 C1orf21 chromosome 1 open reading frame 21 1503 192 B20140214_SF053_03 B20140214_SF053_03 TB246592.[MT7]-ANMHISESQQEFFR.3b3_1.heavy 623.301 / 461.23 22596.0 31.88634967803955 47 20 10 7 10 12.558220808285474 7.962911428824655 0.026599884033203125 3 0.9981943467372676 29.03887724529792 22596.0 13.93026375858717 0.0 - - - - - - - 816.25 45 4 C1orf21 chromosome 1 open reading frame 21 1505 192 B20140214_SF053_03 B20140214_SF053_03 TB246592.[MT7]-ANMHISESQQEFFR.3y5_1.heavy 623.301 / 726.357 8427.0 31.88634967803955 47 20 10 7 10 12.558220808285474 7.962911428824655 0.026599884033203125 3 0.9981943467372676 29.03887724529792 8427.0 21.346845966505306 0.0 - - - - - - - 721.6 16 10 C1orf21 chromosome 1 open reading frame 21 1507 192 B20140214_SF053_03 B20140214_SF053_03 TB246592.[MT7]-ANMHISESQQEFFR.3y9_1.heavy 623.301 / 1157.52 9534.0 31.88634967803955 47 20 10 7 10 12.558220808285474 7.962911428824655 0.026599884033203125 3 0.9981943467372676 29.03887724529792 9534.0 56.49476100973946 0.0 - - - - - - - 194.9 19 20 C1orf21 chromosome 1 open reading frame 21 1509 193 B20140214_SF053_03 B20140214_SF053_03 TB246665.[MT7]-EEVDQMFAAFPPDVTGNLDYK[MT7].4b4_1.heavy 669.329 / 617.29 4107.0 44.06930160522461 40 14 8 10 8 1.4539044639064926 54.617512104029686 0.0 4 0.9386842713037361 4.958290376215508 4107.0 5.230577030812325 3.0 - - - - - - - 1709.2222222222222 8 9 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1511 193 B20140214_SF053_03 B20140214_SF053_03 TB246665.[MT7]-EEVDQMFAAFPPDVTGNLDYK[MT7].4b5_1.heavy 669.329 / 745.349 9664.0 44.06930160522461 40 14 8 10 8 1.4539044639064926 54.617512104029686 0.0 4 0.9386842713037361 4.958290376215508 9664.0 17.16587699406464 0.0 - - - - - - - 1718.0 19 3 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1513 193 B20140214_SF053_03 B20140214_SF053_03 TB246665.[MT7]-EEVDQMFAAFPPDVTGNLDYK[MT7].4b3_1.heavy 669.329 / 502.263 2255.0 44.06930160522461 40 14 8 10 8 1.4539044639064926 54.617512104029686 0.0 4 0.9386842713037361 4.958290376215508 2255.0 3.463939824591881 2.0 - - - - - - - 1225.7777777777778 4 9 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1515 193 B20140214_SF053_03 B20140214_SF053_03 TB246665.[MT7]-EEVDQMFAAFPPDVTGNLDYK[MT7].4b6_1.heavy 669.329 / 876.389 7328.0 44.06930160522461 40 14 8 10 8 1.4539044639064926 54.617512104029686 0.0 4 0.9386842713037361 4.958290376215508 7328.0 13.919724018973696 1.0 - - - - - - - 845.5 24 2 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1517 194 B20140214_SF053_03 B20140214_SF053_03 TB246664.[MT7]-C[CAM]FVSFPLNTGDLDC[CAM]ETC[CAM]TITR.3b4_1.heavy 884.074 / 638.309 6936.0 42.18632411956787 44 18 10 6 10 5.365379317012311 14.863493693953341 0.036701202392578125 3 0.9848932006819994 10.028313124071044 6936.0 5.2692093023255815 0.0 - - - - - - - 368.7142857142857 13 7 TMEM126A transmembrane protein 126A 1519 194 B20140214_SF053_03 B20140214_SF053_03 TB246664.[MT7]-C[CAM]FVSFPLNTGDLDC[CAM]ETC[CAM]TITR.3b3_1.heavy 884.074 / 551.277 8872.0 42.18632411956787 44 18 10 6 10 5.365379317012311 14.863493693953341 0.036701202392578125 3 0.9848932006819994 10.028313124071044 8872.0 7.03894214876033 1.0 - - - - - - - 736.25 17 8 TMEM126A transmembrane protein 126A 1521 194 B20140214_SF053_03 B20140214_SF053_03 TB246664.[MT7]-C[CAM]FVSFPLNTGDLDC[CAM]ETC[CAM]TITR.3y8_1.heavy 884.074 / 1040.45 3871.0 42.18632411956787 44 18 10 6 10 5.365379317012311 14.863493693953341 0.036701202392578125 3 0.9848932006819994 10.028313124071044 3871.0 0.0 2.0 - - - - - - - 679.8571428571429 8 7 TMEM126A transmembrane protein 126A 1523 194 B20140214_SF053_03 B20140214_SF053_03 TB246664.[MT7]-C[CAM]FVSFPLNTGDLDC[CAM]ETC[CAM]TITR.3y9_1.heavy 884.074 / 1155.48 5969.0 42.18632411956787 44 18 10 6 10 5.365379317012311 14.863493693953341 0.036701202392578125 3 0.9848932006819994 10.028313124071044 5969.0 6.652902489301743 1.0 - - - - - - - 293.3636363636364 11 11 TMEM126A transmembrane protein 126A 1525 195 B20140214_SF053_03 B20140214_SF053_03 TB107894.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].3y6_1.heavy 750.052 / 766.458 26812.0 45.60919952392578 44 14 10 10 10 1.7120780999469083 46.300526900057335 0.0 3 0.9303915980418355 4.650284738814145 26812.0 52.123197422732304 0.0 - - - - - - - 727.5555555555555 53 9 BET1 blocked early in transport 1 homolog (S. cerevisiae) 1527 195 B20140214_SF053_03 B20140214_SF053_03 TB107894.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].3b6_1.heavy 750.052 / 817.425 30876.0 45.60919952392578 44 14 10 10 10 1.7120780999469083 46.300526900057335 0.0 3 0.9303915980418355 4.650284738814145 30876.0 24.445893541752366 0.0 - - - - - - - 367.0 61 4 BET1 blocked early in transport 1 homolog (S. cerevisiae) 1529 195 B20140214_SF053_03 B20140214_SF053_03 TB107894.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].3b4_1.heavy 750.052 / 571.357 47075.0 45.60919952392578 44 14 10 10 10 1.7120780999469083 46.300526900057335 0.0 3 0.9303915980418355 4.650284738814145 47075.0 112.95935688238553 0.0 - - - - - - - 414.0 94 3 BET1 blocked early in transport 1 homolog (S. cerevisiae) 1531 195 B20140214_SF053_03 B20140214_SF053_03 TB107894.[MT7]-LLAEMDSQFDSTTGFLGK[MT7].3y5_1.heavy 750.052 / 665.41 45269.0 45.60919952392578 44 14 10 10 10 1.7120780999469083 46.300526900057335 0.0 3 0.9303915980418355 4.650284738814145 45269.0 70.55750764625496 0.0 - - - - - - - 745.0 90 5 BET1 blocked early in transport 1 homolog (S. cerevisiae) 1533 196 B20140214_SF053_03 B20140214_SF053_03 TB107899.[MT7]-EASGPINFTVFLTMFGEK[MT7].3y6_1.heavy 759.401 / 856.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 1535 196 B20140214_SF053_03 B20140214_SF053_03 TB107899.[MT7]-EASGPINFTVFLTMFGEK[MT7].3b6_1.heavy 759.401 / 699.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 1537 196 B20140214_SF053_03 B20140214_SF053_03 TB107899.[MT7]-EASGPINFTVFLTMFGEK[MT7].3y4_1.heavy 759.401 / 624.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 1539 196 B20140214_SF053_03 B20140214_SF053_03 TB107899.[MT7]-EASGPINFTVFLTMFGEK[MT7].3b7_1.heavy 759.401 / 813.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 1541 197 B20140214_SF053_03 B20140214_SF053_03 TB246599.