Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140219_SF055_05 B20140219_SF055_05 TB469397.[MT7]-HGQGIYK[MT7].2y5_2.heavy 545.816 / 376.725 243547.0 30.529300689697266 45 15 10 10 10 2.320730197884156 36.621337937715126 0.0 3 0.9590987715073794 6.081387848730902 243547.0 129.95019803557085 0.0 - - - - - - - 469.0 487 1 RSPH1 radial spoke head 1 homolog (Chlamydomonas) 3 1 B20140219_SF055_05 B20140219_SF055_05 TB469397.[MT7]-HGQGIYK[MT7].2y5_1.heavy 545.816 / 752.442 14071.0 30.529300689697266 45 15 10 10 10 2.320730197884156 36.621337937715126 0.0 3 0.9590987715073794 6.081387848730902 14071.0 31.169318445415353 0.0 - - - - - - - 725.625 28 8 RSPH1 radial spoke head 1 homolog (Chlamydomonas) 5 1 B20140219_SF055_05 B20140219_SF055_05 TB469397.[MT7]-HGQGIYK[MT7].2y3_1.heavy 545.816 / 567.362 19641.0 30.529300689697266 45 15 10 10 10 2.320730197884156 36.621337937715126 0.0 3 0.9590987715073794 6.081387848730902 19641.0 32.1168864769633 0.0 - - - - - - - 1197.7142857142858 39 7 RSPH1 radial spoke head 1 homolog (Chlamydomonas) 7 1 B20140219_SF055_05 B20140219_SF055_05 TB469397.[MT7]-HGQGIYK[MT7].2b5_1.heavy 545.816 / 637.354 3049.0 30.529300689697266 45 15 10 10 10 2.320730197884156 36.621337937715126 0.0 3 0.9590987715073794 6.081387848730902 3049.0 2.844102306920762 4.0 - - - - - - - 715.4666666666667 6 15 RSPH1 radial spoke head 1 homolog (Chlamydomonas) 9 2 B20140219_SF055_05 B20140219_SF055_05 TB469297.[MT7]-VFGALK[MT7].2y4_1.heavy 461.802 / 532.357 82720.0 30.83009910583496 47 17 10 10 10 3.9853556651308266 25.09186341257633 0.0 3 0.9733928089995497 7.549099990750617 82720.0 87.55858372625113 0.0 - - - - - - - 1252.6666666666667 165 9 RPL5 ribosomal protein L5 11 2 B20140219_SF055_05 B20140219_SF055_05 TB469297.[MT7]-VFGALK[MT7].2y5_1.heavy 461.802 / 679.426 239980.0 30.83009910583496 47 17 10 10 10 3.9853556651308266 25.09186341257633 0.0 3 0.9733928089995497 7.549099990750617 239980.0 491.66019974142284 0.0 - - - - - - - 772.5555555555555 479 9 RPL5 ribosomal protein L5 13 2 B20140219_SF055_05 B20140219_SF055_05 TB469297.[MT7]-VFGALK[MT7].2b4_1.heavy 461.802 / 519.305 25353.0 30.83009910583496 47 17 10 10 10 3.9853556651308266 25.09186341257633 0.0 3 0.9733928089995497 7.549099990750617 25353.0 19.77461254016044 0.0 - - - - - - - 1635.7 50 10 RPL5 ribosomal protein L5 15 2 B20140219_SF055_05 B20140219_SF055_05 TB469297.[MT7]-VFGALK[MT7].2b5_1.heavy 461.802 / 632.389 14429.0 30.83009910583496 47 17 10 10 10 3.9853556651308266 25.09186341257633 0.0 3 0.9733928089995497 7.549099990750617 14429.0 10.488073303934103 0.0 - - - - - - - 764.6363636363636 28 11 RPL5 ribosomal protein L5 17 3 B20140219_SF055_05 B20140219_SF055_05 TB469291.[MT7]-GGWLWR.2y4_1.heavy 459.757 / 660.362 9654.0 37.203800201416016 42 18 10 6 8 4.772716201027203 20.952429557508072 0.0316009521484375 4 0.9828568342641244 9.412271949031688 9654.0 15.558267775893023 1.0 - - - - - - - 339.93333333333334 25 15 PLEKHB1 pleckstrin homology domain containing, family B (evectins) member 1 19 3 B20140219_SF055_05 B20140219_SF055_05 TB469291.[MT7]-GGWLWR.2y5_1.heavy 459.757 / 717.383 35909.0 37.203800201416016 42 18 10 6 8 4.772716201027203 20.952429557508072 0.0316009521484375 4 0.9828568342641244 9.412271949031688 35909.0 229.88418484716792 0.0 - - - - - - - 261.6 71 20 PLEKHB1 pleckstrin homology domain containing, family B (evectins) member 1 21 3 B20140219_SF055_05 B20140219_SF055_05 TB469291.[MT7]-GGWLWR.2b4_1.heavy 459.757 / 558.316 81382.0 37.203800201416016 42 18 10 6 8 4.772716201027203 20.952429557508072 0.0316009521484375 4 0.9828568342641244 9.412271949031688 81382.0 54.664990159310065 0.0 - - - - - - - 1223.111111111111 162 9 PLEKHB1 pleckstrin homology domain containing, family B (evectins) member 1 23 3 B20140219_SF055_05 B20140219_SF055_05 TB469291.[MT7]-GGWLWR.2y3_1.heavy 459.757 / 474.282 11368.0 37.203800201416016 42 18 10 6 8 4.772716201027203 20.952429557508072 0.0316009521484375 4 0.9828568342641244 9.412271949031688 11368.0 9.659871515616198 2.0 - - - - - - - 320.8888888888889 36 9 PLEKHB1 pleckstrin homology domain containing, family B (evectins) member 1 25 4 B20140219_SF055_05 B20140219_SF055_05 TB469625.[MT7]-QC[CAM]QPSDTVC[CAM]ASVR.2b3_1.heavy 826.386 / 561.257 5353.0 21.555699348449707 37 12 10 7 8 0.9162058033713989 71.24772305584446 0.027599334716796875 4 0.893370888715463 3.7453094153636615 5353.0 54.81182196772514 0.0 - - - - - - - 169.47058823529412 10 17 LY6H lymphocyte antigen 6 complex, locus H 27 4 B20140219_SF055_05 B20140219_SF055_05 TB469625.[MT7]-QC[CAM]QPSDTVC[CAM]ASVR.2y5_1.heavy 826.386 / 592.287 644.0 21.555699348449707 37 12 10 7 8 0.9162058033713989 71.24772305584446 0.027599334716796875 4 0.893370888715463 3.7453094153636615 644.0 -0.4446158638461756 2.0 - - - - - - - 0.0 1 0 LY6H lymphocyte antigen 6 complex, locus H 29 4 B20140219_SF055_05 B20140219_SF055_05 TB469625.[MT7]-QC[CAM]QPSDTVC[CAM]ASVR.2y10_1.heavy 826.386 / 1091.52 5725.0 21.555699348449707 37 12 10 7 8 0.9162058033713989 71.24772305584446 0.027599334716796875 4 0.893370888715463 3.7453094153636615 5725.0 87.63338398089864 0.0 - - - - - - - 177.61904761904762 11 21 LY6H lymphocyte antigen 6 complex, locus H 31 4 B20140219_SF055_05 B20140219_SF055_05 TB469625.[MT7]-QC[CAM]QPSDTVC[CAM]ASVR.2y7_1.heavy 826.386 / 792.403 1965.0 21.555699348449707 37 12 10 7 8 0.9162058033713989 71.24772305584446 0.027599334716796875 4 0.893370888715463 3.7453094153636615 1965.0 17.732015270963117 1.0 - - - - - - - 151.91304347826087 4 23 LY6H lymphocyte antigen 6 complex, locus H 33 5 B20140219_SF055_05 B20140219_SF055_05 TB469394.[MT7]-ESATEEK[MT7].2y4_1.heavy 541.284 / 650.348 5132.0 14.44379997253418 50 20 10 10 10 46.964256317115584 2.1292788993564056 0.0 3 0.9967932637479349 21.78786246089563 5132.0 67.22637578616352 0.0 - - - - - - - 124.11111111111111 10 18 DCTN2 dynactin 2 (p50) 35 5 B20140219_SF055_05 B20140219_SF055_05 TB469394.[MT7]-ESATEEK[MT7].2y5_1.heavy 541.284 / 721.385 2901.0 14.44379997253418 50 20 10 10 10 46.964256317115584 2.1292788993564056 0.0 3 0.9967932637479349 21.78786246089563 2901.0 57.1134375 0.0 - - - - - - - 97.70588235294117 5 17 DCTN2 dynactin 2 (p50) 37 5 B20140219_SF055_05 B20140219_SF055_05 TB469394.[MT7]-ESATEEK[MT7].2y3_1.heavy 541.284 / 549.3 2136.0 14.44379997253418 50 20 10 10 10 46.964256317115584 2.1292788993564056 0.0 3 0.9967932637479349 21.78786246089563 2136.0 32.07358490566038 0.0 - - - - - - - 136.05263157894737 4 19 DCTN2 dynactin 2 (p50) 39 5 B20140219_SF055_05 B20140219_SF055_05 TB469394.[MT7]-ESATEEK[MT7].2y6_1.heavy 541.284 / 808.417 13134.0 14.44379997253418 50 20 10 10 10 46.964256317115584 2.1292788993564056 0.0 3 0.9967932637479349 21.78786246089563 13134.0 77.832757424486 0.0 - - - - - - - 147.6315789473684 26 19 DCTN2 dynactin 2 (p50) 41 6 B20140219_SF055_05 B20140219_SF055_05 TB244818.[MT7]-GDSSIR.2b3_1.heavy 389.712 / 404.19 2214.0 14.818450212478638 46 20 10 6 10 12.652042267561724 7.903862308173571 0.037400245666503906 3 0.9914954915907006 13.373019961316453 2214.0 9.295742937667956 2.0 - - - - - - - 308.77777777777777 4 18 CORO1A;CORO1C;CORO1B;CORO6 coronin, actin binding protein, 1A;coronin, actin binding protein, 1C;coronin, actin binding protein, 1B;coronin 6 43 6 B20140219_SF055_05 B20140219_SF055_05 TB244818.[MT7]-GDSSIR.2y4_1.heavy 389.712 / 462.267 6893.0 14.818450212478638 46 20 10 6 10 12.652042267561724 7.903862308173571 0.037400245666503906 3 0.9914954915907006 13.373019961316453 6893.0 9.851633928003224 0.0 - - - - - - - 706.5833333333334 13 12 CORO1A;CORO1C;CORO1B;CORO6 coronin, actin binding protein, 1A;coronin, actin binding protein, 1C;coronin, actin binding protein, 1B;coronin 6 45 6 B20140219_SF055_05 B20140219_SF055_05 TB244818.[MT7]-GDSSIR.2y5_1.heavy 389.712 / 577.294 2131.0 14.818450212478638 46 20 10 6 10 12.652042267561724 7.903862308173571 0.037400245666503906 3 0.9914954915907006 13.373019961316453 2131.0 12.041609589041096 0.0 - - - - - - - 176.63636363636363 4 22 CORO1A;CORO1C;CORO1B;CORO6 coronin, actin binding protein, 1A;coronin, actin binding protein, 1C;coronin, actin binding protein, 1B;coronin 6 47 6 B20140219_SF055_05 B20140219_SF055_05 TB244818.[MT7]-GDSSIR.2b4_1.heavy 389.712 / 491.222 4428.0 14.818450212478638 46 20 10 6 10 12.652042267561724 7.903862308173571 0.037400245666503906 3 0.9914954915907006 13.373019961316453 4428.0 1.9532238385734395 1.0 - - - - - - - 642.375 8 8 CORO1A;CORO1C;CORO1B;CORO6 coronin, actin binding protein, 1A;coronin, actin binding protein, 1C;coronin, actin binding protein, 1B;coronin 6 49 7 B20140219_SF055_05 B20140219_SF055_05 TB469786.[MT7]-HEEEPK[MT7]PEEK[MT7]PEEEEK[MT7].4y4_1.heavy 643.083 / 678.343 1679.0 16.591299057006836 38 8 10 10 10 0.8556269045141933 74.75565489705951 0.0 3 0.7581602830827967 2.457140095613036 1679.0 38.211724137931036 0.0 - - - - - - - 135.25 3 12 WBP5 WW domain binding protein 5 51 7 B20140219_SF055_05 B20140219_SF055_05 TB469786.[MT7]-HEEEPK[MT7]PEEK[MT7]PEEEEK[MT7].4b4_1.heavy 643.083 / 669.296 7121.0 16.591299057006836 38 8 10 10 10 0.8556269045141933 74.75565489705951 0.0 3 0.7581602830827967 2.457140095613036 7121.0 174.34172413793107 0.0 - - - - - - - 96.66666666666667 14 6 WBP5 WW domain binding protein 5 53 7 B20140219_SF055_05 B20140219_SF055_05 TB469786.[MT7]-HEEEPK[MT7]PEEK[MT7]PEEEEK[MT7].4y3_1.heavy 643.083 / 549.3 984.0 16.591299057006836 38 8 10 10 10 0.8556269045141933 74.75565489705951 0.0 3 0.7581602830827967 2.457140095613036 984.0 7.63448275862069 0.0 - - - - - - - 0.0 1 0 WBP5 WW domain binding protein 5 55 7 B20140219_SF055_05 B20140219_SF055_05 TB469786.[MT7]-HEEEPK[MT7]PEEK[MT7]PEEEEK[MT7].4y6_1.heavy 643.083 / 904.438 3242.0 16.591299057006836 38 8 10 10 10 0.8556269045141933 74.75565489705951 0.0 3 0.7581602830827967 2.457140095613036 3242.0 81.60896551724137 0.0 - - - - - - - 150.6 6 5 WBP5 WW domain binding protein 5 57 8 B20140219_SF055_05 B20140219_SF055_05 TB469788.[MT7]-LIDAMK[MT7]PFGVFEDEEELNHR.4y4_1.heavy 670.094 / 539.305 9453.0 40.7333984375 41 15 6 10 10 5.383084720540611 18.57670930171748 0.0 3 0.9537028973965898 5.713411564169334 9453.0 9.833871668329184 0.0 - - - - - - - 717.9047619047619 18 21 PAPOLG poly(A) polymerase gamma 59 8 B20140219_SF055_05 B20140219_SF055_05 TB469788.[MT7]-LIDAMK[MT7]PFGVFEDEEELNHR.4b4_1.heavy 670.094 / 557.341 4659.0 40.7333984375 41 15 6 10 10 5.383084720540611 18.57670930171748 0.0 3 0.9537028973965898 5.713411564169334 4659.0 3.5780276117642433 2.0 - - - - - - - 1246.0 34 17 PAPOLG poly(A) polymerase gamma 61 8 B20140219_SF055_05 B20140219_SF055_05 TB469788.[MT7]-LIDAMK[MT7]PFGVFEDEEELNHR.4y6_1.heavy 670.094 / 797.39 6614.0 40.7333984375 41 15 6 10 10 5.383084720540611 18.57670930171748 0.0 3 0.9537028973965898 5.713411564169334 6614.0 17.997583722873337 0.0 - - - - - - - 612.5 13 8 PAPOLG poly(A) polymerase gamma 63 8 B20140219_SF055_05 B20140219_SF055_05 TB469788.[MT7]-LIDAMK[MT7]PFGVFEDEEELNHR.4b9_2.heavy 670.094 / 631.365 10926.0 40.7333984375 41 15 6 10 10 5.383084720540611 18.57670930171748 0.0 3 0.9537028973965898 5.713411564169334 10926.0 25.849830499039776 0.0 - - - - - - - 656.9411764705883 21 17 PAPOLG poly(A) polymerase gamma 65 9 B20140219_SF055_05 B20140219_SF055_05 TB244819.[MT7]-AGAPGK[MT7].2b3_1.heavy 394.747 / 344.205 N/A 14.229333559672037 44 20 10 6 8 5.232995599439328 19.109513489886016 0.03320026397705078 4 0.9940587375105767 16.00323355859378 19318.0 47.0447699323554 0.0 - - - - - - - 703.6363636363636 38 11 PFDN6 prefoldin subunit 6 67 9 B20140219_SF055_05 B20140219_SF055_05 TB244819.[MT7]-AGAPGK[MT7].2y4_1.heavy 394.747 / 516.326 2558.0 14.229333559672037 44 20 10 6 8 5.232995599439328 19.109513489886016 0.03320026397705078 4 0.9940587375105767 16.00323355859378 2558.0 4.159349593495935 1.0 - - - - - - - 239.16666666666666 7 24 PFDN6 prefoldin subunit 6 69 9 B20140219_SF055_05 B20140219_SF055_05 TB244819.[MT7]-AGAPGK[MT7].2y5_1.heavy 394.747 / 573.348 8200.0 14.229333559672037 44 20 10 6 8 5.232995599439328 19.109513489886016 0.03320026397705078 4 0.9940587375105767 16.00323355859378 8200.0 13.335788149375555 0.0 - - - - - - - 280.1818181818182 16 22 PFDN6 prefoldin subunit 6 71 9 B20140219_SF055_05 B20140219_SF055_05 TB244819.[MT7]-AGAPGK[MT7].2y3_1.heavy 394.747 / 445.289 24435.0 14.229333559672037 44 20 10 6 8 5.232995599439328 19.109513489886016 0.03320026397705078 4 0.9940587375105767 16.00323355859378 24435.0 38.61060948081264 0.0 - - - - - - - 309.0 48 19 PFDN6 prefoldin subunit 6 73 10 B20140219_SF055_05 B20140219_SF055_05 TB469789.[MT7]-C[CAM]TDGIIYVVDSVDVDRLEEAK[MT7].4b4_1.heavy 671.848 / 578.236 34397.0 41.42409896850586 43 13 10 10 10 0.9496279191333045 64.9127907705124 0.0 3 0.9020003104135789 3.9096492037035664 34397.0 90.25204771613431 0.0 - - - - - - - 300.1875 68 16 ARL4C ADP-ribosylation factor-like 4C 75 10 B20140219_SF055_05 B20140219_SF055_05 TB469789.[MT7]-C[CAM]TDGIIYVVDSVDVDRLEEAK[MT7].4b5_1.heavy 671.848 / 691.32 86545.0 41.42409896850586 43 13 10 10 10 0.9496279191333045 64.9127907705124 0.0 3 0.9020003104135789 3.9096492037035664 86545.0 139.16475580502512 0.0 - - - - - - - 324.375 173 8 ARL4C ADP-ribosylation factor-like 4C 77 10 B20140219_SF055_05 B20140219_SF055_05 TB469789.[MT7]-C[CAM]TDGIIYVVDSVDVDRLEEAK[MT7].4b3_1.heavy 671.848 / 521.215 15653.0 41.42409896850586 43 13 10 10 10 0.9496279191333045 64.9127907705124 0.0 3 0.9020003104135789 3.9096492037035664 15653.0 38.76202945670978 0.0 - - - - - - - 700.3636363636364 31 11 ARL4C ADP-ribosylation factor-like 4C 79 10 B20140219_SF055_05 B20140219_SF055_05 TB469789.[MT7]-C[CAM]TDGIIYVVDSVDVDRLEEAK[MT7].4b6_1.heavy 671.848 / 804.404 71444.0 41.42409896850586 43 13 10 10 10 0.9496279191333045 64.9127907705124 0.0 3 0.9020003104135789 3.9096492037035664 71444.0 193.9668115134633 0.0 - - - - - - - 381.45454545454544 142 11 ARL4C ADP-ribosylation factor-like 4C 81 11 B20140219_SF055_05 B20140219_SF055_05 TB244810.[MT7]-AVIDR.2b3_1.heavy 359.222 / 428.299 9882.0 18.219666798909504 30 14 0 6 10 1.8200765038883737 45.08427232359182 0.03289985656738281 3 0.9362862355868221 4.863091504333015 9882.0 4.51121110752217 0.0 - - - - - - - 702.4444444444445 19 9 MRPL35 mitochondrial ribosomal protein L35 83 11 B20140219_SF055_05 B20140219_SF055_05 TB244810.[MT7]-AVIDR.2y4_1.heavy 359.222 / 502.298 22900.0 18.219666798909504 30 14 0 6 10 1.8200765038883737 45.08427232359182 0.03289985656738281 3 0.9362862355868221 4.863091504333015 22900.0 34.349999999999994 1.0 - - - - - - - 748.375 45 8 MRPL35 mitochondrial ribosomal protein L35 85 11 B20140219_SF055_05 B20140219_SF055_05 TB244810.[MT7]-AVIDR.2b4_1.heavy 359.222 / 543.326 28744.0 18.219666798909504 30 14 0 6 10 1.8200765038883737 45.08427232359182 0.03289985656738281 3 0.9362862355868221 4.863091504333015 28744.0 18.55744055396618 0.0 - - - - - - - 301.0 57 6 MRPL35 mitochondrial ribosomal protein L35 87 11 B20140219_SF055_05 B20140219_SF055_05 TB244810.[MT7]-AVIDR.2y3_1.heavy 359.222 / 403.23 N/A 18.219666798909504 30 14 0 6 10 1.8200765038883737 45.08427232359182 0.03289985656738281 3 0.9362862355868221 4.863091504333015 7744.0 2.0565337510652264 4.0 - - - - - - - 475.0 221 1 MRPL35 mitochondrial ribosomal protein L35 89 12 B20140219_SF055_05 B20140219_SF055_05 TB244918.[MT7]-YNC[CAM]DK[MT7].2b3_1.heavy 494.244 / 582.246 1042.0 15.796500205993652 45 15 10 10 10 1.6011743399940017 42.75461505788877 0.0 3 0.9515058784981779 5.5814488026726226 1042.0 2.7693970498783456 2.0 - - - - - - - 219.41176470588235 2 17 UBA52 ubiquitin A-52 residue ribosomal protein fusion product 1 91 12 B20140219_SF055_05 B20140219_SF055_05 TB244918.[MT7]-YNC[CAM]DK[MT7].2y4_1.heavy 494.244 / 680.315 4004.0 15.796500205993652 45 15 10 10 10 1.6011743399940017 42.75461505788877 0.0 3 0.9515058784981779 5.5814488026726226 4004.0 54.599999999999994 0.0 - - - - - - - 103.0625 8 16 UBA52 ubiquitin A-52 residue ribosomal protein fusion product 1 93 12 B20140219_SF055_05 B20140219_SF055_05 TB244918.[MT7]-YNC[CAM]DK[MT7].2b4_1.heavy 494.244 / 697.273 4168.0 15.796500205993652 45 15 10 10 10 1.6011743399940017 42.75461505788877 0.0 3 0.9515058784981779 5.5814488026726226 4168.0 31.990369346965096 0.0 - - - - - - - 193.7058823529412 8 17 UBA52 ubiquitin A-52 residue ribosomal protein fusion product 1 95 12 B20140219_SF055_05 B20140219_SF055_05 TB244918.[MT7]-YNC[CAM]DK[MT7].2y3_1.heavy 494.244 / 566.273 2304.0 15.796500205993652 45 15 10 10 10 1.6011743399940017 42.75461505788877 0.0 3 0.9515058784981779 5.5814488026726226 2304.0 7.864423195794984 0.0 - - - - - - - 219.5625 4 16 UBA52 ubiquitin A-52 residue ribosomal protein fusion product 1 97 13 B20140219_SF055_05 B20140219_SF055_05 TB469781.[MT7]-LFC[CAM]C[CAM]FPNSMVVEHPEFLK[MT7].4y5_1.heavy 636.319 / 777.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 99 13 B20140219_SF055_05 B20140219_SF055_05 TB469781.[MT7]-LFC[CAM]C[CAM]FPNSMVVEHPEFLK[MT7].4b4_1.heavy 636.319 / 725.323 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 101 13 B20140219_SF055_05 B20140219_SF055_05 TB469781.[MT7]-LFC[CAM]C[CAM]FPNSMVVEHPEFLK[MT7].4y3_1.heavy 636.319 / 551.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 103 13 B20140219_SF055_05 B20140219_SF055_05 TB469781.[MT7]-LFC[CAM]C[CAM]FPNSMVVEHPEFLK[MT7].4b3_1.heavy 636.319 / 565.292 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 105 14 B20140219_SF055_05 B20140219_SF055_05 TB469285.[MT7]-YNTPK[MT7].2b3_1.heavy 455.765 / 523.263 10217.0 17.197399139404297 44 14 10 10 10 2.3957139708584463 41.74121001772487 0.0 3 0.9427315114479282 5.1322733885700345 10217.0 33.01849937899658 0.0 - - - - - - - 287.57142857142856 20 14 RPL5 ribosomal protein L5 107 14 B20140219_SF055_05 B20140219_SF055_05 TB469285.[MT7]-YNTPK[MT7].2y4_1.heavy 455.765 / 603.358 24821.0 17.197399139404297 44 14 10 10 10 2.3957139708584463 41.74121001772487 0.0 3 0.9427315114479282 5.1322733885700345 24821.0 30.64946633458624 0.0 - - - - - - - 278.6363636363636 49 11 RPL5 ribosomal protein L5 109 14 B20140219_SF055_05 B20140219_SF055_05 TB469285.[MT7]-YNTPK[MT7].2y3_1.heavy 455.765 / 489.315 10277.0 17.197399139404297 44 14 10 10 10 2.3957139708584463 41.74121001772487 0.0 3 0.9427315114479282 5.1322733885700345 10277.0 20.29719332168339 0.0 - - - - - - - 349.72727272727275 20 11 RPL5 ribosomal protein L5 111 15 B20140219_SF055_05 B20140219_SF055_05 TB469387.[MT7]-IVEYEK[MT7].2y4_1.heavy 534.813 / 712.363 29274.0 24.918399810791016 47 17 10 10 10 3.8945198136145485 25.677106494725688 0.0 3 0.9775733202885524 8.225548603625834 29274.0 64.54559459612874 0.0 - - - - - - - 729.8181818181819 58 11 ATP5H ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d 113 15 B20140219_SF055_05 B20140219_SF055_05 TB469387.[MT7]-IVEYEK[MT7].2y5_1.heavy 534.813 / 811.432 55955.0 24.918399810791016 47 17 10 10 10 3.8945198136145485 25.677106494725688 0.0 3 0.9775733202885524 8.225548603625834 55955.0 88.36017255038662 0.0 - - - - - - - 653.8181818181819 111 11 ATP5H ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d 115 15 B20140219_SF055_05 B20140219_SF055_05 TB469387.[MT7]-IVEYEK[MT7].2y3_1.heavy 534.813 / 583.321 29901.0 24.918399810791016 47 17 10 10 10 3.8945198136145485 25.677106494725688 0.0 3 0.9775733202885524 8.225548603625834 29901.0 119.45142441637965 0.0 - - - - - - - 312.26666666666665 59 15 ATP5H ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d 117 15 B20140219_SF055_05 B20140219_SF055_05 TB469387.[MT7]-IVEYEK[MT7].2b5_1.heavy 534.813 / 778.41 9159.0 24.918399810791016 47 17 10 10 10 3.8945198136145485 25.677106494725688 0.0 3 0.9775733202885524 8.225548603625834 9159.0 28.021620843989773 0.0 - - - - - - - 233.31578947368422 18 19 ATP5H ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d 119 16 B20140219_SF055_05 B20140219_SF055_05 TB469281.[MT7]-SLTYFSARK[MT7].3y7_1.heavy 454.266 / 1016.56 N/A 27.650999069213867 38 8 10 10 10 0.5131533519394867 111.17356133247362 0.0 3 0.7523358815907331 2.4267795896293736 0.0 0.0 4.0 - - - - - - - 0.0 0 0 MRPL35 mitochondrial ribosomal protein L35 121 16 B20140219_SF055_05 B20140219_SF055_05 TB469281.[MT7]-SLTYFSARK[MT7].3y6_1.heavy 454.266 / 915.517 1701.0 27.650999069213867 38 8 10 10 10 0.5131533519394867 111.17356133247362 0.0 3 0.7523358815907331 2.4267795896293736 1701.0 41.1877358490566 0.0 - - - - - - - 106.08333333333333 3 12 MRPL35 mitochondrial ribosomal protein L35 123 16 B20140219_SF055_05 B20140219_SF055_05 TB469281.[MT7]-SLTYFSARK[MT7].3y7_2.heavy 454.266 / 508.786 61181.0 27.650999069213867 38 8 10 10 10 0.5131533519394867 111.17356133247362 0.0 3 0.7523358815907331 2.4267795896293736 61181.0 93.38082671715446 0.0 - - - - - - - 1149.375 122 8 MRPL35 mitochondrial ribosomal protein L35 125 16 B20140219_SF055_05 B20140219_SF055_05 TB469281.[MT7]-SLTYFSARK[MT7].3y5_1.heavy 454.266 / 752.453 30511.0 27.650999069213867 38 8 10 10 10 0.5131533519394867 111.17356133247362 0.0 3 0.7523358815907331 2.4267795896293736 30511.0 91.16324132588124 0.0 - - - - - - - 277.44444444444446 61 18 MRPL35 mitochondrial ribosomal protein L35 127 17 B20140219_SF055_05 B20140219_SF055_05 TB245176.[MT7]-AVLFC[CAM]LSDDK[MT7].2y4_1.heavy 728.391 / 608.301 7650.0 36.67290115356445 50 20 10 10 10 17.790230112245435 5.62106276136179 0.0 3 0.9949026965527257 17.278557213860406 7650.0 18.3589353550637 0.0 - - - - - - - 664.2857142857143 15 7 CFL2 cofilin 2 (muscle) 129 17 B20140219_SF055_05 B20140219_SF055_05 TB245176.[MT7]-AVLFC[CAM]LSDDK[MT7].2y8_1.heavy 728.391 / 1141.57 5527.0 36.67290115356445 50 20 10 10 10 17.790230112245435 5.62106276136179 0.0 3 0.9949026965527257 17.278557213860406 5527.0 52.102132684785886 0.0 - - - - - - - 116.45454545454545 11 22 CFL2 cofilin 2 (muscle) 131 17 B20140219_SF055_05 B20140219_SF055_05 TB245176.[MT7]-AVLFC[CAM]LSDDK[MT7].2y6_1.heavy 728.391 / 881.416 7077.0 36.67290115356445 50 20 10 10 10 17.790230112245435 5.62106276136179 0.0 3 0.9949026965527257 17.278557213860406 7077.0 24.234383561643835 0.0 - - - - - - - 683.5714285714286 14 7 CFL2 cofilin 2 (muscle) 133 17 B20140219_SF055_05 B20140219_SF055_05 TB245176.[MT7]-AVLFC[CAM]LSDDK[MT7].2y7_1.heavy 728.391 / 1028.48 10548.0 36.67290115356445 50 20 10 10 10 17.790230112245435 5.62106276136179 0.0 3 0.9949026965527257 17.278557213860406 10548.0 34.315082423960995 0.0 - - - - - - - 203.77272727272728 21 22 CFL2 cofilin 2 (muscle) 135 18 B20140219_SF055_05 B20140219_SF055_05 TB469280.[MT7]-QINDK[MT7].2b3_1.heavy 453.268 / 500.295 2156.0 15.536999702453613 41 11 10 10 10 0.7408520796040877 77.18771372526024 0.0 3 0.8736497626958544 3.4347236336317573 2156.0 14.363772357723576 0.0 - - - - - - - 257.26666666666665 4 15 FAM96A family with sequence similarity 96, member A 137 18 B20140219_SF055_05 B20140219_SF055_05 TB469280.[MT7]-QINDK[MT7].2y4_1.heavy 453.268 / 633.369 21913.0 15.536999702453613 41 11 10 10 10 0.7408520796040877 77.18771372526024 0.0 3 0.8736497626958544 3.4347236336317573 21913.0 52.33914906103286 0.0 - - - - - - - 735.4444444444445 43 9 FAM96A family with sequence similarity 96, member A 139 18 B20140219_SF055_05 B20140219_SF055_05 TB469280.[MT7]-QINDK[MT7].2b4_1.heavy 453.268 / 615.322 22114.0 15.536999702453613 41 11 10 10 10 0.7408520796040877 77.18771372526024 0.0 3 0.8736497626958544 3.4347236336317573 22114.0 39.21944312100248 0.0 - - - - - - - 724.3333333333334 44 9 FAM96A family with sequence similarity 96, member A 141 18 B20140219_SF055_05 B20140219_SF055_05 TB469280.[MT7]-QINDK[MT7].2y3_1.heavy 453.268 / 520.285 9227.0 15.536999702453613 41 11 10 10 10 0.7408520796040877 77.18771372526024 0.0 3 0.8736497626958544 3.4347236336317573 9227.0 26.274558897876638 0.0 - - - - - - - 609.0 18 7 FAM96A family with sequence similarity 96, member A 143 19 B20140219_SF055_05 B20140219_SF055_05 TB106426.[MT7]-YFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQR.4b4_1.heavy 1145.55 / 639.362 4692.0 47.197898864746094 46 16 10 10 10 7.0224736882399945 14.23999639435637 0.0 3 0.9684539938306794 6.930137139392492 4692.0 4.544462489456258 1.0 - - - - - - - 222.47058823529412 9 17 SST somatostatin 145 19 B20140219_SF055_05 B20140219_SF055_05 TB106426.[MT7]-YFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQR.4y20_2.heavy 1145.55 / 1194.06 4022.0 47.197898864746094 46 16 10 10 10 7.0224736882399945 14.23999639435637 0.0 3 0.9684539938306794 6.930137139392492 4022.0 72.96743169398907 0.0 - - - - - - - 187.06666666666666 8 15 SST somatostatin 147 19 B20140219_SF055_05 B20140219_SF055_05 TB106426.[MT7]-YFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQR.4b5_1.heavy 1145.55 / 768.405 11578.0 47.197898864746094 46 16 10 10 10 7.0224736882399945 14.23999639435637 0.0 3 0.9684539938306794 6.930137139392492 11578.0 14.12631313131313 1.0 - - - - - - - 626.4285714285714 23 7 SST somatostatin 149 19 B20140219_SF055_05 B20140219_SF055_05 TB106426.[MT7]-YFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQR.4b3_1.heavy 1145.55 / 568.325 4448.0 47.197898864746094 46 16 10 10 10 7.0224736882399945 14.23999639435637 0.0 3 0.9684539938306794 6.930137139392492 4448.0 14.82692011829262 0.0 - - - - - - - 174.21428571428572 8 14 SST somatostatin 151 20 B20140219_SF055_05 B20140219_SF055_05 TB106423.[MT7]-DFRDYLMSTHFWGPVANWGLPIAAINDMK[MT7].4y4_1.heavy 914.212 / 651.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - BRP44L brain protein 44-like 153 20 B20140219_SF055_05 B20140219_SF055_05 TB106423.[MT7]-DFRDYLMSTHFWGPVANWGLPIAAINDMK[MT7].4y9_1.heavy 914.212 / 1116.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - BRP44L brain protein 44-like 155 20 B20140219_SF055_05 B20140219_SF055_05 TB106423.[MT7]-DFRDYLMSTHFWGPVANWGLPIAAINDMK[MT7].4y7_1.heavy 914.212 / 906.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - BRP44L brain protein 44-like 157 20 B20140219_SF055_05 B20140219_SF055_05 TB106423.[MT7]-DFRDYLMSTHFWGPVANWGLPIAAINDMK[MT7].4y6_1.heavy 914.212 / 835.446 N/A N/A - - - - - - - - - 0.0 - - - - - - - BRP44L brain protein 44-like 159 21 B20140219_SF055_05 B20140219_SF055_05 TB469539.[MT7]-AYQLLSEC[CAM]LR.2b3_1.heavy 698.872 / 507.268 23860.0 36.06560134887695 50 20 10 10 10 8.206189927806962 12.185923172597613 0.0 3 0.9964696052270018 20.7645671312355 23860.0 208.89284573350147 0.0 - - - - - - - 210.4375 47 16 METTL12 methyltransferase like 12 161 21 B20140219_SF055_05 B20140219_SF055_05 TB469539.[MT7]-AYQLLSEC[CAM]LR.2y9_1.heavy 698.872 / 1181.6 16248.0 36.06560134887695 50 20 10 10 10 8.206189927806962 12.185923172597613 0.0 3 0.9964696052270018 20.7645671312355 16248.0 232.5053940345369 0.0 - - - - - - - 110.66666666666667 32 15 METTL12 methyltransferase like 12 163 21 B20140219_SF055_05 B20140219_SF055_05 TB469539.[MT7]-AYQLLSEC[CAM]LR.2y6_1.heavy 698.872 / 777.392 16004.0 36.06560134887695 50 20 10 10 10 8.206189927806962 12.185923172597613 0.0 3 0.9964696052270018 20.7645671312355 16004.0 27.832741880835222 1.0 - - - - - - - 264.05882352941177 35 17 METTL12 methyltransferase like 12 165 21 B20140219_SF055_05 B20140219_SF055_05 TB469539.[MT7]-AYQLLSEC[CAM]LR.2y7_1.heavy 698.872 / 890.476 15565.0 36.06560134887695 50 20 10 10 10 8.206189927806962 12.185923172597613 0.0 3 0.9964696052270018 20.7645671312355 15565.0 66.9464238422947 0.0 - - - - - - - 227.73333333333332 31 15 METTL12 methyltransferase like 12 167 22 B20140219_SF055_05 B20140219_SF055_05 TB106424.[MT7]-FQSSAVMALQEAC[CAM]ESYLVGLFEDTNLC[CAM]VIHAK[MT7].4b8_1.heavy 980.488 / 966.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIST3H3 histone cluster 3, H3 169 22 B20140219_SF055_05 B20140219_SF055_05 TB106424.[MT7]-FQSSAVMALQEAC[CAM]ESYLVGLFEDTNLC[CAM]VIHAK[MT7].4b5_1.heavy 980.488 / 665.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIST3H3 histone cluster 3, H3 171 22 B20140219_SF055_05 B20140219_SF055_05 TB106424.[MT7]-FQSSAVMALQEAC[CAM]ESYLVGLFEDTNLC[CAM]VIHAK[MT7].4b9_1.heavy 980.488 / 1079.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIST3H3 histone cluster 3, H3 173 22 B20140219_SF055_05 B20140219_SF055_05 TB106424.[MT7]-FQSSAVMALQEAC[CAM]ESYLVGLFEDTNLC[CAM]VIHAK[MT7].4b6_1.heavy 980.488 / 764.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIST3H3 histone cluster 3, H3 175 23 B20140219_SF055_05 B20140219_SF055_05 TB106421.[MT7]-ENC[CAM]TC[CAM]SSC[CAM]LLRAPTISDLLNDQDLLDVIR.4y5_1.heavy 884.688 / 615.382 2431.0 47.97560119628906 48 18 10 10 10 4.821969435794124 20.738414320440658 0.0 3 0.9830187933111618 9.457178866491272 2431.0 17.883933463796478 0.0 - - - - - - - 204.78947368421052 4 19 EDARADD EDAR-associated death domain 177 23 B20140219_SF055_05 B20140219_SF055_05 TB106421.[MT7]-ENC[CAM]TC[CAM]SSC[CAM]LLRAPTISDLLNDQDLLDVIR.4y10_1.heavy 884.688 / 1200.62 2492.0 47.97560119628906 48 18 10 10 10 4.821969435794124 20.738414320440658 0.0 3 0.9830187933111618 9.457178866491272 2492.0 17.38651721897336 0.0 - - - - - - - 182.28571428571428 4 14 EDARADD EDAR-associated death domain 179 23 B20140219_SF055_05 B20140219_SF055_05 TB106421.[MT7]-ENC[CAM]TC[CAM]SSC[CAM]LLRAPTISDLLNDQDLLDVIR.4b17_2.heavy 884.688 / 1055.48 9177.0 47.97560119628906 48 18 10 10 10 4.821969435794124 20.738414320440658 0.0 3 0.9830187933111618 9.457178866491272 9177.0 32.804223529411765 0.0 - - - - - - - 243.07692307692307 18 13 EDARADD EDAR-associated death domain 181 23 B20140219_SF055_05 B20140219_SF055_05 TB106421.[MT7]-ENC[CAM]TC[CAM]SSC[CAM]LLRAPTISDLLNDQDLLDVIR.4y6_1.heavy 884.688 / 728.466 3099.0 47.97560119628906 48 18 10 10 10 4.821969435794124 20.738414320440658 0.0 3 0.9830187933111618 9.457178866491272 3099.0 12.720678576615832 0.0 - - - - - - - 210.73333333333332 6 15 EDARADD EDAR-associated death domain 183 24 B20140219_SF055_05 B20140219_SF055_05 TB469384.[MT7]-EIHSC[CAM]K[MT7].2b3_1.heavy 531.286 / 524.295 615.0 14.725074768066406 32 14 4 6 8 1.7606608656798954 36.413089030103656 0.03730010986328125 4 0.9378943519849037 4.926325493805665 615.0 7.0 3.0 - - - - - - - 160.43478260869566 4 23 CRYGS crystallin, gamma S 185 24 B20140219_SF055_05 B20140219_SF055_05 TB469384.[MT7]-EIHSC[CAM]K[MT7].2y4_1.heavy 531.286 / 675.336 2297.0 14.725074768066406 32 14 4 6 8 1.7606608656798954 36.413089030103656 0.03730010986328125 4 0.9378943519849037 4.926325493805665 2297.0 5.602439024390244 1.0 - - - - - - - 147.6 4 15 CRYGS crystallin, gamma S 187 24 B20140219_SF055_05 B20140219_SF055_05 TB469384.[MT7]-EIHSC[CAM]K[MT7].2y5_1.heavy 531.286 / 788.42 902.0 14.725074768066406 32 14 4 6 8 1.7606608656798954 36.413089030103656 0.03730010986328125 4 0.9378943519849037 4.926325493805665 902.0 8.8 3.0 - - - - - - - 151.1875 8 16 CRYGS crystallin, gamma S 189 24 B20140219_SF055_05 B20140219_SF055_05 TB469384.[MT7]-EIHSC[CAM]K[MT7].2y3_1.heavy 531.286 / 538.278 2215.0 14.725074768066406 32 14 4 6 8 1.7606608656798954 36.413089030103656 0.03730010986328125 4 0.9378943519849037 4.926325493805665 2215.0 16.027235772357724 0.0 - - - - - - - 117.14285714285714 4 14 CRYGS crystallin, gamma S 191 25 B20140219_SF055_05 B20140219_SF055_05 TB469289.[MT7]-QLQIK[MT7].2b3_1.heavy 459.305 / 514.311 13992.0 24.06717538833618 39 15 10 6 8 3.2007327281727247 31.24284608952316 0.031099319458007812 4 0.9597317896433931 6.129329522900273 13992.0 20.616094987579974 1.0 - - - - - - - 1235.2857142857142 31 7 AADAT aminoadipate aminotransferase 193 25 B20140219_SF055_05 B20140219_SF055_05 TB469289.[MT7]-QLQIK[MT7].2y4_1.heavy 459.305 / 645.442 27788.0 24.06717538833618 39 15 10 6 8 3.2007327281727247 31.24284608952316 0.031099319458007812 4 0.9597317896433931 6.129329522900273 27788.0 52.3127602905569 0.0 - - - - - - - 711.4 55 10 AADAT aminoadipate aminotransferase 195 25 B20140219_SF055_05 B20140219_SF055_05 TB469289.[MT7]-QLQIK[MT7].2b4_1.heavy 459.305 / 627.395 7232.0 24.06717538833618 39 15 10 6 8 3.2007327281727247 31.24284608952316 0.031099319458007812 4 0.9597317896433931 6.129329522900273 7232.0 17.64458719037826 0.0 - - - - - - - 695.7 14 10 AADAT aminoadipate aminotransferase 197 25 B20140219_SF055_05 B20140219_SF055_05 TB469289.