[MT7]-GAQGGDYFYSFGGC[CAM]HR.3y7_1.heavy 641.617 / 820.352 58341.0 33.33072566986084 42 16 10 6 10 3.0845312930797983 32.419836434907246 0.038097381591796875 3 0.9618603721256567 6.299180755274 58341.0 43.85107843137255 0.0 - - - - - - - 340.0 116 8 SRXN1 sulfiredoxin 1 1543 197 B20140214_SF053_03 B20140214_SF053_03 TB246599.[MT7]-GAQGGDYFYSFGGC[CAM]HR.3b6_1.heavy 641.617 / 630.296 87171.0 33.33072566986084 42 16 10 6 10 3.0845312930797983 32.419836434907246 0.038097381591796875 3 0.9618603721256567 6.299180755274 87171.0 69.85760638698501 0.0 - - - - - - - 714.0 174 2 SRXN1 sulfiredoxin 1 1545 197 B20140214_SF053_03 B20140214_SF053_03 TB246599.[MT7]-GAQGGDYFYSFGGC[CAM]HR.3y5_1.heavy 641.617 / 586.251 58817.0 33.33072566986084 42 16 10 6 10 3.0845312930797983 32.419836434907246 0.038097381591796875 3 0.9618603721256567 6.299180755274 58817.0 52.13521580882353 0.0 - - - - - - - 476.0 117 1 SRXN1 sulfiredoxin 1 1547 197 B20140214_SF053_03 B20140214_SF053_03 TB246599.[MT7]-GAQGGDYFYSFGGC[CAM]HR.3b7_1.heavy 641.617 / 793.36 58545.0 33.33072566986084 42 16 10 6 10 3.0845312930797983 32.419836434907246 0.038097381591796875 3 0.9618603721256567 6.299180755274 58545.0 100.82749999999999 0.0 - - - - - - - 348.5 117 8 SRXN1 sulfiredoxin 1 1549 198 B20140214_SF053_03 B20140214_SF053_03 TB107897.[MT7]-IAAGLPMAGIPFLTTDLTYR.2y4_1.heavy 1133.13 / 552.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 1551 198 B20140214_SF053_03 B20140214_SF053_03 TB107897.[MT7]-IAAGLPMAGIPFLTTDLTYR.2b4_1.heavy 1133.13 / 457.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 1553 198 B20140214_SF053_03 B20140214_SF053_03 TB107897.[MT7]-IAAGLPMAGIPFLTTDLTYR.2y10_1.heavy 1133.13 / 1226.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 1555 198 B20140214_SF053_03 B20140214_SF053_03 TB107897.[MT7]-IAAGLPMAGIPFLTTDLTYR.2b5_1.heavy 1133.13 / 570.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM126A transmembrane protein 126A 1557 199 B20140214_SF053_03 B20140214_SF053_03 TB246661.[MT7]-LAGDMGELALEGAEGQVEGSAPDK[MT7].4b7_1.heavy 658.831 / 818.383 108080.0 39.847999572753906 40 10 10 10 10 0.7750363515353197 77.78149314953365 0.0 3 0.8354694519052689 2.9998277277165384 108080.0 109.17829687780906 0.0 - - - - - - - 684.0 216 9 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 1559 199 B20140214_SF053_03 B20140214_SF053_03 TB246661.[MT7]-LAGDMGELALEGAEGQVEGSAPDK[MT7].4b4_1.heavy 658.831 / 501.279 37403.0 39.847999572753906 40 10 10 10 10 0.7750363515353197 77.78149314953365 0.0 3 0.8354694519052689 2.9998277277165384 37403.0 42.08744381413999 0.0 - - - - - - - 1274.75 74 8 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 1561 199 B20140214_SF053_03 B20140214_SF053_03 TB246661.[MT7]-LAGDMGELALEGAEGQVEGSAPDK[MT7].4y3_1.heavy 658.831 / 503.295 160217.0 39.847999572753906 40 10 10 10 10 0.7750363515353197 77.78149314953365 0.0 3 0.8354694519052689 2.9998277277165384 160217.0 126.78770525774911 0.0 - - - - - - - 783.0 320 3 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 1563 199 B20140214_SF053_03 B20140214_SF053_03 TB246661.[MT7]-LAGDMGELALEGAEGQVEGSAPDK[MT7].4b6_1.heavy 658.831 / 689.341 22426.0 39.847999572753906 40 10 10 10 10 0.7750363515353197 77.78149314953365 0.0 3 0.8354694519052689 2.9998277277165384 22426.0 19.78764705882353 0.0 - - - - - - - 717.4285714285714 44 7 PKIG protein kinase (cAMP-dependent, catalytic) inhibitor gamma 1565 200 B20140214_SF053_03 B20140214_SF053_03 TB246660.[MT7]-AFQHWELIQEDILDTGNDK[MT7].4y4_1.heavy 640.828 / 577.306 24689.0 41.900299072265625 37 7 10 10 10 0.4674700559923609 98.52211684482236 0.0 3 0.7170460763296923 2.2630135167632393 24689.0 57.47163911845729 0.0 - - - - - - - 718.8181818181819 49 11 NTS neurotensin 1567 200 B20140214_SF053_03 B20140214_SF053_03 TB246660.[MT7]-AFQHWELIQEDILDTGNDK[MT7].4b7_2.heavy 640.828 / 528.773 34291.0 41.900299072265625 37 7 10 10 10 0.4674700559923609 98.52211684482236 0.0 3 0.7170460763296923 2.2630135167632393 34291.0 50.895142892918614 0.0 - - - - - - - 242.14285714285714 68 7 NTS neurotensin 1569 200 B20140214_SF053_03 B20140214_SF053_03 TB246660.[MT7]-AFQHWELIQEDILDTGNDK[MT7].4b4_1.heavy 640.828 / 628.332 9279.0 41.900299072265625 37 7 10 10 10 0.4674700559923609 98.52211684482236 0.0 3 0.7170460763296923 2.2630135167632393 9279.0 11.972219350975742 1.0 - - - - - - - 782.6 18 10 NTS neurotensin 1571 200 B20140214_SF053_03 B20140214_SF053_03 TB246660.[MT7]-AFQHWELIQEDILDTGNDK[MT7].4b6_1.heavy 640.828 / 943.454 5729.0 41.900299072265625 37 7 10 10 10 0.4674700559923609 98.52211684482236 0.0 3 0.7170460763296923 2.2630135167632393 5729.0 42.15334700755934 0.0 - - - - - - - 219.0 11 14 NTS neurotensin 1573 201 B20140214_SF053_03 B20140214_SF053_03 TB246679.[MT7]-DSLYNEGILIVWDPSVYHSDIPK[MT7].4b8_1.heavy 737.888 / 1036.51 24402.0 46.16360092163086 50 20 10 10 10 5.6919907160230325 17.56854587244821 0.0 3 0.9951252398166465 17.668885680686138 24402.0 87.41014925373135 0.0 - - - - - - - 251.25 48 12 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 1575 201 B20140214_SF053_03 B20140214_SF053_03 TB246679.[MT7]-DSLYNEGILIVWDPSVYHSDIPK[MT7].4b7_1.heavy 737.888 / 923.423 44714.0 46.16360092163086 50 20 10 10 10 5.6919907160230325 17.56854587244821 0.0 3 0.9951252398166465 17.668885680686138 44714.0 110.67271144278607 0.0 - - - - - - - 678.375 89 8 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 1577 201 B20140214_SF053_03 B20140214_SF053_03 TB246679.[MT7]-DSLYNEGILIVWDPSVYHSDIPK[MT7].4b4_1.heavy 737.888 / 623.316 16223.0 46.16360092163086 50 20 10 10 10 5.6919907160230325 17.56854587244821 0.0 3 0.9951252398166465 17.668885680686138 16223.0 40.06222523744911 0.0 - - - - - - - 689.1428571428571 32 7 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 1579 201 B20140214_SF053_03 B20140214_SF053_03 TB246679.[MT7]-DSLYNEGILIVWDPSVYHSDIPK[MT7].4b5_1.heavy 737.888 / 737.359 N/A 46.16360092163086 50 20 10 10 10 5.6919907160230325 17.56854587244821 0.0 3 0.9951252398166465 17.668885680686138 16558.0 5.324611903235419 1.0 - - - - - - - 1944.0 45 1 ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 1581 202 B20140214_SF053_03 B20140214_SF053_03 TB246677.