[MT7]-QLQIK[MT7].2y3_1.heavy 459.305 / 532.357 9079.0 24.06717538833618 39 15 10 6 8 3.2007327281727247 31.24284608952316 0.031099319458007812 4 0.9597317896433931 6.129329522900273 9079.0 15.170968083031342 0.0 - - - - - - - 710.75 18 12 AADAT aminoadipate aminotransferase 199 26 B20140219_SF055_05 B20140219_SF055_05 TB469382.[MT7]-MQIFVK[MT7].2b3_1.heavy 527.322 / 517.292 24232.0 32.945899963378906 44 14 10 10 10 1.972003728599231 43.62597785877391 0.0 3 0.9493908587636685 5.462595524288809 24232.0 16.713962029357656 0.0 - - - - - - - 2269.285714285714 48 7 RPS27A;UBA52;UBB;UBC ribosomal protein S27a;ubiquitin A-52 residue ribosomal protein fusion product 1;ubiquitin B;ubiquitin C 201 26 B20140219_SF055_05 B20140219_SF055_05 TB469382.[MT7]-MQIFVK[MT7].2y4_1.heavy 527.322 / 650.436 22509.0 32.945899963378906 44 14 10 10 10 1.972003728599231 43.62597785877391 0.0 3 0.9493908587636685 5.462595524288809 22509.0 34.935114144271566 0.0 - - - - - - - 1192.4285714285713 45 7 RPS27A;UBA52;UBB;UBC ribosomal protein S27a;ubiquitin A-52 residue ribosomal protein fusion product 1;ubiquitin B;ubiquitin C 203 26 B20140219_SF055_05 B20140219_SF055_05 TB469382.[MT7]-MQIFVK[MT7].2y5_1.heavy 527.322 / 778.494 33279.0 32.945899963378906 44 14 10 10 10 1.972003728599231 43.62597785877391 0.0 3 0.9493908587636685 5.462595524288809 33279.0 77.55753826459963 0.0 - - - - - - - 741.7777777777778 66 9 RPS27A;UBA52;UBB;UBC ribosomal protein S27a;ubiquitin A-52 residue ribosomal protein fusion product 1;ubiquitin B;ubiquitin C 205 26 B20140219_SF055_05 B20140219_SF055_05 TB469382.[MT7]-MQIFVK[MT7].2y3_1.heavy 527.322 / 537.352 43833.0 32.945899963378906 44 14 10 10 10 1.972003728599231 43.62597785877391 0.0 3 0.9493908587636685 5.462595524288809 43833.0 59.8026541351439 0.0 - - - - - - - 760.625 87 8 RPS27A;UBA52;UBB;UBC ribosomal protein S27a;ubiquitin A-52 residue ribosomal protein fusion product 1;ubiquitin B;ubiquitin C 207 27 B20140219_SF055_05 B20140219_SF055_05 TB106420.[MT7]-VGGTK[MT7]PAGGDFGEVLNSAANASATTTEPLPEK[MT7].4b16_2.heavy 880.464 / 894.48 6172.0 34.506224632263184 43 17 10 6 10 5.63200999344606 17.75565031247627 0.033702850341796875 3 0.9714151624956211 7.28206450384405 6172.0 71.08530330295466 0.0 - - - - - - - 167.41176470588235 12 17 TPD52 tumor protein D52 209 27 B20140219_SF055_05 B20140219_SF055_05 TB106420.[MT7]-VGGTK[MT7]PAGGDFGEVLNSAANASATTTEPLPEK[MT7].4b14_2.heavy 880.464 / 780.917 22165.0 34.506224632263184 43 17 10 6 10 5.63200999344606 17.75565031247627 0.033702850341796875 3 0.9714151624956211 7.28206450384405 22165.0 110.21756108134889 0.0 - - - - - - - 284.9230769230769 44 13 TPD52 tumor protein D52 211 27 B20140219_SF055_05 B20140219_SF055_05 TB106420.[MT7]-VGGTK[MT7]PAGGDFGEVLNSAANASATTTEPLPEK[MT7].4y3_1.heavy 880.464 / 517.31 40358.0 34.506224632263184 43 17 10 6 10 5.63200999344606 17.75565031247627 0.033702850341796875 3 0.9714151624956211 7.28206450384405 40358.0 103.351896647023 0.0 - - - - - - - 735.8571428571429 80 7 TPD52 tumor protein D52 213 27 B20140219_SF055_05 B20140219_SF055_05 TB106420.[MT7]-VGGTK[MT7]PAGGDFGEVLNSAANASATTTEPLPEK[MT7].4b10_2.heavy 880.464 / 564.816 4723.0 34.506224632263184 43 17 10 6 10 5.63200999344606 17.75565031247627 0.033702850341796875 3 0.9714151624956211 7.28206450384405 4723.0 13.580993788819876 1.0 - - - - - - - 191.61904761904762 9 21 TPD52 tumor protein D52 215 28 B20140219_SF055_05 B20140219_SF055_05 TB244827.[MT7]-GPGQVAR.2y5_1.heavy 414.744 / 530.305 5283.0 15.398950099945068 40 14 10 6 10 2.367094116068555 42.24589099401227 0.039099693298339844 3 0.9343238349670213 4.78908371269629 5283.0 20.003226496507843 0.0 - - - - - - - 241.47058823529412 10 17 FRMPD2 FERM and PDZ domain containing 2 217 28 B20140219_SF055_05 B20140219_SF055_05 TB244827.[MT7]-GPGQVAR.2b4_1.heavy 414.744 / 484.264 12463.0 15.398950099945068 40 14 10 6 10 2.367094116068555 42.24589099401227 0.039099693298339844 3 0.9343238349670213 4.78908371269629 12463.0 41.0238048795591 0.0 - - - - - - - 656.3 24 10 FRMPD2 FERM and PDZ domain containing 2 219 28 B20140219_SF055_05 B20140219_SF055_05 TB244827.[MT7]-GPGQVAR.2y6_1.heavy 414.744 / 627.357 49492.0 15.398950099945068 40 14 10 6 10 2.367094116068555 42.24589099401227 0.039099693298339844 3 0.9343238349670213 4.78908371269629 49492.0 263.9793381605691 0.0 - - - - - - - 261.5 98 10 FRMPD2 FERM and PDZ domain containing 2 221 28 B20140219_SF055_05 B20140219_SF055_05 TB244827.[MT7]-GPGQVAR.2b5_1.heavy 414.744 / 583.332 9437.0 15.398950099945068 40 14 10 6 10 2.367094116068555 42.24589099401227 0.039099693298339844 3 0.9343238349670213 4.78908371269629 9437.0 13.158035982008995 1.0 - - - - - - - 300.42857142857144 18 14 FRMPD2 FERM and PDZ domain containing 2 223 29 B20140219_SF055_05 B20140219_SF055_05 TB469795.[MT7]-ITHEVDELTQIIADVSQDPTLPR.4y5_1.heavy 684.365 / 583.356 86407.0 48.309200286865234 44 14 10 10 10 3.028775136940597 33.01664715229115 0.0 3 0.9368739036588697 4.885920356992495 86407.0 309.6385928705441 0.0 - - - - - - - 338.14285714285717 172 14 POLR2I polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa 225 29 B20140219_SF055_05 B20140219_SF055_05 TB469795.[MT7]-ITHEVDELTQIIADVSQDPTLPR.4b7_1.heavy 684.365 / 968.481 8108.0 48.309200286865234 44 14 10 10 10 3.028775136940597 33.01664715229115 0.0 3 0.9368739036588697 4.885920356992495 8108.0 158.93025244940287 0.0 - - - - - - - 124.88888888888889 16 9 POLR2I polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa 227 29 B20140219_SF055_05 B20140219_SF055_05 TB469795.[MT7]-ITHEVDELTQIIADVSQDPTLPR.4b4_1.heavy 684.365 / 625.343 5977.0 48.309200286865234 44 14 10 10 10 3.028775136940597 33.01664715229115 0.0 3 0.9368739036588697 4.885920356992495 5977.0 60.38908662900188 0.0 - - - - - - - 199.6875 11 16 POLR2I polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa 229 29 B20140219_SF055_05 B20140219_SF055_05 TB469795.[MT7]-ITHEVDELTQIIADVSQDPTLPR.4b6_1.heavy 684.365 / 839.438 3433.0 48.309200286865234 44 14 10 10 10 3.028775136940597 33.01664715229115 0.0 3 0.9368739036588697 4.885920356992495 3433.0 4.513091852182762 1.0 - - - - - - - 168.46153846153845 10 13 POLR2I polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa 231 30 B20140219_SF055_05 B20140219_SF055_05 TB469793.[MT7]-LIAVIGDEDTVTGFLLGGIGELNK[MT7].4y5_1.heavy 683.889 / 704.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1F ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F 233 30 B20140219_SF055_05 B20140219_SF055_05 TB469793.[MT7]-LIAVIGDEDTVTGFLLGGIGELNK[MT7].4y8_1.heavy 683.889 / 931.533 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1F ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F 235 30 B20140219_SF055_05 B20140219_SF055_05 TB469793.[MT7]-LIAVIGDEDTVTGFLLGGIGELNK[MT7].4b4_1.heavy 683.889 / 541.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1F ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F 237 30 B20140219_SF055_05 B20140219_SF055_05 TB469793.[MT7]-LIAVIGDEDTVTGFLLGGIGELNK[MT7].4y3_1.heavy 683.889 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1F ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F 239 31 B20140219_SF055_05 B20140219_SF055_05 TB469531.[MT7]-TALLEANSTPAPAGATVPPR.3y7_1.heavy 693.384 / 697.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLEKHB1 pleckstrin homology domain containing, family B (evectins) member 1 241 31 B20140219_SF055_05 B20140219_SF055_05 TB469531.[MT7]-TALLEANSTPAPAGATVPPR.3y11_1.heavy 693.384 / 1033.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLEKHB1 pleckstrin homology domain containing, family B (evectins) member 1 243 31 B20140219_SF055_05 B20140219_SF055_05 TB469531.[MT7]-TALLEANSTPAPAGATVPPR.3b4_1.heavy 693.384 / 543.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLEKHB1 pleckstrin homology domain containing, family B (evectins) member 1 245 31 B20140219_SF055_05 B20140219_SF055_05 TB469531.[MT7]-TALLEANSTPAPAGATVPPR.3y9_1.heavy 693.384 / 865.489 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLEKHB1 pleckstrin homology domain containing, family B (evectins) member 1 247 32 B20140219_SF055_05 B20140219_SF055_05 TB469799.[MT7]-AIPAGC[CAM]GDEEEEEEESILDTVLK[MT7].4y4_1.heavy 706.094 / 604.415 23666.0 43.64762496948242 48 20 10 8 10 11.6410768253192 8.590270599580721 0.0196990966796875 3 0.9941795025472242 16.168563701474234 23666.0 36.695766583839294 0.0 - - - - - - - 681.4666666666667 47 15 CPLX2 complexin 2 249 32 B20140219_SF055_05 B20140219_SF055_05 TB469799.[MT7]-AIPAGC[CAM]GDEEEEEEESILDTVLK[MT7].4y5_1.heavy 706.094 / 719.442 30774.0 43.64762496948242 48 20 10 8 10 11.6410768253192 8.590270599580721 0.0196990966796875 3 0.9941795025472242 16.168563701474234 30774.0 107.46778465346534 0.0 - - - - - - - 780.6666666666666 61 9 CPLX2 complexin 2 251 32 B20140219_SF055_05 B20140219_SF055_05 TB469799.[MT7]-AIPAGC[CAM]GDEEEEEEESILDTVLK[MT7].4b5_1.heavy 706.094 / 554.342 20442.0 43.64762496948242 48 20 10 8 10 11.6410768253192 8.590270599580721 0.0196990966796875 3 0.9941795025472242 16.168563701474234 20442.0 75.17748833265861 0.0 - - - - - - - 651.0 40 8 CPLX2 complexin 2 253 32 B20140219_SF055_05 B20140219_SF055_05 TB469799.[MT7]-AIPAGC[CAM]GDEEEEEEESILDTVLK[MT7].4y6_1.heavy 706.094 / 832.526 21765.0 43.64762496948242 48 20 10 8 10 11.6410768253192 8.590270599580721 0.0196990966796875 3 0.9941795025472242 16.168563701474234 21765.0 69.69760386450267 0.0 - - - - - - - 802.7142857142857 43 7 CPLX2 complexin 2 255 33 B20140219_SF055_05 B20140219_SF055_05 TB469797.[MT7]-EWVSALIHSELAEINLLTHHRR.4b4_1.heavy 692.882 / 646.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - C4orf17 chromosome 4 open reading frame 17 257 33 B20140219_SF055_05 B20140219_SF055_05 TB469797.[MT7]-EWVSALIHSELAEINLLTHHRR.4b5_1.heavy 692.882 / 717.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - C4orf17 chromosome 4 open reading frame 17 259 33 B20140219_SF055_05 B20140219_SF055_05 TB469797.[MT7]-EWVSALIHSELAEINLLTHHRR.4b6_1.heavy 692.882 / 830.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - C4orf17 chromosome 4 open reading frame 17 261 33 B20140219_SF055_05 B20140219_SF055_05 TB469797.[MT7]-EWVSALIHSELAEINLLTHHRR.4b3_1.heavy 692.882 / 559.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - C4orf17 chromosome 4 open reading frame 17 263 34 B20140219_SF055_05 B20140219_SF055_05 TB245423.[MT7]-YFLAELLSEPNQTENDALEPEDLSQAAEQDEMR.4y10_1.heavy 985.71 / 1164.49 1059.0 47.44459915161133 48 18 10 10 10 7.725459689535784 12.944213550871421 0.0 3 0.9857738981828627 10.334826866555373 1059.0 -0.3165251456505725 2.0 - - - - - - - 158.54545454545453 2 11 SST somatostatin 265 34 B20140219_SF055_05 B20140219_SF055_05 TB245423.[MT7]-YFLAELLSEPNQTENDALEPEDLSQAAEQDEMR.4b5_1.heavy 985.71 / 768.405 4672.0 47.44459915161133 48 18 10 10 10 7.725459689535784 12.944213550871421 0.0 3 0.9857738981828627 10.334826866555373 4672.0 18.435028383152716 0.0 - - - - - - - 237.375 9 16 SST somatostatin 267 34 B20140219_SF055_05 B20140219_SF055_05 TB245423.[MT7]-YFLAELLSEPNQTENDALEPEDLSQAAEQDEMR.4b3_1.heavy 985.71 / 568.325 2678.0 47.44459915161133 48 18 10 10 10 7.725459689535784 12.944213550871421 0.0 3 0.9857738981828627 10.334826866555373 2678.0 15.14200559289604 0.0 - - - - - - - 153.94117647058823 5 17 SST somatostatin 269 34 B20140219_SF055_05 B20140219_SF055_05 TB245423.[MT7]-YFLAELLSEPNQTENDALEPEDLSQAAEQDEMR.4b6_1.heavy 985.71 / 881.489 3550.0 47.44459915161133 48 18 10 10 10 7.725459689535784 12.944213550871421 0.0 3 0.9857738981828627 10.334826866555373 3550.0 37.53362248995984 0.0 - - - - - - - 170.33333333333334 7 15 SST somatostatin 271 35 B20140219_SF055_05 B20140219_SF055_05 TB469633.[MT7]-EAEEHQETQC[CAM]LR.2y8_1.heavy 837.387 / 1071.5 1682.0 17.362199783325195 44 14 10 10 10 2.5334022716503886 32.92707989974411 0.0 3 0.9400684647180535 5.015814196142562 1682.0 45.974666666666664 0.0 - - - - - - - 60.0 3 5 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 273 35 B20140219_SF055_05 B20140219_SF055_05 TB469633.[MT7]-EAEEHQETQC[CAM]LR.2b4_1.heavy 837.387 / 603.274 2523.0 17.362199783325195 44 14 10 10 10 2.5334022716503886 32.92707989974411 0.0 3 0.9400684647180535 5.015814196142562 2523.0 15.292482977038798 0.0 - - - - - - - 165.125 5 8 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 275 35 B20140219_SF055_05 B20140219_SF055_05 TB469633.[MT7]-EAEEHQETQC[CAM]LR.2y6_1.heavy 837.387 / 806.383 721.0 17.362199783325195 44 14 10 10 10 2.5334022716503886 32.92707989974411 0.0 3 0.9400684647180535 5.015814196142562 721.0 9.373000000000001 0.0 - - - - - - - 0.0 1 0 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 277 35 B20140219_SF055_05 B20140219_SF055_05 TB469633.[MT7]-EAEEHQETQC[CAM]LR.2y7_1.heavy 837.387 / 934.441 1081.0 17.362199783325195 44 14 10 10 10 2.5334022716503886 32.92707989974411 0.0 3 0.9400684647180535 5.015814196142562 1081.0 15.269124999999999 0.0 - - - - - - - 200.16666666666666 2 6 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 279 36 B20140219_SF055_05 B20140219_SF055_05 TB245424.[MT7]-NVILTSGC[CAM]IIGAC[CAM]C[CAM]NLNTFEVIPENTVIYGADC[CAM]LR.4b8_1.heavy 1026.01 / 989.521 2044.0 46.35657501220703 43 17 10 6 10 3.816612427664966 26.201245710762624 0.0381011962890625 3 0.9752492632095418 7.828317876226671 2044.0 8.737165060003935 0.0 - - - - - - - 185.89473684210526 4 19 DCTN6 dynactin 6 281 36 B20140219_SF055_05 B20140219_SF055_05 TB245424.[MT7]-NVILTSGC[CAM]IIGAC[CAM]C[CAM]NLNTFEVIPENTVIYGADC[CAM]LR.4b9_1.heavy 1026.01 / 1102.6 1160.0 46.35657501220703 43 17 10 6 10 3.816612427664966 26.201245710762624 0.0381011962890625 3 0.9752492632095418 7.828317876226671 1160.0 1.6811594202898552 0.0 - - - - - - - 162.5 2 18 DCTN6 dynactin 6 283 36 B20140219_SF055_05 B20140219_SF055_05 TB245424.[MT7]-NVILTSGC[CAM]IIGAC[CAM]C[CAM]NLNTFEVIPENTVIYGADC[CAM]LR.4y6_1.heavy 1026.01 / 691.319 3480.0 46.35657501220703 43 17 10 6 10 3.816612427664966 26.201245710762624 0.0381011962890625 3 0.9752492632095418 7.828317876226671 3480.0 20.520896528479945 0.0 - - - - - - - 200.52631578947367 6 19 DCTN6 dynactin 6 285 36 B20140219_SF055_05 B20140219_SF055_05 TB245424.[MT7]-NVILTSGC[CAM]IIGAC[CAM]C[CAM]NLNTFEVIPENTVIYGADC[CAM]LR.4b3_1.heavy 1026.01 / 471.305 4750.0 46.35657501220703 43 17 10 6 10 3.816612427664966 26.201245710762624 0.0381011962890625 3 0.9752492632095418 7.828317876226671 4750.0 10.322193258574332 0.0 - - - - - - - 261.5263157894737 9 19 DCTN6 dynactin 6 287 37 B20140219_SF055_05 B20140219_SF055_05 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1213160.0 29.373899459838867 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1213160.0 589.5853852755079 0.0 - - - - - - - 354.0 2426 1 289 37 B20140219_SF055_05 B20140219_SF055_05 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 407181.0 29.373899459838867 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 407181.0 240.35336208719016 0.0 - - - - - - - 236.0 814 1 291 37 B20140219_SF055_05 B20140219_SF055_05 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 302689.0 29.373899459838867 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 302689.0 273.91458373757945 0.0 - - - - - - - 589.0 605 2 293 38 B20140219_SF055_05 B20140219_SF055_05 TB244820.[MT7]-ANVAK[MT7].2b3_1.heavy 395.755 / 429.258 15338.0 15.096350193023682 42 16 10 6 10 2.585706915602289 38.674143382838494 0.036299705505371094 3 0.9678081504586952 6.8598940096461565 15338.0 48.85022762699745 0.0 - - - - - - - 685.8571428571429 30 7 ATP5H;MRPL12 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d;mitochondrial ribosomal protein L12 295 38 B20140219_SF055_05 B20140219_SF055_05 TB244820.[MT7]-ANVAK[MT7].2y4_1.heavy 395.755 / 575.363 24894.0 15.096350193023682 42 16 10 6 10 2.585706915602289 38.674143382838494 0.036299705505371094 3 0.9678081504586952 6.8598940096461565 24894.0 45.447799611675634 0.0 - - - - - - - 732.0 49 10 ATP5H;MRPL12 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d;mitochondrial ribosomal protein L12 297 38 B20140219_SF055_05 B20140219_SF055_05 TB244820.[MT7]-ANVAK[MT7].2b4_1.heavy 395.755 / 500.295 4895.0 15.096350193023682 42 16 10 6 10 2.585706915602289 38.674143382838494 0.036299705505371094 3 0.9678081504586952 6.8598940096461565 4895.0 8.253505917159764 3.0 - - - - - - - 769.3333333333334 11 12 ATP5H;MRPL12 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d;mitochondrial ribosomal protein L12 299 38 B20140219_SF055_05 B20140219_SF055_05 TB244820.[MT7]-ANVAK[MT7].2y3_1.heavy 395.755 / 461.32 6247.0 15.096350193023682 42 16 10 6 10 2.585706915602289 38.674143382838494 0.036299705505371094 3 0.9678081504586952 6.8598940096461565 6247.0 21.799702790069986 0.0 - - - - - - - 615.4 12 10 ATP5H;MRPL12 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d;mitochondrial ribosomal protein L12 301 39 B20140219_SF055_05 B20140219_SF055_05 TB469791.[MT7]-LAQIHIQQQDQC[CAM]VEITEESK[MT7].3y7_1.heavy 895.797 / 979.506 14250.0 30.19099998474121 41 11 10 10 10 0.944717189143092 62.33161346400564 0.0 3 0.8786210790997497 3.505877401355391 14250.0 61.654704254583194 0.0 - - - - - - - 162.0625 28 16 DCTN3 dynactin 3 (p22) 303 39 B20140219_SF055_05 B20140219_SF055_05 TB469791.[MT7]-LAQIHIQQQDQC[CAM]VEITEESK[MT7].3b4_1.heavy 895.797 / 570.373 10776.0 30.19099998474121 41 11 10 10 10 0.944717189143092 62.33161346400564 0.0 3 0.8786210790997497 3.505877401355391 10776.0 26.47742254653392 0.0 - - - - - - - 201.57894736842104 21 19 DCTN3 dynactin 3 (p22) 305 39 B20140219_SF055_05 B20140219_SF055_05 TB469791.[MT7]-LAQIHIQQQDQC[CAM]VEITEESK[MT7].3b5_1.heavy 895.797 / 707.432 9657.0 30.19099998474121 41 11 10 10 10 0.944717189143092 62.33161346400564 0.0 3 0.8786210790997497 3.505877401355391 9657.0 50.63468298362702 0.0 - - - - - - - 176.8421052631579 19 19 DCTN3 dynactin 3 (p22) 307 39 B20140219_SF055_05 B20140219_SF055_05 TB469791.[MT7]-LAQIHIQQQDQC[CAM]VEITEESK[MT7].3y5_1.heavy 895.797 / 737.38 19608.0 30.19099998474121 41 11 10 10 10 0.944717189143092 62.33161346400564 0.0 3 0.8786210790997497 3.505877401355391 19608.0 232.6372881355932 0.0 - - - - - - - 145.4 39 15 DCTN3 dynactin 3 (p22) 309 40 B20140219_SF055_05 B20140219_SF055_05 TB244823.[MT7]-LPFQR.2b3_1.heavy 402.746 / 502.315 13080.0 30.07830047607422 50 20 10 10 10 3.9534622165985676 17.535826815235236 0.0 3 0.9992887544512841 46.27291348345342 13080.0 15.504338855513074 0.0 - - - - - - - 712.125 26 8 HIST2H3C;H3F3A;H3F3B;HIST2H3A;H3F3C;HIST2H3D;HIST3H3;HIST1H3A;HIST1H3D;HIST1H3C;HIST1H3E;HIST1H3I;HIST1H3G;HIST1H3J;HIST1H3H;HIST1H3B;HIST1H3F histone cluster 2, H3c;H3 histone, family 3A;H3 histone, family 3B (H3.3B);histone cluster 2, H3a;H3 histone, family 3C;histone cluster 2, H3d;histone cluster 3, H3;histone cluster 1, H3a;histone cluster 1, H3d;histone cluster 1, H3c;histone cluster 1, H3e;histone cluster 1, H3i;histone cluster 1, H3g;histone cluster 1, H3j;histone cluster 1, H3h;histone cluster 1, H3b;histone cluster 1, H3f 311 40 B20140219_SF055_05 B20140219_SF055_05 TB244823.[MT7]-LPFQR.2y4_1.heavy 402.746 / 547.299 287469.0 30.07830047607422 50 20 10 10 10 3.9534622165985676 17.535826815235236 0.0 3 0.9992887544512841 46.27291348345342 287469.0 188.16260991144944 0.0 - - - - - - - 232.5 574 4 HIST2H3C;H3F3A;H3F3B;HIST2H3A;H3F3C;HIST2H3D;HIST3H3;HIST1H3A;HIST1H3D;HIST1H3C;HIST1H3E;HIST1H3I;HIST1H3G;HIST1H3J;HIST1H3H;HIST1H3B;HIST1H3F histone cluster 2, H3c;H3 histone, family 3A;H3 histone, family 3B (H3.3B);histone cluster 2, H3a;H3 histone, family 3C;histone cluster 2, H3d;histone cluster 3, H3;histone cluster 1, H3a;histone cluster 1, H3d;histone cluster 1, H3c;histone cluster 1, H3e;histone cluster 1, H3i;histone cluster 1, H3g;histone cluster 1, H3j;histone cluster 1, H3h;histone cluster 1, H3b;histone cluster 1, H3f 313 40 B20140219_SF055_05 B20140219_SF055_05 TB244823.[MT7]-LPFQR.2y4_2.heavy 402.746 / 274.153 9883.0 30.07830047607422 50 20 10 10 10 3.9534622165985676 17.535826815235236 0.0 3 0.9992887544512841 46.27291348345342 9883.0 15.416088997090391 0.0 - - - - - - - 742.7777777777778 19 9 HIST2H3C;H3F3A;H3F3B;HIST2H3A;H3F3C;HIST2H3D;HIST3H3;HIST1H3A;HIST1H3D;HIST1H3C;HIST1H3E;HIST1H3I;HIST1H3G;HIST1H3J;HIST1H3H;HIST1H3B;HIST1H3F histone cluster 2, H3c;H3 histone, family 3A;H3 histone, family 3B (H3.3B);histone cluster 2, H3a;H3 histone, family 3C;histone cluster 2, H3d;histone cluster 3, H3;histone cluster 1, H3a;histone cluster 1, H3d;histone cluster 1, H3c;histone cluster 1, H3e;histone cluster 1, H3i;histone cluster 1, H3g;histone cluster 1, H3j;histone cluster 1, H3h;histone cluster 1, H3b;histone cluster 1, H3f 315 40 B20140219_SF055_05 B20140219_SF055_05 TB244823.[MT7]-LPFQR.2y3_1.heavy 402.746 / 450.246 12440.0 30.07830047607422 50 20 10 10 10 3.9534622165985676 17.535826815235236 0.0 3 0.9992887544512841 46.27291348345342 12440.0 16.57394044312413 0.0 - - - - - - - 630.8571428571429 24 7 HIST2H3C;H3F3A;H3F3B;HIST2H3A;H3F3C;HIST2H3D;HIST3H3;HIST1H3A;HIST1H3D;HIST1H3C;HIST1H3E;HIST1H3I;HIST1H3G;HIST1H3J;HIST1H3H;HIST1H3B;HIST1H3F histone cluster 2, H3c;H3 histone, family 3A;H3 histone, family 3B (H3.3B);histone cluster 2, H3a;H3 histone, family 3C;histone cluster 2, H3d;histone cluster 3, H3;histone cluster 1, H3a;histone cluster 1, H3d;histone cluster 1, H3c;histone cluster 1, H3e;histone cluster 1, H3i;histone cluster 1, H3g;histone cluster 1, H3j;histone cluster 1, H3h;histone cluster 1, H3b;histone cluster 1, H3f 317 41 B20140219_SF055_05 B20140219_SF055_05 TB245427.[MT7]-FGLLRTDPVPEEGEDVAATISATETLSEEEQEELRR.4b7_1.heavy 1041.02 / 947.543 6940.0 43.28072547912598 33 8 10 7 8 1.4183908355674566 47.12459847814242 0.02050018310546875 4 0.791063432163327 2.6514650905213437 6940.0 52.54827611664821 0.0 - - - - - - - 147.39285714285714 13 28 TPD52 tumor protein D52 319 41 B20140219_SF055_05 B20140219_SF055_05 TB245427.[MT7]-FGLLRTDPVPEEGEDVAATISATETLSEEEQEELRR.4b15_2.heavy 1041.02 / 900.45 8087.0 43.28072547912598 33 8 10 7 8 1.4183908355674566 47.12459847814242 0.02050018310546875 4 0.791063432163327 2.6514650905213437 8087.0 19.749292129755837 1.0 - - - - - - - 160.46666666666667 16 30 TPD52 tumor protein D52 321 41 B20140219_SF055_05 B20140219_SF055_05 TB245427.[MT7]-FGLLRTDPVPEEGEDVAATISATETLSEEEQEELRR.4y20_2.heavy 1041.02 / 1132.06 9550.0 43.28072547912598 33 8 10 7 8 1.4183908355674566 47.12459847814242 0.02050018310546875 4 0.791063432163327 2.6514650905213437 9550.0 158.7811054833737 0.0 - - - - - - - 137.45833333333334 19 24 TPD52 tumor protein D52 323 41 B20140219_SF055_05 B20140219_SF055_05 TB245427.[MT7]-FGLLRTDPVPEEGEDVAATISATETLSEEEQEELRR.4b9_1.heavy 1041.02 / 1143.66 8345.0 43.28072547912598 33 8 10 7 8 1.4183908355674566 47.12459847814242 0.02050018310546875 4 0.791063432163327 2.6514650905213437 8345.0 80.21107887745443 0.0 - - - - - - - 123.58620689655173 16 29 TPD52 tumor protein D52 325 42 B20140219_SF055_05 B20140219_SF055_05 TB244822.[MT7]-AITAK[MT7].2y4_1.heavy 396.265 / 576.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 327 42 B20140219_SF055_05 B20140219_SF055_05 TB244822.[MT7]-AITAK[MT7].2b4_1.heavy 396.265 / 501.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 329 42 B20140219_SF055_05 B20140219_SF055_05 TB244822.[MT7]-AITAK[MT7].2y3_1.heavy 396.265 / 463.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 331 43 B20140219_SF055_05 B20140219_SF055_05 TB469697.[MT7]-HLQLAIRNDEELNK[MT7].3y4_1.heavy 661.04 / 647.385 2226.0 27.037500381469727 42 12 10 10 10 2.324879663565407 43.01297893700064 0.0 3 0.8862889961065049 3.624575904061006 2226.0 3.6684519104084323 1.0 - - - - - - - 736.7692307692307 4 13 HIST1H2AA;HIST1H2AE;HIST1H2AD;H2AFX;H2AFJ;HIST2H2AA4;HIST1H2AI;HIST1H2AK;HIST1H2AJ;HIST1H2AL;HIST1H2AC;HIST1H2AB;HIST1H2AM;HIST2H2AA3;HIST2H2AC;HIST1H2AH;HIST1H2AG;HIST3H2A histone cluster 1, H2aa;histone cluster 1, H2ae;histone cluster 1, H2ad;H2A histone family, member X;H2A histone family, member J;histone cluster 2, H2aa4;histone cluster 1, H2ai;histone cluster 1, H2ak;histone cluster 1, H2aj;histone cluster 1, H2al;histone cluster 1, H2ac;histone cluster 1, H2ab;histone cluster 1, H2am;histone cluster 2, H2aa3;histone cluster 2, H2ac;histone cluster 1, H2ah;histone cluster 1, H2ag;histone cluster 3, H2a 333 43 B20140219_SF055_05 B20140219_SF055_05 TB469697.[MT7]-HLQLAIRNDEELNK[MT7].3b3_1.heavy 661.04 / 523.311 2019.0 27.037500381469727 42 12 10 10 10 2.324879663565407 43.01297893700064 0.0 3 0.8862889961065049 3.624575904061006 2019.0 5.845901486555757 0.0 - - - - - - - 177.21052631578948 4 19 HIST1H2AA;HIST1H2AE;HIST1H2AD;H2AFX;H2AFJ;HIST2H2AA4;HIST1H2AI;HIST1H2AK;HIST1H2AJ;HIST1H2AL;HIST1H2AC;HIST1H2AB;HIST1H2AM;HIST2H2AA3;HIST2H2AC;HIST1H2AH;HIST1H2AG;HIST3H2A histone cluster 1, H2aa;histone cluster 1, H2ae;histone cluster 1, H2ad;H2A histone family, member X;H2A histone family, member J;histone cluster 2, H2aa4;histone cluster 1, H2ai;histone cluster 1, H2ak;histone cluster 1, H2aj;histone cluster 1, H2al;histone cluster 1, H2ac;histone cluster 1, H2ab;histone cluster 1, H2am;histone cluster 2, H2aa3;histone cluster 2, H2ac;histone cluster 1, H2ah;histone cluster 1, H2ag;histone cluster 3, H2a 335 43 B20140219_SF055_05 B20140219_SF055_05 TB469697.[MT7]-HLQLAIRNDEELNK[MT7].3y5_1.heavy 661.04 / 776.427 2433.0 27.037500381469727 42 12 10 10 10 2.324879663565407 43.01297893700064 0.0 3 0.8862889961065049 3.624575904061006 2433.0 1.342344827586207 0.0 - - - - - - - 236.25 4 16 HIST1H2AA;HIST1H2AE;HIST1H2AD;H2AFX;H2AFJ;HIST2H2AA4;HIST1H2AI;HIST1H2AK;HIST1H2AJ;HIST1H2AL;HIST1H2AC;HIST1H2AB;HIST1H2AM;HIST2H2AA3;HIST2H2AC;HIST1H2AH;HIST1H2AG;HIST3H2A histone cluster 1, H2aa;histone cluster 1, H2ae;histone cluster 1, H2ad;H2A histone family, member X;H2A histone family, member J;histone cluster 2, H2aa4;histone cluster 1, H2ai;histone cluster 1, H2ak;histone cluster 1, H2aj;histone cluster 1, H2al;histone cluster 1, H2ac;histone cluster 1, H2ab;histone cluster 1, H2am;histone cluster 2, H2aa3;histone cluster 2, H2ac;histone cluster 1, H2ah;histone cluster 1, H2ag;histone cluster 3, H2a 337 43 B20140219_SF055_05 B20140219_SF055_05 TB469697.[MT7]-HLQLAIRNDEELNK[MT7].3y13_2.heavy 661.04 / 850.477 11700.0 27.037500381469727 42 12 10 10 10 2.324879663565407 43.01297893700064 0.0 3 0.8862889961065049 3.624575904061006 11700.0 65.99731408427061 0.0 - - - - - - - 195.66666666666666 23 18 HIST1H2AA;HIST1H2AE;HIST1H2AD;H2AFX;H2AFJ;HIST2H2AA4;HIST1H2AI;HIST1H2AK;HIST1H2AJ;HIST1H2AL;HIST1H2AC;HIST1H2AB;HIST1H2AM;HIST2H2AA3;HIST2H2AC;HIST1H2AH;HIST1H2AG;HIST3H2A histone cluster 1, H2aa;histone cluster 1, H2ae;histone cluster 1, H2ad;H2A histone family, member X;H2A histone family, member J;histone cluster 2, H2aa4;histone cluster 1, H2ai;histone cluster 1, H2ak;histone cluster 1, H2aj;histone cluster 1, H2al;histone cluster 1, H2ac;histone cluster 1, H2ab;histone cluster 1, H2am;histone cluster 2, H2aa3;histone cluster 2, H2ac;histone cluster 1, H2ah;histone cluster 1, H2ag;histone cluster 3, H2a 339 44 B20140219_SF055_05 B20140219_SF055_05 TB244928.[MT7]-QGESATLR.2y5_1.heavy 503.276 / 547.32 5893.0 17.06399917602539 47 17 10 10 10 5.121238551512061 19.526526443583595 0.0 3 0.9770404921217692 8.129177941994593 5893.0 20.6694776119403 0.0 - - - - - - - 226.4 11 15 OPCML;NTM opioid binding protein/cell adhesion molecule-like;neurotrimin 341 44 B20140219_SF055_05 B20140219_SF055_05 TB244928.[MT7]-QGESATLR.2b4_1.heavy 503.276 / 546.264 1250.0 17.06399917602539 47 17 10 10 10 5.121238551512061 19.526526443583595 0.0 3 0.9770404921217692 8.129177941994593 1250.0 2.421878013035597 1.0 - - - - - - - 262.0 6 15 OPCML;NTM opioid binding protein/cell adhesion molecule-like;neurotrimin 343 44 B20140219_SF055_05 B20140219_SF055_05 TB244928.[MT7]-QGESATLR.2b5_1.heavy 503.276 / 617.301 2381.0 17.06399917602539 47 17 10 10 10 5.121238551512061 19.526526443583595 0.0 3 0.9770404921217692 8.129177941994593 2381.0 6.002521008403361 0.0 - - - - - - - 279.0625 4 16 OPCML;NTM opioid binding protein/cell adhesion molecule-like;neurotrimin 345 44 B20140219_SF055_05 B20140219_SF055_05 TB244928.[MT7]-QGESATLR.2y7_1.heavy 503.276 / 733.384 16966.0 17.06399917602539 47 17 10 10 10 5.121238551512061 19.526526443583595 0.0 3 0.9770404921217692 8.129177941994593 16966.0 22.80632513597694 0.0 - - - - - - - 304.22222222222223 33 9 OPCML;NTM opioid binding protein/cell adhesion molecule-like;neurotrimin 347 45 B20140219_SF055_05 B20140219_SF055_05 TB469790.[MT7]-C[CAM]TDGIIYVVDSVDVDRLEEAK[MT7].3b4_1.heavy 895.461 / 578.236 5053.0 41.43212413787842 38 12 10 6 10 0.8777189787428119 65.37133972196784 0.032100677490234375 3 0.8871078596915326 3.637956651732166 5053.0 13.580756432131256 0.0 - - - - - - - 236.25 10 20 ARL4C ADP-ribosylation factor-like 4C 349 45 B20140219_SF055_05 B20140219_SF055_05 TB469790.[MT7]-C[CAM]TDGIIYVVDSVDVDRLEEAK[MT7].3b5_1.heavy 895.461 / 691.32 8788.0 41.43212413787842 38 12 10 6 10 0.8777189787428119 65.37133972196784 0.032100677490234375 3 0.8871078596915326 3.637956651732166 8788.0 30.73722941232864 0.0 - - - - - - - 285.55 17 20 ARL4C ADP-ribosylation factor-like 4C 351 45 B20140219_SF055_05 B20140219_SF055_05 TB469790.[MT7]-C[CAM]TDGIIYVVDSVDVDRLEEAK[MT7].3b3_1.heavy 895.461 / 521.215 12056.0 41.43212413787842 38 12 10 6 10 0.8777189787428119 65.37133972196784 0.032100677490234375 3 0.8871078596915326 3.637956651732166 12056.0 40.12155356951499 0.0 - - - - - - - 698.2857142857143 24 7 ARL4C ADP-ribosylation factor-like 4C 353 45 B20140219_SF055_05 B20140219_SF055_05 TB469790.[MT7]-C[CAM]TDGIIYVVDSVDVDRLEEAK[MT7].3y8_1.heavy 895.461 / 1103.62 934.0 41.43212413787842 38 12 10 6 10 0.8777189787428119 65.37133972196784 0.032100677490234375 3 0.8871078596915326 3.637956651732166 934.0 3.8916666666666666 1.0 - - - - - - - 0.0 1 0 ARL4C ADP-ribosylation factor-like 4C 355 46 B20140219_SF055_05 B20140219_SF055_05 TB469649.[MT7]-LFYPESAHFDPK[MT7].3b6_1.heavy 580.306 / 881.453 6219.0 33.18784999847412 46 20 10 6 10 5.79754344788619 12.57463783248889 0.035800933837890625 3 0.998921565915495 37.577382842501 6219.0 31.748117560832597 0.0 - - - - - - - 253.04545454545453 12 22 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 357 46 B20140219_SF055_05 B20140219_SF055_05 TB469649.[MT7]-LFYPESAHFDPK[MT7].3b5_1.heavy 580.306 / 794.42 7841.0 33.18784999847412 46 20 10 6 10 5.79754344788619 12.57463783248889 0.035800933837890625 3 0.998921565915495 37.577382842501 7841.0 32.155494441810234 0.0 - - - - - - - 649.0 15 9 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 359 46 B20140219_SF055_05 B20140219_SF055_05 TB469649.[MT7]-LFYPESAHFDPK[MT7].3b3_1.heavy 580.306 / 568.325 40774.0 33.18784999847412 46 20 10 6 10 5.79754344788619 12.57463783248889 0.035800933837890625 3 0.998921565915495 37.577382842501 40774.0 56.144689840907375 0.0 - - - - - - - 746.2 81 10 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 361 46 B20140219_SF055_05 B20140219_SF055_05 TB469649.[MT7]-LFYPESAHFDPK[MT7].3b7_1.heavy 580.306 / 952.49 8003.0 33.18784999847412 46 20 10 6 10 5.79754344788619 12.57463783248889 0.035800933837890625 3 0.998921565915495 37.577382842501 8003.0 120.46491049382715 0.0 - - - - - - - 110.7 16 20 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 363 47 B20140219_SF055_05 B20140219_SF055_05 TB469271.[MT7]-IISSGLR.2b3_1.heavy 445.283 / 458.31 N/A 27.0487003326416 42 20 10 6 6 32.59600283001848 3.067860820895116 0.033599853515625 6 0.9999121251410287 131.65182047649824 3773.0 0.0 8.0 - - - - - - - 1251.888888888889 42 9 AADAT aminoadipate aminotransferase 365 47 B20140219_SF055_05 B20140219_SF055_05 TB469271.[MT7]-IISSGLR.2y5_1.heavy 445.283 / 519.289 11751.0 27.0487003326416 42 20 10 6 6 32.59600283001848 3.067860820895116 0.033599853515625 6 0.9999121251410287 131.65182047649824 11751.0 5.876196509114873 2.0 - - - - - - - 1701.857142857143 28 7 AADAT aminoadipate aminotransferase 367 47 B20140219_SF055_05 B20140219_SF055_05 TB469271.[MT7]-IISSGLR.2y6_1.heavy 445.283 / 632.373 31211.0 27.0487003326416 42 20 10 6 6 32.59600283001848 3.067860820895116 0.033599853515625 6 0.9999121251410287 131.65182047649824 31211.0 16.900449989567832 0.0 - - - - - - - 1704.75 62 8 AADAT aminoadipate aminotransferase 369 47 B20140219_SF055_05 B20140219_SF055_05 TB469271.[MT7]-IISSGLR.2b5_1.heavy 445.283 / 602.363 4636.0 27.0487003326416 42 20 10 6 6 32.59600283001848 3.067860820895116 0.033599853515625 6 0.9999121251410287 131.65182047649824 4636.0 4.066190007107498 4.0 - - - - - - - 1147.4285714285713 27 7 AADAT aminoadipate aminotransferase 371 48 B20140219_SF055_05 B20140219_SF055_05 TB469647.[MT7]-EVAEAYEVLSDPK[MT7].2b8_1.heavy 869.461 / 1035.51 3113.0 34.506224632263184 42 16 10 6 10 3.200205755399611 31.247990799114405 0.033702850341796875 3 0.9603141465163383 6.174441250499378 3113.0 55.27757009345794 0.0 - - - - - - - 120.8125 6 16 DNAJB4 DnaJ (Hsp40) homolog, subfamily B, member 4 373 48 B20140219_SF055_05 B20140219_SF055_05 TB469647.[MT7]-EVAEAYEVLSDPK[MT7].2b4_1.heavy 869.461 / 573.3 5528.0 34.506224632263184 42 16 10 6 10 3.200205755399611 31.247990799114405 0.033702850341796875 3 0.9603141465163383 6.174441250499378 5528.0 43.969815518679894 0.0 - - - - - - - 190.83333333333334 11 18 DNAJB4 DnaJ (Hsp40) homolog, subfamily B, member 4 375 48 B20140219_SF055_05 B20140219_SF055_05 TB469647.[MT7]-EVAEAYEVLSDPK[MT7].2b7_1.heavy 869.461 / 936.443 4186.0 34.506224632263184 42 16 10 6 10 3.200205755399611 31.247990799114405 0.033702850341796875 3 0.9603141465163383 6.174441250499378 4186.0 27.278551092318537 0.0 - - - - - - - 157.6875 8 16 DNAJB4 DnaJ (Hsp40) homolog, subfamily B, member 4 377 48 B20140219_SF055_05 B20140219_SF055_05 TB469647.[MT7]-EVAEAYEVLSDPK[MT7].2b5_1.heavy 869.461 / 644.337 4508.0 34.506224632263184 42 16 10 6 10 3.200205755399611 31.247990799114405 0.033702850341796875 3 0.9603141465163383 6.174441250499378 4508.0 48.6380428294447 0.0 - - - - - - - 202.83333333333334 9 18 DNAJB4 DnaJ (Hsp40) homolog, subfamily B, member 4 379 49 B20140219_SF055_05 B20140219_SF055_05 TB469274.[MT7]-FGPIYR.2y4_1.heavy 448.759 / 548.319 10130.0 29.715499877929688 50 20 10 10 10 8.200815988557027 12.193908525631421 0.0 3 0.9946437456577784 16.855348412649466 10130.0 25.623543608302136 0.0 - - - - - - - 693.6666666666666 20 9 LOC100510686;CYP21A2 steroid 21-hydroxylase-like;cytochrome P450, family 21, subfamily A, polypeptide 2 381 49 B20140219_SF055_05 B20140219_SF055_05 TB469274.[MT7]-FGPIYR.2y5_1.heavy 448.759 / 605.341 57189.0 29.715499877929688 50 20 10 10 10 8.200815988557027 12.193908525631421 0.0 3 0.9946437456577784 16.855348412649466 57189.0 157.1196690212775 0.0 - - - - - - - 235.71428571428572 114 7 LOC100510686;CYP21A2 steroid 21-hydroxylase-like;cytochrome P450, family 21, subfamily A, polypeptide 2 383 49 B20140219_SF055_05 B20140219_SF055_05 TB469274.[MT7]-FGPIYR.2b4_1.heavy 448.759 / 559.336 21380.0 29.715499877929688 50 20 10 10 10 8.200815988557027 12.193908525631421 0.0 3 0.9946437456577784 16.855348412649466 21380.0 20.23048241751399 0.0 - - - - - - - 759.1111111111111 42 9 LOC100510686;CYP21A2 steroid 21-hydroxylase-like;cytochrome P450, family 21, subfamily A, polypeptide 2 385 49 B20140219_SF055_05 B20140219_SF055_05 TB469274.[MT7]-FGPIYR.2b4_2.heavy 448.759 / 280.172 1944.0 29.715499877929688 50 20 10 10 10 8.200815988557027 12.193908525631421 0.0 3 0.9946437456577784 16.855348412649466 1944.0 1.4671698113207547 17.0 - - - - - - - 1203.142857142857 35 7 LOC100510686;CYP21A2 steroid 21-hydroxylase-like;cytochrome P450, family 21, subfamily A, polypeptide 2 387 50 B20140219_SF055_05 B20140219_SF055_05 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 388591.0 15.496600151062012 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 388591.0 428.13903492037696 0.0 - - - - - - - 289.55555555555554 777 9 389 50 B20140219_SF055_05 B20140219_SF055_05 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 625937.0 15.496600151062012 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 625937.0 1597.5873365271868 1.0 - - - - - - - 203.5 1256 4 391 50 B20140219_SF055_05 B20140219_SF055_05 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 299789.0 15.496600151062012 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 299789.0 1361.8843578923224 0.0 - - - - - - - 302.7142857142857 599 7 393 51 B20140219_SF055_05 B20140219_SF055_05 TB469276.[MT7]-HFVGMLPEK[MT7].3y3_1.heavy 449.256 / 517.31 136525.0 29.54129981994629 46 16 10 10 10 3.28629850033033 23.1080680085332 0.0 3 0.9688466007915101 6.97389934845756 136525.0 137.23275012960084 0.0 - - - - - - - 117.0 273 1 DSTN;LOC729454 destrin (actin depolymerizing factor);destrin-like 395 51 B20140219_SF055_05 B20140219_SF055_05 TB469276.[MT7]-HFVGMLPEK[MT7].3b4_1.heavy 449.256 / 585.326 84663.0 29.54129981994629 46 16 10 10 10 3.28629850033033 23.1080680085332 0.0 3 0.9688466007915101 6.97389934845756 84663.0 125.29576550258528 0.0 - - - - - - - 668.4285714285714 169 7 DSTN;LOC729454 destrin (actin depolymerizing factor);destrin-like 397 51 B20140219_SF055_05 B20140219_SF055_05 TB469276.[MT7]-HFVGMLPEK[MT7].3b5_1.heavy 449.256 / 716.367 32801.0 29.54129981994629 46 16 10 10 10 3.28629850033033 23.1080680085332 0.0 3 0.9688466007915101 6.97389934845756 32801.0 73.3485249662618 0.0 - - - - - - - 282.5833333333333 65 12 DSTN;LOC729454 destrin (actin depolymerizing factor);destrin-like 399 51 B20140219_SF055_05 B20140219_SF055_05 TB469276.[MT7]-HFVGMLPEK[MT7].3y4_1.heavy 449.256 / 630.394 5438.0 29.54129981994629 46 16 10 10 10 3.28629850033033 23.1080680085332 0.0 3 0.9688466007915101 6.97389934845756 5438.0 12.430608183679954 3.0 - - - - - - - 742.7 20 10 DSTN;LOC729454 destrin (actin depolymerizing factor);destrin-like 401 52 B20140219_SF055_05 B20140219_SF055_05 TB469279.[MT7]-EELPK[MT7].2b3_1.heavy 452.273 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - VSIG10;PTPN13;AMMECR1L;NUP153 V-set and immunoglobulin domain containing 10;protein tyrosine phosphatase, non-receptor type 13 (APO-1/CD95 (Fas)-associated phosphatase);AMME chromosomal region gene 1-like;nucleoporin 153kDa 403 52 B20140219_SF055_05 B20140219_SF055_05 TB469279.[MT7]-EELPK[MT7].2y4_1.heavy 452.273 / 630.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - VSIG10;PTPN13;AMMECR1L;NUP153 V-set and immunoglobulin domain containing 10;protein tyrosine phosphatase, non-receptor type 13 (APO-1/CD95 (Fas)-associated phosphatase);AMME chromosomal region gene 1-like;nucleoporin 153kDa 405 52 B20140219_SF055_05 B20140219_SF055_05 TB469279.[MT7]-EELPK[MT7].2y3_1.heavy 452.273 / 501.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - VSIG10;PTPN13;AMMECR1L;NUP153 V-set and immunoglobulin domain containing 10;protein tyrosine phosphatase, non-receptor type 13 (APO-1/CD95 (Fas)-associated phosphatase);AMME chromosomal region gene 1-like;nucleoporin 153kDa 407 53 B20140219_SF055_05 B20140219_SF055_05 TB469278.[MT7]-VAWLNR.2b3_1.heavy 451.77 / 501.294 38218.0 31.74832534790039 46 20 10 6 10 25.12041572800768 3.98082583834416 0.03369903564453125 3 0.9996388537561905 64.93932161169103 38218.0 20.548724198214238 0.0 - - - - - - - 456.0 76 1 IGLON5;LSAMP;OPCML;NTM IgLON family member 5;limbic system-associated membrane protein;opioid binding protein/cell adhesion molecule-like;neurotrimin 409 53 B20140219_SF055_05 B20140219_SF055_05 TB469278.[MT7]-VAWLNR.2y4_1.heavy 451.77 / 588.325 45736.0 31.74832534790039 46 20 10 6 10 25.12041572800768 3.98082583834416 0.03369903564453125 3 0.9996388537561905 64.93932161169103 45736.0 79.79127043481394 0.0 - - - - - - - 364.8 91 5 IGLON5;LSAMP;OPCML;NTM IgLON family member 5;limbic system-associated membrane protein;opioid binding protein/cell adhesion molecule-like;neurotrimin 411 53 B20140219_SF055_05 B20140219_SF055_05 TB469278.[MT7]-VAWLNR.2y5_1.heavy 451.77 / 659.362 223498.0 31.74832534790039 46 20 10 6 10 25.12041572800768 3.98082583834416 0.03369903564453125 3 0.9996388537561905 64.93932161169103 223498.0 355.1008787619929 0.0 - - - - - - - 380.0 446 3 IGLON5;LSAMP;OPCML;NTM IgLON family member 5;limbic system-associated membrane protein;opioid binding protein/cell adhesion molecule-like;neurotrimin 413 53 B20140219_SF055_05 B20140219_SF055_05 TB469278.[MT7]-VAWLNR.2y3_1.heavy 451.77 / 402.246 25232.0 31.74832534790039 46 20 10 6 10 25.12041572800768 3.98082583834416 0.03369903564453125 3 0.9996388537561905 64.93932161169103 25232.0 14.652415621494852 1.0 - - - - - - - 2215.818181818182 52 11 IGLON5;LSAMP;OPCML;NTM IgLON family member 5;limbic system-associated membrane protein;opioid binding protein/cell adhesion molecule-like;neurotrimin 415 54 B20140219_SF055_05 B20140219_SF055_05 TB245008.[MT7]-RFGLNIDR.3y3_1.heavy 378.888 / 403.23 77626.0 27.857500076293945 43 13 10 10 10 2.3394157181288437 42.745716045707304 0.0 3 0.9205658550299944 4.34951800325613 77626.0 100.07872577003684 0.0 - - - - - - - 1249.5 155 12 NDUFS5 NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase) 417 54 B20140219_SF055_05 B20140219_SF055_05 TB245008.[MT7]-RFGLNIDR.3b5_1.heavy 378.888 / 732.427 16266.0 27.857500076293945 43 13 10 10 10 2.3394157181288437 42.745716045707304 0.0 3 0.9205658550299944 4.34951800325613 16266.0 206.59689655172411 0.0 - - - - - - - 126.75 32 16 NDUFS5 NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase) 419 54 B20140219_SF055_05 B20140219_SF055_05 TB245008.[MT7]-RFGLNIDR.3b3_1.heavy 378.888 / 505.3 23213.0 27.857500076293945 43 13 10 10 10 2.3394157181288437 42.745716045707304 0.0 3 0.9205658550299944 4.34951800325613 23213.0 175.3613656987296 0.0 - - - - - - - 235.71428571428572 46 14 NDUFS5 NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase) 421 54 B20140219_SF055_05 B20140219_SF055_05 TB245008.[MT7]-RFGLNIDR.3y4_1.heavy 378.888 / 517.273 83704.0 27.857500076293945 43 13 10 10 10 2.3394157181288437 42.745716045707304 0.0 3 0.9205658550299944 4.34951800325613 83704.0 57.52396446211509 0.0 - - - - - - - 738.0 167 8 NDUFS5 NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase) 423 55 B20140219_SF055_05 B20140219_SF055_05 TB245311.[MT7]-LRNLDLLIYPWPELR.3b6_1.heavy 685.734 / 869.532 3431.0 46.63214874267578 36 10 10 6 10 0.7804556661740294 74.48731845734788 0.039398193359375 3 0.8499465029979403 3.1452328140245314 3431.0 30.91160703589825 0.0 - - - - - - - 180.6315789473684 6 19 C10orf111 chromosome 10 open reading frame 111 425 55 B20140219_SF055_05 B20140219_SF055_05 TB245311.[MT7]-LRNLDLLIYPWPELR.3y6_1.heavy 685.734 / 797.43 18632.0 46.63214874267578 36 10 10 6 10 0.7804556661740294 74.48731845734788 0.039398193359375 3 0.8499465029979403 3.1452328140245314 18632.0 66.76104099595153 0.0 - - - - - - - 285.9166666666667 37 12 C10orf111 chromosome 10 open reading frame 111 427 55 B20140219_SF055_05 B20140219_SF055_05 TB245311.[MT7]-LRNLDLLIYPWPELR.3b5_1.heavy 685.734 / 756.448 4170.0 46.63214874267578 36 10 10 6 10 0.7804556661740294 74.48731845734788 0.039398193359375 3 0.8499465029979403 3.1452328140245314 4170.0 26.7127545167766 0.0 - - - - - - - 187.77777777777777 8 18 C10orf111 chromosome 10 open reading frame 111 429 55 B20140219_SF055_05 B20140219_SF055_05 TB245311.[MT7]-LRNLDLLIYPWPELR.3y4_1.heavy 685.734 / 514.298 9765.0 46.63214874267578 36 10 10 6 10 0.7804556661740294 74.48731845734788 0.039398193359375 3 0.8499465029979403 3.1452328140245314 9765.0 47.613234253905766 0.0 - - - - - - - 177.28571428571428 19 14 C10orf111 chromosome 10 open reading frame 111 431 56 B20140219_SF055_05 B20140219_SF055_05 TB245419.[MT7]-C[CAM]DQDAQNPLSAGLQGAC[CAM]LMETVELLQAK[MT7].4y4_1.heavy 837.917 / 603.395 13018.0 47.38344955444336 35 10 10 5 10 0.712157791479752 86.2351756160596 0.04129791259765625 3 0.8252320004304422 2.9079928225690015 13018.0 56.595016214590984 0.0 - - - - - - - 266.7857142857143 26 14 DCTN2 dynactin 2 (p50) 433 56 B20140219_SF055_05 B20140219_SF055_05 TB245419.[MT7]-C[CAM]DQDAQNPLSAGLQGAC[CAM]LMETVELLQAK[MT7].4b4_1.heavy 837.917 / 663.253 8658.0 47.38344955444336 35 10 10 5 10 0.712157791479752 86.2351756160596 0.04129791259765625 3 0.8252320004304422 2.9079928225690015 8658.0 68.56857831325301 0.0 - - - - - - - 197.94117647058823 17 17 DCTN2 dynactin 2 (p50) 435 56 B20140219_SF055_05 B20140219_SF055_05 TB245419.[MT7]-C[CAM]DQDAQNPLSAGLQGAC[CAM]LMETVELLQAK[MT7].4b5_1.heavy 837.917 / 734.29 6603.0 47.38344955444336 35 10 10 5 10 0.712157791479752 86.2351756160596 0.04129791259765625 3 0.8252320004304422 2.9079928225690015 6603.0 31.266013246332733 0.0 - - - - - - - 260.875 13 16 DCTN2 dynactin 2 (p50) 437 56 B20140219_SF055_05 B20140219_SF055_05 TB245419.[MT7]-C[CAM]DQDAQNPLSAGLQGAC[CAM]LMETVELLQAK[MT7].4b6_1.heavy 837.917 / 862.348 8347.0 47.38344955444336 35 10 10 5 10 0.712157791479752 86.2351756160596 0.04129791259765625 3 0.8252320004304422 2.9079928225690015 8347.0 50.994533762057884 0.0 - - - - - - - 220.0 16 15 DCTN2 dynactin 2 (p50) 439 57 B20140219_SF055_05 B20140219_SF055_05 TB469664.[MT7]-GAAALLALLC[CAM]VAC[CAM]ALR.3y7_1.heavy 596.343 / 849.407 6077.0 50.04240036010742 47 17 10 10 10 3.8931194453968487 25.686342636683833 0.0 3 0.9717617397892863 7.3268296251426985 6077.0 8.702147971360382 0.0 - - - - - - - 173.23076923076923 12 13 CRTAP cartilage associated protein 441 57 B20140219_SF055_05 B20140219_SF055_05 TB469664.[MT7]-GAAALLALLC[CAM]VAC[CAM]ALR.3b6_1.heavy 596.343 / 641.41 3405.0 50.04240036010742 47 17 10 10 10 3.8931194453968487 25.686342636683833 0.0 3 0.9717617397892863 7.3268296251426985 3405.0 0.0 0.0 - - - - - - - 179.71428571428572 6 14 CRTAP cartilage associated protein 443 57 B20140219_SF055_05 B20140219_SF055_05 TB469664.[MT7]-GAAALLALLC[CAM]VAC[CAM]ALR.3b5_1.heavy 596.343 / 528.326 11002.0 50.04240036010742 47 17 10 10 10 3.8931194453968487 25.686342636683833 0.0 3 0.9717617397892863 7.3268296251426985 11002.0 5.995640326975475 0.0 - - - - - - - 214.45454545454547 22 11 CRTAP cartilage associated protein 445 57 B20140219_SF055_05 B20140219_SF055_05 TB469664.[MT7]-GAAALLALLC[CAM]VAC[CAM]ALR.3b7_1.heavy 596.343 / 712.447 3877.0 50.04240036010742 47 17 10 10 10 3.8931194453968487 25.686342636683833 0.0 3 0.9717617397892863 7.3268296251426985 3877.0 25.846666666666664 0.0 - - - - - - - 157.2 7 10 CRTAP cartilage associated protein 447 58 B20140219_SF055_05 B20140219_SF055_05 TB469640.[MT7]-FITAASAARNPSPIR.3y6_1.heavy 572.661 / 683.383 11283.0 28.464125156402588 38 12 10 6 10 1.4578915861066146 54.50494341671286 0.03849983215332031 3 0.8860727268840108 3.6210658669502798 11283.0 15.568531157270028 0.0 - - - - - - - 662.3 22 10 AADAT aminoadipate aminotransferase 449 58 B20140219_SF055_05 B20140219_SF055_05 TB469640.[MT7]-FITAASAARNPSPIR.3y5_1.heavy 572.661 / 569.341 18917.0 28.464125156402588 38 12 10 6 10 1.4578915861066146 54.50494341671286 0.03849983215332031 3 0.8860727268840108 3.6210658669502798 18917.0 28.10353510893501 0.0 - - - - - - - 365.0 37 2 AADAT aminoadipate aminotransferase 451 58 B20140219_SF055_05 B20140219_SF055_05 TB469640.[MT7]-FITAASAARNPSPIR.3y13_2.heavy 572.661 / 656.36 41988.0 28.464125156402588 38 12 10 6 10 1.4578915861066146 54.50494341671286 0.03849983215332031 3 0.8860727268840108 3.6210658669502798 41988.0 36.59685098406747 0.0 - - - - - - - 686.0 83 9 AADAT aminoadipate aminotransferase 453 58 B20140219_SF055_05 B20140219_SF055_05 TB469640.[MT7]-FITAASAARNPSPIR.3b12_2.heavy 572.661 / 666.363 18636.0 28.464125156402588 38 12 10 6 10 1.4578915861066146 54.50494341671286 0.03849983215332031 3 0.8860727268840108 3.6210658669502798 18636.0 26.742749539015584 0.0 - - - - - - - 739.1666666666666 37 12 AADAT aminoadipate aminotransferase 455 59 B20140219_SF055_05 B20140219_SF055_05 TB245417.[MT7]-WGMSYDELC[CAM]FLEQRPQSPTLEFLLR.4y8_1.heavy 815.656 / 988.583 5427.0 47.38344955444336 39 14 10 5 10 1.337446518403302 52.35293826545514 0.04129791259765625 3 0.9361330350080129 4.857191842992202 5427.0 39.73868852459016 0.0 - - - - - - - 191.71428571428572 10 14 EDARADD EDAR-associated death domain 457 59 B20140219_SF055_05 B20140219_SF055_05 TB245417.[MT7]-WGMSYDELC[CAM]FLEQRPQSPTLEFLLR.4b7_1.heavy 815.656 / 1013.42 8232.0 47.38344955444336 39 14 10 5 10 1.337446518403302 52.35293826545514 0.04129791259765625 3 0.9361330350080129 4.857191842992202 8232.0 106.16131147540986 0.0 - - - - - - - 118.41176470588235 16 17 EDARADD EDAR-associated death domain 459 59 B20140219_SF055_05 B20140219_SF055_05 TB245417.[MT7]-WGMSYDELC[CAM]FLEQRPQSPTLEFLLR.4y17_2.heavy 815.656 / 1067.56 7378.0 47.38344955444336 39 14 10 5 10 1.337446518403302 52.35293826545514 0.04129791259765625 3 0.9361330350080129 4.857191842992202 7378.0 71.11908196721312 0.0 - - - - - - - 132.16666666666666 14 12 EDARADD EDAR-associated death domain 461 59 B20140219_SF055_05 B20140219_SF055_05 TB245417.[MT7]-WGMSYDELC[CAM]FLEQRPQSPTLEFLLR.4b6_1.heavy 815.656 / 884.373 5610.0 47.38344955444336 39 14 10 5 10 1.337446518403302 52.35293826545514 0.04129791259765625 3 0.9361330350080129 4.857191842992202 5610.0 21.459016393442624 0.0 - - - - - - - 237.22222222222223 11 18 EDARADD EDAR-associated death domain 463 60 B20140219_SF055_05 B20140219_SF055_05 TB469644.[MT7]-AEEC[CAM]DTITLNC[CAM]PR.2y8_1.heavy 861.899 / 974.509 9712.0 27.037500381469727 44 14 10 10 10 1.3382052098500423 52.683704808391866 0.0 3 0.9334006942341837 4.755401907471531 9712.0 146.63146375492872 0.0 - - - - - - - 132.92307692307693 19 13 EDARADD EDAR-associated death domain 465 60 B20140219_SF055_05 B20140219_SF055_05 TB469644.[MT7]-AEEC[CAM]DTITLNC[CAM]PR.2y6_1.heavy 861.899 / 760.377 12756.0 27.037500381469727 44 14 10 10 10 1.3382052098500423 52.683704808391866 0.0 3 0.9334006942341837 4.755401907471531 12756.0 39.888160435751416 0.0 - - - - - - - 180.1875 25 16 EDARADD EDAR-associated death domain 467 60 B20140219_SF055_05 B20140219_SF055_05 TB469644.[MT7]-AEEC[CAM]DTITLNC[CAM]PR.2y10_1.heavy 861.899 / 1249.57 6562.0 27.037500381469727 44 14 10 10 10 1.3382052098500423 52.683704808391866 0.0 3 0.9334006942341837 4.755401907471531 6562.0 146.7009659424545 0.0 - - - - - - - 157.0 13 8 EDARADD EDAR-associated death domain 469 60 B20140219_SF055_05 B20140219_SF055_05 TB469644.[MT7]-AEEC[CAM]DTITLNC[CAM]PR.2b5_1.heavy 861.899 / 749.289 10814.0 27.037500381469727 44 14 10 10 10 1.3382052098500423 52.683704808391866 0.0 3 0.9334006942341837 4.755401907471531 10814.0 130.6642529989095 0.0 - - - - - - - 169.66666666666666 21 21 EDARADD EDAR-associated death domain 471 61 B20140219_SF055_05 B20140219_SF055_05 TB469659.[MT7]-GAAALLALLC[CAM]VAC[CAM]ALR.2y9_1.heavy 894.011 / 1075.58 17424.0 50.04240036010742 44 14 10 10 10 2.5102380859850073 39.836858725996265 0.0 3 0.9471382313443563 5.343915447617069 17424.0 32.875471698113195 0.0 - - - - - - - 86.125 34 8 CRTAP cartilage associated protein 473 61 B20140219_SF055_05 B20140219_SF055_05 TB469659.[MT7]-GAAALLALLC[CAM]VAC[CAM]ALR.2b6_1.heavy 894.011 / 641.41 13928.0 50.04240036010742 44 14 10 10 10 2.5102380859850073 39.836858725996265 0.0 3 0.9471382313443563 5.343915447617069 13928.0 96.3572327044025 0.0 - - - - - - - 106.0 27 12 CRTAP cartilage associated protein 475 61 B20140219_SF055_05 B20140219_SF055_05 TB469659.[MT7]-GAAALLALLC[CAM]VAC[CAM]ALR.2y10_1.heavy 894.011 / 1146.61 138966.0 50.04240036010742 44 14 10 10 10 2.5102380859850073 39.836858725996265 0.0 3 0.9471382313443563 5.343915447617069 138966.0 0.0 0.0 - - - - - - - 132.5 277 10 CRTAP cartilage associated protein 477 61 B20140219_SF055_05 B20140219_SF055_05 TB469659.[MT7]-GAAALLALLC[CAM]VAC[CAM]ALR.2b5_1.heavy 894.011 / 528.326 133829.0 50.04240036010742 44 14 10 10 10 2.5102380859850073 39.836858725996265 0.0 3 0.9471382313443563 5.343915447617069 133829.0 577.1601078167116 0.0 - - - - - - - 155.46666666666667 267 15 CRTAP cartilage associated protein 479 62 B20140219_SF055_05 B20140219_SF055_05 TB245198.[MT7]-RDGSNIIYTAK[MT7].3b6_1.heavy 509.291 / 787.418 26708.0 23.905399322509766 38 8 10 10 10 0.854892969027931 77.20367451479883 0.0 3 0.7975175101831966 2.6949595505218573 26708.0 252.14928280613842 0.0 - - - - - - - 272.5 53 18 DNAJB4 DnaJ (Hsp40) homolog, subfamily B, member 4 481 62 B20140219_SF055_05 B20140219_SF055_05 TB245198.[MT7]-RDGSNIIYTAK[MT7].3b5_1.heavy 509.291 / 674.334 31571.0 23.905399322509766 38 8 10 10 10 0.854892969027931 77.20367451479883 0.0 3 0.7975175101831966 2.6949595505218573 31571.0 80.80871577697135 0.0 - - - - - - - 708.9 63 10 DNAJB4 DnaJ (Hsp40) homolog, subfamily B, member 4 483 62 B20140219_SF055_05 B20140219_SF055_05 TB245198.[MT7]-RDGSNIIYTAK[MT7].3y4_1.heavy 509.291 / 626.363 63720.0 23.905399322509766 38 8 10 10 10 0.854892969027931 77.20367451479883 0.0 3 0.7975175101831966 2.6949595505218573 63720.0 203.6607995550842 0.0 - - - - - - - 1241.5 127 8 DNAJB4 DnaJ (Hsp40) homolog, subfamily B, member 4 485 62 B20140219_SF055_05 B20140219_SF055_05 TB245198.[MT7]-RDGSNIIYTAK[MT7].3y5_1.heavy 509.291 / 739.447 9438.0 23.905399322509766 38 8 10 10 10 0.854892969027931 77.20367451479883 0.0 3 0.7975175101831966 2.6949595505218573 9438.0 47.65434646218195 0.0 - - - - - - - 247.3846153846154 18 26 DNAJB4 DnaJ (Hsp40) homolog, subfamily B, member 4 487 63 B20140219_SF055_05 B20140219_SF055_05 TB469262.[MT7]-LSPTASR.2y5_1.heavy 438.257 / 531.289 47514.0 18.472700119018555 50 20 10 10 10 13.395885904875986 7.46497847996756 0.0 3 0.9947804576162909 17.074856911529768 47514.0 94.42065586360074 0.0 - - - - - - - 668.2 95 10 GDF15 growth differentiation factor 15 489 63 B20140219_SF055_05 B20140219_SF055_05 TB469262.[MT7]-LSPTASR.2b4_1.heavy 438.257 / 543.326 4804.0 18.472700119018555 50 20 10 10 10 13.395885904875986 7.46497847996756 0.0 3 0.9947804576162909 17.074856911529768 4804.0 9.249124637005297 0.0 - - - - - - - 645.2857142857143 9 7 GDF15 growth differentiation factor 15 491 63 B20140219_SF055_05 B20140219_SF055_05 TB469262.[MT7]-LSPTASR.2b6_1.heavy 438.257 / 701.395 8215.0 18.472700119018555 50 20 10 10 10 13.395885904875986 7.46497847996756 0.0 3 0.9947804576162909 17.074856911529768 8215.0 11.80830853856376 0.0 - - - - - - - 678.875 16 8 GDF15 growth differentiation factor 15 493 63 B20140219_SF055_05 B20140219_SF055_05 TB469262.[MT7]-LSPTASR.2y6_1.heavy 438.257 / 618.321 116983.0 18.472700119018555 50 20 10 10 10 13.395885904875986 7.46497847996756 0.0 3 0.9947804576162909 17.074856911529768 116983.0 110.709004005189 0.0 - - - - - - - 384.0 233 4 GDF15 growth differentiation factor 15 495 64 B20140219_SF055_05 B20140219_SF055_05 TB469261.[MT7]-LQQTSC[CAM]RK[MT7].3y6_1.heavy 436.915 / 923.485 N/A 15.57509994506836 43 13 10 10 10 2.4016236376723263 41.63849756946964 0.0 3 0.913939797429037 4.1763436191770955 0.0 0.0 1.0 - - - - - - - 0.0 0 0 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 497 64 B20140219_SF055_05 B20140219_SF055_05 TB469261.[MT7]-LQQTSC[CAM]RK[MT7].3y7_2.heavy 436.915 / 526.275 32468.0 15.57509994506836 43 13 10 10 10 2.4016236376723263 41.63849756946964 0.0 3 0.913939797429037 4.1763436191770955 32468.0 140.60535733933483 0.0 - - - - - - - 700.5714285714286 64 7 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 499 64 B20140219_SF055_05 B20140219_SF055_05 TB469261.[MT7]-LQQTSC[CAM]RK[MT7].3b3_1.heavy 436.915 / 514.311 5626.0 15.57509994506836 43 13 10 10 10 2.4016236376723263 41.63849756946964 0.0 3 0.913939797429037 4.1763436191770955 5626.0 10.957264216699977 0.0 - - - - - - - 642.2222222222222 11 9 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 501 64 B20140219_SF055_05 B20140219_SF055_05 TB469261.[MT7]-LQQTSC[CAM]RK[MT7].3y5_1.heavy 436.915 / 795.426 8620.0 15.57509994506836 43 13 10 10 10 2.4016236376723263 41.63849756946964 0.0 3 0.913939797429037 4.1763436191770955 8620.0 31.772747798600136 0.0 - - - - - - - 133.25 17 12 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 503 65 B20140219_SF055_05 B20140219_SF055_05 TB469267.[MT7]-HTPHPR.2y4_1.heavy 444.75 / 506.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - C4orf17 chromosome 4 open reading frame 17 505 65 B20140219_SF055_05 B20140219_SF055_05 TB469267.[MT7]-HTPHPR.2y5_1.heavy 444.75 / 607.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - C4orf17 chromosome 4 open reading frame 17 507 65 B20140219_SF055_05 B20140219_SF055_05 TB469267.[MT7]-HTPHPR.2b4_1.heavy 444.75 / 617.328 N/A N/A - - - - - - - - - 0.0 - - - - - - - C4orf17 chromosome 4 open reading frame 17 509 65 B20140219_SF055_05 B20140219_SF055_05 TB469267.[MT7]-HTPHPR.2y3_1.heavy 444.75 / 409.231 N/A N/A - - - - - - - - - 0.0 - - - - - - - C4orf17 chromosome 4 open reading frame 17 511 66 B20140219_SF055_05 B20140219_SF055_05 TB469265.[MT7]-SAQC[CAM]LR.2y4_1.heavy 439.735 / 576.292 4358.0 16.469100952148438 50 20 10 10 10 60.334252649328874 1.6574333087576971 0.0 3 0.9929382613436334 14.677451193333637 4358.0 24.43397489539749 1.0 - - - - - - - 238.83333333333334 8 12 SLPI secretory leukocyte peptidase inhibitor 513 66 B20140219_SF055_05 B20140219_SF055_05 TB469265.[MT7]-SAQC[CAM]LR.2y5_1.heavy 439.735 / 647.329 19400.0 16.469100952148438 50 20 10 10 10 60.334252649328874 1.6574333087576971 0.0 3 0.9929382613436334 14.677451193333637 19400.0 20.70946297054307 0.0 - - - - - - - 249.63636363636363 38 11 SLPI secretory leukocyte peptidase inhibitor 515 66 B20140219_SF055_05 B20140219_SF055_05 TB469265.[MT7]-SAQC[CAM]LR.2b4_1.heavy 439.735 / 591.268 6327.0 16.469100952148438 50 20 10 10 10 60.334252649328874 1.6574333087576971 0.0 3 0.9929382613436334 14.677451193333637 6327.0 15.303045136117762 0.0 - - - - - - - 214.86666666666667 12 15 SLPI secretory leukocyte peptidase inhibitor 517 66 B20140219_SF055_05 B20140219_SF055_05 TB469265.[MT7]-SAQC[CAM]LR.2y3_1.heavy 439.735 / 448.234 3761.0 16.469100952148438 50 20 10 10 10 60.334252649328874 1.6574333087576971 0.0 3 0.9929382613436334 14.677451193333637 3761.0 12.841724285703155 1.0 - - - - - - - 268.5833333333333 13 12 SLPI secretory leukocyte peptidase inhibitor 519 67 B20140219_SF055_05 B20140219_SF055_05 TB469515.[MT7]-LRATGGNRTK[MT7].3b9_2.heavy 454.612 / 536.311 4340.0 14.647700309753418 34 8 10 6 10 0.521782784669088 99.41338586467421 0.03600025177001953 3 0.7829651209739809 2.599621834621453 4340.0 11.899475484606615 0.0 - - - - - - - 707.7142857142857 8 7 RPS14 ribosomal protein S14 521 67 B20140219_SF055_05 B20140219_SF055_05 TB469515.[MT7]-LRATGGNRTK[MT7].3y8_1.heavy 454.612 / 948.534 N/A 14.647700309753418 34 8 10 6 10 0.521782784669088 99.41338586467421 0.03600025177001953 3 0.7829651209739809 2.599621834621453 0.0 -0.0 0.0 - - - - - - - 0.0 0 0 RPS14 ribosomal protein S14 523 67 B20140219_SF055_05 B20140219_SF055_05 TB469515.[MT7]-LRATGGNRTK[MT7].3y8_2.heavy 454.612 / 474.771 3463.0 14.647700309753418 34 8 10 6 10 0.521782784669088 99.41338586467421 0.03600025177001953 3 0.7829651209739809 2.599621834621453 3463.0 24.934317534317536 0.0 - - - - - - - 185.5 6 22 RPS14 ribosomal protein S14 525 67 B20140219_SF055_05 B20140219_SF055_05 TB469515.[MT7]-LRATGGNRTK[MT7].3b7_1.heavy 454.612 / 814.465 921.0 14.647700309753418 34 8 10 6 10 0.521782784669088 99.41338586467421 0.03600025177001953 3 0.7829651209739809 2.599621834621453 921.0 13.288359277708594 0.0 - - - - - - - 0.0 1 0 RPS14 ribosomal protein S14 527 68 B20140219_SF055_05 B20140219_SF055_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 613063.0 18.0093994140625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 613063.0 2833.7590526353697 0.0 - - - - - - - 255.77777777777777 1226 9 529 68 B20140219_SF055_05 B20140219_SF055_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 346170.0 18.0093994140625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 346170.0 810.6307135265171 0.0 - - - - - - - 276.0 692 13 531 68 B20140219_SF055_05 B20140219_SF055_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 349648.0 18.0093994140625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 349648.0 2119.8462063115476 0.0 - - - - - - - 277.54545454545456 699 11 533 69 B20140219_SF055_05 B20140219_SF055_05 TB245013.[MT7]-VLIHFNVR.3y3_1.heavy 381.237 / 388.23 26828.0 32.83420181274414 47 20 9 10 8 6.083865311364079 16.436918781421667 0.0 4 0.9927768388776538 14.512323696164605 26828.0 26.61522869104617 0.0 - - - - - - - 353.2 53 5 PLEKHB1 pleckstrin homology domain containing, family B (evectins) member 1 535 69 B20140219_SF055_05 B20140219_SF055_05 TB245013.[MT7]-VLIHFNVR.3b3_1.heavy 381.237 / 470.346 30898.0 32.83420181274414 47 20 9 10 8 6.083865311364079 16.436918781421667 0.0 4 0.9927768388776538 14.512323696164605 30898.0 34.65077256139955 0.0 - - - - - - - 214.16666666666666 61 6 PLEKHB1 pleckstrin homology domain containing, family B (evectins) member 1 537 69 B20140219_SF055_05 B20140219_SF055_05 TB245013.[MT7]-VLIHFNVR.3y4_1.heavy 381.237 / 535.299 68650.0 32.83420181274414 47 20 9 10 8 6.083865311364079 16.436918781421667 0.0 4 0.9927768388776538 14.512323696164605 68650.0 90.63930480788859 1.0 - - - - - - - 329.0 164 7 PLEKHB1 pleckstrin homology domain containing, family B (evectins) member 1 539 69 B20140219_SF055_05 B20140219_SF055_05 TB245013.[MT7]-VLIHFNVR.3y5_1.heavy 381.237 / 672.358 7283.0 32.83420181274414 47 20 9 10 8 6.083865311364079 16.436918781421667 0.0 4 0.9927768388776538 14.512323696164605 7283.0 27.798294329183953 0.0 - - - - - - - 160.76923076923077 14 13 PLEKHB1 pleckstrin homology domain containing, family B (evectins) member 1 541 70 B20140219_SF055_05 B20140219_SF055_05 TB244944.[MT7]-EIYELAR.2b3_1.heavy 519.291 / 550.299 6017.0 30.303699493408203 46 18 10 10 8 9.608032660618983 10.407957958956153 0.0 4 0.9856653244582273 10.295519797937503 6017.0 4.02405464769765 1.0 - - - - - - - 1115.5714285714287 97 7 AADAT aminoadipate aminotransferase 543 70 B20140219_SF055_05 B20140219_SF055_05 TB244944.[MT7]-EIYELAR.2y5_1.heavy 519.291 / 651.346 48771.0 30.303699493408203 46 18 10 10 8 9.608032660618983 10.407957958956153 0.0 4 0.9856653244582273 10.295519797937503 48771.0 79.20886655818954 0.0 - - - - - - - 1115.5714285714287 97 7 AADAT aminoadipate aminotransferase 545 70 B20140219_SF055_05 B20140219_SF055_05 TB244944.[MT7]-EIYELAR.2b4_1.heavy 519.291 / 679.342 19612.0 30.303699493408203 46 18 10 10 8 9.608032660618983 10.407957958956153 0.0 4 0.9856653244582273 10.295519797937503 19612.0 28.41837334942231 1.0 - - - - - - - 752.25 62 8 AADAT aminoadipate aminotransferase 547 70 B20140219_SF055_05 B20140219_SF055_05 TB244944.[MT7]-EIYELAR.2y6_1.heavy 519.291 / 764.43 36564.0 30.303699493408203 46 18 10 10 8 9.608032660618983 10.407957958956153 0.0 4 0.9856653244582273 10.295519797937503 36564.0 109.2320754716981 0.0 - - - - - - - 628.1428571428571 73 7 AADAT aminoadipate aminotransferase 549 71 B20140219_SF055_05 B20140219_SF055_05 TB469674.[MT7]-HVLPASFEVNSLQK[MT7].4y4_1.heavy 465.017 / 619.39 17712.0 32.01089954376221 44 18 10 6 10 5.8502290437441475 17.09334784198466 0.032398223876953125 3 0.9857395410756429 10.32234002400516 17712.0 31.635193368834486 0.0 - - - - - - - 737.3636363636364 35 11 FAM173B family with sequence similarity 173, member B 551 71 B20140219_SF055_05 B20140219_SF055_05 TB469674.[MT7]-HVLPASFEVNSLQK[MT7].4b5_1.heavy 465.017 / 662.411 11587.0 32.01089954376221 44 18 10 6 10 5.8502290437441475 17.09334784198466 0.032398223876953125 3 0.9857395410756429 10.32234002400516 11587.0 38.07590893083112 0.0 - - - - - - - 668.3333333333334 23 9 FAM173B family with sequence similarity 173, member B 553 71 B20140219_SF055_05 B20140219_SF055_05 TB469674.[MT7]-HVLPASFEVNSLQK[MT7].4y3_1.heavy 465.017 / 532.357 37024.0 32.01089954376221 44 18 10 6 10 5.8502290437441475 17.09334784198466 0.032398223876953125 3 0.9857395410756429 10.32234002400516 37024.0 37.899284510568634 0.0 - - - - - - - 815.2222222222222 74 9 FAM173B family with sequence similarity 173, member B 555 71 B20140219_SF055_05 B20140219_SF055_05 TB469674.[MT7]-HVLPASFEVNSLQK[MT7].4b3_1.heavy 465.017 / 494.321 80173.0 32.01089954376221 44 18 10 6 10 5.8502290437441475 17.09334784198466 0.032398223876953125 3 0.9857395410756429 10.32234002400516 80173.0 88.46702997627473 0.0 - - - - - - - 1308.5714285714287 160 7 FAM173B family with sequence similarity 173, member B 557 72 B20140219_SF055_05 B20140219_SF055_05 TB106372.[MT7]-NLIPFDQMTIEDLNEAFPETK[MT7].3b6_1.heavy 918.47 / 844.469 6729.0 46.60260009765625 50 20 10 10 10 5.032759812988642 19.86981372365876 0.0 3 0.9960464228435263 19.621132558515665 6729.0 27.353294606913245 0.0 - - - - - - - 182.23076923076923 13 13 ATP5H ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d 559 72 B20140219_SF055_05 B20140219_SF055_05 TB106372.