[MT7]-IAAVHNVPLSVLIRPLPSVLDPAK[MT7].3b6_1.heavy 936.575 / 750.438 3870.0 43.4921989440918 41 11 10 10 10 0.9414417845170864 64.71286785490116 0.0 3 0.8667642783319246 3.3427797449762235 3870.0 11.716115702479339 0.0 - - - - - - - 257.125 7 16 SRXN1 sulfiredoxin 1 1583 202 B20140214_SF053_03 B20140214_SF053_03 TB246677.[MT7]-IAAVHNVPLSVLIRPLPSVLDPAK[MT7].3y17_2.heavy 936.575 / 980.11 5079.0 43.4921989440918 41 11 10 10 10 0.9414417845170864 64.71286785490116 0.0 3 0.8667642783319246 3.3427797449762235 5079.0 8.91507358177071 0.0 - - - - - - - 219.14285714285714 10 7 SRXN1 sulfiredoxin 1 1585 202 B20140214_SF053_03 B20140214_SF053_03 TB246677.[MT7]-IAAVHNVPLSVLIRPLPSVLDPAK[MT7].3y20_2.heavy 936.575 / 1155.19 3951.0 43.4921989440918 41 11 10 10 10 0.9414417845170864 64.71286785490116 0.0 3 0.8667642783319246 3.3427797449762235 3951.0 73.07304968944099 0.0 - - - - - - - 169.5 7 10 SRXN1 sulfiredoxin 1 1587 202 B20140214_SF053_03 B20140214_SF053_03 TB246677.[MT7]-IAAVHNVPLSVLIRPLPSVLDPAK[MT7].3y10_1.heavy 936.575 / 1180.71 484.0 43.4921989440918 41 11 10 10 10 0.9414417845170864 64.71286785490116 0.0 3 0.8667642783319246 3.3427797449762235 484.0 0.0 2.0 - - - - - - - 0.0 0 0 SRXN1 sulfiredoxin 1 1589 203 B20140214_SF053_03 B20140214_SF053_03 TB246281.[MT7]-VETYK[MT7].2b3_1.heavy 464.273 / 474.268 2928.0 21.654199600219727 46 18 10 10 8 4.688412523223818 21.3291811470631 0.0 4 0.9815079992488837 9.061474866802952 2928.0 4.282085397096498 3.0 - - - - - - - 1175.0 10 9 PTHLH parathyroid hormone-like hormone 1591 203 B20140214_SF053_03 B20140214_SF053_03 TB246281.[MT7]-VETYK[MT7].2y4_1.heavy 464.273 / 684.369 31142.0 21.654199600219727 46 18 10 10 8 4.688412523223818 21.3291811470631 0.0 4 0.9815079992488837 9.061474866802952 31142.0 99.4160222421448 1.0 - - - - - - - 658.7777777777778 63 9 PTHLH parathyroid hormone-like hormone 1593 203 B20140214_SF053_03 B20140214_SF053_03 TB246281.[MT7]-VETYK[MT7].2b4_1.heavy 464.273 / 637.331 3733.0 21.654199600219727 46 18 10 10 8 4.688412523223818 21.3291811470631 0.0 4 0.9815079992488837 9.061474866802952 3733.0 3.0877612179828344 1.0 - - - - - - - 762.25 7 12 PTHLH parathyroid hormone-like hormone 1595 203 B20140214_SF053_03 B20140214_SF053_03 TB246281.[MT7]-VETYK[MT7].2y3_1.heavy 464.273 / 555.326 13540.0 21.654199600219727 46 18 10 10 8 4.688412523223818 21.3291811470631 0.0 4 0.9815079992488837 9.061474866802952 13540.0 26.376133502578472 0.0 - - - - - - - 781.6363636363636 27 11 PTHLH parathyroid hormone-like hormone 1597 204 B20140214_SF053_03 B20140214_SF053_03 TB107880.[MT7]-EAFTIMDQNRDGFIDK[MT7].3y15_2.heavy 730.036 / 957.979 9956.0 35.984500885009766 42 12 10 10 10 1.3337298207384738 43.649810298429784 0.0 3 0.8954663609509746 3.7833495675389526 9956.0 32.90106712564544 0.0 - - - - - - - 274.9375 19 16 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1599 204 B20140214_SF053_03 B20140214_SF053_03 TB107880.[MT7]-EAFTIMDQNRDGFIDK[MT7].3y6_1.heavy 730.036 / 838.443 1576.0 35.984500885009766 42 12 10 10 10 1.3337298207384738 43.649810298429784 0.0 3 0.8954663609509746 3.7833495675389526 1576.0 4.208916509836434 1.0 - - - - - - - 223.0625 3 16 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1601 204 B20140214_SF053_03 B20140214_SF053_03 TB107880.[MT7]-EAFTIMDQNRDGFIDK[MT7].3y9_2.heavy 730.036 / 618.826 13192.0 35.984500885009766 42 12 10 10 10 1.3337298207384738 43.649810298429784 0.0 3 0.8954663609509746 3.7833495675389526 13192.0 44.82101204819277 0.0 - - - - - - - 723.2857142857143 26 7 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1603 204 B20140214_SF053_03 B20140214_SF053_03 TB107880.[MT7]-EAFTIMDQNRDGFIDK[MT7].3y5_1.heavy 730.036 / 723.416 9708.0 35.984500885009766 42 12 10 10 10 1.3337298207384738 43.649810298429784 0.0 3 0.8954663609509746 3.7833495675389526 9708.0 19.674451848726708 0.0 - - - - - - - 674.375 19 8 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1605 205 B20140214_SF053_03 B20140214_SF053_03 TB107881.[MT7]-EAFTIMDQNRDGFIDK[MT7].4y10_2.heavy 547.779 / 676.34 62841.0 35.984500885009766 47 17 10 10 10 2.48186923791466 26.937077354061618 0.0 3 0.9709135233002507 7.218691423266348 62841.0 24.09220137493452 0.0 - - - - - - - 415.0 125 1 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1607 205 B20140214_SF053_03 B20140214_SF053_03 TB107881.[MT7]-EAFTIMDQNRDGFIDK[MT7].4y11_2.heavy 547.779 / 741.86 53792.0 35.984500885009766 47 17 10 10 10 2.48186923791466 26.937077354061618 0.0 3 0.9709135233002507 7.218691423266348 53792.0 118.60860733255603 0.0 - - - - - - - 802.3333333333334 107 9 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1609 205 B20140214_SF053_03 B20140214_SF053_03 TB107881.[MT7]-EAFTIMDQNRDGFIDK[MT7].4b4_1.heavy 547.779 / 593.305 48148.0 35.984500885009766 47 17 10 10 10 2.48186923791466 26.937077354061618 0.0 3 0.9709135233002507 7.218691423266348 48148.0 47.035640995110775 0.0 - - - - - - - 853.7142857142857 96 7 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1611 205 B20140214_SF053_03 B20140214_SF053_03 TB107881.[MT7]-EAFTIMDQNRDGFIDK[MT7].4y3_1.heavy 547.779 / 519.326 24821.0 35.984500885009766 47 17 10 10 10 2.48186923791466 26.937077354061618 0.0 3 0.9709135233002507 7.218691423266348 24821.0 17.439443430286804 0.0 - - - - - - - 332.0 49 1 MYL2 myosin, light chain 2, regulatory, cardiac, slow 1613 206 B20140214_SF053_03 B20140214_SF053_03 TB246487.[MT7]-EILK[MT7]EQENR.3b6_2.heavy 482.943 / 515.313 121259.0 22.49329948425293 43 13 10 10 10 1.0080139698992707 59.18388982327359 0.0 3 0.9012782313793859 3.8950816210154606 121259.0 118.63751028642591 0.0 - - - - - - - 1277.25 242 8 PARK7 Parkinson disease (autosomal recessive, early onset) 7 1615 206 B20140214_SF053_03 B20140214_SF053_03 TB246487.[MT7]-EILK[MT7]EQENR.3y8_2.heavy 482.943 / 587.339 315911.0 22.49329948425293 43 13 10 10 10 1.0080139698992707 59.18388982327359 0.0 3 0.9012782313793859 3.8950816210154606 315911.0 420.9706672349175 0.0 - - - - - - - 787.8 631 10 PARK7 Parkinson disease (autosomal recessive, early onset) 7 1617 206 B20140214_SF053_03 B20140214_SF053_03 TB246487.