[MT7]-NLIPFDQMTIEDLNEAFPETK[MT7].3y4_1.heavy 918.47 / 618.358 75518.0 46.60260009765625 50 20 10 10 10 5.032759812988642 19.86981372365876 0.0 3 0.9960464228435263 19.621132558515665 75518.0 142.70926163778455 0.0 - - - - - - - 347.14285714285717 151 7 ATP5H ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d 561 72 B20140219_SF055_05 B20140219_SF055_05 TB106372.[MT7]-NLIPFDQMTIEDLNEAFPETK[MT7].3b7_1.heavy 918.47 / 972.527 5857.0 46.60260009765625 50 20 10 10 10 5.032759812988642 19.86981372365876 0.0 3 0.9960464228435263 19.621132558515665 5857.0 55.098139759036144 0.0 - - - - - - - 177.30769230769232 11 13 ATP5H ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d 563 72 B20140219_SF055_05 B20140219_SF055_05 TB106372.[MT7]-NLIPFDQMTIEDLNEAFPETK[MT7].3y5_1.heavy 918.47 / 765.426 23054.0 46.60260009765625 50 20 10 10 10 5.032759812988642 19.86981372365876 0.0 3 0.9960464228435263 19.621132558515665 23054.0 123.0658421547871 0.0 - - - - - - - 238.91666666666666 46 12 ATP5H ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d 565 73 B20140219_SF055_05 B20140219_SF055_05 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 1550510.0 36.86330032348633 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1550510.0 555.8546418656927 0.0 - - - - - - - 277.7142857142857 3101 7 567 73 B20140219_SF055_05 B20140219_SF055_05 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 721439.0 36.86330032348633 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 721439.0 1200.920518003009 0.0 - - - - - - - 246.85714285714286 1442 7 569 73 B20140219_SF055_05 B20140219_SF055_05 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1006440.0 36.86330032348633 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1006440.0 1240.3704650459526 0.0 - - - - - - - 683.0 2012 7 571 74 B20140219_SF055_05 B20140219_SF055_05 TB106374.[MT7]-AIPAGC[CAM]GDEEEEEEESILDTVLK[MT7].3y6_1.heavy 941.123 / 832.526 17235.0 43.652549743652344 45 17 10 8 10 10.208921980850503 9.795353533661643 0.0196990966796875 3 0.9760585659572887 7.960071923058974 17235.0 52.16234021816547 0.0 - - - - - - - 271.3333333333333 34 18 CPLX2 complexin 2 573 74 B20140219_SF055_05 B20140219_SF055_05 TB106374.[MT7]-AIPAGC[CAM]GDEEEEEEESILDTVLK[MT7].3b10_1.heavy 941.123 / 1144.51 4734.0 43.652549743652344 45 17 10 8 10 10.208921980850503 9.795353533661643 0.0196990966796875 3 0.9760585659572887 7.960071923058974 4734.0 50.81267733550469 0.0 - - - - - - - 151.52380952380952 9 21 CPLX2 complexin 2 575 74 B20140219_SF055_05 B20140219_SF055_05 TB106374.[MT7]-AIPAGC[CAM]GDEEEEEEESILDTVLK[MT7].3y4_1.heavy 941.123 / 604.415 11724.0 43.652549743652344 45 17 10 8 10 10.208921980850503 9.795353533661643 0.0196990966796875 3 0.9760585659572887 7.960071923058974 11724.0 41.658410174880764 0.0 - - - - - - - 242.55555555555554 23 18 CPLX2 complexin 2 577 74 B20140219_SF055_05 B20140219_SF055_05 TB106374.[MT7]-AIPAGC[CAM]GDEEEEEEESILDTVLK[MT7].3y5_1.heavy 941.123 / 719.442 15608.0 43.652549743652344 45 17 10 8 10 10.208921980850503 9.795353533661643 0.0196990966796875 3 0.9760585659572887 7.960071923058974 15608.0 78.10391482391483 0.0 - - - - - - - 259.0 31 18 CPLX2 complexin 2 579 75 B20140219_SF055_05 B20140219_SF055_05 TB245266.[MT7]-QTQAESFVLTSSDGK[MT7].3y6_1.heavy 629.33 / 738.375 24114.0 29.946799278259277 38 12 10 6 10 1.2603647709968933 52.94858813485688 0.03759956359863281 3 0.8911026074758663 3.7053681951003545 24114.0 57.47720547945205 0.0 - - - - - - - 318.84615384615387 48 13 IFT80 intraflagellar transport 80 homolog (Chlamydomonas) 581 75 B20140219_SF055_05 B20140219_SF055_05 TB245266.[MT7]-QTQAESFVLTSSDGK[MT7].3b6_1.heavy 629.33 / 789.386 12495.0 29.946799278259277 38 12 10 6 10 1.2603647709968933 52.94858813485688 0.03759956359863281 3 0.8911026074758663 3.7053681951003545 12495.0 26.05129129118024 0.0 - - - - - - - 726.4444444444445 24 9 IFT80 intraflagellar transport 80 homolog (Chlamydomonas) 583 75 B20140219_SF055_05 B20140219_SF055_05 TB245266.[MT7]-QTQAESFVLTSSDGK[MT7].3b5_1.heavy 629.33 / 702.354 10685.0 29.946799278259277 38 12 10 6 10 1.2603647709968933 52.94858813485688 0.03759956359863281 3 0.8911026074758663 3.7053681951003545 10685.0 24.075031425398617 0.0 - - - - - - - 302.29411764705884 21 17 IFT80 intraflagellar transport 80 homolog (Chlamydomonas) 585 75 B20140219_SF055_05 B20140219_SF055_05 TB245266.[MT7]-QTQAESFVLTSSDGK[MT7].3y5_1.heavy 629.33 / 637.327 22713.0 29.946799278259277 38 12 10 6 10 1.2603647709968933 52.94858813485688 0.03759956359863281 3 0.8911026074758663 3.7053681951003545 22713.0 28.178471970595517 0.0 - - - - - - - 733.0 45 9 IFT80 intraflagellar transport 80 homolog (Chlamydomonas) 587 76 B20140219_SF055_05 B20140219_SF055_05 TB106376.[MT7]-TTGTPPDSSLVTYELHSRPEQDK[MT7].4y5_1.heavy 712.366 / 760.396 2985.0 29.13962459564209 39 13 10 6 10 4.14805014416972 24.107712424970252 0.032299041748046875 3 0.9171278189015614 4.25708285500873 2985.0 8.265735460303278 1.0 - - - - - - - 218.89473684210526 5 19 DCTN2 dynactin 2 (p50) 589 76 B20140219_SF055_05 B20140219_SF055_05 TB106376.[MT7]-TTGTPPDSSLVTYELHSRPEQDK[MT7].4y12_2.heavy 712.366 / 823.916 35298.0 29.13962459564209 39 13 10 6 10 4.14805014416972 24.107712424970252 0.032299041748046875 3 0.9171278189015614 4.25708285500873 35298.0 55.511384615384614 1.0 - - - - - - - 325.22222222222223 70 9 DCTN2 dynactin 2 (p50) 591 76 B20140219_SF055_05 B20140219_SF055_05 TB106376.[MT7]-TTGTPPDSSLVTYELHSRPEQDK[MT7].4b4_1.heavy 712.366 / 505.274 39981.0 29.13962459564209 39 13 10 6 10 4.14805014416972 24.107712424970252 0.032299041748046875 3 0.9171278189015614 4.25708285500873 39981.0 35.23505395683453 0.0 - - - - - - - 709.75 79 8 DCTN2 dynactin 2 (p50) 593 76 B20140219_SF055_05 B20140219_SF055_05 TB106376.[MT7]-TTGTPPDSSLVTYELHSRPEQDK[MT7].4y13_2.heavy 712.366 / 873.451 18205.0 29.13962459564209 39 13 10 6 10 4.14805014416972 24.107712424970252 0.032299041748046875 3 0.9171278189015614 4.25708285500873 18205.0 20.425121951219516 1.0 - - - - - - - 191.8181818181818 36 11 DCTN2 dynactin 2 (p50) 595 77 B20140219_SF055_05 B20140219_SF055_05 TB106378.[MT7]-ESRK[MT7]EELMFFLWAPELAPLK[MT7].4b8_2.heavy 717.403 / 646.35 N/A N/A - - - - - - - - - 0.0 - - - - - - - DSTN destrin (actin depolymerizing factor) 597 77 B20140219_SF055_05 B20140219_SF055_05 TB106378.[MT7]-ESRK[MT7]EELMFFLWAPELAPLK[MT7].4y3_1.heavy 717.403 / 501.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - DSTN destrin (actin depolymerizing factor) 599 77 B20140219_SF055_05 B20140219_SF055_05 TB106378.[MT7]-ESRK[MT7]EELMFFLWAPELAPLK[MT7].4b10_2.heavy 717.403 / 793.418 N/A N/A - - - - - - - - - 0.0 - - - - - - - DSTN destrin (actin depolymerizing factor) 601 77 B20140219_SF055_05 B20140219_SF055_05 TB106378.[MT7]-ESRK[MT7]EELMFFLWAPELAPLK[MT7].4b9_2.heavy 717.403 / 719.884 N/A N/A - - - - - - - - - 0.0 - - - - - - - DSTN destrin (actin depolymerizing factor) 603 78 B20140219_SF055_05 B20140219_SF055_05 TB106377.[MT7]-ITFPREGDETPNSIPADIVFIIK[MT7].4b8_1.heavy 715.898 / 1060.55 891.0 45.28710174560547 43 13 10 10 10 5.073393824891308 19.71067168280444 0.0 3 0.9110010245440004 4.105773647645372 891.0 10.297271845836867 0.0 - - - - - - - 0.0 1 0 DNAJB4 DnaJ (Hsp40) homolog, subfamily B, member 4 605 78 B20140219_SF055_05 B20140219_SF055_05 TB106377.[MT7]-ITFPREGDETPNSIPADIVFIIK[MT7].4y4_1.heavy 715.898 / 664.451 19652.0 45.28710174560547 43 13 10 10 10 5.073393824891308 19.71067168280444 0.0 3 0.9110010245440004 4.105773647645372 19652.0 32.22310118307858 0.0 - - - - - - - 630.8888888888889 39 9 DNAJB4 DnaJ (Hsp40) homolog, subfamily B, member 4 607 78 B20140219_SF055_05 B20140219_SF055_05 TB106377.[MT7]-ITFPREGDETPNSIPADIVFIIK[MT7].4y13_2.heavy 715.898 / 785.97 17202.0 45.28710174560547 43 13 10 10 10 5.073393824891308 19.71067168280444 0.0 3 0.9110010245440004 4.105773647645372 17202.0 59.1201547673883 0.0 - - - - - - - 668.0 34 7 DNAJB4 DnaJ (Hsp40) homolog, subfamily B, member 4 609 78 B20140219_SF055_05 B20140219_SF055_05 TB106377.[MT7]-ITFPREGDETPNSIPADIVFIIK[MT7].4y3_1.heavy 715.898 / 517.383 12637.0 45.28710174560547 43 13 10 10 10 5.073393824891308 19.71067168280444 0.0 3 0.9110010245440004 4.105773647645372 12637.0 34.40492614770459 0.0 - - - - - - - 673.0 25 11 DNAJB4 DnaJ (Hsp40) homolog, subfamily B, member 4 611 79 B20140219_SF055_05 B20140219_SF055_05 TB106379.[MT7]-NASLISALSTGRFSHIQTPVVSSTPR.4y8_1.heavy 718.396 / 842.473 30225.0 36.79457378387451 41 15 10 6 10 1.7301106439688527 45.051162865882816 0.031299591064453125 3 0.958872596115665 6.064526797674706 30225.0 58.115932623776885 0.0 - - - - - - - 326.15384615384613 60 13 MRPL35 mitochondrial ribosomal protein L35 613 79 B20140219_SF055_05 B20140219_SF055_05 TB106379.[MT7]-NASLISALSTGRFSHIQTPVVSSTPR.4b4_1.heavy 718.396 / 530.305 7669.0 36.79457378387451 41 15 10 6 10 1.7301106439688527 45.051162865882816 0.031299591064453125 3 0.958872596115665 6.064526797674706 7669.0 13.224408424841736 0.0 - - - - - - - 740.5 15 12 MRPL35 mitochondrial ribosomal protein L35 615 79 B20140219_SF055_05 B20140219_SF055_05 TB106379.[MT7]-NASLISALSTGRFSHIQTPVVSSTPR.4y7_1.heavy 718.396 / 745.42 7083.0 36.79457378387451 41 15 10 6 10 1.7301106439688527 45.051162865882816 0.031299591064453125 3 0.958872596115665 6.064526797674706 7083.0 20.855819939871235 0.0 - - - - - - - 736.8888888888889 14 9 MRPL35 mitochondrial ribosomal protein L35 617 79 B20140219_SF055_05 B20140219_SF055_05 TB106379.[MT7]-NASLISALSTGRFSHIQTPVVSSTPR.4y6_1.heavy 718.396 / 646.352 18000.0 36.79457378387451 41 15 10 6 10 1.7301106439688527 45.051162865882816 0.031299591064453125 3 0.958872596115665 6.064526797674706 18000.0 43.08142702979923 0.0 - - - - - - - 739.8 36 10 MRPL35 mitochondrial ribosomal protein L35 619 80 B20140219_SF055_05 B20140219_SF055_05 TB245071.[MT7]-STELLIRK[MT7].3b4_1.heavy 416.602 / 575.316 48009.0 26.201799392700195 45 15 10 10 10 2.0943561157307986 47.74737173343908 0.0 3 0.9507450857194865 5.5378179175231725 48009.0 102.15735329668391 0.0 - - - - - - - 804.7142857142857 96 7 HIST2H3C;H3F3A;H3F3B;HIST2H3A;H3F3C;HIST2H3D;HIST3H3;HIST1H3A;HIST1H3D;HIST1H3C;HIST1H3E;HIST1H3I;HIST1H3G;HIST1H3J;HIST1H3H;HIST1H3B;HIST1H3F histone cluster 2, H3c;H3 histone, family 3A;H3 histone, family 3B (H3.3B);histone cluster 2, H3a;H3 histone, family 3C;histone cluster 2, H3d;histone cluster 3, H3;histone cluster 1, H3a;histone cluster 1, H3d;histone cluster 1, H3c;histone cluster 1, H3e;histone cluster 1, H3i;histone cluster 1, H3g;histone cluster 1, H3j;histone cluster 1, H3h;histone cluster 1, H3b;histone cluster 1, H3f 621 80 B20140219_SF055_05 B20140219_SF055_05 TB245071.[MT7]-STELLIRK[MT7].3b5_1.heavy 416.602 / 688.4 15020.0 26.201799392700195 45 15 10 10 10 2.0943561157307986 47.74737173343908 0.0 3 0.9507450857194865 5.5378179175231725 15020.0 7.521907581046244 1.0 - - - - - - - 268.0 30 1 HIST2H3C;H3F3A;H3F3B;HIST2H3A;H3F3C;HIST2H3D;HIST3H3;HIST1H3A;HIST1H3D;HIST1H3C;HIST1H3E;HIST1H3I;HIST1H3G;HIST1H3J;HIST1H3H;HIST1H3B;HIST1H3F histone cluster 2, H3c;H3 histone, family 3A;H3 histone, family 3B (H3.3B);histone cluster 2, H3a;H3 histone, family 3C;histone cluster 2, H3d;histone cluster 3, H3;histone cluster 1, H3a;histone cluster 1, H3d;histone cluster 1, H3c;histone cluster 1, H3e;histone cluster 1, H3i;histone cluster 1, H3g;histone cluster 1, H3j;histone cluster 1, H3h;histone cluster 1, H3b;histone cluster 1, H3f 623 80 B20140219_SF055_05 B20140219_SF055_05 TB245071.[MT7]-STELLIRK[MT7].3y7_2.heavy 416.602 / 508.833 43879.0 26.201799392700195 45 15 10 10 10 2.0943561157307986 47.74737173343908 0.0 3 0.9507450857194865 5.5378179175231725 43879.0 101.12233318625289 0.0 - - - - - - - 252.1 87 10 HIST2H3C;H3F3A;H3F3B;HIST2H3A;H3F3C;HIST2H3D;HIST3H3;HIST1H3A;HIST1H3D;HIST1H3C;HIST1H3E;HIST1H3I;HIST1H3G;HIST1H3J;HIST1H3H;HIST1H3B;HIST1H3F histone cluster 2, H3c;H3 histone, family 3A;H3 histone, family 3B (H3.3B);histone cluster 2, H3a;H3 histone, family 3C;histone cluster 2, H3d;histone cluster 3, H3;histone cluster 1, H3a;histone cluster 1, H3d;histone cluster 1, H3c;histone cluster 1, H3e;histone cluster 1, H3i;histone cluster 1, H3g;histone cluster 1, H3j;histone cluster 1, H3h;histone cluster 1, H3b;histone cluster 1, H3f 625 80 B20140219_SF055_05 B20140219_SF055_05 TB245071.[MT7]-STELLIRK[MT7].3b3_1.heavy 416.602 / 462.232 50798.0 26.201799392700195 45 15 10 10 10 2.0943561157307986 47.74737173343908 0.0 3 0.9507450857194865 5.5378179175231725 50798.0 127.07612036934849 0.0 - - - - - - - 670.4166666666666 101 12 HIST2H3C;H3F3A;H3F3B;HIST2H3A;H3F3C;HIST2H3D;HIST3H3;HIST1H3A;HIST1H3D;HIST1H3C;HIST1H3E;HIST1H3I;HIST1H3G;HIST1H3J;HIST1H3H;HIST1H3B;HIST1H3F histone cluster 2, H3c;H3 histone, family 3A;H3 histone, family 3B (H3.3B);histone cluster 2, H3a;H3 histone, family 3C;histone cluster 2, H3d;histone cluster 3, H3;histone cluster 1, H3a;histone cluster 1, H3d;histone cluster 1, H3c;histone cluster 1, H3e;histone cluster 1, H3i;histone cluster 1, H3g;histone cluster 1, H3j;histone cluster 1, H3h;histone cluster 1, H3b;histone cluster 1, H3f 627 81 B20140219_SF055_05 B20140219_SF055_05 TB245137.[MT7]-LQARVEELER.3y6_1.heavy 462.932 / 774.399 4518.0 27.61680030822754 48 18 10 10 10 4.760302557814013 21.00706809819273 0.0 3 0.9888229883462524 11.662567675725075 4518.0 23.050119400250406 0.0 - - - - - - - 192.3181818181818 9 22 DCTN3 dynactin 3 (p22) 629 81 B20140219_SF055_05 B20140219_SF055_05 TB245137.[MT7]-LQARVEELER.3y4_1.heavy 462.932 / 546.288 7320.0 27.61680030822754 48 18 10 10 10 4.760302557814013 21.00706809819273 0.0 3 0.9888229883462524 11.662567675725075 7320.0 7.865256143587235 0.0 - - - - - - - 690.7692307692307 14 13 DCTN3 dynactin 3 (p22) 631 81 B20140219_SF055_05 B20140219_SF055_05 TB245137.[MT7]-LQARVEELER.3y5_1.heavy 462.932 / 675.331 8464.0 27.61680030822754 48 18 10 10 10 4.760302557814013 21.00706809819273 0.0 3 0.9888229883462524 11.662567675725075 8464.0 38.44688063028674 0.0 - - - - - - - 234.33333333333334 16 21 DCTN3 dynactin 3 (p22) 633 81 B20140219_SF055_05 B20140219_SF055_05 TB245137.[MT7]-LQARVEELER.3b7_2.heavy 462.932 / 485.776 N/A 27.61680030822754 48 18 10 10 10 4.760302557814013 21.00706809819273 0.0 3 0.9888229883462524 11.662567675725075 10237.0 5.4531693200476585 2.0 - - - - - - - 669.8571428571429 20 7 DCTN3 dynactin 3 (p22) 635 82 B20140219_SF055_05 B20140219_SF055_05 TB245070.[MT7]-RHGQGIYK[MT7].3y3_1.heavy 416.247 / 567.362 5357.0 15.684800148010254 42 12 10 10 10 0.881295884428549 65.02847656419277 0.0 3 0.8836300264590629 3.582098173470574 5357.0 31.36100969407025 0.0 - - - - - - - 181.21428571428572 10 14 RSPH1 radial spoke head 1 homolog (Chlamydomonas) 637 82 B20140219_SF055_05 B20140219_SF055_05 TB245070.[MT7]-RHGQGIYK[MT7].3b5_1.heavy 416.247 / 680.371 12462.0 15.684800148010254 42 12 10 10 10 0.881295884428549 65.02847656419277 0.0 3 0.8836300264590629 3.582098173470574 12462.0 136.0659987005713 0.0 - - - - - - - 141.0 24 14 RSPH1 radial spoke head 1 homolog (Chlamydomonas) 639 82 B20140219_SF055_05 B20140219_SF055_05 TB245070.[MT7]-RHGQGIYK[MT7].3b5_2.heavy 416.247 / 340.689 26842.0 15.684800148010254 42 12 10 10 10 0.881295884428549 65.02847656419277 0.0 3 0.8836300264590629 3.582098173470574 26842.0 179.81861973726762 0.0 - - - - - - - 197.1875 53 16 RSPH1 radial spoke head 1 homolog (Chlamydomonas) 641 82 B20140219_SF055_05 B20140219_SF055_05 TB245070.[MT7]-RHGQGIYK[MT7].3y4_1.heavy 416.247 / 624.384 15676.0 15.684800148010254 42 12 10 10 10 0.881295884428549 65.02847656419277 0.0 3 0.8836300264590629 3.582098173470574 15676.0 150.7636037073886 0.0 - - - - - - - 222.125 31 16 RSPH1 radial spoke head 1 homolog (Chlamydomonas) 643 83 B20140219_SF055_05 B20140219_SF055_05 TB245073.[MT7]-K[MT7]ASAISIK[MT7].3y3_1.heavy 417.278 / 491.331 N/A 22.133366266886394 26 15 0 7 4 2.231356431665742 44.81578943680837 0.027698516845703125 9 0.9588360883952807 6.061818202446719 44310.0 66.31778316479718 1.0 - - - - - - - 854.7777777777778 595 9 PCNP PEST proteolytic signal containing nuclear protein 645 83 B20140219_SF055_05 B20140219_SF055_05 TB245073.[MT7]-K[MT7]ASAISIK[MT7].3b4_1.heavy 417.278 / 646.413 11265.0 22.133366266886394 26 15 0 7 4 2.231356431665742 44.81578943680837 0.027698516845703125 9 0.9588360883952807 6.061818202446719 11265.0 50.36117647058824 1.0 - - - - - - - 251.30434782608697 47 23 PCNP PEST proteolytic signal containing nuclear protein 647 83 B20140219_SF055_05 B20140219_SF055_05 TB245073.[MT7]-K[MT7]ASAISIK[MT7].3b3_1.heavy 417.278 / 575.375 3437.0 22.133366266886394 26 15 0 7 4 2.231356431665742 44.81578943680837 0.027698516845703125 9 0.9588360883952807 6.061818202446719 3437.0 0.6171018800444636 5.0 - - - - - - - 751.2666666666667 13 15 PCNP PEST proteolytic signal containing nuclear protein 649 83 B20140219_SF055_05 B20140219_SF055_05 TB245073.[MT7]-K[MT7]ASAISIK[MT7].3y4_1.heavy 417.278 / 604.415 8985.0 22.133366266886394 26 15 0 7 4 2.231356431665742 44.81578943680837 0.027698516845703125 9 0.9588360883952807 6.061818202446719 8985.0 15.058801806664206 0.0 - - - - - - - 763.5 17 14 PCNP PEST proteolytic signal containing nuclear protein 651 84 B20140219_SF055_05 B20140219_SF055_05 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 628418.0 33.96630096435547 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 628418.0 203.87671187774112 0.0 - - - - - - - 898.25 1256 4 653 84 B20140219_SF055_05 B20140219_SF055_05 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 168611.0 33.96630096435547 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 168611.0 253.2720712834191 0.0 - - - - - - - 1118.5714285714287 337 7 655 84 B20140219_SF055_05 B20140219_SF055_05 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 247393.0 33.96630096435547 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 247393.0 318.545291891956 0.0 - - - - - - - 1682.090909090909 494 11 657 85 B20140219_SF055_05 B20140219_SF055_05 TB245246.[MT7]-AEEC[CAM]DTITLNC[CAM]PR.3y6_1.heavy 574.935 / 760.377 167344.0 27.037500381469727 46 16 10 10 10 5.012156209961489 19.95149309218524 0.0 3 0.9661269846754698 6.686546210500542 167344.0 143.73099312359574 0.0 - - - - - - - 743.1 334 10 EDARADD EDAR-associated death domain 659 85 B20140219_SF055_05 B20140219_SF055_05 TB245246.[MT7]-AEEC[CAM]DTITLNC[CAM]PR.3b5_1.heavy 574.935 / 749.289 68446.0 27.037500381469727 46 16 10 10 10 5.012156209961489 19.95149309218524 0.0 3 0.9661269846754698 6.686546210500542 68446.0 158.9373816563741 0.0 - - - - - - - 709.7 136 10 EDARADD EDAR-associated death domain 661 85 B20140219_SF055_05 B20140219_SF055_05 TB245246.[MT7]-AEEC[CAM]DTITLNC[CAM]PR.3y4_1.heavy 574.935 / 546.245 128176.0 27.037500381469727 46 16 10 10 10 5.012156209961489 19.95149309218524 0.0 3 0.9661269846754698 6.686546210500542 128176.0 153.04619564889546 0.0 - - - - - - - 738.7777777777778 256 9 EDARADD EDAR-associated death domain 663 85 B20140219_SF055_05 B20140219_SF055_05 TB245246.[MT7]-AEEC[CAM]DTITLNC[CAM]PR.3y5_1.heavy 574.935 / 659.329 70737.0 27.037500381469727 46 16 10 10 10 5.012156209961489 19.95149309218524 0.0 3 0.9661269846754698 6.686546210500542 70737.0 175.83266592886812 0.0 - - - - - - - 620.8888888888889 141 9 EDARADD EDAR-associated death domain 665 86 B20140219_SF055_05 B20140219_SF055_05 TB469812.[MT7]-TDPVPEEGEDVAATISATETLSEEEQEELRR.4y16_2.heavy 894.43 / 953.953 77187.0 41.21289825439453 46 16 10 10 10 0.7253031329814502 67.32260454901034 0.0 3 0.9641122498088314 6.4950395679800925 77187.0 264.92704665574416 0.0 - - - - - - - 793.0 154 7 TPD52 tumor protein D52 667 86 B20140219_SF055_05 B20140219_SF055_05 TB469812.[MT7]-TDPVPEEGEDVAATISATETLSEEEQEELRR.4b10_1.heavy 894.43 / 1213.53 28887.0 41.21289825439453 46 16 10 10 10 0.7253031329814502 67.32260454901034 0.0 3 0.9641122498088314 6.4950395679800925 28887.0 556.2784984326019 0.0 - - - - - - - 246.66666666666666 57 15 TPD52 tumor protein D52 669 86 B20140219_SF055_05 B20140219_SF055_05 TB469812.[MT7]-TDPVPEEGEDVAATISATETLSEEEQEELRR.4b4_1.heavy 894.43 / 557.305 293836.0 41.21289825439453 46 16 10 10 10 0.7253031329814502 67.32260454901034 0.0 3 0.9641122498088314 6.4950395679800925 293836.0 475.42984520935426 0.0 - - - - - - - 649.0 587 8 TPD52 tumor protein D52 671 86 B20140219_SF055_05 B20140219_SF055_05 TB469812.[MT7]-TDPVPEEGEDVAATISATETLSEEEQEELRR.4b6_1.heavy 894.43 / 783.401 26346.0 41.21289825439453 46 16 10 10 10 0.7253031329814502 67.32260454901034 0.0 3 0.9641122498088314 6.4950395679800925 26346.0 161.82372271695476 0.0 - - - - - - - 294.11764705882354 52 17 TPD52 tumor protein D52 673 87 B20140219_SF055_05 B20140219_SF055_05 TB245355.[MT7]-DQPIFLRLEDYFWVK[MT7].3y3_1.heavy 753.08 / 576.363 2181.0 48.10559844970703 32 10 4 10 8 1.2436566144758785 50.18522970297292 0.0 4 0.8338250018010912 2.9845121899025004 2181.0 10.852411785462245 0.0 - - - - - - - 202.55 4 20 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 675 87 B20140219_SF055_05 B20140219_SF055_05 TB245355.[MT7]-DQPIFLRLEDYFWVK[MT7].3b4_1.heavy 753.08 / 598.332 623.0 48.10559844970703 32 10 4 10 8 1.2436566144758785 50.18522970297292 0.0 4 0.8338250018010912 2.9845121899025004 623.0 1.3012048192771084 7.0 - - - - - - - 0.0 1 0 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 677 87 B20140219_SF055_05 B20140219_SF055_05 TB245355.[MT7]-DQPIFLRLEDYFWVK[MT7].3y5_1.heavy 753.08 / 886.494 1869.0 48.10559844970703 32 10 4 10 8 1.2436566144758785 50.18522970297292 0.0 4 0.8338250018010912 2.9845121899025004 1869.0 9.114045412418907 1.0 - - - - - - - 215.76923076923077 15 13 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 679 87 B20140219_SF055_05 B20140219_SF055_05 TB245355.[MT7]-DQPIFLRLEDYFWVK[MT7].3y13_2.heavy 753.08 / 935.523 4673.0 48.10559844970703 32 10 4 10 8 1.2436566144758785 50.18522970297292 0.0 4 0.8338250018010912 2.9845121899025004 4673.0 43.48139037433155 0.0 - - - - - - - 155.75 9 12 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 681 88 B20140219_SF055_05 B20140219_SF055_05 TB469816.[MT7]-HLEEPLSLQELDTSSGVLLPFFDPDTNIVYLC[CAM]GK[MT7].4y5_1.heavy 1034.54 / 784.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - CORO1A coronin, actin binding protein, 1A 683 88 B20140219_SF055_05 B20140219_SF055_05 TB469816.[MT7]-HLEEPLSLQELDTSSGVLLPFFDPDTNIVYLC[CAM]GK[MT7].4b4_1.heavy 1034.54 / 653.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - CORO1A coronin, actin binding protein, 1A 685 88 B20140219_SF055_05 B20140219_SF055_05 TB469816.[MT7]-HLEEPLSLQELDTSSGVLLPFFDPDTNIVYLC[CAM]GK[MT7].4b9_1.heavy 1034.54 / 1191.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - CORO1A coronin, actin binding protein, 1A 687 88 B20140219_SF055_05 B20140219_SF055_05 TB469816.[MT7]-HLEEPLSLQELDTSSGVLLPFFDPDTNIVYLC[CAM]GK[MT7].4y3_1.heavy 1034.54 / 508.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - CORO1A coronin, actin binding protein, 1A 689 89 B20140219_SF055_05 B20140219_SF055_05 TB469403.[MT7]-LRPLWK[MT7].2y4_1.heavy 550.863 / 687.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARL4C;ARL4A;TRIM23 ADP-ribosylation factor-like 4C;ADP-ribosylation factor-like 4A;tripartite motif-containing 23 691 89 B20140219_SF055_05 B20140219_SF055_05 TB469403.[MT7]-LRPLWK[MT7].2y5_1.heavy 550.863 / 843.532 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARL4C;ARL4A;TRIM23 ADP-ribosylation factor-like 4C;ADP-ribosylation factor-like 4A;tripartite motif-containing 23 693 89 B20140219_SF055_05 B20140219_SF055_05 TB469403.[MT7]-LRPLWK[MT7].2y3_1.heavy 550.863 / 590.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARL4C;ARL4A;TRIM23 ADP-ribosylation factor-like 4C;ADP-ribosylation factor-like 4A;tripartite motif-containing 23 695 89 B20140219_SF055_05 B20140219_SF055_05 TB469403.[MT7]-LRPLWK[MT7].2b5_1.heavy 550.863 / 810.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARL4C;ARL4A;TRIM23 ADP-ribosylation factor-like 4C;ADP-ribosylation factor-like 4A;tripartite motif-containing 23 697 90 B20140219_SF055_05 B20140219_SF055_05 TB469401.[MT7]-RYESQLR.2y4_1.heavy 548.305 / 503.294 N/A 17.854267120361328 46 20 10 6 10 3.9283959480946375 25.455682502804304 0.03529930114746094 3 0.9906947572695011 12.7838354720084 2948.0 2.477070851598707 0.0 - - - - - - - 743.1428571428571 5 14 PFDN6 prefoldin subunit 6 699 90 B20140219_SF055_05 B20140219_SF055_05 TB469401.[MT7]-RYESQLR.2b4_1.heavy 548.305 / 680.348 694.0 17.854267120361328 46 20 10 6 10 3.9283959480946375 25.455682502804304 0.03529930114746094 3 0.9906947572695011 12.7838354720084 694.0 8.375862068965516 1.0 - - - - - - - 0.0 1 0 PFDN6 prefoldin subunit 6 701 90 B20140219_SF055_05 B20140219_SF055_05 TB469401.[MT7]-RYESQLR.2y6_1.heavy 548.305 / 795.399 4855.0 17.854267120361328 46 20 10 6 10 3.9283959480946375 25.455682502804304 0.03529930114746094 3 0.9906947572695011 12.7838354720084 4855.0 83.77937005523214 0.0 - - - - - - - 136.35714285714286 9 14 PFDN6 prefoldin subunit 6 703 90 B20140219_SF055_05 B20140219_SF055_05 TB469401.[MT7]-RYESQLR.2b5_1.heavy 548.305 / 808.407 3006.0 17.854267120361328 46 20 10 6 10 3.9283959480946375 25.455682502804304 0.03529930114746094 3 0.9906947572695011 12.7838354720084 3006.0 54.63166832768587 0.0 - - - - - - - 115.6923076923077 6 13 PFDN6 prefoldin subunit 6 705 91 B20140219_SF055_05 B20140219_SF055_05 TB469408.[MT7]-FSAFLDK[MT7].2y4_1.heavy 558.321 / 666.394 27328.0 35.35599899291992 50 20 10 10 10 9.186049631101024 10.886072252585267 0.0 3 0.9918856243042056 13.691174539455632 27328.0 87.42354609929077 0.0 - - - - - - - 724.1428571428571 54 7 ALG13 asparagine-linked glycosylation 13 homolog (S. cerevisiae) 707 91 B20140219_SF055_05 B20140219_SF055_05 TB469408.[MT7]-FSAFLDK[MT7].2b4_1.heavy 558.321 / 597.315 21946.0 35.35599899291992 50 20 10 10 10 9.186049631101024 10.886072252585267 0.0 3 0.9918856243042056 13.691174539455632 21946.0 47.38486308465478 0.0 - - - - - - - 731.7272727272727 43 11 ALG13 asparagine-linked glycosylation 13 homolog (S. cerevisiae) 709 91 B20140219_SF055_05 B20140219_SF055_05 TB469408.[MT7]-FSAFLDK[MT7].2y3_1.heavy 558.321 / 519.326 22207.0 35.35599899291992 50 20 10 10 10 9.186049631101024 10.886072252585267 0.0 3 0.9918856243042056 13.691174539455632 22207.0 34.81725374190226 0.0 - - - - - - - 783.8333333333334 44 12 ALG13 asparagine-linked glycosylation 13 homolog (S. cerevisiae) 711 91 B20140219_SF055_05 B20140219_SF055_05 TB469408.[MT7]-FSAFLDK[MT7].2y6_1.heavy 558.321 / 824.463 45877.0 35.35599899291992 50 20 10 10 10 9.186049631101024 10.886072252585267 0.0 3 0.9918856243042056 13.691174539455632 45877.0 170.3053679671291 0.0 - - - - - - - 712.125 91 8 ALG13 asparagine-linked glycosylation 13 homolog (S. cerevisiae) 713 92 B20140219_SF055_05 B20140219_SF055_05 TB469409.[MT7]-RERGDPSR.2b3_1.heavy 558.803 / 586.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - EDARADD EDAR-associated death domain 715 92 B20140219_SF055_05 B20140219_SF055_05 TB469409.[MT7]-RERGDPSR.2y5_1.heavy 558.803 / 531.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - EDARADD EDAR-associated death domain 717 92 B20140219_SF055_05 B20140219_SF055_05 TB469409.[MT7]-RERGDPSR.2b4_1.heavy 558.803 / 643.376 N/A N/A - - - - - - - - - 0.0 - - - - - - - EDARADD EDAR-associated death domain 719 92 B20140219_SF055_05 B20140219_SF055_05 TB469409.[MT7]-RERGDPSR.2b5_1.heavy 558.803 / 758.403 N/A N/A - - - - - - - - - 0.0 - - - - - - - EDARADD EDAR-associated death domain 721 93 B20140219_SF055_05 B20140219_SF055_05 TB245047.[MT7]-QFSQYIK[MT7].2y5_1.heavy 601.345 / 782.453 6198.0 29.047700881958008 47 17 10 10 10 7.512985528455785 13.310287850448441 0.0 3 0.9715771289839925 7.30288290298437 6198.0 23.340559404135632 0.0 - - - - - - - 236.2173913043478 12 23 RPL5 ribosomal protein L5 723 93 B20140219_SF055_05 B20140219_SF055_05 TB245047.[MT7]-QFSQYIK[MT7].2b4_1.heavy 601.345 / 635.327 2690.0 29.047700881958008 47 17 10 10 10 7.512985528455785 13.310287850448441 0.0 3 0.9715771289839925 7.30288290298437 2690.0 12.181909876775403 1.0 - - - - - - - 221.3684210526316 5 19 RPL5 ribosomal protein L5 725 93 B20140219_SF055_05 B20140219_SF055_05 TB245047.[MT7]-QFSQYIK[MT7].2y3_1.heavy 601.345 / 567.362 4327.0 29.047700881958008 47 17 10 10 10 7.512985528455785 13.310287850448441 0.0 3 0.9715771289839925 7.30288290298437 4327.0 6.907411630558723 0.0 - - - - - - - 691.4705882352941 8 17 RPL5 ribosomal protein L5 727 93 B20140219_SF055_05 B20140219_SF055_05 TB245047.[MT7]-QFSQYIK[MT7].2y6_1.heavy 601.345 / 929.521 9590.0 29.047700881958008 47 17 10 10 10 7.512985528455785 13.310287850448441 0.0 3 0.9715771289839925 7.30288290298437 9590.0 44.31564792176039 0.0 - - - - - - - 228.27272727272728 19 22 RPL5 ribosomal protein L5 729 94 B20140219_SF055_05 B20140219_SF055_05 TB469811.[MT7]-ASHSASYPWEGLNALDAAVLAYNNLSVFR.4y8_1.heavy 820.918 / 1012.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - PM20D2 peptidase M20 domain containing 2 731 94 B20140219_SF055_05 B20140219_SF055_05 TB469811.[MT7]-ASHSASYPWEGLNALDAAVLAYNNLSVFR.4b7_1.heavy 820.918 / 848.402 N/A N/A - - - - - - - - - 0.0 - - - - - - - PM20D2 peptidase M20 domain containing 2 733 94 B20140219_SF055_05 B20140219_SF055_05 TB469811.[MT7]-ASHSASYPWEGLNALDAAVLAYNNLSVFR.4y10_1.heavy 820.918 / 1196.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - PM20D2 peptidase M20 domain containing 2 735 94 B20140219_SF055_05 B20140219_SF055_05 TB469811.[MT7]-ASHSASYPWEGLNALDAAVLAYNNLSVFR.4y9_1.heavy 820.918 / 1083.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - PM20D2 peptidase M20 domain containing 2 737 95 B20140219_SF055_05 B20140219_SF055_05 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 267198.0 22.336599349975586 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 267198.0 140.47207723936663 0.0 - - - - - - - 626.5 534 12 739 95 B20140219_SF055_05 B20140219_SF055_05 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 427011.0 22.336599349975586 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 427011.0 3207.3450077840575 0.0 - - - - - - - 198.44827586206895 854 29 741 95 B20140219_SF055_05 B20140219_SF055_05 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 1509660.0 22.336599349975586 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1509660.0 6420.843152784979 0.0 - - - - - - - 207.42857142857142 3019 21 743 96 B20140219_SF055_05 B20140219_SF055_05 TB245249.[MT7]-GGAHDYYNVLPNK[MT7].3b6_1.heavy 579.305 / 745.339 N/A 27.686599731445312 30 10 2 10 8 1.0801582380029828 77.31911727464308 0.0 4 0.8410264767654757 3.053311330735984 8023.0 0.8364954851336247 3.0 - - - - - - - 346.0 453 1 PM20D2 peptidase M20 domain containing 2 745 96 B20140219_SF055_05 B20140219_SF055_05 TB245249.[MT7]-GGAHDYYNVLPNK[MT7].3y3_1.heavy 579.305 / 502.311 70884.0 27.686599731445312 30 10 2 10 8 1.0801582380029828 77.31911727464308 0.0 4 0.8410264767654757 3.053311330735984 70884.0 53.544183148581794 0.0 - - - - - - - 1253.4285714285713 141 7 PM20D2 peptidase M20 domain containing 2 747 96 B20140219_SF055_05 B20140219_SF055_05 TB245249.[MT7]-GGAHDYYNVLPNK[MT7].3b5_1.heavy 579.305 / 582.275 7158.0 27.686599731445312 30 10 2 10 8 1.0801582380029828 77.31911727464308 0.0 4 0.8410264767654757 3.053311330735984 7158.0 19.614047244094486 1.0 - - - - - - - 656.0 16 11 PM20D2 peptidase M20 domain containing 2 749 96 B20140219_SF055_05 B20140219_SF055_05 TB245249.[MT7]-GGAHDYYNVLPNK[MT7].3y4_1.heavy 579.305 / 615.395 12641.0 27.686599731445312 30 10 2 10 8 1.0801582380029828 77.31911727464308 0.0 4 0.8410264767654757 3.053311330735984 12641.0 26.397094001922532 0.0 - - - - - - - 786.625 25 8 PM20D2 peptidase M20 domain containing 2 751 97 B20140219_SF055_05 B20140219_SF055_05 TB469810.[MT7]-SDLFQEDLYPPTAGPDPALTAEEWLGGR.3b4_1.heavy 1063.85 / 607.321 7903.0 47.04707622528076 42 16 10 6 10 2.7675855482771348 36.13257774895217 0.039897918701171875 3 0.9601159110140329 6.158974499718507 7903.0 88.1134791406698 0.0 - - - - - - - 165.8 15 15 CORO1A coronin, actin binding protein, 1A 753 97 B20140219_SF055_05 B20140219_SF055_05 TB469810.[MT7]-SDLFQEDLYPPTAGPDPALTAEEWLGGR.3b8_1.heavy 1063.85 / 1092.53 12426.0 47.04707622528076 42 16 10 6 10 2.7675855482771348 36.13257774895217 0.039897918701171875 3 0.9601159110140329 6.158974499718507 12426.0 99.35016761660651 0.0 - - - - - - - 185.53333333333333 24 15 CORO1A coronin, actin binding protein, 1A 755 97 B20140219_SF055_05 B20140219_SF055_05 TB469810.[MT7]-SDLFQEDLYPPTAGPDPALTAEEWLGGR.3b7_1.heavy 1063.85 / 979.449 15458.0 47.04707622528076 42 16 10 6 10 2.7675855482771348 36.13257774895217 0.039897918701171875 3 0.9601159110140329 6.158974499718507 15458.0 138.23718660803826 0.0 - - - - - - - 161.58333333333334 30 12 CORO1A coronin, actin binding protein, 1A 757 97 B20140219_SF055_05 B20140219_SF055_05 TB469810.[MT7]-SDLFQEDLYPPTAGPDPALTAEEWLGGR.3y9_1.heavy 1063.85 / 1018.5 6163.0 47.04707622528076 42 16 10 6 10 2.7675855482771348 36.13257774895217 0.039897918701171875 3 0.9601159110140329 6.158974499718507 6163.0 87.93873052129334 0.0 - - - - - - - 177.0625 12 16 CORO1A coronin, actin binding protein, 1A 759 98 B20140219_SF055_05 B20140219_SF055_05 TB469802.[MT7]-SALLLGIRDSMEPVVEQLTQEFC[CAM]ER.4b12_2.heavy 766.895 / 715.893 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510686;CYP21A2 steroid 21-hydroxylase-like;cytochrome P450, family 21, subfamily A, polypeptide 2 761 98 B20140219_SF055_05 B20140219_SF055_05 TB469802.[MT7]-SALLLGIRDSMEPVVEQLTQEFC[CAM]ER.4b4_1.heavy 766.895 / 529.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510686;CYP21A2 steroid 21-hydroxylase-like;cytochrome P450, family 21, subfamily A, polypeptide 2 763 98 B20140219_SF055_05 B20140219_SF055_05 TB469802.[MT7]-SALLLGIRDSMEPVVEQLTQEFC[CAM]ER.4b13_2.heavy 766.895 / 764.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510686;CYP21A2 steroid 21-hydroxylase-like;cytochrome P450, family 21, subfamily A, polypeptide 2 765 98 B20140219_SF055_05 B20140219_SF055_05 TB469802.[MT7]-SALLLGIRDSMEPVVEQLTQEFC[CAM]ER.4y7_1.heavy 766.895 / 969.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510686;CYP21A2 steroid 21-hydroxylase-like;cytochrome P450, family 21, subfamily A, polypeptide 2 767 99 B20140219_SF055_05 B20140219_SF055_05 TB469803.[MT7]-C[CAM]VFVTVGTTSFDDLIAC[CAM]VSAPDSLQK[MT7].4y4_1.heavy 780.397 / 619.39 8348.0 48.062198638916016 42 12 10 10 10 0.9352035037862295 64.51346423584921 0.0 3 0.8993355740127267 3.856665987264997 8348.0 15.115802013222945 0.0 - - - - - - - 806.7142857142857 16 7 ALG13 asparagine-linked glycosylation 13 homolog (S. cerevisiae) 769 99 B20140219_SF055_05 B20140219_SF055_05 TB469803.[MT7]-C[CAM]VFVTVGTTSFDDLIAC[CAM]VSAPDSLQK[MT7].4b4_1.heavy 780.397 / 650.345 14654.0 48.062198638916016 42 12 10 10 10 0.9352035037862295 64.51346423584921 0.0 3 0.8993355740127267 3.856665987264997 14654.0 91.99907003491478 0.0 - - - - - - - 235.3846153846154 29 13 ALG13 asparagine-linked glycosylation 13 homolog (S. cerevisiae) 771 99 B20140219_SF055_05 B20140219_SF055_05 TB469803.[MT7]-C[CAM]VFVTVGTTSFDDLIAC[CAM]VSAPDSLQK[MT7].4y6_1.heavy 780.397 / 831.469 27207.0 48.062198638916016 42 12 10 10 10 0.9352035037862295 64.51346423584921 0.0 3 0.8993355740127267 3.856665987264997 27207.0 31.7025028842123 0.0 - - - - - - - 261.8181818181818 54 11 ALG13 asparagine-linked glycosylation 13 homolog (S. cerevisiae) 773 99 B20140219_SF055_05 B20140219_SF055_05 TB469803.[MT7]-C[CAM]VFVTVGTTSFDDLIAC[CAM]VSAPDSLQK[MT7].4b3_1.heavy 780.397 / 551.277 8528.0 48.062198638916016 42 12 10 10 10 0.9352035037862295 64.51346423584921 0.0 3 0.8993355740127267 3.856665987264997 8528.0 32.70857269629981 0.0 - - - - - - - 207.69230769230768 17 13 ALG13 asparagine-linked glycosylation 13 homolog (S. cerevisiae) 775 100 B20140219_SF055_05 B20140219_SF055_05 TB245340.[MT7]-HLIEIPVRYQEEFEAR.3b4_1.heavy 725.056 / 637.379 9330.0 34.21200180053711 44 14 10 10 10 7.757988325111604 12.889939480356388 0.0 3 0.938872231763761 4.965987170397342 9330.0 21.781607499349015 0.0 - - - - - - - 667.5555555555555 18 9 HSPB3 heat shock 27kDa protein 3 777 100 B20140219_SF055_05 B20140219_SF055_05 TB245340.[MT7]-HLIEIPVRYQEEFEAR.3y14_2.heavy 725.056 / 889.957 14865.0 34.21200180053711 44 14 10 10 10 7.757988325111604 12.889939480356388 0.0 3 0.938872231763761 4.965987170397342 14865.0 84.20938173201208 0.0 - - - - - - - 195.95238095238096 29 21 HSPB3 heat shock 27kDa protein 3 779 100 B20140219_SF055_05 B20140219_SF055_05 TB245340.[MT7]-HLIEIPVRYQEEFEAR.3y8_1.heavy 725.056 / 1071.47 2214.0 34.21200180053711 44 14 10 10 10 7.757988325111604 12.889939480356388 0.0 3 0.938872231763761 4.965987170397342 2214.0 12.36824644549763 0.0 - - - - - - - 139.58823529411765 4 17 HSPB3 heat shock 27kDa protein 3 781 100 B20140219_SF055_05 B20140219_SF055_05 TB245340.[MT7]-HLIEIPVRYQEEFEAR.3y12_2.heavy 725.056 / 768.894 11913.0 34.21200180053711 44 14 10 10 10 7.757988325111604 12.889939480356388 0.0 3 0.938872231763761 4.965987170397342 11913.0 21.248994307400377 1.0 - - - - - - - 194.21052631578948 23 19 HSPB3 heat shock 27kDa protein 3 783 101 B20140219_SF055_05 B20140219_SF055_05 TB469804.[MT7]-RHC[CAM]AEPFTEYWTC[CAM]IDYTGQQLFR.4y9_1.heavy 781.365 / 1127.55 12243.0 42.482826232910156 39 13 10 6 10 2.249681256827426 35.54639840193792 0.0343017578125 3 0.9053529060718939 3.979443086646618 12243.0 100.56071129707112 0.0 - - - - - - - 182.0952380952381 24 21 NDUFA8 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa 785 101 B20140219_SF055_05 B20140219_SF055_05 TB469804.[MT7]-RHC[CAM]AEPFTEYWTC[CAM]IDYTGQQLFR.4b5_1.heavy 781.365 / 798.38 10172.0 42.482826232910156 39 13 10 6 10 2.249681256827426 35.54639840193792 0.0343017578125 3 0.9053529060718939 3.979443086646618 10172.0 34.73376429340239 0.0 - - - - - - - 303.05882352941177 20 17 NDUFA8 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa 787 101 B20140219_SF055_05 B20140219_SF055_05 TB469804.[MT7]-RHC[CAM]AEPFTEYWTC[CAM]IDYTGQQLFR.4y7_1.heavy 781.365 / 849.458 12031.0 42.482826232910156 39 13 10 6 10 2.249681256827426 35.54639840193792 0.0343017578125 3 0.9053529060718939 3.979443086646618 12031.0 52.623942360766925 0.0 - - - - - - - 294.5 24 22 NDUFA8 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa 789 101 B20140219_SF055_05 B20140219_SF055_05 TB469804.[MT7]-RHC[CAM]AEPFTEYWTC[CAM]IDYTGQQLFR.4y6_1.heavy 781.365 / 748.41 21353.0 42.482826232910156 39 13 10 6 10 2.249681256827426 35.54639840193792 0.0343017578125 3 0.9053529060718939 3.979443086646618 21353.0 71.9877308541095 0.0 - - - - - - - 639.8181818181819 42 11 NDUFA8 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa 791 102 B20140219_SF055_05 B20140219_SF055_05 TB469805.[MT7]-DLPPLVVQRESAEEAWGTEEAPAPAPAR.4y5_1.heavy 783.404 / 511.299 37319.0 35.09230041503906 50 20 10 10 10 8.6072070070744 11.61817066997557 0.0 3 0.996424728757462 20.633760896139385 37319.0 39.51120566861478 0.0 - - - - - - - 425.0 74 2 BLOC1S3 biogenesis of lysosomal organelles complex-1, subunit 3 793 102 B20140219_SF055_05 B20140219_SF055_05 TB469805.[MT7]-DLPPLVVQRESAEEAWGTEEAPAPAPAR.4y8_1.heavy 783.404 / 750.426 13908.0 35.09230041503906 50 20 10 10 10 8.6072070070744 11.61817066997557 0.0 3 0.996424728757462 20.633760896139385 13908.0 17.267400554193465 0.0 - - - - - - - 666.4444444444445 27 9 BLOC1S3 biogenesis of lysosomal organelles complex-1, subunit 3 795 102 B20140219_SF055_05 B20140219_SF055_05 TB469805.[MT7]-DLPPLVVQRESAEEAWGTEEAPAPAPAR.4y9_1.heavy 783.404 / 879.468 9396.0 35.09230041503906 50 20 10 10 10 8.6072070070744 11.61817066997557 0.0 3 0.996424728757462 20.633760896139385 9396.0 17.94951940391541 0.0 - - - - - - - 286.8 18 5 BLOC1S3 biogenesis of lysosomal organelles complex-1, subunit 3 797 102 B20140219_SF055_05 B20140219_SF055_05 TB469805.[MT7]-DLPPLVVQRESAEEAWGTEEAPAPAPAR.4y7_1.heavy 783.404 / 679.389 103835.0 35.09230041503906 50 20 10 10 10 8.6072070070744 11.61817066997557 0.0 3 0.996424728757462 20.633760896139385 103835.0 91.48675710280547 0.0 - - - - - - - 531.0 207 1 BLOC1S3 biogenesis of lysosomal organelles complex-1, subunit 3 799 103 B20140219_SF055_05 B20140219_SF055_05 TB469806.[MT7]-AVSLFLC[CAM]Y[MT7]LLLFTC[CAM]SGVEAGENAGK[MT7].4y8_1.heavy 788.669 / 919.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI6 interferon, alpha-inducible protein 6 801 103 B20140219_SF055_05 B20140219_SF055_05 TB469806.[MT7]-AVSLFLC[CAM]Y[MT7]LLLFTC[CAM]SGVEAGENAGK[MT7].4b8_2.heavy 788.669 / 621.843 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI6 interferon, alpha-inducible protein 6 803 103 B20140219_SF055_05 B20140219_SF055_05 TB469806.[MT7]-AVSLFLC[CAM]Y[MT7]LLLFTC[CAM]SGVEAGENAGK[MT7].4b4_1.heavy 788.669 / 515.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI6 interferon, alpha-inducible protein 6 805 103 B20140219_SF055_05 B20140219_SF055_05 TB469806.[MT7]-AVSLFLC[CAM]Y[MT7]LLLFTC[CAM]SGVEAGENAGK[MT7].4b9_2.heavy 788.669 / 678.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI6 interferon, alpha-inducible protein 6 807 104 B20140219_SF055_05 B20140219_SF055_05 TB245343.[MT7]-AAQSPPVDSAAETPPREGK[MT7].4y9_2.heavy 549.793 / 564.81 28834.0 20.285800457000732 37 10 10 7 10 2.119643289076837 47.17774944271531 0.029199600219726562 3 0.8483771492921771 3.1284799927253912 28834.0 41.00730476393313 1.0 - - - - - - - 196.22222222222223 57 9 HSPB3 heat shock 27kDa protein 3 809 104 B20140219_SF055_05 B20140219_SF055_05 TB245343.[MT7]-AAQSPPVDSAAETPPREGK[MT7].4y12_2.heavy 549.793 / 701.358 26149.0 20.285800457000732 37 10 10 7 10 2.119643289076837 47.17774944271531 0.029199600219726562 3 0.8483771492921771 3.1284799927253912 26149.0 17.359226489789208 0.0 - - - - - - - 736.8571428571429 52 7 HSPB3 heat shock 27kDa protein 3 811 104 B20140219_SF055_05 B20140219_SF055_05 TB245343.[MT7]-AAQSPPVDSAAETPPREGK[MT7].4b4_1.heavy 549.793 / 502.274 38199.0 20.285800457000732 37 10 10 7 10 2.119643289076837 47.17774944271531 0.029199600219726562 3 0.8483771492921771 3.1284799927253912 38199.0 26.689217371118705 0.0 - - - - - - - 706.625 76 8 HSPB3 heat shock 27kDa protein 3 813 104 B20140219_SF055_05 B20140219_SF055_05 TB245343.[MT7]-AAQSPPVDSAAETPPREGK[MT7].4y6_1.heavy 549.793 / 827.486 7809.0 20.285800457000732 37 10 10 7 10 2.119643289076837 47.17774944271531 0.029199600219726562 3 0.8483771492921771 3.1284799927253912 7809.0 6.0745736735600255 0.0 - - - - - - - 219.35714285714286 15 14 HSPB3 heat shock 27kDa protein 3 815 105 B20140219_SF055_05 B20140219_SF055_05 TB245253.[MT7]-RLDRLEETVQAK[MT7].3y11_2.heavy 582.675 / 723.408 8042.0 25.628400802612305 46 16 10 10 10 3.692595619893489 27.081221529175853 0.0 3 0.9644542846164014 6.526402154959976 8042.0 37.182478922716626 0.0 - - - - - - - 225.26315789473685 16 19 CORO1A coronin, actin binding protein, 1A 817 105 B20140219_SF055_05 B20140219_SF055_05 TB245253.[MT7]-RLDRLEETVQAK[MT7].3y4_1.heavy 582.675 / 589.379 5548.0 25.628400802612305 46 16 10 10 10 3.692595619893489 27.081221529175853 0.0 3 0.9644542846164014 6.526402154959976 5548.0 21.959134362627815 0.0 - - - - - - - 317.4117647058824 11 17 CORO1A coronin, actin binding protein, 1A 819 105 B20140219_SF055_05 B20140219_SF055_05 TB245253.[MT7]-RLDRLEETVQAK[MT7].3b3_1.heavy 582.675 / 529.321 12267.0 25.628400802612305 46 16 10 10 10 3.692595619893489 27.081221529175853 0.0 3 0.9644542846164014 6.526402154959976 12267.0 26.093965317919075 0.0 - - - - - - - 752.5714285714286 24 14 CORO1A coronin, actin binding protein, 1A 821 105 B20140219_SF055_05 B20140219_SF055_05 TB245253.[MT7]-RLDRLEETVQAK[MT7].3y5_1.heavy 582.675 / 690.427 6923.0 25.628400802612305 46 16 10 10 10 3.692595619893489 27.081221529175853 0.0 3 0.9644542846164014 6.526402154959976 6923.0 22.919101098264036 0.0 - - - - - - - 661.75 13 8 CORO1A coronin, actin binding protein, 1A 823 106 B20140219_SF055_05 B20140219_SF055_05 TB469809.[MT7]-SDLFQEDLYPPTAGPDPALTAEEWLGGR.4y5_1.heavy 798.143 / 588.325 6191.0 47.03710174560547 48 18 10 10 10 3.869570434651967 25.842661786047607 0.0 3 0.9890222241641425 11.768120036632807 6191.0 17.28903837755213 0.0 - - - - - - - 669.5 12 8 CORO1A coronin, actin binding protein, 1A 825 106 B20140219_SF055_05 B20140219_SF055_05 TB469809.[MT7]-SDLFQEDLYPPTAGPDPALTAEEWLGGR.4b7_1.heavy 798.143 / 979.449 11940.0 47.03710174560547 48 18 10 10 10 3.869570434651967 25.842661786047607 0.0 3 0.9890222241641425 11.768120036632807 11940.0 58.98681021782595 0.0 - - - - - - - 216.64705882352942 23 17 CORO1A coronin, actin binding protein, 1A 827 106 B20140219_SF055_05 B20140219_SF055_05 TB469809.[MT7]-SDLFQEDLYPPTAGPDPALTAEEWLGGR.4y9_1.heavy 798.143 / 1018.5 5208.0 47.03710174560547 48 18 10 10 10 3.869570434651967 25.842661786047607 0.0 3 0.9890222241641425 11.768120036632807 5208.0 23.149764774964595 0.0 - - - - - - - 183.33333333333334 10 15 CORO1A coronin, actin binding protein, 1A 829 106 B20140219_SF055_05 B20140219_SF055_05 TB469809.[MT7]-SDLFQEDLYPPTAGPDPALTAEEWLGGR.4b4_1.heavy 798.143 / 607.321 6240.0 47.03710174560547 48 18 10 10 10 3.869570434651967 25.842661786047607 0.0 3 0.9890222241641425 11.768120036632807 6240.0 31.702534433359794 0.0 - - - - - - - 268.7647058823529 12 17 CORO1A coronin, actin binding protein, 1A 831 107 B20140219_SF055_05 B20140219_SF055_05 TB469412.[MT7]-ELQVLTK[MT7].2y4_1.heavy 559.855 / 604.415 30470.0 29.30769920349121 48 18 10 10 10 5.16752736224889 19.351614996863866 0.0 3 0.9836184430431261 9.62919817224219 30470.0 33.03118326223397 0.0 - - - - - - - 714.1428571428571 60 7 PM20D2 peptidase M20 domain containing 2 833 107 B20140219_SF055_05 B20140219_SF055_05 TB469412.[MT7]-ELQVLTK[MT7].2b3_1.heavy 559.855 / 515.295 36412.0 29.30769920349121 48 18 10 10 10 5.16752736224889 19.351614996863866 0.0 3 0.9836184430431261 9.62919817224219 36412.0 35.813149255434624 0.0 - - - - - - - 739.5714285714286 72 7 PM20D2 peptidase M20 domain containing 2 835 107 B20140219_SF055_05 B20140219_SF055_05 TB469412.[MT7]-ELQVLTK[MT7].2b4_1.heavy 559.855 / 614.363 28412.0 29.30769920349121 48 18 10 10 10 5.16752736224889 19.351614996863866 0.0 3 0.9836184430431261 9.62919817224219 28412.0 34.00520601700458 0.0 - - - - - - - 1223.6 56 10 PM20D2 peptidase M20 domain containing 2 837 107 B20140219_SF055_05 B20140219_SF055_05 TB469412.[MT7]-ELQVLTK[MT7].2y3_1.heavy 559.855 / 505.347 40588.0 29.30769920349121 48 18 10 10 10 5.16752736224889 19.351614996863866 0.0 3 0.9836184430431261 9.62919817224219 40588.0 67.09774756893108 0.0 - - - - - - - 341.2 81 5 PM20D2 peptidase M20 domain containing 2 839 108 B20140219_SF055_05 B20140219_SF055_05 TB469414.[MT7]-AQDNTRK[MT7].2y4_1.heavy 560.819 / 662.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP prolactin-induced protein 841 108 B20140219_SF055_05 B20140219_SF055_05 TB469414.[MT7]-AQDNTRK[MT7].2y5_1.heavy 560.819 / 777.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP prolactin-induced protein 843 108 B20140219_SF055_05 B20140219_SF055_05 TB469414.[MT7]-AQDNTRK[MT7].2b6_1.heavy 560.819 / 830.424 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP prolactin-induced protein 845 108 B20140219_SF055_05 B20140219_SF055_05 TB469414.[MT7]-AQDNTRK[MT7].2y6_1.heavy 560.819 / 905.492 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP prolactin-induced protein 847 109 B20140219_SF055_05 B20140219_SF055_05 TB244904.[MT7]-QAFGEK[MT7].2y4_1.heavy 484.276 / 624.347 7694.0 19.884700775146484 41 17 6 10 8 2.830686294424896 30.366882603410765 0.0 4 0.9725007257319764 7.42508561577138 7694.0 18.35345889063729 1.0 - - - - - - - 623.2727272727273 16 11 SDCBP syndecan binding protein (syntenin) 849 109 B20140219_SF055_05 B20140219_SF055_05 TB244904.[MT7]-QAFGEK[MT7].2y5_1.heavy 484.276 / 695.385 13201.0 19.884700775146484 41 17 6 10 8 2.830686294424896 30.366882603410765 0.0 4 0.9725007257319764 7.42508561577138 13201.0 28.50573905448936 0.0 - - - - - - - 693.0 26 8 SDCBP syndecan binding protein (syntenin) 851 109 B20140219_SF055_05 B20140219_SF055_05 TB244904.[MT7]-QAFGEK[MT7].2b4_1.heavy 484.276 / 548.295 766.0 19.884700775146484 41 17 6 10 8 2.830686294424896 30.366882603410765 0.0 4 0.9725007257319764 7.42508561577138 766.0 0.43749211043188485 30.0 - - - - - - - 702.6 43 15 SDCBP syndecan binding protein (syntenin) 853 109 B20140219_SF055_05 B20140219_SF055_05 TB244904.[MT7]-QAFGEK[MT7].2y3_1.heavy 484.276 / 477.279 6856.0 19.884700775146484 41 17 6 10 8 2.830686294424896 30.366882603410765 0.0 4 0.9725007257319764 7.42508561577138 6856.0 12.480008372223839 1.0 - - - - - - - 672.5555555555555 13 9 SDCBP syndecan binding protein (syntenin) 855 110 B20140219_SF055_05 B20140219_SF055_05 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 525762.0 31.387500762939453 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 525762.0 1109.100255812214 0.0 - - - - - - - 1194.375 1051 8 857 110 B20140219_SF055_05 B20140219_SF055_05 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 568795.0 31.387500762939453 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 568795.0 522.5316796442112 0.0 - - - - - - - 752.0 1137 9 859 110 B20140219_SF055_05 B20140219_SF055_05 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 951108.0 31.387500762939453 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 951108.0 770.0168779923733 0.0 - - - - - - - 1293.875 1902 8 861 111 B20140219_SF055_05 B20140219_SF055_05 TB245346.[MT7]-VLDVGC[CAM]GTSSLC[CAM]TGLYTK[MT7].3y7_1.heavy 740.381 / 986.51 10292.0 35.168399810791016 44 14 10 10 10 3.227435292685324 30.984354737224486 0.0 3 0.938228955539692 4.939790967905956 10292.0 31.347488091232666 0.0 - - - - - - - 211.86666666666667 20 15 METTL12 methyltransferase like 12 863 111 B20140219_SF055_05 B20140219_SF055_05 TB245346.[MT7]-VLDVGC[CAM]GTSSLC[CAM]TGLYTK[MT7].3y3_1.heavy 740.381 / 555.326 29310.0 35.168399810791016 44 14 10 10 10 3.227435292685324 30.984354737224486 0.0 3 0.938228955539692 4.939790967905956 29310.0 37.45364136849133 0.0 - - - - - - - 687.75 58 8 METTL12 methyltransferase like 12 865 111 B20140219_SF055_05 B20140219_SF055_05 TB245346.[MT7]-VLDVGC[CAM]GTSSLC[CAM]TGLYTK[MT7].3b4_1.heavy 740.381 / 571.357 9817.0 35.168399810791016 44 14 10 10 10 3.227435292685324 30.984354737224486 0.0 3 0.938228955539692 4.939790967905956 9817.0 22.80588843504401 0.0 - - - - - - - 288.3333333333333 19 12 METTL12 methyltransferase like 12 867 111 B20140219_SF055_05 B20140219_SF055_05 TB245346.[MT7]-VLDVGC[CAM]GTSSLC[CAM]TGLYTK[MT7].3b5_1.heavy 740.381 / 628.379 6355.0 35.168399810791016 44 14 10 10 10 3.227435292685324 30.984354737224486 0.0 3 0.938228955539692 4.939790967905956 6355.0 15.512734812833179 0.0 - - - - - - - 768.4 12 10 METTL12 methyltransferase like 12 869 112 B20140219_SF055_05 B20140219_SF055_05 TB245058.[MT7]-EFLC[CAM]DQK[MT7].2y5_1.heavy 614.318 / 807.415 2145.0 26.153932571411133 34 10 10 6 8 0.832497396113946 70.49399159114486 0.035900115966796875 4 0.8462250560211189 3.1059208156218086 2145.0 23.934190654205604 0.0 - - - - - - - 185.2 4 20 AIF1L allograft inflammatory factor 1-like 871 112 B20140219_SF055_05 B20140219_SF055_05 TB245058.[MT7]-EFLC[CAM]DQK[MT7].2y6_1.heavy 614.318 / 954.484 3433.0 26.153932571411133 34 10 10 6 8 0.832497396113946 70.49399159114486 0.035900115966796875 4 0.8462250560211189 3.1059208156218086 3433.0 17.25198681013537 1.0 - - - - - - - 176.42857142857142 7 21 AIF1L allograft inflammatory factor 1-like 873 112 B20140219_SF055_05 B20140219_SF055_05 TB245058.[MT7]-EFLC[CAM]DQK[MT7].2b5_1.heavy 614.318 / 809.362 5953.0 26.153932571411133 34 10 10 6 8 0.832497396113946 70.49399159114486 0.035900115966796875 4 0.8462250560211189 3.1059208156218086 5953.0 200.63814814814816 0.0 - - - - - - - 198.88235294117646 11 17 AIF1L allograft inflammatory factor 1-like 875 113 B20140219_SF055_05 B20140219_SF055_05 TB245053.[MT7]-K[MT7]AEDC[CAM]FR.3y6_1.heavy 405.213 / 797.325 3455.0 18.307600021362305 42 12 10 10 10 10.657942167385517 9.382674293918678 0.0 3 0.8889039692417927 3.6678190734858904 3455.0 79.74748427672955 0.0 - - - - - - - 111.4 6 10 PM20D2 peptidase M20 domain containing 2 877 113 B20140219_SF055_05 B20140219_SF055_05 TB245053.[MT7]-K[MT7]AEDC[CAM]FR.3y3_1.heavy 405.213 / 482.218 33486.0 18.307600021362305 42 12 10 10 10 10.657942167385517 9.382674293918678 0.0 3 0.8889039692417927 3.6678190734858904 33486.0 64.56209267554712 0.0 - - - - - - - 707.1 66 10 PM20D2 peptidase M20 domain containing 2 879 113 B20140219_SF055_05 B20140219_SF055_05 TB245053.[MT7]-K[MT7]AEDC[CAM]FR.3y4_1.heavy 405.213 / 597.245 21845.0 18.307600021362305 42 12 10 10 10 10.657942167385517 9.382674293918678 0.0 3 0.8889039692417927 3.6678190734858904 21845.0 84.6938315299828 0.0 - - - - - - - 268.6666666666667 43 18 PM20D2 peptidase M20 domain containing 2 881 113 B20140219_SF055_05 B20140219_SF055_05 TB245053.[MT7]-K[MT7]AEDC[CAM]FR.3y5_1.heavy 405.213 / 726.288 8079.0 18.307600021362305 42 12 10 10 10 10.657942167385517 9.382674293918678 0.0 3 0.8889039692417927 3.6678190734858904 8079.0 36.28224944714728 0.0 - - - - - - - 165.22222222222223 16 18 PM20D2 peptidase M20 domain containing 2 883 114 B20140219_SF055_05 B20140219_SF055_05 TB244995.[MT7]-AQDNTRK[MT7].3y6_2.heavy 374.215 / 453.25 5940.0 12.393899917602539 33 3 10 10 10 0.41873268307235056 113.4475171783556 0.0 3 0.5390201272226509 1.7426751738264907 5940.0 75.3913043478261 0.0 - - - - - - - 114.375 11 24 PIP prolactin-induced protein 885 114 B20140219_SF055_05 B20140219_SF055_05 TB244995.[MT7]-AQDNTRK[MT7].3b4_1.heavy 374.215 / 573.275 1558.0 12.393899917602539 33 3 10 10 10 0.41873268307235056 113.4475171783556 0.0 3 0.5390201272226509 1.7426751738264907 1558.0 59.15714285714286 0.0 - - - - - - - 81.7 3 20 PIP prolactin-induced protein 887 114 B20140219_SF055_05 B20140219_SF055_05 TB244995.[MT7]-AQDNTRK[MT7].3b3_1.heavy 374.215 / 459.232 1368.0 12.393899917602539 33 3 10 10 10 0.41873268307235056 113.4475171783556 0.0 3 0.5390201272226509 1.7426751738264907 1368.0 15.859384806230043 0.0 - - - - - - - 204.47619047619048 2 21 PIP prolactin-induced protein 889 114 B20140219_SF055_05 B20140219_SF055_05 TB244995.[MT7]-AQDNTRK[MT7].3y5_1.heavy 374.215 / 777.433 N/A 12.393899917602539 33 3 10 10 10 0.41873268307235056 113.4475171783556 0.0 3 0.5390201272226509 1.7426751738264907 0.0 0.0 1.0 - - - - - - - 0.0 0 0 PIP prolactin-induced protein 891 115 B20140219_SF055_05 B20140219_SF055_05 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 328679.0 26.05820083618164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 328679.0 1494.9761532669522 0.0 - - - - - - - 1151.5 657 2 893 115 B20140219_SF055_05 B20140219_SF055_05 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 389053.0 26.05820083618164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 389053.0 1268.8473389469464 0.0 - - - - - - - 2098.0 778 1 895 115 B20140219_SF055_05 B20140219_SF055_05 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 458943.0 26.05820083618164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 458943.0 1419.997956541525 0.0 - - - - - - - 2353.6666666666665 917 3 897 116 B20140219_SF055_05 B20140219_SF055_05 TB469493.[MT7]-VDVDC[CAM]C[CAM]EK[MT7].2y4_1.heavy 656.809 / 740.319 4117.0 20.74275016784668 47 20 10 7 10 5.530453507993692 18.08169978383517 0.02809906005859375 3 0.9900307885830619 12.350100952644274 4117.0 49.2757615309436 0.0 - - - - - - - 122.79166666666667 8 24 LY6H lymphocyte antigen 6 complex, locus H 899 116 B20140219_SF055_05 B20140219_SF055_05 TB469493.[MT7]-VDVDC[CAM]C[CAM]EK[MT7].2y5_1.heavy 656.809 / 855.346 2878.0 20.74275016784668 47 20 10 7 10 5.530453507993692 18.08169978383517 0.02809906005859375 3 0.9900307885830619 12.350100952644274 2878.0 23.022961370163753 0.0 - - - - - - - 154.70833333333334 5 24 LY6H lymphocyte antigen 6 complex, locus H 901 116 B20140219_SF055_05 B20140219_SF055_05 TB469493.[MT7]-VDVDC[CAM]C[CAM]EK[MT7].2b4_1.heavy 656.809 / 573.3 3279.0 20.74275016784668 47 20 10 7 10 5.530453507993692 18.08169978383517 0.02809906005859375 3 0.9900307885830619 12.350100952644274 3279.0 40.89575611066345 0.0 - - - - - - - 117.45454545454545 6 22 LY6H lymphocyte antigen 6 complex, locus H 903 116 B20140219_SF055_05 B20140219_SF055_05 TB469493.[MT7]-VDVDC[CAM]C[CAM]EK[MT7].2y7_1.heavy 656.809 / 1069.44 4081.0 20.74275016784668 47 20 10 7 10 5.530453507993692 18.08169978383517 0.02809906005859375 3 0.9900307885830619 12.350100952644274 4081.0 74.07601685985247 0.0 - - - - - - - 106.75 8 16 LY6H lymphocyte antigen 6 complex, locus H 905 117 B20140219_SF055_05 B20140219_SF055_05 TB469733.[MT7]-YRTPNC[CAM]SQYRLPGC[CAM]PR.4y5_1.heavy 543.02 / 586.277 16680.0 25.219550132751465 44 18 10 6 10 2.2842148409287217 32.852759597425226 0.03230094909667969 3 0.9856168076177927 10.27809912589298 16680.0 38.24358798518721 0.0 - - - - - - - 720.3636363636364 33 11 SPINK2 serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor) 907 117 B20140219_SF055_05 B20140219_SF055_05 TB469733.[MT7]-YRTPNC[CAM]SQYRLPGC[CAM]PR.4y10_2.heavy 543.02 / 617.312 5903.0 25.219550132751465 44 18 10 6 10 2.2842148409287217 32.852759597425226 0.03230094909667969 3 0.9856168076177927 10.27809912589298 5903.0 11.257629580174507 0.0 - - - - - - - 661.7 11 10 SPINK2 serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor) 909 117 B20140219_SF055_05 B20140219_SF055_05 TB469733.[MT7]-YRTPNC[CAM]SQYRLPGC[CAM]PR.4y11_2.heavy 543.02 / 697.327 4398.0 25.219550132751465 44 18 10 6 10 2.2842148409287217 32.852759597425226 0.03230094909667969 3 0.9856168076177927 10.27809912589298 4398.0 23.052412199329492 2.0 - - - - - - - 775.4285714285714 9 7 SPINK2 serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor) 911 117 B20140219_SF055_05 B20140219_SF055_05 TB469733.[MT7]-YRTPNC[CAM]SQYRLPGC[CAM]PR.4y6_1.heavy 543.02 / 699.361 4437.0 25.219550132751465 44 18 10 6 10 2.2842148409287217 32.852759597425226 0.03230094909667969 3 0.9856168076177927 10.27809912589298 4437.0 15.059822859664607 0.0 - - - - - - - 299.3333333333333 8 18 SPINK2 serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor) 913 118 B20140219_SF055_05 B20140219_SF055_05 TB469734.[MT7]-HLIEIPVRYQEEFEAR.4y8_1.heavy 544.044 / 1071.47 16742.0 34.19455146789551 42 16 10 6 10 4.921826886069519 20.317658933319 0.034900665283203125 3 0.9616310348662084 6.280205213983142 16742.0 453.4303967554223 0.0 - - - - - - - 140.8181818181818 33 11 HSPB3 heat shock 27kDa protein 3 915 118 B20140219_SF055_05 B20140219_SF055_05 TB469734.[MT7]-HLIEIPVRYQEEFEAR.4b4_1.heavy 544.044 / 637.379 248830.0 34.19455146789551 42 16 10 6 10 4.921826886069519 20.317658933319 0.034900665283203125 3 0.9616310348662084 6.280205213983142 248830.0 518.8341461812578 0.0 - - - - - - - 815.625 497 8 HSPB3 heat shock 27kDa protein 3 917 118 B20140219_SF055_05 B20140219_SF055_05 TB469734.[MT7]-HLIEIPVRYQEEFEAR.4y11_2.heavy 544.044 / 712.352 571844.0 34.19455146789551 42 16 10 6 10 4.921826886069519 20.317658933319 0.034900665283203125 3 0.9616310348662084 6.280205213983142 571844.0 800.6944056632624 0.0 - - - - - - - 395.6 1143 5 HSPB3 heat shock 27kDa protein 3 919 118 B20140219_SF055_05 B20140219_SF055_05 TB469734.[MT7]-HLIEIPVRYQEEFEAR.4b3_1.heavy 544.044 / 508.336 113503.0 34.19455146789551 42 16 10 6 10 4.921826886069519 20.317658933319 0.034900665283203125 3 0.9616310348662084 6.280205213983142 113503.0 87.11214273323328 0.0 - - - - - - - 1757.5714285714287 227 7 HSPB3 heat shock 27kDa protein 3 921 119 B20140219_SF055_05 B20140219_SF055_05 TB469310.[MT7]-FSQAAK[MT7].2y4_1.heavy 470.279 / 561.348 8950.0 18.854999542236328 48 20 10 10 8 17.41443517958384 5.742362526763831 0.0 4 0.9993327809173468 47.77536238731509 8950.0 9.832397347784934 0.0 - - - - - - - 753.5555555555555 17 9 DCTN2 dynactin 2 (p50) 923 119 B20140219_SF055_05 B20140219_SF055_05 TB469310.[MT7]-FSQAAK[MT7].2b3_1.heavy 470.279 / 507.268 11070.0 18.854999542236328 48 20 10 10 8 17.41443517958384 5.742362526763831 0.0 4 0.9993327809173468 47.77536238731509 11070.0 21.411179545727677 0.0 - - - - - - - 747.75 22 16 DCTN2 dynactin 2 (p50) 925 119 B20140219_SF055_05 B20140219_SF055_05 TB469310.[MT7]-FSQAAK[MT7].2y5_1.heavy 470.279 / 648.38 43477.0 18.854999542236328 48 20 10 10 8 17.41443517958384 5.742362526763831 0.0 4 0.9993327809173468 47.77536238731509 43477.0 172.16570902896967 0.0 - - - - - - - 264.38461538461536 86 13 DCTN2 dynactin 2 (p50) 927 119 B20140219_SF055_05 B20140219_SF055_05 TB469310.[MT7]-FSQAAK[MT7].2b4_1.heavy 470.279 / 578.305 10316.0 18.854999542236328 48 20 10 10 8 17.41443517958384 5.742362526763831 0.0 4 0.9993327809173468 47.77536238731509 10316.0 12.99940399387758 1.0 - - - - - - - 757.5 20 12 DCTN2 dynactin 2 (p50) 929 120 B20140219_SF055_05 B20140219_SF055_05 TB244892.[MT7]-QELGEAR.2y5_1.heavy 473.757 / 545.304 21955.0 17.37202501296997 37 11 10 6 10 0.8319939589787333 73.16018108323844 0.03930091857910156 3 0.8543788128918524 3.1939877724750754 21955.0 14.86795112430149 0.0 - - - - - - - 332.8888888888889 43 9 PFDN6 prefoldin subunit 6 931 120 B20140219_SF055_05 B20140219_SF055_05 TB244892.[MT7]-QELGEAR.2b4_1.heavy 473.757 / 572.316 9510.0 17.37202501296997 37 11 10 6 10 0.8319939589787333 73.16018108323844 0.03930091857910156 3 0.8543788128918524 3.1939877724750754 9510.0 26.576186152099886 0.0 - - - - - - - 667.625 19 8 PFDN6 prefoldin subunit 6 933 120 B20140219_SF055_05 B20140219_SF055_05 TB244892.[MT7]-QELGEAR.2y6_1.heavy 473.757 / 674.347 39683.0 17.37202501296997 37 11 10 6 10 0.8319939589787333 73.16018108323844 0.03930091857910156 3 0.8543788128918524 3.1939877724750754 39683.0 14.75582719898899 0.0 - - - - - - - 362.1666666666667 79 6 PFDN6 prefoldin subunit 6 935 120 B20140219_SF055_05 B20140219_SF055_05 TB244892.[MT7]-QELGEAR.2b5_1.heavy 473.757 / 701.359 68096.0 17.37202501296997 37 11 10 6 10 0.8319939589787333 73.16018108323844 0.03930091857910156 3 0.8543788128918524 3.1939877724750754 68096.0 152.27429167847237 0.0 - - - - - - - 270.1 136 10 PFDN6 prefoldin subunit 6 937 121 B20140219_SF055_05 B20140219_SF055_05 TB245237.[MT7]-EAEEHQETQC[CAM]LR.3y7_1.heavy 558.594 / 934.441 24206.0 17.362199783325195 50 20 10 10 10 5.059224368647448 19.76587569820201 0.0 3 0.990767478272579 12.83416142544889 24206.0 536.0876836158193 0.0 - - - - - - - 84.28571428571429 48 7 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 939 121 B20140219_SF055_05 B20140219_SF055_05 TB245237.[MT7]-EAEEHQETQC[CAM]LR.3y6_1.heavy 558.594 / 806.383 33003.0 17.362199783325195 50 20 10 10 10 5.059224368647448 19.76587569820201 0.0 3 0.990767478272579 12.83416142544889 33003.0 209.1655024213075 0.0 - - - - - - - 185.42857142857142 66 14 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 941 121 B20140219_SF055_05 B20140219_SF055_05 TB245237.[MT7]-EAEEHQETQC[CAM]LR.3b4_1.heavy 558.594 / 603.274 50184.0 17.362199783325195 50 20 10 10 10 5.059224368647448 19.76587569820201 0.0 3 0.990767478272579 12.83416142544889 50184.0 242.05983050847456 0.0 - - - - - - - 210.1875 100 16 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 943 121 B20140219_SF055_05 B20140219_SF055_05 TB245237.[MT7]-EAEEHQETQC[CAM]LR.3y5_1.heavy 558.594 / 677.34 35896.0 17.362199783325195 50 20 10 10 10 5.059224368647448 19.76587569820201 0.0 3 0.990767478272579 12.83416142544889 35896.0 228.65954802259887 0.0 - - - - - - - 170.05882352941177 71 17 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 945 122 B20140219_SF055_05 B20140219_SF055_05 TB469481.[MT7]-C[CAM]TIDDRVTR.3b4_1.heavy 427.223 / 634.299 68392.0 19.087900161743164 44 14 10 10 10 3.772731343162028 26.505995498790885 0.0 3 0.9466544549972026 5.319410272700935 68392.0 143.96970730110496 0.0 - - - - - - - 683.5714285714286 136 7 OPCML opioid binding protein/cell adhesion molecule-like 947 122 B20140219_SF055_05 B20140219_SF055_05 TB469481.[MT7]-C[CAM]TIDDRVTR.3b5_1.heavy 427.223 / 749.326 6380.0 19.087900161743164 44 14 10 10 10 3.772731343162028 26.505995498790885 0.0 3 0.9466544549972026 5.319410272700935 6380.0 57.3666809003843 0.0 - - - - - - - 169.0625 12 16 OPCML opioid binding protein/cell adhesion molecule-like 949 122 B20140219_SF055_05 B20140219_SF055_05 TB469481.