[MT7]-EILK[MT7]EQENR.3b7_1.heavy 482.943 / 1158.66 N/A 22.49329948425293 43 13 10 10 10 1.0080139698992707 59.18388982327359 0.0 3 0.9012782313793859 3.8950816210154606 34.0 1.97 8.0 - - - - - - - 0.0 0 0 PARK7 Parkinson disease (autosomal recessive, early onset) 7 1619 206 B20140214_SF053_03 B20140214_SF053_03 TB246487.[MT7]-EILK[MT7]EQENR.3b4_1.heavy 482.943 / 772.517 171874.0 22.49329948425293 43 13 10 10 10 1.0080139698992707 59.18388982327359 0.0 3 0.9012782313793859 3.8950816210154606 171874.0 636.5138795920668 0.0 - - - - - - - 763.875 343 8 PARK7 Parkinson disease (autosomal recessive, early onset) 7 1621 207 B20140214_SF053_03 B20140214_SF053_03 TB107886.[MT7]-IFYPEIEEVQALDDTER.3y7_1.heavy 737.703 / 819.384 23156.0 44.734975814819336 43 17 10 6 10 2.825185550820743 35.395905225038774 0.03730010986328125 3 0.9728912125534963 7.478617321247962 23156.0 52.80462302634249 0.0 - - - - - - - 717.625 46 8 DUT deoxyuridine triphosphatase 1623 207 B20140214_SF053_03 B20140214_SF053_03 TB107886.[MT7]-IFYPEIEEVQALDDTER.3b5_1.heavy 737.703 / 794.42 24039.0 44.734975814819336 43 17 10 6 10 2.825185550820743 35.395905225038774 0.03730010986328125 3 0.9728912125534963 7.478617321247962 24039.0 79.2336327063012 0.0 - - - - - - - 267.75 48 4 DUT deoxyuridine triphosphatase 1625 207 B20140214_SF053_03 B20140214_SF053_03 TB107886.[MT7]-IFYPEIEEVQALDDTER.3y4_1.heavy 737.703 / 520.236 10348.0 44.734975814819336 43 17 10 6 10 2.825185550820743 35.395905225038774 0.03730010986328125 3 0.9728912125534963 7.478617321247962 10348.0 29.77227310202679 0.0 - - - - - - - 673.0 20 9 DUT deoxyuridine triphosphatase 1627 207 B20140214_SF053_03 B20140214_SF053_03 TB107886.[MT7]-IFYPEIEEVQALDDTER.3b3_1.heavy 737.703 / 568.325 32936.0 44.734975814819336 43 17 10 6 10 2.825185550820743 35.395905225038774 0.03730010986328125 3 0.9728912125534963 7.478617321247962 32936.0 51.93553090332805 1.0 - - - - - - - 273.3333333333333 65 3 DUT deoxyuridine triphosphatase 1629 208 B20140214_SF053_03 B20140214_SF053_03 TB246587.[MT7]-VGIGFHLQIYPDGK[MT7].3b6_1.heavy 611.348 / 755.432 3584.0 38.207149505615234 39 13 10 6 10 1.1781610950274612 49.3176301968585 0.0337982177734375 3 0.9182008338876999 4.285308543665705 3584.0 9.271492842535787 2.0 - - - - - - - 640.1428571428571 7 7 FGF5 fibroblast growth factor 5 1631 208 B20140214_SF053_03 B20140214_SF053_03 TB246587.[MT7]-VGIGFHLQIYPDGK[MT7].3b5_1.heavy 611.348 / 618.373 11242.0 38.207149505615234 39 13 10 6 10 1.1781610950274612 49.3176301968585 0.0337982177734375 3 0.9182008338876999 4.285308543665705 11242.0 17.54977543484049 0.0 - - - - - - - 1242.375 22 8 FGF5 fibroblast growth factor 5 1633 208 B20140214_SF053_03 B20140214_SF053_03 TB246587.[MT7]-VGIGFHLQIYPDGK[MT7].3y4_1.heavy 611.348 / 560.316 23788.0 38.207149505615234 39 13 10 6 10 1.1781610950274612 49.3176301968585 0.0337982177734375 3 0.9182008338876999 4.285308543665705 23788.0 33.07626679082479 0.0 - - - - - - - 869.1666666666666 47 12 FGF5 fibroblast growth factor 5 1635 208 B20140214_SF053_03 B20140214_SF053_03 TB246587.[MT7]-VGIGFHLQIYPDGK[MT7].3y5_1.heavy 611.348 / 723.379 13442.0 38.207149505615234 39 13 10 6 10 1.1781610950274612 49.3176301968585 0.0337982177734375 3 0.9182008338876999 4.285308543665705 13442.0 21.023388951321127 0.0 - - - - - - - 782.2 26 10 FGF5 fibroblast growth factor 5 1637 209 B20140214_SF053_03 B20140214_SF053_03 TB107887.[MT7]-IFYPEIEEVQALDDTER.2b3_1.heavy 1106.05 / 568.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 1639 209 B20140214_SF053_03 B20140214_SF053_03 TB107887.[MT7]-IFYPEIEEVQALDDTER.2y4_1.heavy 1106.05 / 520.236 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 1641 209 B20140214_SF053_03 B20140214_SF053_03 TB107887.[MT7]-IFYPEIEEVQALDDTER.2y9_1.heavy 1106.05 / 1046.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 1643 209 B20140214_SF053_03 B20140214_SF053_03 TB107887.[MT7]-IFYPEIEEVQALDDTER.2y10_1.heavy 1106.05 / 1175.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 1645 210 B20140214_SF053_03 B20140214_SF053_03 TB107889.[MT7]-TVHC[CAM]QPAIFVASLAAVEK[MT7].3y3_1.heavy 743.748 / 519.326 17541.0 40.07440185546875 42 12 10 10 10 4.258365114425624 23.48319068772199 0.0 3 0.8906620942866751 3.6977549203974367 17541.0 35.368641506650064 0.0 - - - - - - - 299.0 35 10 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 1647 210 B20140214_SF053_03 B20140214_SF053_03 TB107889.[MT7]-TVHC[CAM]QPAIFVASLAAVEK[MT7].3b5_1.heavy 743.748 / 770.374 11397.0 40.07440185546875 42 12 10 10 10 4.258365114425624 23.48319068772199 0.0 3 0.8906620942866751 3.6977549203974367 11397.0 20.13448897807994 0.0 - - - - - - - 707.125 22 8 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 1649 210 B20140214_SF053_03 B20140214_SF053_03 TB107889.[MT7]-TVHC[CAM]QPAIFVASLAAVEK[MT7].3y4_1.heavy 743.748 / 590.363 27645.0 40.07440185546875 42 12 10 10 10 4.258365114425624 23.48319068772199 0.0 3 0.8906620942866751 3.6977549203974367 27645.0 48.91601942081964 0.0 - - - - - - - 683.3636363636364 55 11 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 1651 210 B20140214_SF053_03 B20140214_SF053_03 TB107889.[MT7]-TVHC[CAM]QPAIFVASLAAVEK[MT7].3y5_1.heavy 743.748 / 661.4 31525.0 40.07440185546875 42 12 10 10 10 4.258365114425624 23.48319068772199 0.0 3 0.8906620942866751 3.6977549203974367 31525.0 37.07176128093158 0.0 - - - - - - - 660.25 63 12 MCAT malonyl CoA:ACP acyltransferase (mitochondrial) 1653 211 B20140214_SF053_03 B20140214_SF053_03 TB246481.[MT7]-REYDQC[CAM]FNR.3b4_1.heavy 477.89 / 708.343 52791.0 22.238900184631348 40 13 10 7 10 1.3910532899056898 49.2017626908581 0.028600692749023438 3 0.9266374276688595 4.528283036449433 52791.0 194.84705682074218 0.0 - - - - - - - 726.75 105 8 TRIAP1 TP53 regulated inhibitor of apoptosis 1 1655 211 B20140214_SF053_03 B20140214_SF053_03 TB246481.[MT7]-REYDQC[CAM]FNR.3b5_1.heavy 477.89 / 836.402 12309.0 22.238900184631348 40 13 10 7 10 1.3910532899056898 49.2017626908581 0.028600692749023438 3 0.9266374276688595 4.528283036449433 12309.0 69.25382372947236 0.0 - - - - - - - 178.0 24 24 TRIAP1 TP53 regulated inhibitor of apoptosis 1 1657 211 B20140214_SF053_03 B20140214_SF053_03 TB246481.[MT7]-REYDQC[CAM]FNR.3y4_1.heavy 477.89 / 596.261 79599.0 22.238900184631348 40 13 10 7 10 1.3910532899056898 49.2017626908581 0.028600692749023438 3 0.9266374276688595 4.528283036449433 79599.0 124.82227019498606 0.0 - - - - - - - 712.0769230769231 159 13 TRIAP1 TP53 regulated inhibitor of apoptosis 1 1659 211 B20140214_SF053_03 B20140214_SF053_03 TB246481.[MT7]-REYDQC[CAM]FNR.3y5_1.heavy 477.89 / 724.32 77123.0 22.238900184631348 40 13 10 7 10 1.3910532899056898 49.2017626908581 0.028600692749023438 3 0.9266374276688595 4.528283036449433 77123.0 194.94354278810368 0.0 - - - - - - - 620.7 154 10 TRIAP1 TP53 regulated inhibitor of apoptosis 1 1661 212 B20140214_SF053_03 B20140214_SF053_03 TB246676.[MT7]-TMHHLLLEVEVIEGTLQC[CAM]PESGR.4y5_1.heavy 698.86 / 545.268 43759.0 45.28609848022461 47 17 10 10 10 3.4593614415106275 23.526286644868026 0.0 3 0.978524018456831 8.406312654285806 43759.0 108.3519065643572 0.0 - - - - - - - 701.6666666666666 87 9 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 1663 212 B20140214_SF053_03 B20140214_SF053_03 TB246676.[MT7]-TMHHLLLEVEVIEGTLQC[CAM]PESGR.4b8_2.heavy 698.86 / 560.309 29699.0 45.28609848022461 47 17 10 10 10 3.4593614415106275 23.526286644868026 0.0 3 0.978524018456831 8.406312654285806 29699.0 61.67290141022686 0.0 - - - - - - - 661.7 59 10 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 1665 212 B20140214_SF053_03 B20140214_SF053_03 TB246676.[MT7]-TMHHLLLEVEVIEGTLQC[CAM]PESGR.4y6_1.heavy 698.86 / 705.299 30752.0 45.28609848022461 47 17 10 10 10 3.4593614415106275 23.526286644868026 0.0 3 0.978524018456831 8.406312654285806 30752.0 78.86365259202469 0.0 - - - - - - - 648.625 61 8 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 1667 212 B20140214_SF053_03 B20140214_SF053_03 TB246676.[MT7]-TMHHLLLEVEVIEGTLQC[CAM]PESGR.4b10_2.heavy 698.86 / 674.364 54812.0 45.28609848022461 47 17 10 10 10 3.4593614415106275 23.526286644868026 0.0 3 0.978524018456831 8.406312654285806 54812.0 73.31495971469587 0.0 - - - - - - - 723.75 109 8 TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) 1669 213 B20140214_SF053_03 B20140214_SF053_03 TB107882.[MT7]-AGAVGAHLPASGLDIFGDLK[MT7].3y6_1.heavy 733.079 / 836.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEC11C SEC11 homolog C (S. cerevisiae) 1671 213 B20140214_SF053_03 B20140214_SF053_03 TB107882.[MT7]-AGAVGAHLPASGLDIFGDLK[MT7].3b6_1.heavy 733.079 / 571.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEC11C SEC11 homolog C (S. cerevisiae) 1673 213 B20140214_SF053_03 B20140214_SF053_03 TB107882.[MT7]-AGAVGAHLPASGLDIFGDLK[MT7].3b5_1.heavy 733.079 / 500.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEC11C SEC11 homolog C (S. cerevisiae) 1675 213 B20140214_SF053_03 B20140214_SF053_03 TB107882.[MT7]-AGAVGAHLPASGLDIFGDLK[MT7].3b7_1.heavy 733.079 / 708.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEC11C SEC11 homolog C (S. cerevisiae) 1677 214 B20140214_SF053_03 B20140214_SF053_03 TB246674.[MT7]-TVEGGSSSVFSMFDQTQIQEFK[MT7].4y4_1.heavy 685.84 / 695.385 15213.0 44.64182472229004 38 12 10 6 10 2.9823457861172136 33.53065243658159 0.03730010986328125 3 0.8961782297750951 3.796532152095154 15213.0 32.83518798576645 0.0 - - - - - - - 772.5 30 10 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 1679 214 B20140214_SF053_03 B20140214_SF053_03 TB246674.[MT7]-TVEGGSSSVFSMFDQTQIQEFK[MT7].4b5_1.heavy 685.84 / 588.311 6520.0 44.64182472229004 38 12 10 6 10 2.9823457861172136 33.53065243658159 0.03730010986328125 3 0.8961782297750951 3.796532152095154 6520.0 12.705042636066954 0.0 - - - - - - - 824.8333333333334 13 12 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 1681 214 B20140214_SF053_03 B20140214_SF053_03 TB246674.[MT7]-TVEGGSSSVFSMFDQTQIQEFK[MT7].4y3_1.heavy 685.84 / 567.326 13523.0 44.64182472229004 38 12 10 6 10 2.9823457861172136 33.53065243658159 0.03730010986328125 3 0.8961782297750951 3.796532152095154 13523.0 20.21130541259982 0.0 - - - - - - - 753.5454545454545 27 11 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 1683 214 B20140214_SF053_03 B20140214_SF053_03 TB246674.[MT7]-TVEGGSSSVFSMFDQTQIQEFK[MT7].4b6_1.heavy 685.84 / 675.343 7325.0 44.64182472229004 38 12 10 6 10 2.9823457861172136 33.53065243658159 0.03730010986328125 3 0.8961782297750951 3.796532152095154 7325.0 8.189440993788821 0.0 - - - - - - - 675.9 14 10 MYLPF myosin light chain, phosphorylatable, fast skeletal muscle 1685 215 B20140214_SF053_03 B20140214_SF053_03 TB107884.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].3b6_1.heavy 736.73 / 719.421 20859.0 40.550899505615234 47 17 10 10 10 3.9334834324977486 25.422758660635907 0.0 3 0.9799691561825165 8.705327816250227 20859.0 15.03801434620053 0.0 - - - - - - - 1220.7777777777778 41 9 MCTS1 malignant T cell amplified sequence 1 1687 215 B20140214_SF053_03 B20140214_SF053_03 TB107884.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].3b3_1.heavy 736.73 / 504.33 19028.0 40.550899505615234 47 17 10 10 10 3.9334834324977486 25.422758660635907 0.0 3 0.9799691561825165 8.705327816250227 19028.0 22.238936535108827 0.0 - - - - - - - 684.5 38 10 MCTS1 malignant T cell amplified sequence 1 1689 215 B20140214_SF053_03 B20140214_SF053_03 TB107884.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].3y4_1.heavy 736.73 / 516.326 94581.0 40.550899505615234 47 17 10 10 10 3.9334834324977486 25.422758660635907 0.0 3 0.9799691561825165 8.705327816250227 94581.0 59.61061295692315 0.0 - - - - - - - 762.0 189 7 MCTS1 malignant T cell amplified sequence 1 1691 215 B20140214_SF053_03 B20140214_SF053_03 TB107884.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].3b7_1.heavy 736.73 / 833.464 62019.0 40.550899505615234 47 17 10 10 10 3.9334834324977486 25.422758660635907 0.0 3 0.9799691561825165 8.705327816250227 62019.0 62.42499095643869 0.0 - - - - - - - 292.0 124 6 MCTS1 malignant T cell amplified sequence 1 1693 216 B20140214_SF053_03 B20140214_SF053_03 TB246673.[MT7]-GLWPFASAAGGGGSEAAGAEQALVRPR.4b24_2.heavy 682.608 / 1150.57 2677.0 40.871599197387695 36 10 10 6 10 1.1781084686790264 52.17283714853956 0.035999298095703125 3 0.8368948855968779 3.0132884753919154 2677.0 3.994253968253968 1.0 - - - - - - - 236.1875 5 16 TUSC2 tumor suppressor candidate 2 1695 216 B20140214_SF053_03 B20140214_SF053_03 TB246673.