[MT7]-C[CAM]TIDDRVTR.3b3_1.heavy 427.223 / 519.272 8845.0 19.087900161743164 44 14 10 10 10 3.772731343162028 26.505995498790885 0.0 3 0.9466544549972026 5.319410272700935 8845.0 8.378723021582733 0.0 - - - - - - - 680.4615384615385 17 13 OPCML opioid binding protein/cell adhesion molecule-like 951 122 B20140219_SF055_05 B20140219_SF055_05 TB469481.[MT7]-C[CAM]TIDDRVTR.3y5_2.heavy 427.223 / 323.685 332391.0 19.087900161743164 44 14 10 10 10 3.772731343162028 26.505995498790885 0.0 3 0.9466544549972026 5.319410272700935 332391.0 352.6229191963422 0.0 - - - - - - - 755.7272727272727 664 11 OPCML opioid binding protein/cell adhesion molecule-like 953 123 B20140219_SF055_05 B20140219_SF055_05 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 157260.0 36.02299880981445 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 157260.0 83.74980538548313 0.0 - - - - - - - 303.14285714285717 314 7 955 123 B20140219_SF055_05 B20140219_SF055_05 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 375014.0 36.02299880981445 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 375014.0 173.11748927715624 0.0 - - - - - - - 744.5 750 6 957 123 B20140219_SF055_05 B20140219_SF055_05 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 329677.0 36.02299880981445 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 329677.0 129.8834688869739 0.0 - - - - - - - 760.4285714285714 659 7 959 124 B20140219_SF055_05 B20140219_SF055_05 TB469482.[MT7]-AGLVDDFEK[MT7].2y4_1.heavy 641.35 / 682.353 8519.0 31.488224983215332 44 18 10 6 10 5.754830833501095 17.37670539642301 0.035099029541015625 3 0.9867511456202438 10.710075822031492 8519.0 23.92827487915068 0.0 - - - - - - - 247.77777777777777 17 18 LOC100510642;ATP5H ATP synthase subunit d, mitochondrial-like;ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d 961 124 B20140219_SF055_05 B20140219_SF055_05 TB469482.[MT7]-AGLVDDFEK[MT7].2y5_1.heavy 641.35 / 797.38 8233.0 31.488224983215332 44 18 10 6 10 5.754830833501095 17.37670539642301 0.035099029541015625 3 0.9867511456202438 10.710075822031492 8233.0 24.72024068164845 0.0 - - - - - - - 187.85714285714286 16 14 LOC100510642;ATP5H ATP synthase subunit d, mitochondrial-like;ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d 963 124 B20140219_SF055_05 B20140219_SF055_05 TB469482.[MT7]-AGLVDDFEK[MT7].2y3_1.heavy 641.35 / 567.326 11263.0 31.488224983215332 44 18 10 6 10 5.754830833501095 17.37670539642301 0.035099029541015625 3 0.9867511456202438 10.710075822031492 11263.0 26.08714387755102 0.0 - - - - - - - 702.4285714285714 22 7 LOC100510642;ATP5H ATP synthase subunit d, mitochondrial-like;ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d 965 124 B20140219_SF055_05 B20140219_SF055_05 TB469482.[MT7]-AGLVDDFEK[MT7].2y6_1.heavy 641.35 / 896.448 5946.0 31.488224983215332 44 18 10 6 10 5.754830833501095 17.37670539642301 0.035099029541015625 3 0.9867511456202438 10.710075822031492 5946.0 30.605267832167833 0.0 - - - - - - - 177.3 11 20 LOC100510642;ATP5H ATP synthase subunit d, mitochondrial-like;ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d 967 125 B20140219_SF055_05 B20140219_SF055_05 TB469480.[MT7]-ITDPSSSRK[MT7].2y8_1.heavy 639.866 / 1021.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - LY6H lymphocyte antigen 6 complex, locus H 969 125 B20140219_SF055_05 B20140219_SF055_05 TB469480.[MT7]-ITDPSSSRK[MT7].2y5_1.heavy 639.866 / 708.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - LY6H lymphocyte antigen 6 complex, locus H 971 125 B20140219_SF055_05 B20140219_SF055_05 TB469480.[MT7]-ITDPSSSRK[MT7].2y6_1.heavy 639.866 / 805.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - LY6H lymphocyte antigen 6 complex, locus H 973 125 B20140219_SF055_05 B20140219_SF055_05 TB469480.[MT7]-ITDPSSSRK[MT7].2y7_1.heavy 639.866 / 920.492 N/A N/A - - - - - - - - - 0.0 - - - - - - - LY6H lymphocyte antigen 6 complex, locus H 975 126 B20140219_SF055_05 B20140219_SF055_05 TB469301.[MT7]-FHPDK[MT7].2y4_1.heavy 466.266 / 640.354 1938.0 17.888600031534832 44 20 10 6 8 3.461838237731582 28.886387269650818 0.03240013122558594 4 0.995808826821146 19.05648363954754 1938.0 0.0 3.0 - - - - - - - 174.35294117647058 4 17 DNAJB4;DNAJC18;P2RX3;DNAJB12;DNAJB14 DnaJ (Hsp40) homolog, subfamily B, member 4;DnaJ (Hsp40) homolog, subfamily C, member 18;purinergic receptor P2X, ligand-gated ion channel, 3;DnaJ (Hsp40) homolog, subfamily B, member 12;DnaJ (Hsp40) homolog, subfamily B, member 14 977 126 B20140219_SF055_05 B20140219_SF055_05 TB469301.[MT7]-FHPDK[MT7].2y4_2.heavy 466.266 / 320.68 1938.0 17.888600031534832 44 20 10 6 8 3.461838237731582 28.886387269650818 0.03240013122558594 4 0.995808826821146 19.05648363954754 1938.0 10.88 0.0 - - - - - - - 165.3 3 10 DNAJB4;DNAJC18;P2RX3;DNAJB12;DNAJB14 DnaJ (Hsp40) homolog, subfamily B, member 4;DnaJ (Hsp40) homolog, subfamily C, member 18;purinergic receptor P2X, ligand-gated ion channel, 3;DnaJ (Hsp40) homolog, subfamily B, member 12;DnaJ (Hsp40) homolog, subfamily B, member 14 979 126 B20140219_SF055_05 B20140219_SF055_05 TB469301.[MT7]-FHPDK[MT7].2y3_1.heavy 466.266 / 503.295 12714.0 17.888600031534832 44 20 10 6 8 3.461838237731582 28.886387269650818 0.03240013122558594 4 0.995808826821146 19.05648363954754 12714.0 45.5374982911825 0.0 - - - - - - - 213.75 25 16 DNAJB4;DNAJC18;P2RX3;DNAJB12;DNAJB14 DnaJ (Hsp40) homolog, subfamily B, member 4;DnaJ (Hsp40) homolog, subfamily C, member 18;purinergic receptor P2X, ligand-gated ion channel, 3;DnaJ (Hsp40) homolog, subfamily B, member 12;DnaJ (Hsp40) homolog, subfamily B, member 14 981 127 B20140219_SF055_05 B20140219_SF055_05 TB469724.[MT7]-DDIGIILINQYIAEMVR.2y9_1.heavy 1060.58 / 1123.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1F ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F 983 127 B20140219_SF055_05 B20140219_SF055_05 TB469724.[MT7]-DDIGIILINQYIAEMVR.2b4_1.heavy 1060.58 / 545.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1F ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F 985 127 B20140219_SF055_05 B20140219_SF055_05 TB469724.[MT7]-DDIGIILINQYIAEMVR.2y10_1.heavy 1060.58 / 1236.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1F ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F 987 127 B20140219_SF055_05 B20140219_SF055_05 TB469724.[MT7]-DDIGIILINQYIAEMVR.2b5_1.heavy 1060.58 / 658.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1F ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F 989 128 B20140219_SF055_05 B20140219_SF055_05 TB469305.[MT7]-STFIAPR.2b3_1.heavy 468.275 / 480.258 8008.0 25.383049964904785 41 15 10 6 10 2.7563547385607614 36.279800491940776 0.034999847412109375 3 0.9568721284325695 5.9212039092640065 8008.0 10.931571982424398 1.0 - - - - - - - 1254.125 16 8 CBLN1 cerebellin 1 precursor 991 128 B20140219_SF055_05 B20140219_SF055_05 TB469305.[MT7]-STFIAPR.2y5_1.heavy 468.275 / 603.361 8008.0 25.383049964904785 41 15 10 6 10 2.7563547385607614 36.279800491940776 0.034999847412109375 3 0.9568721284325695 5.9212039092640065 8008.0 13.73531643384202 0.0 - - - - - - - 739.8 16 10 CBLN1 cerebellin 1 precursor 993 128 B20140219_SF055_05 B20140219_SF055_05 TB469305.[MT7]-STFIAPR.2b4_1.heavy 468.275 / 593.341 6784.0 25.383049964904785 41 15 10 6 10 2.7563547385607614 36.279800491940776 0.034999847412109375 3 0.9568721284325695 5.9212039092640065 6784.0 17.547119166482226 0.0 - - - - - - - 1191.0 13 7 CBLN1 cerebellin 1 precursor 995 128 B20140219_SF055_05 B20140219_SF055_05 TB469305.[MT7]-STFIAPR.2y6_1.heavy 468.275 / 704.409 20162.0 25.383049964904785 41 15 10 6 10 2.7563547385607614 36.279800491940776 0.034999847412109375 3 0.9568721284325695 5.9212039092640065 20162.0 89.82521229556897 0.0 - - - - - - - 301.0 40 18 CBLN1 cerebellin 1 precursor 997 129 B20140219_SF055_05 B20140219_SF055_05 TB245232.[MT7]-QGLAVTDEILQGK[MT7].3b4_1.heavy 553.989 / 514.311 19642.0 35.43080139160156 42 12 10 10 10 1.0674610346563937 54.54490677051635 0.0 3 0.8970325312620591 3.812531332491774 19642.0 29.559917763157898 0.0 - - - - - - - 1156.5454545454545 39 11 PAPOLG poly(A) polymerase gamma 999 129 B20140219_SF055_05 B20140219_SF055_05 TB245232.[MT7]-QGLAVTDEILQGK[MT7].3b5_1.heavy 553.989 / 613.379 19923.0 35.43080139160156 42 12 10 10 10 1.0674610346563937 54.54490677051635 0.0 3 0.8970325312620591 3.812531332491774 19923.0 66.5519017094017 0.0 - - - - - - - 640.6 39 10 PAPOLG poly(A) polymerase gamma 1001 129 B20140219_SF055_05 B20140219_SF055_05 TB245232.[MT7]-QGLAVTDEILQGK[MT7].3b8_1.heavy 553.989 / 958.496 26985.0 35.43080139160156 42 12 10 10 10 1.0674610346563937 54.54490677051635 0.0 3 0.8970325312620591 3.812531332491774 26985.0 328.51274700560975 0.0 - - - - - - - 163.77777777777777 53 18 PAPOLG poly(A) polymerase gamma 1003 129 B20140219_SF055_05 B20140219_SF055_05 TB245232.[MT7]-QGLAVTDEILQGK[MT7].3b7_1.heavy 553.989 / 829.454 16556.0 35.43080139160156 42 12 10 10 10 1.0674610346563937 54.54490677051635 0.0 3 0.8970325312620591 3.812531332491774 16556.0 74.10736283931516 0.0 - - - - - - - 265.06666666666666 33 15 PAPOLG poly(A) polymerase gamma 1005 130 B20140219_SF055_05 B20140219_SF055_05 TB469475.[MT7]-YPDSALGQLR.2y8_1.heavy 632.344 / 859.463 1868.0 30.99625062942505 43 17 10 6 10 6.335913811467071 15.78304297937493 0.03619956970214844 3 0.9770544965950091 8.13166790030951 1868.0 0.5814785992217899 1.0 - - - - - - - 675.8571428571429 3 7 KCTD19 potassium channel tetramerisation domain containing 19 1007 130 B20140219_SF055_05 B20140219_SF055_05 TB469475.[MT7]-YPDSALGQLR.2y9_1.heavy 632.344 / 956.516 29136.0 30.99625062942505 43 17 10 6 10 6.335913811467071 15.78304297937493 0.03619956970214844 3 0.9770544965950091 8.13166790030951 29136.0 91.70176996577757 0.0 - - - - - - - 279.0 58 9 KCTD19 potassium channel tetramerisation domain containing 19 1009 130 B20140219_SF055_05 B20140219_SF055_05 TB469475.[MT7]-YPDSALGQLR.2y6_1.heavy 632.344 / 657.404 1226.0 30.99625062942505 43 17 10 6 10 6.335913811467071 15.78304297937493 0.03619956970214844 3 0.9770544965950091 8.13166790030951 1226.0 0.7738503155996392 3.0 - - - - - - - 308.57142857142856 2 7 KCTD19 potassium channel tetramerisation domain containing 19 1011 130 B20140219_SF055_05 B20140219_SF055_05 TB469475.[MT7]-YPDSALGQLR.2y7_1.heavy 632.344 / 744.436 8642.0 30.99625062942505 43 17 10 6 10 6.335913811467071 15.78304297937493 0.03619956970214844 3 0.9770544965950091 8.13166790030951 8642.0 -0.5 1.0 - - - - - - - 667.5714285714286 17 7 KCTD19 potassium channel tetramerisation domain containing 19 1013 131 B20140219_SF055_05 B20140219_SF055_05 TB244878.[MT7]-RAGRDVAALASR.3y10_2.heavy 462.94 / 508.286 1354.0 19.497849464416504 44 18 10 6 10 5.0204151589289445 19.918671431414847 0.036998748779296875 3 0.9822263741318884 9.243341474871283 1354.0 2.5427230046948357 3.0 - - - - - - - 336.8235294117647 2 17 BLOC1S3 biogenesis of lysosomal organelles complex-1, subunit 3 1015 131 B20140219_SF055_05 B20140219_SF055_05 TB244878.[MT7]-RAGRDVAALASR.3y7_1.heavy 462.94 / 687.415 5686.0 19.497849464416504 44 18 10 6 10 5.0204151589289445 19.918671431414847 0.036998748779296875 3 0.9822263741318884 9.243341474871283 5686.0 29.7872737763729 0.0 - - - - - - - 176.8095238095238 11 21 BLOC1S3 biogenesis of lysosomal organelles complex-1, subunit 3 1017 131 B20140219_SF055_05 B20140219_SF055_05 TB244878.[MT7]-RAGRDVAALASR.3y6_1.heavy 462.94 / 588.346 3830.0 19.497849464416504 44 18 10 6 10 5.0204151589289445 19.918671431414847 0.036998748779296875 3 0.9822263741318884 9.243341474871283 3830.0 10.568621704423911 0.0 - - - - - - - 646.7142857142857 7 7 BLOC1S3 biogenesis of lysosomal organelles complex-1, subunit 3 1019 131 B20140219_SF055_05 B20140219_SF055_05 TB244878.[MT7]-RAGRDVAALASR.3y5_1.heavy 462.94 / 517.309 5300.0 19.497849464416504 44 18 10 6 10 5.0204151589289445 19.918671431414847 0.036998748779296875 3 0.9822263741318884 9.243341474871283 5300.0 15.74911124386685 0.0 - - - - - - - 718.8333333333334 10 12 BLOC1S3 biogenesis of lysosomal organelles complex-1, subunit 3 1021 132 B20140219_SF055_05 B20140219_SF055_05 TB244877.[MT7]-C[CAM]TIDDR.2b3_1.heavy 462.222 / 519.272 3660.0 16.753599166870117 42 12 10 10 10 2.0922342685266577 47.795794908960914 0.0 3 0.8920029303720408 3.7210719243656585 3660.0 9.582083333333333 0.0 - - - - - - - 320.0 7 12 OPCML opioid binding protein/cell adhesion molecule-like 1023 132 B20140219_SF055_05 B20140219_SF055_05 TB244877.[MT7]-C[CAM]TIDDR.2y5_1.heavy 462.222 / 619.305 8100.0 16.753599166870117 42 12 10 10 10 2.0922342685266577 47.795794908960914 0.0 3 0.8920029303720408 3.7210719243656585 8100.0 14.464285714285715 0.0 - - - - - - - 275.0 16 12 OPCML opioid binding protein/cell adhesion molecule-like 1025 132 B20140219_SF055_05 B20140219_SF055_05 TB244877.[MT7]-C[CAM]TIDDR.2b4_1.heavy 462.222 / 634.299 40321.0 16.753599166870117 42 12 10 10 10 2.0922342685266577 47.795794908960914 0.0 3 0.8920029303720408 3.7210719243656585 40321.0 119.84297222222223 0.0 - - - - - - - 690.0 80 8 OPCML opioid binding protein/cell adhesion molecule-like 1027 132 B20140219_SF055_05 B20140219_SF055_05 TB244877.[MT7]-C[CAM]TIDDR.2b5_1.heavy 462.222 / 749.326 3600.0 16.753599166870117 42 12 10 10 10 2.0922342685266577 47.795794908960914 0.0 3 0.8920029303720408 3.7210719243656585 3600.0 -0.27835396453663425 2.0 - - - - - - - 205.71428571428572 17 14 OPCML opioid binding protein/cell adhesion molecule-like 1029 133 B20140219_SF055_05 B20140219_SF055_05 TB469472.[MT7]-RHGQGIYK[MT7].2y6_1.heavy 623.867 / 809.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - RSPH1 radial spoke head 1 homolog (Chlamydomonas) 1031 133 B20140219_SF055_05 B20140219_SF055_05 TB469472.[MT7]-RHGQGIYK[MT7].2b7_1.heavy 623.867 / 956.518 N/A N/A - - - - - - - - - 0.0 - - - - - - - RSPH1 radial spoke head 1 homolog (Chlamydomonas) 1033 133 B20140219_SF055_05 B20140219_SF055_05 TB469472.[MT7]-RHGQGIYK[MT7].2b5_1.heavy 623.867 / 680.371 N/A N/A - - - - - - - - - 0.0 - - - - - - - RSPH1 radial spoke head 1 homolog (Chlamydomonas) 1035 133 B20140219_SF055_05 B20140219_SF055_05 TB469472.[MT7]-RHGQGIYK[MT7].2y7_1.heavy 623.867 / 946.523 N/A N/A - - - - - - - - - 0.0 - - - - - - - RSPH1 radial spoke head 1 homolog (Chlamydomonas) 1037 134 B20140219_SF055_05 B20140219_SF055_05 TB244876.[MT7]-LFQVK[MT7].2b3_1.heavy 461.802 / 533.32 9713.0 30.98720073699951 42 20 10 6 6 15.997285323092694 6.251060600616166 0.03619956970214844 6 0.9986429416247516 33.49762212324172 9713.0 4.658935758810732 1.0 - - - - - - - 1251.0 19 9 C17orf104;GSN chromosome 17 open reading frame 104;gelsolin 1039 134 B20140219_SF055_05 B20140219_SF055_05 TB244876.[MT7]-LFQVK[MT7].2y4_1.heavy 461.802 / 665.41 33832.0 30.98720073699951 42 20 10 6 6 15.997285323092694 6.251060600616166 0.03619956970214844 6 0.9986429416247516 33.49762212324172 33832.0 7.947392453421903 0.0 - - - - - - - 166.0 67 1 C17orf104;GSN chromosome 17 open reading frame 104;gelsolin 1041 134 B20140219_SF055_05 B20140219_SF055_05 TB244876.[MT7]-LFQVK[MT7].2b4_1.heavy 461.802 / 632.389 4581.0 30.98720073699951 42 20 10 6 6 15.997285323092694 6.251060600616166 0.03619956970214844 6 0.9986429416247516 33.49762212324172 4581.0 3.837970194983534 3.0 - - - - - - - 1238.0 27 7 C17orf104;GSN chromosome 17 open reading frame 104;gelsolin 1043 134 B20140219_SF055_05 B20140219_SF055_05 TB244876.[MT7]-LFQVK[MT7].2y3_1.heavy 461.802 / 518.342 9106.0 30.98720073699951 42 20 10 6 6 15.997285323092694 6.251060600616166 0.03619956970214844 6 0.9986429416247516 33.49762212324172 9106.0 2.8628386081116823 4.0 - - - - - - - 1280.6 37 5 C17orf104;GSN chromosome 17 open reading frame 104;gelsolin 1045 135 B20140219_SF055_05 B20140219_SF055_05 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 293285.0 38.8838996887207 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 293285.0 495.5354887947843 0.0 - - - - - - - 758.9166666666666 586 12 1047 135 B20140219_SF055_05 B20140219_SF055_05 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 510439.0 38.8838996887207 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 510439.0 395.2876611360798 0.0 - - - - - - - 1248.625 1020 8 1049 135 B20140219_SF055_05 B20140219_SF055_05 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 670527.0 38.8838996887207 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 670527.0 269.28194017542165 0.0 - - - - - - - 1231.5 1341 12 1051 136 B20140219_SF055_05 B20140219_SF055_05 TB244871.[MT7]-LEEIK[MT7].2b3_1.heavy 460.289 / 516.279 10874.0 25.44580078125 32 16 0 10 6 1.2847226147307567 50.83798763846842 0.0 5 0.9609173780269035 6.222226716028116 10874.0 10.6937539528959 0.0 - - - - - - - 783.0 21 9 LOC100289196;LRRC42;TOR1AIP2;C6orf204;VPS13C;LRRC49;PL-5283;LOC654258;TSGA14 hypothetical protein LOC100289196;leucine rich repeat containing 42;torsin A interacting protein 2;chromosome 6 open reading frame 204;vacuolar protein sorting 13 homolog C (S. cerevisiae);leucine rich repeat containing 49;PL-5283 protein;leucine-rich repeat-containing protein 49-like;testis specific, 14 1053 136 B20140219_SF055_05 B20140219_SF055_05 TB244871.[MT7]-LEEIK[MT7].2y4_1.heavy 460.289 / 662.384 22564.0 25.44580078125 32 16 0 10 6 1.2847226147307567 50.83798763846842 0.0 5 0.9609173780269035 6.222226716028116 22564.0 21.046637967971407 1.0 - - - - - - - 459.0 232 1 LOC100289196;LRRC42;TOR1AIP2;C6orf204;VPS13C;LRRC49;PL-5283;LOC654258;TSGA14 hypothetical protein LOC100289196;leucine rich repeat containing 42;torsin A interacting protein 2;chromosome 6 open reading frame 204;vacuolar protein sorting 13 homolog C (S. cerevisiae);leucine rich repeat containing 49;PL-5283 protein;leucine-rich repeat-containing protein 49-like;testis specific, 14 1055 136 B20140219_SF055_05 B20140219_SF055_05 TB244871.[MT7]-LEEIK[MT7].2b4_1.heavy 460.289 / 629.363 11691.0 25.44580078125 32 16 0 10 6 1.2847226147307567 50.83798763846842 0.0 5 0.9609173780269035 6.222226716028116 11691.0 25.982840012781487 1.0 - - - - - - - 736.8571428571429 24 7 LOC100289196;LRRC42;TOR1AIP2;C6orf204;VPS13C;LRRC49;PL-5283;LOC654258;TSGA14 hypothetical protein LOC100289196;leucine rich repeat containing 42;torsin A interacting protein 2;chromosome 6 open reading frame 204;vacuolar protein sorting 13 homolog C (S. cerevisiae);leucine rich repeat containing 49;PL-5283 protein;leucine-rich repeat-containing protein 49-like;testis specific, 14 1057 136 B20140219_SF055_05 B20140219_SF055_05 TB244871.[MT7]-LEEIK[MT7].2y3_1.heavy 460.289 / 533.341 10210.0 25.44580078125 32 16 0 10 6 1.2847226147307567 50.83798763846842 0.0 5 0.9609173780269035 6.222226716028116 10210.0 12.998041775456919 2.0 - - - - - - - 715.0 78 11 LOC100289196;LRRC42;TOR1AIP2;C6orf204;VPS13C;LRRC49;PL-5283;LOC654258;TSGA14 hypothetical protein LOC100289196;leucine rich repeat containing 42;torsin A interacting protein 2;chromosome 6 open reading frame 204;vacuolar protein sorting 13 homolog C (S. cerevisiae);leucine rich repeat containing 49;PL-5283 protein;leucine-rich repeat-containing protein 49-like;testis specific, 14 1059 137 B20140219_SF055_05 B20140219_SF055_05 TB469713.[MT7]-GDLC[CAM]ALAERLDIVAGC[CAM]R.3y7_1.heavy 678.351 / 790.388 13829.0 41.15420150756836 48 18 10 10 10 4.469623134851432 22.373250939270513 0.0 3 0.9820013011528654 9.185192440924142 13829.0 40.73424032865457 0.0 - - - - - - - 686.8888888888889 27 9 BLOC1S3 biogenesis of lysosomal organelles complex-1, subunit 3 1061 137 B20140219_SF055_05 B20140219_SF055_05 TB469713.[MT7]-GDLC[CAM]ALAERLDIVAGC[CAM]R.3y6_1.heavy 678.351 / 675.361 42840.0 41.15420150756836 48 18 10 10 10 4.469623134851432 22.373250939270513 0.0 3 0.9820013011528654 9.185192440924142 42840.0 72.04163508765022 0.0 - - - - - - - 690.0 85 10 BLOC1S3 biogenesis of lysosomal organelles complex-1, subunit 3 1063 137 B20140219_SF055_05 B20140219_SF055_05 TB469713.[MT7]-GDLC[CAM]ALAERLDIVAGC[CAM]R.3b5_1.heavy 678.351 / 661.31 21723.0 41.15420150756836 48 18 10 10 10 4.469623134851432 22.373250939270513 0.0 3 0.9820013011528654 9.185192440924142 21723.0 36.70924791086351 0.0 - - - - - - - 1166.5 43 8 BLOC1S3 biogenesis of lysosomal organelles complex-1, subunit 3 1065 137 B20140219_SF055_05 B20140219_SF055_05 TB469713.[MT7]-GDLC[CAM]ALAERLDIVAGC[CAM]R.3y5_1.heavy 678.351 / 562.277 18660.0 41.15420150756836 48 18 10 10 10 4.469623134851432 22.373250939270513 0.0 3 0.9820013011528654 9.185192440924142 18660.0 69.0783844011142 0.0 - - - - - - - 364.6842105263158 37 19 BLOC1S3 biogenesis of lysosomal organelles complex-1, subunit 3 1067 138 B20140219_SF055_05 B20140219_SF055_05 TB106397.[MT7]-TLAPMDVLNEWTAEITVYSPQQIIK[MT7].4y4_1.heavy 787.927 / 645.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 1069 138 B20140219_SF055_05 B20140219_SF055_05 TB106397.[MT7]-TLAPMDVLNEWTAEITVYSPQQIIK[MT7].4b7_1.heavy 787.927 / 872.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 1071 138 B20140219_SF055_05 B20140219_SF055_05 TB106397.[MT7]-TLAPMDVLNEWTAEITVYSPQQIIK[MT7].4y7_1.heavy 787.927 / 957.585 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 1073 138 B20140219_SF055_05 B20140219_SF055_05 TB106397.[MT7]-TLAPMDVLNEWTAEITVYSPQQIIK[MT7].4y6_1.heavy 787.927 / 870.553 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 1075 139 B20140219_SF055_05 B20140219_SF055_05 TB106398.[MT7]-ALAMTALDVIFK[MT7]PELLEGIREDFK[MT7].4y12_2.heavy 788.701 / 795.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - PM20D2 peptidase M20 domain containing 2 1077 139 B20140219_SF055_05 B20140219_SF055_05 TB106398.[MT7]-ALAMTALDVIFK[MT7]PELLEGIREDFK[MT7].4b4_1.heavy 788.701 / 531.308 N/A N/A - - - - - - - - - 0.0 - - - - - - - PM20D2 peptidase M20 domain containing 2 1079 139 B20140219_SF055_05 B20140219_SF055_05 TB106398.[MT7]-ALAMTALDVIFK[MT7]PELLEGIREDFK[MT7].4y7_1.heavy 788.701 / 1008.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - PM20D2 peptidase M20 domain containing 2 1081 139 B20140219_SF055_05 B20140219_SF055_05 TB106398.[MT7]-ALAMTALDVIFK[MT7]PELLEGIREDFK[MT7].4b6_1.heavy 788.701 / 703.393 N/A N/A - - - - - - - - - 0.0 - - - - - - - PM20D2 peptidase M20 domain containing 2 1083 140 B20140219_SF055_05 B20140219_SF055_05 TB106395.[MT7]-LK[MT7]PDTVPAPC[CAM]C[CAM]VPASYNPMVLIQK[MT7].4y4_1.heavy 783.426 / 645.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF15 growth differentiation factor 15 1085 140 B20140219_SF055_05 B20140219_SF055_05 TB106395.[MT7]-LK[MT7]PDTVPAPC[CAM]C[CAM]VPASYNPMVLIQK[MT7].4b8_1.heavy 783.426 / 1110.68 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF15 growth differentiation factor 15 1087 140 B20140219_SF055_05 B20140219_SF055_05 TB106395.[MT7]-LK[MT7]PDTVPAPC[CAM]C[CAM]VPASYNPMVLIQK[MT7].4y3_1.heavy 783.426 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF15 growth differentiation factor 15 1089 140 B20140219_SF055_05 B20140219_SF055_05 TB106395.[MT7]-LK[MT7]PDTVPAPC[CAM]C[CAM]VPASYNPMVLIQK[MT7].4b6_1.heavy 783.426 / 942.586 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF15 growth differentiation factor 15 1091 141 B20140219_SF055_05 B20140219_SF055_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 515084.0 34.05659866333008 24 -3 9 10 8 null 0.0 0.0 4 0.0 0.0 515084.0 686.3562269344824 0.0 - - - - - - - 1198.111111111111 1030 9 1093 141 B20140219_SF055_05 B20140219_SF055_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 89765.0 34.05659866333008 24 -3 9 10 8 null 0.0 0.0 4 0.0 0.0 89765.0 99.33846480555984 1.0 - - - - - - - 1204.2222222222222 1283 9 1095 141 B20140219_SF055_05 B20140219_SF055_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 70395.0 34.05659866333008 24 -3 9 10 8 null 0.0 0.0 4 0.0 0.0 70395.0 67.6302299768646 0.0 - - - - - - - 1244.7 140 10 1097 142 B20140219_SF055_05 B20140219_SF055_05 TB106396.[MT7]-TLAPMDVLNEWTAEITVYSPQQIIK[MT7].3y6_1.heavy 1050.23 / 870.553 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 1099 142 B20140219_SF055_05 B20140219_SF055_05 TB106396.[MT7]-TLAPMDVLNEWTAEITVYSPQQIIK[MT7].3b10_1.heavy 1050.23 / 1228.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 1101 142 B20140219_SF055_05 B20140219_SF055_05 TB106396.[MT7]-TLAPMDVLNEWTAEITVYSPQQIIK[MT7].3b8_1.heavy 1050.23 / 985.551 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 1103 142 B20140219_SF055_05 B20140219_SF055_05 TB106396.[MT7]-TLAPMDVLNEWTAEITVYSPQQIIK[MT7].3b7_1.heavy 1050.23 / 872.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 1105 143 B20140219_SF055_05 B20140219_SF055_05 TB106393.[MT7]-TVSIPSYIEPEDDYDDVEIPANTEK[MT7].4y5_1.heavy 782.633 / 706.385 9459.0 37.14830017089844 43 17 10 6 10 3.973384753350296 25.167459535772757 0.0316009521484375 3 0.9763538063849753 8.009810298574209 9459.0 25.595159124138547 0.0 - - - - - - - 696.4444444444445 18 9 C17orf87 chromosome 17 open reading frame 87 1107 143 B20140219_SF055_05 B20140219_SF055_05 TB106393.[MT7]-TVSIPSYIEPEDDYDDVEIPANTEK[MT7].4b4_1.heavy 782.633 / 545.341 41925.0 37.14830017089844 43 17 10 6 10 3.973384753350296 25.167459535772757 0.0316009521484375 3 0.9763538063849753 8.009810298574209 41925.0 58.81709257161968 0.0 - - - - - - - 428.0 83 4 C17orf87 chromosome 17 open reading frame 87 1109 143 B20140219_SF055_05 B20140219_SF055_05 TB106393.[MT7]-TVSIPSYIEPEDDYDDVEIPANTEK[MT7].4y3_1.heavy 782.633 / 521.305 9576.0 37.14830017089844 43 17 10 6 10 3.973384753350296 25.167459535772757 0.0316009521484375 3 0.9763538063849753 8.009810298574209 9576.0 13.289709746736655 0.0 - - - - - - - 686.6363636363636 19 11 C17orf87 chromosome 17 open reading frame 87 1111 143 B20140219_SF055_05 B20140219_SF055_05 TB106393.[MT7]-TVSIPSYIEPEDDYDDVEIPANTEK[MT7].4y6_1.heavy 782.633 / 803.438 72094.0 37.14830017089844 43 17 10 6 10 3.973384753350296 25.167459535772757 0.0316009521484375 3 0.9763538063849753 8.009810298574209 72094.0 80.18517139858594 0.0 - - - - - - - 627.75 144 8 C17orf87 chromosome 17 open reading frame 87 1113 144 B20140219_SF055_05 B20140219_SF055_05 TB245398.[MT7]-ITHEVDELTQIIADVSQDPTLPR.3y11_1.heavy 912.151 / 1198.61 12507.0 48.309200286865234 47 17 10 10 10 2.7236623601140875 29.386673843813945 0.0 3 0.9742068098987169 7.667819970517987 12507.0 109.64717336849044 0.0 - - - - - - - 175.46153846153845 25 13 POLR2I polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa 1115 144 B20140219_SF055_05 B20140219_SF055_05 TB245398.[MT7]-ITHEVDELTQIIADVSQDPTLPR.3b4_1.heavy 912.151 / 625.343 8194.0 48.309200286865234 47 17 10 10 10 2.7236623601140875 29.386673843813945 0.0 3 0.9742068098987169 7.667819970517987 8194.0 49.51440080734914 0.0 - - - - - - - 155.88235294117646 16 17 POLR2I polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa 1117 144 B20140219_SF055_05 B20140219_SF055_05 TB245398.[MT7]-ITHEVDELTQIIADVSQDPTLPR.3b7_1.heavy 912.151 / 968.481 8317.0 48.309200286865234 47 17 10 10 10 2.7236623601140875 29.386673843813945 0.0 3 0.9742068098987169 7.667819970517987 8317.0 31.274618716481548 1.0 - - - - - - - 191.77777777777777 19 9 POLR2I polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa 1119 144 B20140219_SF055_05 B20140219_SF055_05 TB245398.[MT7]-ITHEVDELTQIIADVSQDPTLPR.3y5_1.heavy 912.151 / 583.356 61732.0 48.309200286865234 47 17 10 10 10 2.7236623601140875 29.386673843813945 0.0 3 0.9742068098987169 7.667819970517987 61732.0 374.8014285714286 0.0 - - - - - - - 228.71428571428572 123 14 POLR2I polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa 1121 145 B20140219_SF055_05 B20140219_SF055_05 TB106392.[MT7]-TVSIPSYIEPEDDYDDVEIPANTEK[MT7].3b9_1.heavy 1043.17 / 1134.62 4694.0 37.14830017089844 46 20 10 6 10 7.765114622563562 12.878109964973856 0.0316009521484375 3 0.9934858234307797 15.282576159292066 4694.0 12.001704545454546 1.0 - - - - - - - 206.33333333333334 9 18 C17orf87 chromosome 17 open reading frame 87 1123 145 B20140219_SF055_05 B20140219_SF055_05 TB106392.[MT7]-TVSIPSYIEPEDDYDDVEIPANTEK[MT7].3y6_1.heavy 1043.17 / 803.438 28245.0 37.14830017089844 46 20 10 6 10 7.765114622563562 12.878109964973856 0.0316009521484375 3 0.9934858234307797 15.282576159292066 28245.0 60.91174121405751 0.0 - - - - - - - 305.0 56 10 C17orf87 chromosome 17 open reading frame 87 1125 145 B20140219_SF055_05 B20140219_SF055_05 TB106392.[MT7]-TVSIPSYIEPEDDYDDVEIPANTEK[MT7].3b4_1.heavy 1043.17 / 545.341 12401.0 37.14830017089844 46 20 10 6 10 7.765114622563562 12.878109964973856 0.0316009521484375 3 0.9934858234307797 15.282576159292066 12401.0 31.87874831763122 0.0 - - - - - - - 634.6666666666666 24 9 C17orf87 chromosome 17 open reading frame 87 1127 145 B20140219_SF055_05 B20140219_SF055_05 TB106392.[MT7]-TVSIPSYIEPEDDYDDVEIPANTEK[MT7].3y4_1.heavy 1043.17 / 635.348 3599.0 37.14830017089844 46 20 10 6 10 7.765114622563562 12.878109964973856 0.0316009521484375 3 0.9934858234307797 15.282576159292066 3599.0 16.58262647754137 0.0 - - - - - - - 148.85714285714286 7 21 C17orf87 chromosome 17 open reading frame 87 1129 146 B20140219_SF055_05 B20140219_SF055_05 TB245397.[MT7]-EIHQDWANREYIEIITSSIK[MT7].4y5_1.heavy 684.117 / 679.411 24153.0 39.57759952545166 41 15 10 6 10 2.4243184220656486 35.04134892014768 0.033199310302734375 3 0.9500222153129673 5.497285690762265 24153.0 28.449597110370455 0.0 - - - - - - - 773.4705882352941 48 17 C3orf10 chromosome 3 open reading frame 10 1131 146 B20140219_SF055_05 B20140219_SF055_05 TB245397.[MT7]-EIHQDWANREYIEIITSSIK[MT7].4b5_1.heavy 684.117 / 767.38 3891.0 39.57759952545166 41 15 10 6 10 2.4243184220656486 35.04134892014768 0.033199310302734375 3 0.9500222153129673 5.497285690762265 3891.0 11.588082782278997 0.0 - - - - - - - 649.25 7 16 C3orf10 chromosome 3 open reading frame 10 1133 146 B20140219_SF055_05 B20140219_SF055_05 TB245397.[MT7]-EIHQDWANREYIEIITSSIK[MT7].4y6_1.heavy 684.117 / 792.495 4240.0 39.57759952545166 41 15 10 6 10 2.4243184220656486 35.04134892014768 0.033199310302734375 3 0.9500222153129673 5.497285690762265 4240.0 10.060812612753942 0.0 - - - - - - - 633.6923076923077 8 13 C3orf10 chromosome 3 open reading frame 10 1135 146 B20140219_SF055_05 B20140219_SF055_05 TB245397.[MT7]-EIHQDWANREYIEIITSSIK[MT7].4b10_2.heavy 684.117 / 712.345 3113.0 39.57759952545166 41 15 10 6 10 2.4243184220656486 35.04134892014768 0.033199310302734375 3 0.9500222153129673 5.497285690762265 3113.0 9.487281681858278 0.0 - - - - - - - 325.39130434782606 6 23 C3orf10 chromosome 3 open reading frame 10 1137 147 B20140219_SF055_05 B20140219_SF055_05 TB106390.[MT7]-RHC[CAM]AEPFTEYWTC[CAM]IDYTGQQLFR.3b5_1.heavy 1041.48 / 798.38 2563.0 42.49140167236328 48 18 10 10 10 11.119559119948736 8.993162311678148 0.0 3 0.9882941560708117 11.395580260776166 2563.0 5.092052980132451 0.0 - - - - - - - 99.76923076923077 5 13 NDUFA8 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa 1139 147 B20140219_SF055_05 B20140219_SF055_05 TB106390.[MT7]-RHC[CAM]AEPFTEYWTC[CAM]IDYTGQQLFR.3y4_1.heavy 1041.48 / 563.33 1658.0 42.49140167236328 48 18 10 10 10 11.119559119948736 8.993162311678148 0.0 3 0.9882941560708117 11.395580260776166 1658.0 8.702209944751381 0.0 - - - - - - - 134.7058823529412 3 17 NDUFA8 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa 1141 147 B20140219_SF055_05 B20140219_SF055_05 TB106390.[MT7]-RHC[CAM]AEPFTEYWTC[CAM]IDYTGQQLFR.3y8_1.heavy 1041.48 / 1012.52 2050.0 42.49140167236328 48 18 10 10 10 11.119559119948736 8.993162311678148 0.0 3 0.9882941560708117 11.395580260776166 2050.0 8.25103734439834 0.0 - - - - - - - 134.36363636363637 4 11 NDUFA8 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa 1143 147 B20140219_SF055_05 B20140219_SF055_05 TB106390.[MT7]-RHC[CAM]AEPFTEYWTC[CAM]IDYTGQQLFR.3y9_1.heavy 1041.48 / 1127.55 2050.0 42.49140167236328 48 18 10 10 10 11.119559119948736 8.993162311678148 0.0 3 0.9882941560708117 11.395580260776166 2050.0 31.774999999999995 0.0 - - - - - - - 71.0909090909091 4 11 NDUFA8 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa 1145 148 B20140219_SF055_05 B20140219_SF055_05 TB106386.[MT7]-SALLLGIRDSMEPVVEQLTQEFC[CAM]ER.3y7_1.heavy 1022.19 / 969.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510686;CYP21A2 steroid 21-hydroxylase-like;cytochrome P450, family 21, subfamily A, polypeptide 2 1147 148 B20140219_SF055_05 B20140219_SF055_05 TB106386.