[MT7]-GLWPFASAAGGGGSEAAGAEQALVRPR.4b4_1.heavy 682.608 / 598.347 9213.0 40.871599197387695 36 10 10 6 10 1.1781084686790264 52.17283714853956 0.035999298095703125 3 0.8368948855968779 3.0132884753919154 9213.0 9.476228571428571 0.0 - - - - - - - 641.1428571428571 18 7 TUSC2 tumor suppressor candidate 2 1697 216 B20140214_SF053_03 B20140214_SF053_03 TB246673.[MT7]-GLWPFASAAGGGGSEAAGAEQALVRPR.4y18_2.heavy 682.608 / 841.932 68743.0 40.871599197387695 36 10 10 6 10 1.1781084686790264 52.17283714853956 0.035999298095703125 3 0.8368948855968779 3.0132884753919154 68743.0 129.42279452209516 0.0 - - - - - - - 433.0 137 2 TUSC2 tumor suppressor candidate 2 1699 216 B20140214_SF053_03 B20140214_SF053_03 TB246673.[MT7]-GLWPFASAAGGGGSEAAGAEQALVRPR.4b3_1.heavy 682.608 / 501.294 59530.0 40.871599197387695 36 10 10 6 10 1.1781084686790264 52.17283714853956 0.035999298095703125 3 0.8368948855968779 3.0132884753919154 59530.0 92.98842046034235 0.0 - - - - - - - 472.0 119 1 TUSC2 tumor suppressor candidate 2 1701 217 B20140214_SF053_03 B20140214_SF053_03 TB107885.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].2b3_1.heavy 1104.59 / 504.33 3595.0 40.531999588012695 38 12 10 6 10 1.592875918846664 55.0414915973728 0.037799835205078125 3 0.8974941063006142 3.821258201275387 3595.0 63.361875 0.0 - - - - - - - 141.53846153846155 7 13 MCTS1 malignant T cell amplified sequence 1 1703 217 B20140214_SF053_03 B20140214_SF053_03 TB107885.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].2y4_1.heavy 1104.59 / 516.326 6232.0 40.531999588012695 38 12 10 6 10 1.592875918846664 55.0414915973728 0.037799835205078125 3 0.8974941063006142 3.821258201275387 6232.0 49.751103340292275 0.0 - - - - - - - 177.66666666666666 12 18 MCTS1 malignant T cell amplified sequence 1 1705 217 B20140214_SF053_03 B20140214_SF053_03 TB107885.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].2y9_1.heavy 1104.59 / 971.564 6152.0 40.531999588012695 38 12 10 6 10 1.592875918846664 55.0414915973728 0.037799835205078125 3 0.8974941063006142 3.821258201275387 6152.0 24.0609297635605 0.0 - - - - - - - 166.66666666666666 12 12 MCTS1 malignant T cell amplified sequence 1 1707 217 B20140214_SF053_03 B20140214_SF053_03 TB107885.[MT7]-FVLSGANIMC[CAM]PGLTSPGAK[MT7].2y10_1.heavy 1104.59 / 1131.59 1358.0 40.531999588012695 38 12 10 6 10 1.592875918846664 55.0414915973728 0.037799835205078125 3 0.8974941063006142 3.821258201275387 1358.0 5.661370005963029 0.0 - - - - - - - 110.76923076923077 2 13 MCTS1 malignant T cell amplified sequence 1 1709 218 B20140214_SF053_03 B20140214_SF053_03 TB246373.[MT7]-VTTHPLAK[MT7].3y3_1.heavy 385.576 / 475.336 328648.0 22.017725467681885 47 20 10 7 10 8.005898652578322 12.490790146062455 0.028699874877929688 3 0.994844955593368 17.181434489103776 328648.0 404.43871584837814 0.0 - - - - - - - 780.1428571428571 657 7 PARK7 Parkinson disease (autosomal recessive, early onset) 7 1711 218 B20140214_SF053_03 B20140214_SF053_03 TB246373.[MT7]-VTTHPLAK[MT7].3b4_1.heavy 385.576 / 583.332 94621.0 22.017725467681885 47 20 10 7 10 8.005898652578322 12.490790146062455 0.028699874877929688 3 0.994844955593368 17.181434489103776 94621.0 229.8471717327851 0.0 - - - - - - - 306.57142857142856 189 14 PARK7 Parkinson disease (autosomal recessive, early onset) 7 1713 218 B20140214_SF053_03 B20140214_SF053_03 TB246373.[MT7]-VTTHPLAK[MT7].3b3_1.heavy 385.576 / 446.273 166951.0 22.017725467681885 47 20 10 7 10 8.005898652578322 12.490790146062455 0.028699874877929688 3 0.994844955593368 17.181434489103776 166951.0 152.3781345751448 0.0 - - - - - - - 1288.0 333 10 PARK7 Parkinson disease (autosomal recessive, early onset) 7 1715 218 B20140214_SF053_03 B20140214_SF053_03 TB246373.[MT7]-VTTHPLAK[MT7].3y4_1.heavy 385.576 / 572.389 190512.0 22.017725467681885 47 20 10 7 10 8.005898652578322 12.490790146062455 0.028699874877929688 3 0.994844955593368 17.181434489103776 190512.0 297.7583361064892 0.0 - - - - - - - 1260.857142857143 381 7 PARK7 Parkinson disease (autosomal recessive, early onset) 7 1717 219 B20140214_SF053_03 B20140214_SF053_03 TB107879.[MT7]-C[CAM]HLIETNIRDQEELK[MT7].3y14_2.heavy 729.387 / 941.511 7779.0 28.276399612426758 47 17 10 10 10 3.866811711889837 20.698638631634168 0.0 3 0.9796054131678854 8.627084143337461 7779.0 94.39402723404254 0.0 - - - - - - - 176.41176470588235 15 17 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 1719 219 B20140214_SF053_03 B20140214_SF053_03 TB107879.[MT7]-C[CAM]HLIETNIRDQEELK[MT7].3b3_1.heavy 729.387 / 555.283 5155.0 28.276399612426758 47 17 10 10 10 3.866811711889837 20.698638631634168 0.0 3 0.9796054131678854 8.627084143337461 5155.0 6.30158286121807 0.0 - - - - - - - 649.0769230769231 10 13 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 1721 219 B20140214_SF053_03 B20140214_SF053_03 TB107879.[MT7]-C[CAM]HLIETNIRDQEELK[MT7].3y12_2.heavy 729.387 / 816.44 7030.0 28.276399612426758 47 17 10 10 10 3.866811711889837 20.698638631634168 0.0 3 0.9796054131678854 8.627084143337461 7030.0 50.98056606234512 0.0 - - - - - - - 199.2 14 20 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 1723 219 B20140214_SF053_03 B20140214_SF053_03 TB107879.[MT7]-C[CAM]HLIETNIRDQEELK[MT7].3y13_2.heavy 729.387 / 872.982 6702.0 28.276399612426758 47 17 10 10 10 3.866811711889837 20.698638631634168 0.0 3 0.9796054131678854 8.627084143337461 6702.0 46.684871794871796 0.0 - - - - - - - 187.52173913043478 13 23 KCNMB1 potassium large conductance calcium-activated channel, subfamily M, beta member 1 1725 220 B20140214_SF053_03 B20140214_SF053_03 TB246371.[MT7]-QEELNTK[MT7].2b3_1.heavy 575.321 / 531.253 N/A 19.930099487304688 36 16 0 10 10 2.4926103564440685 33.08779424011038 0.0 3 0.9637676126414172 6.463887692570643 5610.0 0.8786203888623696 16.0 - - - - - - - 1702.3333333333333 83 3 MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 1727 220 B20140214_SF053_03 B20140214_SF053_03 TB246371.[MT7]-QEELNTK[MT7].2y5_1.heavy 575.321 / 748.432 2863.0 19.930099487304688 36 16 0 10 10 2.4926103564440685 33.08779424011038 0.0 3 0.9637676126414172 6.463887692570643 2863.0 43.096231747527085 0.0 - - - - - - - 114.0952380952381 5 21 MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 1729 220 B20140214_SF053_03 B20140214_SF053_03 TB246371.[MT7]-QEELNTK[MT7].2y3_1.heavy 575.321 / 506.306 4140.0 19.930099487304688 36 16 0 10 10 2.4926103564440685 33.08779424011038 0.0 3 0.9637676126414172 6.463887692570643 4140.0 10.43017755535751 0.0 - - - - - - - 311.35 8 20 MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 1731 220 B20140214_SF053_03 B20140214_SF053_03 TB246371.[MT7]-QEELNTK[MT7].2y6_1.heavy 575.321 / 877.475 6151.0 19.930099487304688 36 16 0 10 10 2.4926103564440685 33.08779424011038 0.0 3 0.9637676126414172 6.463887692570643 6151.0 39.64726223068682 0.0 - - - - - - - 163.07142857142858 12 14 MYL3 myosin, light chain 3, alkali; ventricular, skeletal, slow 1733 221 B20140214_SF053_03 B20140214_SF053_03 TB246278.[MT7]-EEILK[MT7].2b3_1.heavy 460.289 / 516.279 30497.0 26.0415997505188 42 16 10 6 10 3.4010594526601468 29.402602745384165 0.03159904479980469 3 0.9677883698850086 6.85777597887351 30497.0 32.7615514717088 0.0 - - - - - - - 1775.142857142857 60 7 CETN1;CETN2;RBM33;EIF2C3;ITPR1;ITPR2;ITPR3;PRKDC;TCN2;LOC731751;MCTP1 centrin, EF-hand protein, 1;centrin, EF-hand protein, 2;RNA binding motif protein 33;eukaryotic translation initiation factor 2C, 3;inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-triphosphate receptor, type 2;inositol 1,4,5-triphosphate receptor, type 3;protein kinase, DNA-activated, catalytic polypeptide;transcobalamin II;DNA-dependent protein kinase catalytic subunit-like;multiple C2 domains, transmembrane 1 1735 221 B20140214_SF053_03 B20140214_SF053_03 TB246278.[MT7]-EEILK[MT7].2y4_1.heavy 460.289 / 646.426 67310.0 26.0415997505188 42 16 10 6 10 3.4010594526601468 29.402602745384165 0.03159904479980469 3 0.9677883698850086 6.85777597887351 67310.0 85.43331536305976 0.0 - - - - - - - 1195.2857142857142 134 7 CETN1;CETN2;RBM33;EIF2C3;ITPR1;ITPR2;ITPR3;PRKDC;TCN2;LOC731751;MCTP1 centrin, EF-hand protein, 1;centrin, EF-hand protein, 2;RNA binding motif protein 33;eukaryotic translation initiation factor 2C, 3;inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-triphosphate receptor, type 2;inositol 1,4,5-triphosphate receptor, type 3;protein kinase, DNA-activated, catalytic polypeptide;transcobalamin II;DNA-dependent protein kinase catalytic subunit-like;multiple C2 domains, transmembrane 1 1737 221 B20140214_SF053_03 B20140214_SF053_03 TB246278.[MT7]-EEILK[MT7].2b4_1.heavy 460.289 / 629.363 15813.0 26.0415997505188 42 16 10 6 10 3.4010594526601468 29.402602745384165 0.03159904479980469 3 0.9677883698850086 6.85777597887351 15813.0 22.168057493924636 1.0 - - - - - - - 1251.0 31 10 CETN1;CETN2;RBM33;EIF2C3;ITPR1;ITPR2;ITPR3;PRKDC;TCN2;LOC731751;MCTP1 centrin, EF-hand protein, 1;centrin, EF-hand protein, 2;RNA binding motif protein 33;eukaryotic translation initiation factor 2C, 3;inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-triphosphate receptor, type 2;inositol 1,4,5-triphosphate receptor, type 3;protein kinase, DNA-activated, catalytic polypeptide;transcobalamin II;DNA-dependent protein kinase catalytic subunit-like;multiple C2 domains, transmembrane 1 1739 221 B20140214_SF053_03 B20140214_SF053_03 TB246278.[MT7]-EEILK[MT7].2y3_1.heavy 460.289 / 517.383 31333.0 26.0415997505188 42 16 10 6 10 3.4010594526601468 29.402602745384165 0.03159904479980469 3 0.9677883698850086 6.85777597887351 31333.0 27.82495322115033 1.0 - - - - - - - 1267.0 62 7 CETN1;CETN2;RBM33;EIF2C3;ITPR1;ITPR2;ITPR3;PRKDC;TCN2;LOC731751;MCTP1 centrin, EF-hand protein, 1;centrin, EF-hand protein, 2;RNA binding motif protein 33;eukaryotic translation initiation factor 2C, 3;inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-triphosphate receptor, type 2;inositol 1,4,5-triphosphate receptor, type 3;protein kinase, DNA-activated, catalytic polypeptide;transcobalamin II;DNA-dependent protein kinase catalytic subunit-like;multiple C2 domains, transmembrane 1 1741 222 B20140214_SF053_03 B20140214_SF053_03 TB246473.[MT7]-WEWLVNQHR.3b4_1.heavy 471.25 / 759.395 55697.0 36.95689868927002 44 18 10 6 10 4.41896607030102 22.629727951993075 0.039600372314453125 3 0.9806462788818301 8.85680733184559 55697.0 364.846729710455 0.0 - - - - - - - 217.45454545454547 111 11 SF3B5 splicing factor 3b, subunit 5, 10kDa 1743 222 B20140214_SF053_03 B20140214_SF053_03 TB246473.[MT7]-WEWLVNQHR.3b3_1.heavy 471.25 / 646.311 145649.0 36.95689868927002 44 18 10 6 10 4.41896607030102 22.629727951993075 0.039600372314453125 3 0.9806462788818301 8.85680733184559 145649.0 221.17450947389636 0.0 - - - - - - - 646.8571428571429 291 7 SF3B5 splicing factor 3b, subunit 5, 10kDa 1745 222 B20140214_SF053_03 B20140214_SF053_03 TB246473.[MT7]-WEWLVNQHR.3y4_1.heavy 471.25 / 554.279 220823.0 36.95689868927002 44 18 10 6 10 4.41896607030102 22.629727951993075 0.039600372314453125 3 0.9806462788818301 8.85680733184559 220823.0 241.8268474958228 0.0 - - - - - - - 744.4285714285714 441 7 SF3B5 splicing factor 3b, subunit 5, 10kDa 1747 222 B20140214_SF053_03 B20140214_SF053_03 TB246473.[MT7]-WEWLVNQHR.3y5_1.heavy 471.25 / 653.348 83118.0 36.95689868927002 44 18 10 6 10 4.41896607030102 22.629727951993075 0.039600372314453125 3 0.9806462788818301 8.85680733184559 83118.0 111.76855076946497 0.0 - - - - - - - 231.71428571428572 166 7 SF3B5 splicing factor 3b, subunit 5, 10kDa 1749 223 B20140214_SF053_03 B20140214_SF053_03 TB464229.[MT7]-GGYFLVDFYAPTAAVESMVEHLSR.3b7_1.heavy 935.134 / 896.463 965.0 52.265201568603516 48 18 10 10 10 3.7386740127920106 21.41040583054373 0.0 3 0.9835557901974917 9.61078644211063 965.0 8.041666666666666 0.0 - - - - - - - 0.0 1 0 MRPS6 mitochondrial ribosomal protein S6 1751 223 B20140214_SF053_03 B20140214_SF053_03 TB464229.[MT7]-GGYFLVDFYAPTAAVESMVEHLSR.3b4_1.heavy 935.134 / 569.284 1097.0 52.265201568603516 48 18 10 10 10 3.7386740127920106 21.41040583054373 0.0 3 0.9835557901974917 9.61078644211063 1097.0 6.240077922077922 0.0 - - - - - - - 101.6842105263158 2 19 MRPS6 mitochondrial ribosomal protein S6 1753 223 B20140214_SF053_03 B20140214_SF053_03 TB464229.