[MT7]-SALLLGIRDSMEPVVEQLTQEFC[CAM]ER.3b4_1.heavy 1022.19 / 529.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510686;CYP21A2 steroid 21-hydroxylase-like;cytochrome P450, family 21, subfamily A, polypeptide 2 1149 148 B20140219_SF055_05 B20140219_SF055_05 TB106386.[MT7]-SALLLGIRDSMEPVVEQLTQEFC[CAM]ER.3y4_1.heavy 1022.19 / 611.261 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510686;CYP21A2 steroid 21-hydroxylase-like;cytochrome P450, family 21, subfamily A, polypeptide 2 1151 148 B20140219_SF055_05 B20140219_SF055_05 TB106386.[MT7]-SALLLGIRDSMEPVVEQLTQEFC[CAM]ER.3y8_1.heavy 1022.19 / 1082.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510686;CYP21A2 steroid 21-hydroxylase-like;cytochrome P450, family 21, subfamily A, polypeptide 2 1153 149 B20140219_SF055_05 B20140219_SF055_05 TB469705.[MT7]-FDLVPVPTNLYGDFFTGDAYVILK[MT7].3b6_1.heavy 998.203 / 815.478 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 1155 149 B20140219_SF055_05 B20140219_SF055_05 TB469705.[MT7]-FDLVPVPTNLYGDFFTGDAYVILK[MT7].3b4_1.heavy 998.203 / 619.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 1157 149 B20140219_SF055_05 B20140219_SF055_05 TB469705.[MT7]-FDLVPVPTNLYGDFFTGDAYVILK[MT7].3b3_1.heavy 998.203 / 520.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 1159 149 B20140219_SF055_05 B20140219_SF055_05 TB469705.[MT7]-FDLVPVPTNLYGDFFTGDAYVILK[MT7].3y8_1.heavy 998.203 / 1022.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 1161 150 B20140219_SF055_05 B20140219_SF055_05 TB245114.[MT7]-SDGDLIVPARR.3b6_1.heavy 448.257 / 745.385 35744.0 24.47410011291504 42 12 10 10 10 0.9319534821034022 65.69925547674754 0.0 3 0.8842591709741457 3.5920175098478024 35744.0 134.43165794286435 0.0 - - - - - - - 221.28571428571428 71 14 MMAA methylmalonic aciduria (cobalamin deficiency) cblA type 1163 150 B20140219_SF055_05 B20140219_SF055_05 TB245114.[MT7]-SDGDLIVPARR.3b4_1.heavy 448.257 / 519.217 118459.0 24.47410011291504 42 12 10 10 10 0.9319534821034022 65.69925547674754 0.0 3 0.8842591709741457 3.5920175098478024 118459.0 63.728433999855596 0.0 - - - - - - - 790.2 236 5 MMAA methylmalonic aciduria (cobalamin deficiency) cblA type 1165 150 B20140219_SF055_05 B20140219_SF055_05 TB245114.[MT7]-SDGDLIVPARR.3b5_1.heavy 448.257 / 632.301 96276.0 24.47410011291504 42 12 10 10 10 0.9319534821034022 65.69925547674754 0.0 3 0.8842591709741457 3.5920175098478024 96276.0 156.59689399756513 0.0 - - - - - - - 318.3636363636364 192 11 MMAA methylmalonic aciduria (cobalamin deficiency) cblA type 1167 150 B20140219_SF055_05 B20140219_SF055_05 TB245114.[MT7]-SDGDLIVPARR.3y4_1.heavy 448.257 / 499.31 130314.0 24.47410011291504 42 12 10 10 10 0.9319534821034022 65.69925547674754 0.0 3 0.8842591709741457 3.5920175098478024 130314.0 61.67706588573387 0.0 - - - - - - - 393.0 260 4 MMAA methylmalonic aciduria (cobalamin deficiency) cblA type 1169 151 B20140219_SF055_05 B20140219_SF055_05 TB106388.[MT7]-K[MT7]AIPAGC[CAM]GDEEEEEEESILDTVLK[MT7].4y5_1.heavy 774.143 / 719.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPLX2 complexin 2 1171 151 B20140219_SF055_05 B20140219_SF055_05 TB106388.[MT7]-K[MT7]AIPAGC[CAM]GDEEEEEEESILDTVLK[MT7].4y6_1.heavy 774.143 / 832.526 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPLX2 complexin 2 1173 151 B20140219_SF055_05 B20140219_SF055_05 TB106388.[MT7]-K[MT7]AIPAGC[CAM]GDEEEEEEESILDTVLK[MT7].4b9_2.heavy 774.143 / 579.813 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPLX2 complexin 2 1175 151 B20140219_SF055_05 B20140219_SF055_05 TB106388.[MT7]-K[MT7]AIPAGC[CAM]GDEEEEEEESILDTVLK[MT7].4b3_1.heavy 774.143 / 601.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPLX2 complexin 2 1177 152 B20140219_SF055_05 B20140219_SF055_05 TB469323.[MT7]-VNEIAK[MT7].2y4_1.heavy 481.3 / 604.379 8556.0 21.1003999710083 43 16 10 7 10 3.1557818769959742 31.687868140998127 0.027599334716796875 3 0.9663695458938131 6.71075374827338 8556.0 18.807644133197456 0.0 - - - - - - - 312.7368421052632 17 19 DCTN2 dynactin 2 (p50) 1179 152 B20140219_SF055_05 B20140219_SF055_05 TB469323.[MT7]-VNEIAK[MT7].2b3_1.heavy 481.3 / 487.263 22205.0 21.1003999710083 43 16 10 7 10 3.1557818769959742 31.687868140998127 0.027599334716796875 3 0.9663695458938131 6.71075374827338 22205.0 32.76756631730319 0.0 - - - - - - - 650.6666666666666 44 18 DCTN2 dynactin 2 (p50) 1181 152 B20140219_SF055_05 B20140219_SF055_05 TB469323.[MT7]-VNEIAK[MT7].2y5_1.heavy 481.3 / 718.422 46107.0 21.1003999710083 43 16 10 7 10 3.1557818769959742 31.687868140998127 0.027599334716796875 3 0.9663695458938131 6.71075374827338 46107.0 113.42684202159217 0.0 - - - - - - - 648.4 92 10 DCTN2 dynactin 2 (p50) 1183 152 B20140219_SF055_05 B20140219_SF055_05 TB469323.[MT7]-VNEIAK[MT7].2b4_1.heavy 481.3 / 600.347 12970.0 21.1003999710083 43 16 10 7 10 3.1557818769959742 31.687868140998127 0.027599334716796875 3 0.9663695458938131 6.71075374827338 12970.0 34.00845484178817 0.0 - - - - - - - 623.1428571428571 25 14 DCTN2 dynactin 2 (p50) 1185 153 B20140219_SF055_05 B20140219_SF055_05 TB106389.[MT7]-C[CAM]NYVVDNIDHLYPNFLVNELILK[MT7].4b4_1.heavy 774.164 / 681.315 2245.0 48.229000091552734 33 3 10 10 10 0.4361956254087926 106.69763067048524 0.0 3 0.5448019765498169 1.754728673946426 2245.0 6.472792838657673 0.0 - - - - - - - 233.05263157894737 4 19 RFWD2 ring finger and WD repeat domain 2 1187 153 B20140219_SF055_05 B20140219_SF055_05 TB106389.[MT7]-C[CAM]NYVVDNIDHLYPNFLVNELILK[MT7].4y3_1.heavy 774.164 / 517.383 13228.0 48.229000091552734 33 3 10 10 10 0.4361956254087926 106.69763067048524 0.0 3 0.5448019765498169 1.754728673946426 13228.0 31.805676680733715 0.0 - - - - - - - 197.1875 26 16 RFWD2 ring finger and WD repeat domain 2 1189 153 B20140219_SF055_05 B20140219_SF055_05 TB106389.[MT7]-C[CAM]NYVVDNIDHLYPNFLVNELILK[MT7].4b9_1.heavy 774.164 / 1237.56 1032.0 48.229000091552734 33 3 10 10 10 0.4361956254087926 106.69763067048524 0.0 3 0.5448019765498169 1.754728673946426 1032.0 21.358737524770312 0.0 - - - - - - - 130.14285714285714 2 7 RFWD2 ring finger and WD repeat domain 2 1191 153 B20140219_SF055_05 B20140219_SF055_05 TB106389.[MT7]-C[CAM]NYVVDNIDHLYPNFLVNELILK[MT7].4b3_1.heavy 774.164 / 582.246 1517.0 48.229000091552734 33 3 10 10 10 0.4361956254087926 106.69763067048524 0.0 3 0.5448019765498169 1.754728673946426 1517.0 16.541643073398248 0.0 - - - - - - - 177.78571428571428 3 14 RFWD2 ring finger and WD repeat domain 2 1193 154 B20140219_SF055_05 B20140219_SF055_05 TB106382.[MT7]-GLEDC[CAM]RLDHALYALPGPTIVDLRK[MT7].4b8_2.heavy 753.415 / 552.267 20263.0 37.25920104980469 46 16 10 10 10 2.646721768445105 32.50408157139957 0.0 3 0.969057011147024 6.997694325343065 20263.0 59.05036303945941 0.0 - - - - - - - 632.1111111111111 40 9 HSPB3 heat shock 27kDa protein 3 1195 154 B20140219_SF055_05 B20140219_SF055_05 TB106382.[MT7]-GLEDC[CAM]RLDHALYALPGPTIVDLRK[MT7].4y10_1.heavy 753.415 / 1239.75 8304.0 37.25920104980469 46 16 10 10 10 2.646721768445105 32.50408157139957 0.0 3 0.969057011147024 6.997694325343065 8304.0 93.37831325301204 0.0 - - - - - - - 105.10526315789474 16 19 HSPB3 heat shock 27kDa protein 3 1197 154 B20140219_SF055_05 B20140219_SF055_05 TB106382.[MT7]-GLEDC[CAM]RLDHALYALPGPTIVDLRK[MT7].4b4_1.heavy 753.415 / 559.284 12540.0 37.25920104980469 46 16 10 10 10 2.646721768445105 32.50408157139957 0.0 3 0.969057011147024 6.997694325343065 12540.0 34.81188710388825 0.0 - - - - - - - 709.6363636363636 25 11 HSPB3 heat shock 27kDa protein 3 1199 154 B20140219_SF055_05 B20140219_SF055_05 TB106382.[MT7]-GLEDC[CAM]RLDHALYALPGPTIVDLRK[MT7].4y3_1.heavy 753.415 / 560.4 9758.0 37.25920104980469 46 16 10 10 10 2.646721768445105 32.50408157139957 0.0 3 0.969057011147024 6.997694325343065 9758.0 29.454845557868868 0.0 - - - - - - - 656.7272727272727 19 11 HSPB3 heat shock 27kDa protein 3 1201 155 B20140219_SF055_05 B20140219_SF055_05 TB106385.[MT7]-VGAGAPVYLAAVLEYLTAEILELAGNAAR.3b11_1.heavy 1020.57 / 1114.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIST1H2AE;HIST1H2AD;H2AFX;HIST2H2AB;H2AFJ;HIST1H2AI;HIST1H2AK;HIST1H2AJ;HIST1H2AL;HIST1H2AC;HIST1H2AB;HIST1H2AM;HIST1H2AH;HIST1H2AG;HIST3H2A histone cluster 1, H2ae;histone cluster 1, H2ad;H2A histone family, member X;histone cluster 2, H2ab;H2A histone family, member J;histone cluster 1, H2ai;histone cluster 1, H2ak;histone cluster 1, H2aj;histone cluster 1, H2al;histone cluster 1, H2ac;histone cluster 1, H2ab;histone cluster 1, H2am;histone cluster 1, H2ah;histone cluster 1, H2ag;histone cluster 3, H2a 1203 155 B20140219_SF055_05 B20140219_SF055_05 TB106385.[MT7]-VGAGAPVYLAAVLEYLTAEILELAGNAAR.3b5_1.heavy 1020.57 / 500.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIST1H2AE;HIST1H2AD;H2AFX;HIST2H2AB;H2AFJ;HIST1H2AI;HIST1H2AK;HIST1H2AJ;HIST1H2AL;HIST1H2AC;HIST1H2AB;HIST1H2AM;HIST1H2AH;HIST1H2AG;HIST3H2A histone cluster 1, H2ae;histone cluster 1, H2ad;H2A histone family, member X;histone cluster 2, H2ab;H2A histone family, member J;histone cluster 1, H2ai;histone cluster 1, H2ak;histone cluster 1, H2aj;histone cluster 1, H2al;histone cluster 1, H2ac;histone cluster 1, H2ab;histone cluster 1, H2am;histone cluster 1, H2ah;histone cluster 1, H2ag;histone cluster 3, H2a 1205 155 B20140219_SF055_05 B20140219_SF055_05 TB106385.[MT7]-VGAGAPVYLAAVLEYLTAEILELAGNAAR.3b8_1.heavy 1020.57 / 859.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIST1H2AE;HIST1H2AD;H2AFX;HIST2H2AB;H2AFJ;HIST1H2AI;HIST1H2AK;HIST1H2AJ;HIST1H2AL;HIST1H2AC;HIST1H2AB;HIST1H2AM;HIST1H2AH;HIST1H2AG;HIST3H2A histone cluster 1, H2ae;histone cluster 1, H2ad;H2A histone family, member X;histone cluster 2, H2ab;H2A histone family, member J;histone cluster 1, H2ai;histone cluster 1, H2ak;histone cluster 1, H2aj;histone cluster 1, H2al;histone cluster 1, H2ac;histone cluster 1, H2ab;histone cluster 1, H2am;histone cluster 1, H2ah;histone cluster 1, H2ag;histone cluster 3, H2a 1207 155 B20140219_SF055_05 B20140219_SF055_05 TB106385.[MT7]-VGAGAPVYLAAVLEYLTAEILELAGNAAR.3b7_1.heavy 1020.57 / 696.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIST1H2AE;HIST1H2AD;H2AFX;HIST2H2AB;H2AFJ;HIST1H2AI;HIST1H2AK;HIST1H2AJ;HIST1H2AL;HIST1H2AC;HIST1H2AB;HIST1H2AM;HIST1H2AH;HIST1H2AG;HIST3H2A histone cluster 1, H2ae;histone cluster 1, H2ad;H2A histone family, member X;histone cluster 2, H2ab;H2A histone family, member J;histone cluster 1, H2ai;histone cluster 1, H2ak;histone cluster 1, H2aj;histone cluster 1, H2al;histone cluster 1, H2ac;histone cluster 1, H2ab;histone cluster 1, H2am;histone cluster 1, H2ah;histone cluster 1, H2ag;histone cluster 3, H2a 1209 156 B20140219_SF055_05 B20140219_SF055_05 TB106380.[MT7]-VTFSQYSNVVIFGVPQMMLQLEK[MT7].4b8_1.heavy 737.398 / 1071.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM173B family with sequence similarity 173, member B 1211 156 B20140219_SF055_05 B20140219_SF055_05 TB106380.[MT7]-VTFSQYSNVVIFGVPQMMLQLEK[MT7].4b5_1.heavy 737.398 / 707.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM173B family with sequence similarity 173, member B 1213 156 B20140219_SF055_05 B20140219_SF055_05 TB106380.[MT7]-VTFSQYSNVVIFGVPQMMLQLEK[MT7].4y3_1.heavy 737.398 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM173B family with sequence similarity 173, member B 1215 156 B20140219_SF055_05 B20140219_SF055_05 TB106380.[MT7]-VTFSQYSNVVIFGVPQMMLQLEK[MT7].4b6_1.heavy 737.398 / 870.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM173B family with sequence similarity 173, member B 1217 157 B20140219_SF055_05 B20140219_SF055_05 TB106381.[MT7]-FDLVPVPTNLYGDFFTGDAYVILK[MT7].4b4_1.heavy 748.904 / 619.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 1219 157 B20140219_SF055_05 B20140219_SF055_05 TB106381.[MT7]-FDLVPVPTNLYGDFFTGDAYVILK[MT7].4y3_1.heavy 748.904 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 1221 157 B20140219_SF055_05 B20140219_SF055_05 TB106381.[MT7]-FDLVPVPTNLYGDFFTGDAYVILK[MT7].4b6_1.heavy 748.904 / 815.478 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 1223 157 B20140219_SF055_05 B20140219_SF055_05 TB106381.[MT7]-FDLVPVPTNLYGDFFTGDAYVILK[MT7].4b3_1.heavy 748.904 / 520.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 1225 158 B20140219_SF055_05 B20140219_SF055_05 TB106409.[MT7]-AQTAFSANPANPAILSEASAPIPHDGNLYPR.4b8_1.heavy 834.429 / 935.47 36544.0 36.42369842529297 46 16 10 10 10 5.956786200041237 16.78757582390782 0.0 3 0.9662984003022882 6.70362641251036 36544.0 38.47418061923652 0.0 - - - - - - - 1165.2222222222222 73 9 SDCBP syndecan binding protein (syntenin) 1227 158 B20140219_SF055_05 B20140219_SF055_05 TB106409.[MT7]-AQTAFSANPANPAILSEASAPIPHDGNLYPR.4y9_1.heavy 834.429 / 1068.52 40260.0 36.42369842529297 46 16 10 10 10 5.956786200041237 16.78757582390782 0.0 3 0.9662984003022882 6.70362641251036 40260.0 73.76704922466644 0.0 - - - - - - - 265.25 80 8 SDCBP syndecan binding protein (syntenin) 1229 158 B20140219_SF055_05 B20140219_SF055_05 TB106409.[MT7]-AQTAFSANPANPAILSEASAPIPHDGNLYPR.4b4_1.heavy 834.429 / 516.29 36057.0 36.42369842529297 46 16 10 10 10 5.956786200041237 16.78757582390782 0.0 3 0.9662984003022882 6.70362641251036 36057.0 66.9526988495794 0.0 - - - - - - - 721.0 72 10 SDCBP syndecan binding protein (syntenin) 1231 158 B20140219_SF055_05 B20140219_SF055_05 TB106409.[MT7]-AQTAFSANPANPAILSEASAPIPHDGNLYPR.4y6_1.heavy 834.429 / 719.383 24068.0 36.42369842529297 46 16 10 10 10 5.956786200041237 16.78757582390782 0.0 3 0.9662984003022882 6.70362641251036 24068.0 36.27817941537705 0.0 - - - - - - - 1183.5 48 8 SDCBP syndecan binding protein (syntenin) 1233 159 B20140219_SF055_05 B20140219_SF055_05 TB106405.[MT7]-HPPVQWAFQETSVESAVDTPFPAGIFVR.4y9_1.heavy 814.919 / 1003.57 10242.0 45.41964817047119 38 14 10 6 8 2.8353439038974657 35.26909023718073 0.034999847412109375 4 0.9462248635436982 5.297926704339832 10242.0 0.9034324835963199 2.0 - - - - - - - 172.0 20 1 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 1235 159 B20140219_SF055_05 B20140219_SF055_05 TB106405.[MT7]-HPPVQWAFQETSVESAVDTPFPAGIFVR.4b5_1.heavy 814.919 / 703.401 3948.0 45.41964817047119 38 14 10 6 8 2.8353439038974657 35.26909023718073 0.034999847412109375 4 0.9462248635436982 5.297926704339832 3948.0 0.475805965652305 3.0 - - - - - - - 378.0 9 5 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 1237 159 B20140219_SF055_05 B20140219_SF055_05 TB106405.[MT7]-HPPVQWAFQETSVESAVDTPFPAGIFVR.4y7_1.heavy 814.919 / 759.451 23689.0 45.41964817047119 38 14 10 6 8 2.8353439038974657 35.26909023718073 0.034999847412109375 4 0.9462248635436982 5.297926704339832 23689.0 0.4731412592999451 3.0 - - - - - - - 1373.0 47 2 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 1239 159 B20140219_SF055_05 B20140219_SF055_05 TB106405.[MT7]-HPPVQWAFQETSVESAVDTPFPAGIFVR.4y6_1.heavy 814.919 / 662.398 5035.0 45.41964817047119 38 14 10 6 8 2.8353439038974657 35.26909023718073 0.034999847412109375 4 0.9462248635436982 5.297926704339832 5035.0 1.2982142857142855 2.0 - - - - - - - 286.0 12 5 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 1241 160 B20140219_SF055_05 B20140219_SF055_05 TB106406.[MT7]-WGMSYDELC[CAM]FLEQRPQSPTLEFLLR.3b6_1.heavy 1087.21 / 884.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - EDARADD EDAR-associated death domain 1243 160 B20140219_SF055_05 B20140219_SF055_05 TB106406.[MT7]-WGMSYDELC[CAM]FLEQRPQSPTLEFLLR.3y4_1.heavy 1087.21 / 548.356 N/A N/A - - - - - - - - - 0.0 - - - - - - - EDARADD EDAR-associated death domain 1245 160 B20140219_SF055_05 B20140219_SF055_05 TB106406.[MT7]-WGMSYDELC[CAM]FLEQRPQSPTLEFLLR.3b8_1.heavy 1087.21 / 1126.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - EDARADD EDAR-associated death domain 1247 160 B20140219_SF055_05 B20140219_SF055_05 TB106406.[MT7]-WGMSYDELC[CAM]FLEQRPQSPTLEFLLR.3b7_1.heavy 1087.21 / 1013.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - EDARADD EDAR-associated death domain 1249 161 B20140219_SF055_05 B20140219_SF055_05 TB106408.[MT7]-LEAQLTENNIVK[MT7]EELALLDGSNVVFK[MT7].4b8_1.heavy 830.468 / 1043.55 1884.0 47.197898864746094 32 7 9 10 6 3.147474490445595 31.771504520070874 0.0 5 0.7349366177625808 2.3420224287774394 1884.0 10.014288876591035 0.0 - - - - - - - 196.3846153846154 3 13 PFDN6 prefoldin subunit 6 1251 161 B20140219_SF055_05 B20140219_SF055_05 TB106408.[MT7]-LEAQLTENNIVK[MT7]EELALLDGSNVVFK[MT7].4b4_1.heavy 830.468 / 586.332 1763.0 47.197898864746094 32 7 9 10 6 3.147474490445595 31.771504520070874 0.0 5 0.7349366177625808 2.3420224287774394 1763.0 5.804115226337449 1.0 - - - - - - - 303.875 6 8 PFDN6 prefoldin subunit 6 1253 161 B20140219_SF055_05 B20140219_SF055_05 TB106408.[MT7]-LEAQLTENNIVK[MT7]EELALLDGSNVVFK[MT7].4b5_1.heavy 830.468 / 699.416 2675.0 47.197898864746094 32 7 9 10 6 3.147474490445595 31.771504520070874 0.0 5 0.7349366177625808 2.3420224287774394 2675.0 7.766307233891904 3.0 - - - - - - - 729.5 13 8 PFDN6 prefoldin subunit 6 1255 161 B20140219_SF055_05 B20140219_SF055_05 TB106408.[MT7]-LEAQLTENNIVK[MT7]EELALLDGSNVVFK[MT7].4y3_1.heavy 830.468 / 537.352 5471.0 47.197898864746094 32 7 9 10 6 3.147474490445595 31.771504520070874 0.0 5 0.7349366177625808 2.3420224287774394 5471.0 12.967915413533836 0.0 - - - - - - - 247.5 10 14 PFDN6 prefoldin subunit 6 1257 162 B20140219_SF055_05 B20140219_SF055_05 TB469777.[MT7]-TRAAQSPPVDSAAETPPREGK[MT7].4y12_2.heavy 614.08 / 701.358 16380.0 18.96769952774048 36 10 10 6 10 0.7167569312471848 80.04791783012894 0.03280067443847656 3 0.8355621613863669 3.000697938043025 16380.0 81.7541584800784 0.0 - - - - - - - 194.6153846153846 32 13 HSPB3 heat shock 27kDa protein 3 1259 162 B20140219_SF055_05 B20140219_SF055_05 TB469777.[MT7]-TRAAQSPPVDSAAETPPREGK[MT7].4y7_1.heavy 614.08 / 928.533 2679.0 18.96769952774048 36 10 10 6 10 0.7167569312471848 80.04791783012894 0.03280067443847656 3 0.8355621613863669 3.000697938043025 2679.0 3.66986301369863 0.0 - - - - - - - 147.84615384615384 5 13 HSPB3 heat shock 27kDa protein 3 1261 162 B20140219_SF055_05 B20140219_SF055_05 TB469777.[MT7]-TRAAQSPPVDSAAETPPREGK[MT7].4y6_1.heavy 614.08 / 827.486 6875.0 18.96769952774048 36 10 10 6 10 0.7167569312471848 80.04791783012894 0.03280067443847656 3 0.8355621613863669 3.000697938043025 6875.0 24.95395963459233 0.0 - - - - - - - 205.23529411764707 13 17 HSPB3 heat shock 27kDa protein 3 1263 162 B20140219_SF055_05 B20140219_SF055_05 TB469777.[MT7]-TRAAQSPPVDSAAETPPREGK[MT7].4b6_1.heavy 614.08 / 759.423 12538.0 18.96769952774048 36 10 10 6 10 0.7167569312471848 80.04791783012894 0.03280067443847656 3 0.8355621613863669 3.000697938043025 12538.0 28.533931401580716 0.0 - - - - - - - 151.8 25 10 HSPB3 heat shock 27kDa protein 3 1265 163 B20140219_SF055_05 B20140219_SF055_05 TB245091.[MT7]-AAGFYAC[CAM]HVR.3b4_1.heavy 432.553 / 491.273 227124.0 24.02829933166504 48 18 10 10 10 5.96295271366372 16.770215160495315 0.0 3 0.9888576391731053 11.680721756833545 227124.0 108.11200572769638 0.0 - - - - - - - 810.5 454 2 TP53TG3;LOC653550;LOC729264;TP53TG3B TP53 target 3;TP53-target gene 3 protein-like;TP53-target gene 3 protein-like;TP53 target 3B 1267 163 B20140219_SF055_05 B20140219_SF055_05 TB245091.[MT7]-AAGFYAC[CAM]HVR.3b5_1.heavy 432.553 / 654.337 63189.0 24.02829933166504 48 18 10 10 10 5.96295271366372 16.770215160495315 0.0 3 0.9888576391731053 11.680721756833545 63189.0 380.63218627318264 0.0 - - - - - - - 242.33333333333334 126 18 TP53TG3;LOC653550;LOC729264;TP53TG3B TP53 target 3;TP53-target gene 3 protein-like;TP53-target gene 3 protein-like;TP53 target 3B 1269 163 B20140219_SF055_05 B20140219_SF055_05 TB245091.[MT7]-AAGFYAC[CAM]HVR.3y4_1.heavy 432.553 / 571.277 145447.0 24.02829933166504 48 18 10 10 10 5.96295271366372 16.770215160495315 0.0 3 0.9888576391731053 11.680721756833545 145447.0 160.03099986987507 0.0 - - - - - - - 851.625 290 8 TP53TG3;LOC653550;LOC729264;TP53TG3B TP53 target 3;TP53-target gene 3 protein-like;TP53-target gene 3 protein-like;TP53 target 3B 1271 163 B20140219_SF055_05 B20140219_SF055_05 TB245091.[MT7]-AAGFYAC[CAM]HVR.3y5_1.heavy 432.553 / 642.314 109678.0 24.02829933166504 48 18 10 10 10 5.96295271366372 16.770215160495315 0.0 3 0.9888576391731053 11.680721756833545 109678.0 368.30279465491765 0.0 - - - - - - - 294.15384615384613 219 13 TP53TG3;LOC653550;LOC729264;TP53TG3B TP53 target 3;TP53-target gene 3 protein-like;TP53-target gene 3 protein-like;TP53 target 3B 1273 164 B20140219_SF055_05 B20140219_SF055_05 TB469259.[MT7]-HALDK[MT7].2b3_1.heavy 436.266 / 466.289 1487.0 15.408725023269653 26 14 0 6 6 0.9497930893598875 66.5273415121977 0.039099693298339844 5 0.9388524693275434 4.965176255048706 1487.0 0.933751962323391 0.0 - - - - - - - 269.0 2 16 CRTAP cartilage associated protein 1275 164 B20140219_SF055_05 B20140219_SF055_05 TB469259.[MT7]-HALDK[MT7].2y4_1.heavy 436.266 / 590.363 15933.0 15.408725023269653 26 14 0 6 6 0.9497930893598875 66.5273415121977 0.039099693298339844 5 0.9388524693275434 4.965176255048706 15933.0 28.323780199757053 0.0 - - - - - - - 251.57894736842104 31 19 CRTAP cartilage associated protein 1277 164 B20140219_SF055_05 B20140219_SF055_05 TB469259.[MT7]-HALDK[MT7].2b4_1.heavy 436.266 / 581.316 7913.0 15.408725023269653 26 14 0 6 6 0.9497930893598875 66.5273415121977 0.039099693298339844 5 0.9388524693275434 4.965176255048706 7913.0 7.058176412289395 2.0 - - - - - - - 731.3076923076923 119 13 CRTAP cartilage associated protein 1279 164 B20140219_SF055_05 B20140219_SF055_05 TB469259.[MT7]-HALDK[MT7].2y3_1.heavy 436.266 / 519.326 6373.0 15.408725023269653 26 14 0 6 6 0.9497930893598875 66.5273415121977 0.039099693298339844 5 0.9388524693275434 4.965176255048706 6373.0 18.238194287901663 0.0 - - - - - - - 254.93333333333334 12 15 CRTAP cartilage associated protein 1281 165 B20140219_SF055_05 B20140219_SF055_05 TB106402.[MT7]-TVQIAAVVDVIRELGIC[CAM]PDDAAVIPIK[MT7].4b7_1.heavy 791.706 / 827.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP prolactin-induced protein 1283 165 B20140219_SF055_05 B20140219_SF055_05 TB106402.[MT7]-TVQIAAVVDVIRELGIC[CAM]PDDAAVIPIK[MT7].4b4_1.heavy 791.706 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP prolactin-induced protein 1285 165 B20140219_SF055_05 B20140219_SF055_05 TB106402.[MT7]-TVQIAAVVDVIRELGIC[CAM]PDDAAVIPIK[MT7].4b5_1.heavy 791.706 / 657.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP prolactin-induced protein 1287 165 B20140219_SF055_05 B20140219_SF055_05 TB106402.[MT7]-TVQIAAVVDVIRELGIC[CAM]PDDAAVIPIK[MT7].4y3_1.heavy 791.706 / 501.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP prolactin-induced protein 1289 166 B20140219_SF055_05 B20140219_SF055_05 TB245098.[MT7]-VIRADSFSK[MT7].3y3_1.heavy 437.594 / 525.315 10271.0 25.044599533081055 46 16 10 10 10 2.737307933276279 28.721933805112315 0.0 3 0.964716022433814 6.55070873470263 10271.0 17.90890669180019 0.0 - - - - - - - 1116.0 20 7 AADAT aminoadipate aminotransferase 1291 166 B20140219_SF055_05 B20140219_SF055_05 TB245098.[MT7]-VIRADSFSK[MT7].3b5_1.heavy 437.594 / 699.427 2749.0 25.044599533081055 46 16 10 10 10 2.737307933276279 28.721933805112315 0.0 3 0.964716022433814 6.55070873470263 2749.0 7.780188679245284 7.0 - - - - - - - 626.875 27 8 AADAT aminoadipate aminotransferase 1293 166 B20140219_SF055_05 B20140219_SF055_05 TB245098.[MT7]-VIRADSFSK[MT7].3y4_1.heavy 437.594 / 612.347 23388.0 25.044599533081055 46 16 10 10 10 2.737307933276279 28.721933805112315 0.0 3 0.964716022433814 6.55070873470263 23388.0 47.505025807104545 1.0 - - - - - - - 736.5454545454545 46 11 AADAT aminoadipate aminotransferase 1295 166 B20140219_SF055_05 B20140219_SF055_05 TB245098.[MT7]-VIRADSFSK[MT7].3y8_2.heavy 437.594 / 534.302 16010.0 25.044599533081055 46 16 10 10 10 2.737307933276279 28.721933805112315 0.0 3 0.964716022433814 6.55070873470263 16010.0 21.73651201052978 0.0 - - - - - - - 1178.0 32 7 AADAT aminoadipate aminotransferase 1297 167 B20140219_SF055_05 B20140219_SF055_05 TB106401.[MT7]-TVQIAAVVDVIRELGIC[CAM]PDDAAVIPIK[MT7].3y3_1.heavy 1055.27 / 501.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP prolactin-induced protein 1299 167 B20140219_SF055_05 B20140219_SF055_05 TB106401.[MT7]-TVQIAAVVDVIRELGIC[CAM]PDDAAVIPIK[MT7].3b4_1.heavy 1055.27 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP prolactin-induced protein 1301 167 B20140219_SF055_05 B20140219_SF055_05 TB106401.[MT7]-TVQIAAVVDVIRELGIC[CAM]PDDAAVIPIK[MT7].3b5_1.heavy 1055.27 / 657.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP prolactin-induced protein 1303 167 B20140219_SF055_05 B20140219_SF055_05 TB106401.[MT7]-TVQIAAVVDVIRELGIC[CAM]PDDAAVIPIK[MT7].3b3_1.heavy 1055.27 / 473.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP prolactin-induced protein 1305 168 B20140219_SF055_05 B20140219_SF055_05 TB245099.[MT7]-VDVDC[CAM]C[CAM]EK[MT7].3y3_1.heavy 438.209 / 580.288 33167.0 20.73572540283203 47 20 10 7 10 6.180134887732836 16.18087660165694 0.02809906005859375 3 0.9926955524678893 14.431250699647222 33167.0 97.88084535560618 0.0 - - - - - - - 830.0 66 7 LY6H lymphocyte antigen 6 complex, locus H 1307 168 B20140219_SF055_05 B20140219_SF055_05 TB245099.[MT7]-VDVDC[CAM]C[CAM]EK[MT7].3b4_1.heavy 438.209 / 573.3 65288.0 20.73572540283203 47 20 10 7 10 6.180134887732836 16.18087660165694 0.02809906005859375 3 0.9926955524678893 14.431250699647222 65288.0 110.1409505856068 0.0 - - - - - - - 678.2307692307693 130 13 LY6H lymphocyte antigen 6 complex, locus H 1309 168 B20140219_SF055_05 B20140219_SF055_05 TB245099.[MT7]-VDVDC[CAM]C[CAM]EK[MT7].3b5_1.heavy 438.209 / 733.331 6012.0 20.73572540283203 47 20 10 7 10 6.180134887732836 16.18087660165694 0.02809906005859375 3 0.9926955524678893 14.431250699647222 6012.0 15.096628056628056 0.0 - - - - - - - 632.5454545454545 12 11 LY6H lymphocyte antigen 6 complex, locus H 1311 168 B20140219_SF055_05 B20140219_SF055_05 TB245099.[MT7]-VDVDC[CAM]C[CAM]EK[MT7].3b3_1.heavy 438.209 / 458.273 43030.0 20.73572540283203 47 20 10 7 10 6.180134887732836 16.18087660165694 0.02809906005859375 3 0.9926955524678893 14.431250699647222 43030.0 44.372605293186815 0.0 - - - - - - - 653.0 86 15 LY6H lymphocyte antigen 6 complex, locus H 1313 169 B20140219_SF055_05 B20140219_SF055_05 TB106404.[MT7]-HPPVQWAFQETSVESAVDTPFPAGIFVR.3y7_1.heavy 1086.22 / 759.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - RARRES2 retinoic acid receptor responder (tazarotene induced) 2 1315 169 B20140219_SF055_05 B20140219_SF055_05 TB106404.[MT7]-HPPVQWAFQETSVESAVDTPFPAGIFVR.3b7_1.heavy 1086.22 / 960.517 N/A N/A - - - - - - - - - 0.0 - - - - - - - RARRES2 retinoic acid receptor responder (tazarotene induced) 2 1317 169 B20140219_SF055_05 B20140219_SF055_05 TB106404.[MT7]-HPPVQWAFQETSVESAVDTPFPAGIFVR.3y10_1.heavy 1086.22 / 1104.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - RARRES2 retinoic acid receptor responder (tazarotene induced) 2 1319 169 B20140219_SF055_05 B20140219_SF055_05 TB106404.[MT7]-HPPVQWAFQETSVESAVDTPFPAGIFVR.3y9_1.heavy 1086.22 / 1003.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - RARRES2 retinoic acid receptor responder (tazarotene induced) 2 1321 170 B20140219_SF055_05 B20140219_SF055_05 TB245097.[MT7]-EIYELARK[MT7].3y6_1.heavy 437.262 / 923.543 N/A N/A - - - - - - - - - 0.0 - - - - - - - AADAT aminoadipate aminotransferase 1323 170 B20140219_SF055_05 B20140219_SF055_05 TB245097.[MT7]-EIYELARK[MT7].3b4_1.heavy 437.262 / 679.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - AADAT aminoadipate aminotransferase 1325 170 B20140219_SF055_05 B20140219_SF055_05 TB245097.[MT7]-EIYELARK[MT7].3y7_2.heavy 437.262 / 518.817 N/A N/A - - - - - - - - - 0.0 - - - - - - - AADAT aminoadipate aminotransferase 1327 170 B20140219_SF055_05 B20140219_SF055_05 TB245097.[MT7]-EIYELARK[MT7].3b3_1.heavy 437.262 / 550.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - AADAT aminoadipate aminotransferase 1329 171 B20140219_SF055_05 B20140219_SF055_05 TB106400.[MT7]-EAVFPFQPGSVAEVC[CAM]ITFDQANLTVK[MT7].3b4_1.heavy 1052.55 / 591.326 12686.0 45.94990158081055 46 16 10 10 10 2.3059988252297527 38.32296074654635 0.0 3 0.9695903803230193 7.059112885415716 12686.0 40.71151217087158 0.0 - - - - - - - 285.8666666666667 25 15 LGALS1 lectin, galactoside-binding, soluble, 1 1331 171 B20140219_SF055_05 B20140219_SF055_05 TB106400.[MT7]-EAVFPFQPGSVAEVC[CAM]ITFDQANLTVK[MT7].3b3_1.heavy 1052.55 / 444.258 9079.0 45.94990158081055 46 16 10 10 10 2.3059988252297527 38.32296074654635 0.0 3 0.9695903803230193 7.059112885415716 9079.0 45.23435079932973 0.0 - - - - - - - 220.7 18 20 LGALS1 lectin, galactoside-binding, soluble, 1 1333 171 B20140219_SF055_05 B20140219_SF055_05 TB106400.[MT7]-EAVFPFQPGSVAEVC[CAM]ITFDQANLTVK[MT7].3b7_1.heavy 1052.55 / 963.506 7089.0 45.94990158081055 46 16 10 10 10 2.3059988252297527 38.32296074654635 0.0 3 0.9695903803230193 7.059112885415716 7089.0 50.10698795180723 0.0 - - - - - - - 204.8235294117647 14 17 LGALS1 lectin, galactoside-binding, soluble, 1 1335 171 B20140219_SF055_05 B20140219_SF055_05 TB106400.[MT7]-EAVFPFQPGSVAEVC[CAM]ITFDQANLTVK[MT7].3y9_1.heavy 1052.55 / 1179.65 1617.0 45.94990158081055 46 16 10 10 10 2.3059988252297527 38.32296074654635 0.0 3 0.9695903803230193 7.059112885415716 1617.0 30.816010493587253 0.0 - - - - - - - 124.26666666666667 3 15 LGALS1 lectin, galactoside-binding, soluble, 1 1337 172 B20140219_SF055_05 B20140219_SF055_05 TB469358.[MT7]-DQPIFLR.2y5_1.heavy 516.802 / 645.408 40184.0 32.57394981384277 42 18 10 6 8 5.9762202428754785 16.732984384103734 0.032497406005859375 4 0.9818990632739414 9.159137209027907 40184.0 61.36138066266227 0.0 - - - - - - - 1168.8333333333333 80 12 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 1339 172 B20140219_SF055_05 B20140219_SF055_05 TB469358.[MT7]-DQPIFLR.2b4_1.heavy 516.802 / 598.332 9694.0 32.57394981384277 42 18 10 6 8 5.9762202428754785 16.732984384103734 0.032497406005859375 4 0.9818990632739414 9.159137209027907 9694.0 17.601557985419767 1.0 - - - - - - - 723.7272727272727 20 11 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 1341 172 B20140219_SF055_05 B20140219_SF055_05 TB469358.[MT7]-DQPIFLR.2y6_1.heavy 516.802 / 773.467 27349.0 32.57394981384277 42 18 10 6 8 5.9762202428754785 16.732984384103734 0.032497406005859375 4 0.9818990632739414 9.159137209027907 27349.0 96.04797413577727 0.0 - - - - - - - 673.2857142857143 54 7 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 1343 172 B20140219_SF055_05 B20140219_SF055_05 TB469358.[MT7]-DQPIFLR.2b5_1.heavy 516.802 / 745.4 12185.0 32.57394981384277 42 18 10 6 8 5.9762202428754785 16.732984384103734 0.032497406005859375 4 0.9818990632739414 9.159137209027907 12185.0 26.51480593013241 1.0 - - - - - - - 689.6666666666666 25 15 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 1345 173 B20140219_SF055_05 B20140219_SF055_05 TB469762.[MT7]-DNTTLLTQVQTTMRENLATVEGNFASIDER.3y11_1.heavy 1171.25 / 1236.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCTN2 dynactin 2 (p50) 1347 173 B20140219_SF055_05 B20140219_SF055_05 TB469762.[MT7]-DNTTLLTQVQTTMRENLATVEGNFASIDER.3b4_1.heavy 1171.25 / 576.275 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCTN2 dynactin 2 (p50) 1349 173 B20140219_SF055_05 B20140219_SF055_05 TB469762.[MT7]-DNTTLLTQVQTTMRENLATVEGNFASIDER.3b5_1.heavy 1171.25 / 689.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCTN2 dynactin 2 (p50) 1351 173 B20140219_SF055_05 B20140219_SF055_05 TB469762.[MT7]-DNTTLLTQVQTTMRENLATVEGNFASIDER.3y9_1.heavy 1171.25 / 1008.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCTN2 dynactin 2 (p50) 1353 174 B20140219_SF055_05 B20140219_SF055_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 238899.0 42.34286753336588 23 -3 10 6 10 null 0.0 0.0343017578125 3 0.0 0.0 238899.0 656.4907786899278 0.0 - - - - - - - 742.7272727272727 477 11 1355 174 B20140219_SF055_05 B20140219_SF055_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 446937.0 42.34286753336588 23 -3 10 6 10 null 0.0 0.0343017578125 3 0.0 0.0 446937.0 288.53425045312883 0.0 - - - - - - - 845.0 893 1 1357 174 B20140219_SF055_05 B20140219_SF055_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 342624.0 42.34286753336588 23 -3 10 6 10 null 0.0 0.0343017578125 3 0.0 0.0 342624.0 338.13240633351415 0.0 - - - - - - - 719.3636363636364 685 11 1359 175 B20140219_SF055_05 B20140219_SF055_05 TB106418.