[MT7]-GGYFLVDFYAPTAAVESMVEHLSR.3b5_1.heavy 935.134 / 682.368 1053.0 52.265201568603516 48 18 10 10 10 3.7386740127920106 21.41040583054373 0.0 3 0.9835557901974917 9.61078644211063 1053.0 10.228393524283936 0.0 - - - - - - - 98.0 2 13 MRPS6 mitochondrial ribosomal protein S6 1755 223 B20140214_SF053_03 B20140214_SF053_03 TB464229.[MT7]-GGYFLVDFYAPTAAVESMVEHLSR.3y9_1.heavy 935.134 / 1087.52 614.0 52.265201568603516 48 18 10 10 10 3.7386740127920106 21.41040583054373 0.0 3 0.9835557901974917 9.61078644211063 614.0 3.7212121212121207 0.0 - - - - - - - 0.0 1 0 MRPS6 mitochondrial ribosomal protein S6 1757 224 B20140214_SF053_03 B20140214_SF053_03 TB246681.[MT7]-GTEFAESADAALQGDPALQDAGDSSRK[MT7].3b9_1.heavy 999.154 / 1052.47 4272.0 34.32547473907471 44 18 10 6 10 11.258517178321998 8.882164357536139 0.037097930908203125 3 0.9878021303862798 11.162923029547903 4272.0 102.69022784810126 0.0 - - - - - - - 200.6153846153846 8 13 GYPC glycophorin C (Gerbich blood group) 1759 224 B20140214_SF053_03 B20140214_SF053_03 TB246681.[MT7]-GTEFAESADAALQGDPALQDAGDSSRK[MT7].3b6_1.heavy 999.154 / 779.369 7831.0 34.32547473907471 44 18 10 6 10 11.258517178321998 8.882164357536139 0.037097930908203125 3 0.9878021303862798 11.162923029547903 7831.0 49.12022535481396 0.0 - - - - - - - 207.5 15 16 GYPC glycophorin C (Gerbich blood group) 1761 224 B20140214_SF053_03 B20140214_SF053_03 TB246681.[MT7]-GTEFAESADAALQGDPALQDAGDSSRK[MT7].3b4_1.heavy 999.154 / 579.289 6249.0 34.32547473907471 44 18 10 6 10 11.258517178321998 8.882164357536139 0.037097930908203125 3 0.9878021303862798 11.162923029547903 6249.0 22.101401658813163 0.0 - - - - - - - 179.13333333333333 12 15 GYPC glycophorin C (Gerbich blood group) 1763 224 B20140214_SF053_03 B20140214_SF053_03 TB246681.[MT7]-GTEFAESADAALQGDPALQDAGDSSRK[MT7].3b5_1.heavy 999.154 / 650.327 6012.0 34.32547473907471 44 18 10 6 10 11.258517178321998 8.882164357536139 0.037097930908203125 3 0.9878021303862798 11.162923029547903 6012.0 32.34303797468355 0.0 - - - - - - - 168.6 12 15 GYPC glycophorin C (Gerbich blood group) 1765 225 B20140214_SF053_03 B20140214_SF053_03 TB107878.[MT7]-SLLSPGLLPHLLPALGFK[MT7].3b6_1.heavy 721.117 / 699.416 11685.0 49.50589942932129 40 14 10 6 10 3.748612737756555 26.67653529338625 0.034999847412109375 3 0.9354533307898457 4.831269719295507 11685.0 46.08151770083428 0.0 - - - - - - - 625.125 23 8 MRPL36 mitochondrial ribosomal protein L36 1767 225 B20140214_SF053_03 B20140214_SF053_03 TB107878.[MT7]-SLLSPGLLPHLLPALGFK[MT7].3y6_1.heavy 721.117 / 776.479 67274.0 49.50589942932129 40 14 10 6 10 3.748612737756555 26.67653529338625 0.034999847412109375 3 0.9354533307898457 4.831269719295507 67274.0 153.96490806595926 0.0 - - - - - - - 266.6363636363636 134 11 MRPL36 mitochondrial ribosomal protein L36 1769 225 B20140214_SF053_03 B20140214_SF053_03 TB107878.[MT7]-SLLSPGLLPHLLPALGFK[MT7].3b4_1.heavy 721.117 / 545.341 18658.0 49.50589942932129 40 14 10 6 10 3.748612737756555 26.67653529338625 0.034999847412109375 3 0.9354533307898457 4.831269719295507 18658.0 56.086768369467535 0.0 - - - - - - - 604.4285714285714 37 7 MRPL36 mitochondrial ribosomal protein L36 1771 225 B20140214_SF053_03 B20140214_SF053_03 TB107878.[MT7]-SLLSPGLLPHLLPALGFK[MT7].3b8_1.heavy 721.117 / 925.584 17311.0 49.50589942932129 40 14 10 6 10 3.748612737756555 26.67653529338625 0.034999847412109375 3 0.9354533307898457 4.831269719295507 17311.0 195.12093649999997 0.0 - - - - - - - 673.0 34 7 MRPL36 mitochondrial ribosomal protein L36 1773 226 B20140214_SF053_03 B20140214_SF053_03 TB246683.[MT7]-VQSLVDTIREDPDSVPPIDVLWIK[MT7].4b11_2.heavy 756.423 / 700.879 68483.0 47.47692394256592 38 11 10 7 10 1.2895945756818155 61.349753483984315 0.028499603271484375 3 0.8600040516639358 3.2591377389126657 68483.0 111.29499573284198 0.0 - - - - - - - 801.25 136 8 SRXN1 sulfiredoxin 1 1775 226 B20140214_SF053_03 B20140214_SF053_03 TB246683.[MT7]-VQSLVDTIREDPDSVPPIDVLWIK[MT7].4y9_2.heavy 756.423 / 612.877 232552.0 47.47692394256592 38 11 10 7 10 1.2895945756818155 61.349753483984315 0.028499603271484375 3 0.8600040516639358 3.2591377389126657 232552.0 129.3181870032582 0.0 - - - - - - - 781.25 465 4 SRXN1 sulfiredoxin 1 1777 226 B20140214_SF053_03 B20140214_SF053_03 TB246683.[MT7]-VQSLVDTIREDPDSVPPIDVLWIK[MT7].4b14_2.heavy 756.423 / 850.435 91976.0 47.47692394256592 38 11 10 7 10 1.2895945756818155 61.349753483984315 0.028499603271484375 3 0.8600040516639358 3.2591377389126657 91976.0 44.26609016995463 0.0 - - - - - - - 706.4444444444445 183 9 SRXN1 sulfiredoxin 1 1779 226 B20140214_SF053_03 B20140214_SF053_03 TB246683.[MT7]-VQSLVDTIREDPDSVPPIDVLWIK[MT7].4y3_1.heavy 756.423 / 590.378 131363.0 47.47692394256592 38 11 10 7 10 1.2895945756818155 61.349753483984315 0.028499603271484375 3 0.8600040516639358 3.2591377389126657 131363.0 165.1133457468306 0.0 - - - - - - - 1232.625 262 8 SRXN1 sulfiredoxin 1 1781 227 B20140214_SF053_03 B20140214_SF053_03 TB107875.[MT7]-SLVIWDNDRLTC[CAM]IQK[MT7].3b4_1.heavy 717.061 / 557.378 19721.0 37.319400787353516 50 20 10 10 10 9.97868512816037 10.021360401261163 0.0 3 0.9956387417688289 18.680930432879695 19721.0 23.83057359412991 0.0 - - - - - - - 768.375 39 8 RBP7 retinol binding protein 7, cellular 1783 227 B20140214_SF053_03 B20140214_SF053_03 TB107875.[MT7]-SLVIWDNDRLTC[CAM]IQK[MT7].3y11_2.heavy 717.061 / 796.902 30564.0 37.319400787353516 50 20 10 10 10 9.97868512816037 10.021360401261163 0.0 3 0.9956387417688289 18.680930432879695 30564.0 91.00339442847559 0.0 - - - - - - - 729.7272727272727 61 11 RBP7 retinol binding protein 7, cellular 1785 227 B20140214_SF053_03 B20140214_SF053_03 TB107875.[MT7]-SLVIWDNDRLTC[CAM]IQK[MT7].3y12_2.heavy 717.061 / 853.444 30734.0 37.319400787353516 50 20 10 10 10 9.97868512816037 10.021360401261163 0.0 3 0.9956387417688289 18.680930432879695 30734.0 77.06801859978664 0.0 - - - - - - - 725.75 61 8 RBP7 retinol binding protein 7, cellular 1787 227 B20140214_SF053_03 B20140214_SF053_03 TB107875.[MT7]-SLVIWDNDRLTC[CAM]IQK[MT7].3y9_2.heavy 717.061 / 646.349 29625.0 37.319400787353516 50 20 10 10 10 9.97868512816037 10.021360401261163 0.0 3 0.9956387417688289 18.680930432879695 29625.0 19.29054465103024 0.0 - - - - - - - 1698.111111111111 59 9 RBP7 retinol binding protein 7, cellular