[MT7]-DNTTLLTQVQTTMRENLATVEGNFASIDER.4y9_1.heavy 878.692 / 1008.47 4092.0 49.77389907836914 43 13 10 10 10 1.2755829559469174 52.288891859116795 0.0 3 0.9073053150707924 4.021811470189832 4092.0 68.79763825808175 1.0 - - - - - - - 145.22222222222223 8 18 DCTN2 dynactin 2 (p50) 1361 175 B20140219_SF055_05 B20140219_SF055_05 TB106418.[MT7]-DNTTLLTQVQTTMRENLATVEGNFASIDER.4b4_1.heavy 878.692 / 576.275 2387.0 49.77389907836914 43 13 10 10 10 1.2755829559469174 52.288891859116795 0.0 3 0.9073053150707924 4.021811470189832 2387.0 57.371754385964906 5.0 - - - - - - - 175.33333333333334 5 12 DCTN2 dynactin 2 (p50) 1363 175 B20140219_SF055_05 B20140219_SF055_05 TB106418.[MT7]-DNTTLLTQVQTTMRENLATVEGNFASIDER.4b5_1.heavy 878.692 / 689.359 3921.0 49.77389907836914 43 13 10 10 10 1.2755829559469174 52.288891859116795 0.0 3 0.9073053150707924 4.021811470189832 3921.0 38.56085989621942 0.0 - - - - - - - 140.0 7 13 DCTN2 dynactin 2 (p50) 1365 175 B20140219_SF055_05 B20140219_SF055_05 TB106418.[MT7]-DNTTLLTQVQTTMRENLATVEGNFASIDER.4b6_1.heavy 878.692 / 802.443 3467.0 49.77389907836914 43 13 10 10 10 1.2755829559469174 52.288891859116795 0.0 3 0.9073053150707924 4.021811470189832 3467.0 77.24719298245614 0.0 - - - - - - - 167.33333333333334 6 18 DCTN2 dynactin 2 (p50) 1367 176 B20140219_SF055_05 B20140219_SF055_05 TB106419.[MT7]-QLHEQAMQFGQLLTHLDTTQQMIANSLK[MT7].4y5_1.heavy 878.961 / 676.411 9613.0 45.779701232910156 33 5 10 10 8 0.8598218189154081 77.53450353172565 0.0 4 0.6978318955053242 2.185950715857918 9613.0 40.03476997578693 0.0 - - - - - - - 256.65 19 20 DCTN2 dynactin 2 (p50) 1369 176 B20140219_SF055_05 B20140219_SF055_05 TB106419.[MT7]-QLHEQAMQFGQLLTHLDTTQQMIANSLK[MT7].4b7_1.heavy 878.961 / 982.49 649.0 45.779701232910156 33 5 10 10 8 0.8598218189154081 77.53450353172565 0.0 4 0.6978318955053242 2.185950715857918 649.0 1.1 2.0 - - - - - - - 0.0 1 0 DCTN2 dynactin 2 (p50) 1371 176 B20140219_SF055_05 B20140219_SF055_05 TB106419.[MT7]-QLHEQAMQFGQLLTHLDTTQQMIANSLK[MT7].4b4_1.heavy 878.961 / 652.354 1121.0 45.779701232910156 33 5 10 10 8 0.8598218189154081 77.53450353172565 0.0 4 0.6978318955053242 2.185950715857918 1121.0 2.4971428571428573 3.0 - - - - - - - 298.6875 2 16 DCTN2 dynactin 2 (p50) 1373 176 B20140219_SF055_05 B20140219_SF055_05 TB106419.[MT7]-QLHEQAMQFGQLLTHLDTTQQMIANSLK[MT7].4b6_1.heavy 878.961 / 851.449 1121.0 45.779701232910156 33 5 10 10 8 0.8598218189154081 77.53450353172565 0.0 4 0.6978318955053242 2.185950715857918 1121.0 1.6285714285714286 2.0 - - - - - - - 300.6190476190476 2 21 DCTN2 dynactin 2 (p50) 1375 177 B20140219_SF055_05 B20140219_SF055_05 TB469544.[MT7]-IIILYDDDER.2y4_1.heavy 704.876 / 534.215 5518.0 37.29090118408203 47 17 10 10 10 2.2259992625571763 30.963365087654644 0.0 3 0.9709668575617532 7.225351255686343 5518.0 10.367235169842711 0.0 - - - - - - - 689.625 11 16 TSGA14 testis specific, 14 1377 177 B20140219_SF055_05 B20140219_SF055_05 TB469544.[MT7]-IIILYDDDER.2y8_1.heavy 704.876 / 1038.47 11446.0 37.29090118408203 47 17 10 10 10 2.2259992625571763 30.963365087654644 0.0 3 0.9709668575617532 7.225351255686343 11446.0 70.90106227592617 0.0 - - - - - - - 159.7826086956522 22 23 TSGA14 testis specific, 14 1379 177 B20140219_SF055_05 B20140219_SF055_05 TB469544.[MT7]-IIILYDDDER.2y9_1.heavy 704.876 / 1151.56 10492.0 37.29090118408203 47 17 10 10 10 2.2259992625571763 30.963365087654644 0.0 3 0.9709668575617532 7.225351255686343 10492.0 46.83888909375234 0.0 - - - - - - - 201.52 20 25 TSGA14 testis specific, 14 1381 177 B20140219_SF055_05 B20140219_SF055_05 TB469544.[MT7]-IIILYDDDER.2y7_1.heavy 704.876 / 925.39 13387.0 37.29090118408203 47 17 10 10 10 2.2259992625571763 30.963365087654644 0.0 3 0.9709668575617532 7.225351255686343 13387.0 44.33141439205956 0.0 - - - - - - - 252.3181818181818 26 22 TSGA14 testis specific, 14 1383 178 B20140219_SF055_05 B20140219_SF055_05 TB244967.[MT7]-RPPSPPK[MT7].3y3_1.heavy 356.225 / 485.32 14010.0 16.38759994506836 41 11 10 10 10 1.154139344635667 57.433613073776584 0.0 3 0.8725927563334874 3.4201301761739633 14010.0 15.584766172016776 1.0 - - - - - - - 834.625 28 8 C4orf17 chromosome 4 open reading frame 17 1385 178 B20140219_SF055_05 B20140219_SF055_05 TB244967.[MT7]-RPPSPPK[MT7].3b4_1.heavy 356.225 / 582.348 5008.0 16.38759994506836 41 11 10 10 10 1.154139344635667 57.433613073776584 0.0 3 0.8725927563334874 3.4201301761739633 5008.0 4.694085695150972 1.0 - - - - - - - 681.5714285714286 10 7 C4orf17 chromosome 4 open reading frame 17 1387 178 B20140219_SF055_05 B20140219_SF055_05 TB244967.[MT7]-RPPSPPK[MT7].3y4_1.heavy 356.225 / 572.352 2027.0 16.38759994506836 41 11 10 10 10 1.154139344635667 57.433613073776584 0.0 3 0.8725927563334874 3.4201301761739633 2027.0 7.431747360866055 3.0 - - - - - - - 698.4285714285714 9 7 C4orf17 chromosome 4 open reading frame 17 1389 178 B20140219_SF055_05 B20140219_SF055_05 TB244967.[MT7]-RPPSPPK[MT7].3y3_2.heavy 356.225 / 243.164 19197.0 16.38759994506836 41 11 10 10 10 1.154139344635667 57.433613073776584 0.0 3 0.8725927563334874 3.4201301761739633 19197.0 8.99939340829936 0.0 - - - - - - - 417.0 38 1 C4orf17 chromosome 4 open reading frame 17 1391 179 B20140219_SF055_05 B20140219_SF055_05 TB469248.[MT7]-RVGTK[MT7].2y4_1.heavy 424.781 / 548.352 3597.0 13.49940013885498 35 14 10 7 4 2.4732127662154655 40.43323783785128 0.02760028839111328 7 0.938442249182009 4.948431591994843 3597.0 33.714608920491266 0.0 - - - - - - - 177.04347826086956 7 23 DCTN2 dynactin 2 (p50) 1393 179 B20140219_SF055_05 B20140219_SF055_05 TB469248.[MT7]-RVGTK[MT7].2b4_1.heavy 424.781 / 558.348 714.0 13.49940013885498 35 14 10 7 4 2.4732127662154655 40.43323783785128 0.02760028839111328 7 0.938442249182009 4.948431591994843 714.0 2.410341662417134 5.0 - - - - - - - 152.57692307692307 2 26 DCTN2 dynactin 2 (p50) 1395 179 B20140219_SF055_05 B20140219_SF055_05 TB469248.[MT7]-RVGTK[MT7].2y3_1.heavy 424.781 / 449.284 1164.0 13.49940013885498 35 14 10 7 4 2.4732127662154655 40.43323783785128 0.02760028839111328 7 0.938442249182009 4.948431591994843 1164.0 2.5668829236354975 1.0 - - - - - - - 129.15384615384616 2 26 DCTN2 dynactin 2 (p50) 1397 180 B20140219_SF055_05 B20140219_SF055_05 TB469246.[MT7]-QSSILR.2b3_1.heavy 424.26 / 447.232 2103.0 21.974299907684326 37 14 10 3 10 7.429924278456556 13.459087367815455 0.05940055847167969 3 0.93457810275654 4.798485464676026 2103.0 6.745954523578181 6.0 - - - - - - - 662.2307692307693 5 13 PLEKHB1 pleckstrin homology domain containing, family B (evectins) member 1 1399 180 B20140219_SF055_05 B20140219_SF055_05 TB469246.[MT7]-QSSILR.2y5_1.heavy 424.26 / 575.351 14492.0 21.974299907684326 37 14 10 3 10 7.429924278456556 13.459087367815455 0.05940055847167969 3 0.93457810275654 4.798485464676026 14492.0 50.12658996028918 0.0 - - - - - - - 696.6666666666666 28 15 PLEKHB1 pleckstrin homology domain containing, family B (evectins) member 1 1401 180 B20140219_SF055_05 B20140219_SF055_05 TB469246.[MT7]-QSSILR.2b4_1.heavy 424.26 / 560.316 6342.0 21.974299907684326 37 14 10 3 10 7.429924278456556 13.459087367815455 0.05940055847167969 3 0.93457810275654 4.798485464676026 6342.0 6.750000000000001 1.0 - - - - - - - 716.3333333333334 12 15 PLEKHB1 pleckstrin homology domain containing, family B (evectins) member 1 1403 180 B20140219_SF055_05 B20140219_SF055_05 TB469246.[MT7]-QSSILR.2b5_1.heavy 424.26 / 673.4 3680.0 21.974299907684326 37 14 10 3 10 7.429924278456556 13.459087367815455 0.05940055847167969 3 0.93457810275654 4.798485464676026 3680.0 8.713876718586143 0.0 - - - - - - - 634.1 7 10 PLEKHB1 pleckstrin homology domain containing, family B (evectins) member 1 1405 181 B20140219_SF055_05 B20140219_SF055_05 TB106415.[MT7]-DTWGLSDEHFQPRPEAVQFFNVTTLQK[MT7].4b8_1.heavy 870.446 / 1048.47 2396.0 39.71057415008545 31 7 10 6 8 1.1372011199072802 80.16161281259522 0.033298492431640625 4 0.7394597540340653 2.363251359255426 2396.0 14.69144135657089 0.0 - - - - - - - 191.76923076923077 4 26 CRTAP cartilage associated protein 1407 181 B20140219_SF055_05 B20140219_SF055_05 TB106415.[MT7]-DTWGLSDEHFQPRPEAVQFFNVTTLQK[MT7].4y5_1.heavy 870.446 / 734.453 25087.0 39.71057415008545 31 7 10 6 8 1.1372011199072802 80.16161281259522 0.033298492431640625 4 0.7394597540340653 2.363251359255426 25087.0 71.61800330033003 0.0 - - - - - - - 696.0909090909091 50 11 CRTAP cartilage associated protein 1409 181 B20140219_SF055_05 B20140219_SF055_05 TB106415.[MT7]-DTWGLSDEHFQPRPEAVQFFNVTTLQK[MT7].4b7_1.heavy 870.446 / 919.428 4048.0 39.71057415008545 31 7 10 6 8 1.1372011199072802 80.16161281259522 0.033298492431640625 4 0.7394597540340653 2.363251359255426 4048.0 8.78761109499092 0.0 - - - - - - - 237.34615384615384 8 26 CRTAP cartilage associated protein 1411 181 B20140219_SF055_05 B20140219_SF055_05 TB106415.[MT7]-DTWGLSDEHFQPRPEAVQFFNVTTLQK[MT7].4b4_1.heavy 870.446 / 604.285 3002.0 39.71057415008545 31 7 10 6 8 1.1372011199072802 80.16161281259522 0.033298492431640625 4 0.7394597540340653 2.363251359255426 3002.0 7.2602686880308624 1.0 - - - - - - - 642.5555555555555 11 9 CRTAP cartilage associated protein 1413 182 B20140219_SF055_05 B20140219_SF055_05 TB469548.[MT7]-EVDEIDEIRR.3b6_1.heavy 473.252 / 845.401 10862.0 26.1658992767334 47 17 10 10 10 3.072408799207336 32.54775211742638 0.0 3 0.9784796853649952 8.39761817419644 10862.0 252.15357142857144 0.0 - - - - - - - 160.3125 21 16 WBP5 WW domain binding protein 5 1415 182 B20140219_SF055_05 B20140219_SF055_05 TB469548.[MT7]-EVDEIDEIRR.3b4_1.heavy 473.252 / 617.29 39018.0 26.1658992767334 47 17 10 10 10 3.072408799207336 32.54775211742638 0.0 3 0.9784796853649952 8.39761817419644 39018.0 50.64336088392037 0.0 - - - - - - - 703.8 78 10 WBP5 WW domain binding protein 5 1417 182 B20140219_SF055_05 B20140219_SF055_05 TB469548.[MT7]-EVDEIDEIRR.3b3_1.heavy 473.252 / 488.247 44519.0 26.1658992767334 47 17 10 10 10 3.072408799207336 32.54775211742638 0.0 3 0.9784796853649952 8.39761817419644 44519.0 65.19716433872141 0.0 - - - - - - - 1241.125 89 8 WBP5 WW domain binding protein 5 1419 182 B20140219_SF055_05 B20140219_SF055_05 TB469548.[MT7]-EVDEIDEIRR.3y9_2.heavy 473.252 / 572.802 21770.0 26.1658992767334 47 17 10 10 10 3.072408799207336 32.54775211742638 0.0 3 0.9784796853649952 8.39761817419644 21770.0 39.69612211221122 0.0 - - - - - - - 647.9 43 10 WBP5 WW domain binding protein 5 1421 183 B20140219_SF055_05 B20140219_SF055_05 TB106414.[MT7]-NWLGTC[CAM]RLPLTETISEVYELC[CAM]AFLDK[MT7].4y4_1.heavy 854.942 / 666.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 1423 183 B20140219_SF055_05 B20140219_SF055_05 TB106414.[MT7]-NWLGTC[CAM]RLPLTETISEVYELC[CAM]AFLDK[MT7].4b13_2.heavy 854.942 / 843.941 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 1425 183 B20140219_SF055_05 B20140219_SF055_05 TB106414.[MT7]-NWLGTC[CAM]RLPLTETISEVYELC[CAM]AFLDK[MT7].4y3_1.heavy 854.942 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 1427 183 B20140219_SF055_05 B20140219_SF055_05 TB106414.[MT7]-NWLGTC[CAM]RLPLTETISEVYELC[CAM]AFLDK[MT7].4y6_1.heavy 854.942 / 897.462 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 1429 184 B20140219_SF055_05 B20140219_SF055_05 TB469549.[MT7]-EFNAEVHRK[MT7].3b4_1.heavy 473.265 / 606.3 2126.0 18.51569938659668 36 10 10 6 10 1.31666510325688 63.43397272260439 0.03440093994140625 3 0.8380087792074965 3.023929422649558 2126.0 14.1129920980487 1.0 - - - - - - - 239.0 4 20 RPL5 ribosomal protein L5 1431 184 B20140219_SF055_05 B20140219_SF055_05 TB469549.[MT7]-EFNAEVHRK[MT7].3b5_1.heavy 473.265 / 735.343 4305.0 18.51569938659668 36 10 10 6 10 1.31666510325688 63.43397272260439 0.03440093994140625 3 0.8380087792074965 3.023929422649558 4305.0 31.125352112676055 0.0 - - - - - - - 151.0 8 19 RPL5 ribosomal protein L5 1433 184 B20140219_SF055_05 B20140219_SF055_05 TB469549.[MT7]-EFNAEVHRK[MT7].3b3_1.heavy 473.265 / 535.263 1701.0 18.51569938659668 36 10 10 6 10 1.31666510325688 63.43397272260439 0.03440093994140625 3 0.8380087792074965 3.023929422649558 1701.0 1.8383612933449784 1.0 - - - - - - - 673.3333333333334 3 9 RPL5 ribosomal protein L5 1435 184 B20140219_SF055_05 B20140219_SF055_05 TB469549.[MT7]-EFNAEVHRK[MT7].3y8_2.heavy 473.265 / 572.821 9408.0 18.51569938659668 36 10 10 6 10 1.31666510325688 63.43397272260439 0.03440093994140625 3 0.8380087792074965 3.023929422649558 9408.0 9.954233276986233 0.0 - - - - - - - 1229.125 18 8 RPL5 ribosomal protein L5 1437 185 B20140219_SF055_05 B20140219_SF055_05 TB106413.[MT7]-NWLGTC[CAM]RLPLTETISEVYELC[CAM]AFLDK[MT7].3y3_1.heavy 1139.59 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 1439 185 B20140219_SF055_05 B20140219_SF055_05 TB106413.[MT7]-NWLGTC[CAM]RLPLTETISEVYELC[CAM]AFLDK[MT7].3y6_1.heavy 1139.59 / 897.462 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 1441 185 B20140219_SF055_05 B20140219_SF055_05 TB106413.[MT7]-NWLGTC[CAM]RLPLTETISEVYELC[CAM]AFLDK[MT7].3b3_1.heavy 1139.59 / 558.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 1443 185 B20140219_SF055_05 B20140219_SF055_05 TB106413.[MT7]-NWLGTC[CAM]RLPLTETISEVYELC[CAM]AFLDK[MT7].3b8_1.heavy 1139.59 / 1145.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCTD19 potassium channel tetramerisation domain containing 19 1445 186 B20140219_SF055_05 B20140219_SF055_05 TB469241.[MT7]-AQYER.2b3_1.heavy 405.715 / 507.268 2989.0 15.078200340270996 38 10 10 10 8 0.6371176323810998 82.86081938101526 0.0 4 0.8354766432016497 2.9998952022183203 2989.0 5.343734978583992 1.0 - - - - - - - 736.75 10 12 LOC100131673;CRTAP hypothetical protein LOC100131673;cartilage associated protein 1447 186 B20140219_SF055_05 B20140219_SF055_05 TB469241.[MT7]-AQYER.2y4_1.heavy 405.715 / 595.284 7958.0 15.078200340270996 38 10 10 10 8 0.6371176323810998 82.86081938101526 0.0 4 0.8354766432016497 2.9998952022183203 7958.0 39.81003188454439 0.0 - - - - - - - 146.1578947368421 15 19 LOC100131673;CRTAP hypothetical protein LOC100131673;cartilage associated protein 1449 186 B20140219_SF055_05 B20140219_SF055_05 TB469241.[MT7]-AQYER.2b4_1.heavy 405.715 / 636.311 9937.0 15.078200340270996 38 10 10 10 8 0.6371176323810998 82.86081938101526 0.0 4 0.8354766432016497 2.9998952022183203 9937.0 38.350157769486145 0.0 - - - - - - - 215.52941176470588 19 17 LOC100131673;CRTAP hypothetical protein LOC100131673;cartilage associated protein 1451 186 B20140219_SF055_05 B20140219_SF055_05 TB469241.[MT7]-AQYER.2y3_1.heavy 405.715 / 467.225 2905.0 15.078200340270996 38 10 10 10 8 0.6371176323810998 82.86081938101526 0.0 4 0.8354766432016497 2.9998952022183203 2905.0 7.080046861945453 2.0 - - - - - - - 680.0769230769231 10 13 LOC100131673;CRTAP hypothetical protein LOC100131673;cartilage associated protein 1453 187 B20140219_SF055_05 B20140219_SF055_05 TB469345.[MT7]-LFGNYSR.2y4_1.heavy 500.77 / 539.257 2037.0 30.416500091552734 48 18 10 10 10 3.0456201705946206 32.834035237058536 0.0 3 0.9899708076079373 12.313053051839265 2037.0 -0.4167348608837971 9.0 - - - - - - - 727.5 5 10 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 1455 187 B20140219_SF055_05 B20140219_SF055_05 TB469345.[MT7]-LFGNYSR.2y5_1.heavy 500.77 / 596.279 21413.0 30.416500091552734 48 18 10 10 10 3.0456201705946206 32.834035237058536 0.0 3 0.9899708076079373 12.313053051839265 21413.0 27.764268161112447 0.0 - - - - - - - 787.6923076923077 42 13 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 1457 187 B20140219_SF055_05 B20140219_SF055_05 TB469345.[MT7]-LFGNYSR.2b4_1.heavy 500.77 / 576.326 8321.0 30.416500091552734 48 18 10 10 10 3.0456201705946206 32.834035237058536 0.0 3 0.9899708076079373 12.313053051839265 8321.0 6.405117535143415 0.0 - - - - - - - 778.7692307692307 16 13 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 1459 187 B20140219_SF055_05 B20140219_SF055_05 TB469345.[MT7]-LFGNYSR.2y6_1.heavy 500.77 / 743.347 62262.0 30.416500091552734 48 18 10 10 10 3.0456201705946206 32.834035237058536 0.0 3 0.9899708076079373 12.313053051839265 62262.0 109.01979100714766 0.0 - - - - - - - 681.5714285714286 124 7 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 1461 188 B20140219_SF055_05 B20140219_SF055_05 TB106412.[MT7]-LFC[CAM]SVSLLTNFEDASDYLDWEVGVHGIR.4y10_1.heavy 847.418 / 1167.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - AMMECR1L AMME chromosomal region gene 1-like 1463 188 B20140219_SF055_05 B20140219_SF055_05 TB106412.[MT7]-LFC[CAM]SVSLLTNFEDASDYLDWEVGVHGIR.4y9_1.heavy 847.418 / 1052.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - AMMECR1L AMME chromosomal region gene 1-like 1465 188 B20140219_SF055_05 B20140219_SF055_05 TB106412.[MT7]-LFC[CAM]SVSLLTNFEDASDYLDWEVGVHGIR.4b4_1.heavy 847.418 / 652.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - AMMECR1L AMME chromosomal region gene 1-like 1467 188 B20140219_SF055_05 B20140219_SF055_05 TB106412.[MT7]-LFC[CAM]SVSLLTNFEDASDYLDWEVGVHGIR.4y7_1.heavy 847.418 / 737.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - AMMECR1L AMME chromosomal region gene 1-like 1469 189 B20140219_SF055_05 B20140219_SF055_05 TB106411.[MT7]-LFC[CAM]SVSLLTNFEDASDYLDWEVGVHGIR.3b6_1.heavy 1129.55 / 838.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - AMMECR1L AMME chromosomal region gene 1-like 1471 189 B20140219_SF055_05 B20140219_SF055_05 TB106411.[MT7]-LFC[CAM]SVSLLTNFEDASDYLDWEVGVHGIR.3b4_1.heavy 1129.55 / 652.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - AMMECR1L AMME chromosomal region gene 1-like 1473 189 B20140219_SF055_05 B20140219_SF055_05 TB106411.[MT7]-LFC[CAM]SVSLLTNFEDASDYLDWEVGVHGIR.3y10_1.heavy 1129.55 / 1167.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - AMMECR1L AMME chromosomal region gene 1-like 1475 189 B20140219_SF055_05 B20140219_SF055_05 TB106411.[MT7]-LFC[CAM]SVSLLTNFEDASDYLDWEVGVHGIR.3y9_1.heavy 1129.55 / 1052.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - AMMECR1L AMME chromosomal region gene 1-like 1477 190 B20140219_SF055_05 B20140219_SF055_05 TB106410.[MT7]-TAVSLVTALPGRPSSC[CAM]VSVTDGPK[MT7]FEVK[MT7].4b4_1.heavy 834.466 / 503.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - FRMPD2 FERM and PDZ domain containing 2 1479 190 B20140219_SF055_05 B20140219_SF055_05 TB106410.[MT7]-TAVSLVTALPGRPSSC[CAM]VSVTDGPK[MT7]FEVK[MT7].4y7_1.heavy 834.466 / 1092.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - FRMPD2 FERM and PDZ domain containing 2 1481 190 B20140219_SF055_05 B20140219_SF055_05 TB106410.[MT7]-TAVSLVTALPGRPSSC[CAM]VSVTDGPK[MT7]FEVK[MT7].4y7_2.heavy 834.466 / 546.836 N/A N/A - - - - - - - - - 0.0 - - - - - - - FRMPD2 FERM and PDZ domain containing 2 1483 190 B20140219_SF055_05 B20140219_SF055_05 TB106410.[MT7]-TAVSLVTALPGRPSSC[CAM]VSVTDGPK[MT7]FEVK[MT7].4y19_2.heavy 834.466 / 1168.12 N/A N/A - - - - - - - - - 0.0 - - - - - - - FRMPD2 FERM and PDZ domain containing 2 1485 191 B20140219_SF055_05 B20140219_SF055_05 TB469349.[MT7]-ISSAVLK[MT7].2y4_1.heavy 503.331 / 574.404 11359.0 27.443899154663086 50 20 10 10 10 24.36572774343583 4.104125312938383 0.0 3 0.993964497400656 15.877677440633883 11359.0 10.900887596574123 1.0 - - - - - - - 1195.5555555555557 42 9 NDUFA8 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa 1487 191 B20140219_SF055_05 B20140219_SF055_05 TB469349.[MT7]-ISSAVLK[MT7].2y5_1.heavy 503.331 / 661.437 15055.0 27.443899154663086 50 20 10 10 10 24.36572774343583 4.104125312938383 0.0 3 0.993964497400656 15.877677440633883 15055.0 33.906769075242316 0.0 - - - - - - - 702.6153846153846 30 13 NDUFA8 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa 1489 191 B20140219_SF055_05 B20140219_SF055_05 TB469349.[MT7]-ISSAVLK[MT7].2y6_1.heavy 503.331 / 748.469 71634.0 27.443899154663086 50 20 10 10 10 24.36572774343583 4.104125312938383 0.0 3 0.993964497400656 15.877677440633883 71634.0 119.90710789417662 0.0 - - - - - - - 672.625 143 8 NDUFA8 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa 1491 191 B20140219_SF055_05 B20140219_SF055_05 TB469349.[MT7]-ISSAVLK[MT7].2b5_1.heavy 503.331 / 602.363 18534.0 27.443899154663086 50 20 10 10 10 24.36572774343583 4.104125312938383 0.0 3 0.993964497400656 15.877677440633883 18534.0 36.101503067484664 0.0 - - - - - - - 684.0 37 12 NDUFA8 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa 1493 192 B20140219_SF055_05 B20140219_SF055_05 TB244834.[MT7]-LTTSER.2y4_1.heavy 425.741 / 492.241 10682.0 17.6558256149292 42 20 8 6 8 1.3305800023424645 42.507979716764915 0.036701202392578125 4 0.992617598641523 14.354762220450018 10682.0 8.28652072968491 2.0 - - - - - - - 649.1 238 10 MRPL35 mitochondrial ribosomal protein L35 1495 192 B20140219_SF055_05 B20140219_SF055_05 TB244834.[MT7]-LTTSER.2y5_1.heavy 425.741 / 593.289 86434.0 17.6558256149292 42 20 8 6 8 1.3305800023424645 42.507979716764915 0.036701202392578125 4 0.992617598641523 14.354762220450018 86434.0 122.08732943523344 0.0 - - - - - - - 738.2857142857143 172 7 MRPL35 mitochondrial ribosomal protein L35 1497 192 B20140219_SF055_05 B20140219_SF055_05 TB244834.[MT7]-LTTSER.2b4_1.heavy 425.741 / 547.321 5628.0 17.6558256149292 42 20 8 6 8 1.3305800023424645 42.507979716764915 0.036701202392578125 4 0.992617598641523 14.354762220450018 5628.0 6.7754954954954965 0.0 - - - - - - - 722.0 11 7 MRPL35 mitochondrial ribosomal protein L35 1499 192 B20140219_SF055_05 B20140219_SF055_05 TB244834.[MT7]-LTTSER.2b5_1.heavy 425.741 / 676.363 14530.0 17.6558256149292 42 20 8 6 8 1.3305800023424645 42.507979716764915 0.036701202392578125 4 0.992617598641523 14.354762220450018 14530.0 19.162172156364704 0.0 - - - - - - - 622.0833333333334 29 12 MRPL35 mitochondrial ribosomal protein L35 1501 193 B20140219_SF055_05 B20140219_SF055_05 TB469756.[MT7]-FTPTVPHC[CAM]SLATLIGLC[CAM]LR.3y11_1.heavy 767.417 / 1216.71 4839.0 44.16579818725586 44 14 10 10 10 1.8028003996881432 47.321630044702744 0.0 3 0.9384378841135675 4.948254312700917 4839.0 51.96000377691048 0.0 - - - - - - - 86.66666666666667 9 24 FAM96A family with sequence similarity 96, member A 1503 193 B20140219_SF055_05 B20140219_SF055_05 TB469756.[MT7]-FTPTVPHC[CAM]SLATLIGLC[CAM]LR.3b4_1.heavy 767.417 / 591.326 4839.0 44.16579818725586 44 14 10 10 10 1.8028003996881432 47.321630044702744 0.0 3 0.9384378841135675 4.948254312700917 4839.0 15.247518293045669 0.0 - - - - - - - 266.8181818181818 9 33 FAM96A family with sequence similarity 96, member A 1505 193 B20140219_SF055_05 B20140219_SF055_05 TB469756.[MT7]-FTPTVPHC[CAM]SLATLIGLC[CAM]LR.3b5_1.heavy 767.417 / 690.394 14377.0 44.16579818725586 44 14 10 10 10 1.8028003996881432 47.321630044702744 0.0 3 0.9384378841135675 4.948254312700917 14377.0 45.45329233648976 0.0 - - - - - - - 352.53333333333336 28 30 FAM96A family with sequence similarity 96, member A 1507 193 B20140219_SF055_05 B20140219_SF055_05 TB469756.[MT7]-FTPTVPHC[CAM]SLATLIGLC[CAM]LR.3y9_1.heavy 767.417 / 1016.59 8525.0 44.16579818725586 44 14 10 10 10 1.8028003996881432 47.321630044702744 0.0 3 0.9384378841135675 4.948254312700917 8525.0 32.79055860419305 0.0 - - - - - - - 698.2727272727273 17 11 FAM96A family with sequence similarity 96, member A 1509 194 B20140219_SF055_05 B20140219_SF055_05 TB469755.[MT7]-TGAFAYPFLFDNLPLFYR.3y7_1.heavy 766.069 / 922.515 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAQR6 progestin and adipoQ receptor family member VI 1511 194 B20140219_SF055_05 B20140219_SF055_05 TB469755.[MT7]-TGAFAYPFLFDNLPLFYR.3b6_1.heavy 766.069 / 755.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAQR6 progestin and adipoQ receptor family member VI 1513 194 B20140219_SF055_05 B20140219_SF055_05 TB469755.[MT7]-TGAFAYPFLFDNLPLFYR.3b4_1.heavy 766.069 / 521.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAQR6 progestin and adipoQ receptor family member VI 1515 194 B20140219_SF055_05 B20140219_SF055_05 TB469755.[MT7]-TGAFAYPFLFDNLPLFYR.3b5_1.heavy 766.069 / 592.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAQR6 progestin and adipoQ receptor family member VI 1517 195 B20140219_SF055_05 B20140219_SF055_05 TB469571.[MT7]-EELMFFLWAPELAPLK[MT7].3y3_1.heavy 741.411 / 501.352 1945.0 50.04240036010742 40 10 10 10 10 1.0115074049639 58.532876744451265 0.0 3 0.840587377420767 3.0489847415860782 1945.0 25.212962962962962 2.0 - - - - - - - 184.73684210526315 3 19 DSTN destrin (actin depolymerizing factor) 1519 195 B20140219_SF055_05 B20140219_SF055_05 TB469571.[MT7]-EELMFFLWAPELAPLK[MT7].3b4_1.heavy 741.411 / 647.319 2053.0 50.04240036010742 40 10 10 10 10 1.0115074049639 58.532876744451265 0.0 3 0.840587377420767 3.0489847415860782 2053.0 18.24888888888889 0.0 - - - - - - - 111.0 4 18 DSTN destrin (actin depolymerizing factor) 1521 195 B20140219_SF055_05 B20140219_SF055_05 TB469571.[MT7]-EELMFFLWAPELAPLK[MT7].3b5_1.heavy 741.411 / 794.388 4484.0 50.04240036010742 40 10 10 10 10 1.0115074049639 58.532876744451265 0.0 3 0.840587377420767 3.0489847415860782 4484.0 116.25185185185185 0.0 - - - - - - - 90.0 8 12 DSTN destrin (actin depolymerizing factor) 1523 195 B20140219_SF055_05 B20140219_SF055_05 TB469571.[MT7]-EELMFFLWAPELAPLK[MT7].3b3_1.heavy 741.411 / 516.279 810.0 50.04240036010742 40 10 10 10 10 1.0115074049639 58.532876744451265 0.0 3 0.840587377420767 3.0489847415860782 810.0 6.75 0.0 - - - - - - - 0.0 1 0 DSTN destrin (actin depolymerizing factor) 1525 196 B20140219_SF055_05 B20140219_SF055_05 TB469432.[MT7]-NDEELNK[MT7].2b3_1.heavy 575.303 / 503.222 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIST1H2AA;HIST1H2AE;HIST1H2AD;H2AFX;HIST2H2AB;H2AFJ;HIST2H2AA4;HIST1H2AI;HIST1H2AK;HIST1H2AJ;HIST1H2AL;HIST1H2AC;HIST1H2AB;HIST1H2AM;HIST2H2AA3;HIST2H2AC;HIST1H2AH;HIST1H2AG;HIST3H2A histone cluster 1, H2aa;histone cluster 1, H2ae;histone cluster 1, H2ad;H2A histone family, member X;histone cluster 2, H2ab;H2A histone family, member J;histone cluster 2, H2aa4;histone cluster 1, H2ai;histone cluster 1, H2ak;histone cluster 1, H2aj;histone cluster 1, H2al;histone cluster 1, H2ac;histone cluster 1, H2ab;histone cluster 1, H2am;histone cluster 2, H2aa3;histone cluster 2, H2ac;histone cluster 1, H2ah;histone cluster 1, H2ag;histone cluster 3, H2a 1527 196 B20140219_SF055_05 B20140219_SF055_05 TB469432.[MT7]-NDEELNK[MT7].2y4_1.heavy 575.303 / 647.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIST1H2AA;HIST1H2AE;HIST1H2AD;H2AFX;HIST2H2AB;H2AFJ;HIST2H2AA4;HIST1H2AI;HIST1H2AK;HIST1H2AJ;HIST1H2AL;HIST1H2AC;HIST1H2AB;HIST1H2AM;HIST2H2AA3;HIST2H2AC;HIST1H2AH;HIST1H2AG;HIST3H2A histone cluster 1, H2aa;histone cluster 1, H2ae;histone cluster 1, H2ad;H2A histone family, member X;histone cluster 2, H2ab;H2A histone family, member J;histone cluster 2, H2aa4;histone cluster 1, H2ai;histone cluster 1, H2ak;histone cluster 1, H2aj;histone cluster 1, H2al;histone cluster 1, H2ac;histone cluster 1, H2ab;histone cluster 1, H2am;histone cluster 2, H2aa3;histone cluster 2, H2ac;histone cluster 1, H2ah;histone cluster 1, H2ag;histone cluster 3, H2a 1529 196 B20140219_SF055_05 B20140219_SF055_05 TB469432.[MT7]-NDEELNK[MT7].2b4_1.heavy 575.303 / 632.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIST1H2AA;HIST1H2AE;HIST1H2AD;H2AFX;HIST2H2AB;H2AFJ;HIST2H2AA4;HIST1H2AI;HIST1H2AK;HIST1H2AJ;HIST1H2AL;HIST1H2AC;HIST1H2AB;HIST1H2AM;HIST2H2AA3;HIST2H2AC;HIST1H2AH;HIST1H2AG;HIST3H2A histone cluster 1, H2aa;histone cluster 1, H2ae;histone cluster 1, H2ad;H2A histone family, member X;histone cluster 2, H2ab;H2A histone family, member J;histone cluster 2, H2aa4;histone cluster 1, H2ai;histone cluster 1, H2ak;histone cluster 1, H2aj;histone cluster 1, H2al;histone cluster 1, H2ac;histone cluster 1, H2ab;histone cluster 1, H2am;histone cluster 2, H2aa3;histone cluster 2, H2ac;histone cluster 1, H2ah;histone cluster 1, H2ag;histone cluster 3, H2a 1531 196 B20140219_SF055_05 B20140219_SF055_05 TB469432.[MT7]-NDEELNK[MT7].2y3_1.heavy 575.303 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIST1H2AA;HIST1H2AE;HIST1H2AD;H2AFX;HIST2H2AB;H2AFJ;HIST2H2AA4;HIST1H2AI;HIST1H2AK;HIST1H2AJ;HIST1H2AL;HIST1H2AC;HIST1H2AB;HIST1H2AM;HIST2H2AA3;HIST2H2AC;HIST1H2AH;HIST1H2AG;HIST3H2A histone cluster 1, H2aa;histone cluster 1, H2ae;histone cluster 1, H2ad;H2A histone family, member X;histone cluster 2, H2ab;H2A histone family, member J;histone cluster 2, H2aa4;histone cluster 1, H2ai;histone cluster 1, H2ak;histone cluster 1, H2aj;histone cluster 1, H2al;histone cluster 1, H2ac;histone cluster 1, H2ab;histone cluster 1, H2am;histone cluster 2, H2aa3;histone cluster 2, H2ac;histone cluster 1, H2ah;histone cluster 1, H2ag;histone cluster 3, H2a 1533 197 B20140219_SF055_05 B20140219_SF055_05 TB469570.[MT7]-WRFTPEDLK[MT7].3y3_1.heavy 493.945 / 519.326 23320.0 33.67300033569336 50 20 10 10 10 8.603961444619841 11.622553244067728 0.0 3 0.9942926693016683 16.32822887673006 23320.0 29.678486611147893 0.0 - - - - - - - 748.0 46 9 TSGA14 testis specific, 14 1535 197 B20140219_SF055_05 B20140219_SF055_05 TB469570.[MT7]-WRFTPEDLK[MT7].3y5_1.heavy 493.945 / 745.421 16480.0 33.67300033569336 50 20 10 10 10 8.603961444619841 11.622553244067728 0.0 3 0.9942926693016683 16.32822887673006 16480.0 47.372111039026805 0.0 - - - - - - - 293.22222222222223 32 18 TSGA14 testis specific, 14 1537 197 B20140219_SF055_05 B20140219_SF055_05 TB469570.[MT7]-WRFTPEDLK[MT7].3b7_1.heavy 493.945 / 1076.53 N/A 33.67300033569336 50 20 10 10 10 8.603961444619841 11.622553244067728 0.0 3 0.9942926693016683 16.32822887673006 54.0 1.92 2.0 - - - - - - - 0.0 0 0 TSGA14 testis specific, 14 1539 197 B20140219_SF055_05 B20140219_SF055_05 TB469570.[MT7]-WRFTPEDLK[MT7].3y4_1.heavy 493.945 / 648.369 10771.0 33.67300033569336 50 20 10 10 10 8.603961444619841 11.622553244067728 0.0 3 0.9942926693016683 16.32822887673006 10771.0 39.236741975837745 0.0 - - - - - - - 742.0 21 9 TSGA14 testis specific, 14 1541 198 B20140219_SF055_05 B20140219_SF055_05 TB469435.[MT7]-RLVIQDK[MT7].2y4_1.heavy 580.374 / 647.385 932.0 22.68090057373047 41 17 10 10 4 8.720895698681765 11.466712073521968 0.0 7 0.9774201918436831 8.197504265254667 932.0 8.016940034808291 1.0 - - - - - - - 162.86206896551724 2 29 RPL5 ribosomal protein L5 1543 198 B20140219_SF055_05 B20140219_SF055_05 TB469435.[MT7]-RLVIQDK[MT7].2y3_1.heavy 580.374 / 534.3 1298.0 22.68090057373047 41 17 10 10 4 8.720895698681765 11.466712073521968 0.0 7 0.9774201918436831 8.197504265254667 1298.0 2.283912568306011 8.0 - - - - - - - 255.16666666666666 9 30 RPL5 ribosomal protein L5 1545 198 B20140219_SF055_05 B20140219_SF055_05 TB469435.[MT7]-RLVIQDK[MT7].2b6_1.heavy 580.374 / 869.532 11219.0 22.68090057373047 41 17 10 10 4 8.720895698681765 11.466712073521968 0.0 7 0.9774201918436831 8.197504265254667 11219.0 60.9760023615621 0.0 - - - - - - - 154.4 22 25 RPL5 ribosomal protein L5 1547 198 B20140219_SF055_05 B20140219_SF055_05 TB469435.[MT7]-RLVIQDK[MT7].2y6_1.heavy 580.374 / 859.537 1365.0 22.68090057373047 41 17 10 10 4 8.720895698681765 11.466712073521968 0.0 7 0.9774201918436831 8.197504265254667 1365.0 15.97377927927928 0.0 - - - - - - - 136.08695652173913 2 23 RPL5 ribosomal protein L5 1549 199 B20140219_SF055_05 B20140219_SF055_05 TB469378.[MT7]-C[CAM]LAC[CAM]IK[MT7].2y4_1.heavy 526.795 / 635.367 9704.0 26.031275749206543 46 20 10 6 10 6.2813528591288055 15.920137308425232 0.035900115966796875 3 0.9936826458703593 15.519076019136655 9704.0 17.67389470073744 0.0 - - - - - - - 735.0 19 7 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 1551 199 B20140219_SF055_05 B20140219_SF055_05 TB469378.[MT7]-C[CAM]LAC[CAM]IK[MT7].2y5_1.heavy 526.795 / 748.451 10391.0 26.031275749206543 46 20 10 6 10 6.2813528591288055 15.920137308425232 0.035900115966796875 3 0.9936826458703593 15.519076019136655 10391.0 40.998503401360544 0.0 - - - - - - - 228.66666666666666 20 21 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 1553 199 B20140219_SF055_05 B20140219_SF055_05 TB469378.[MT7]-C[CAM]LAC[CAM]IK[MT7].2b4_1.heavy 526.795 / 649.292 3725.0 26.031275749206543 46 20 10 6 10 6.2813528591288055 15.920137308425232 0.035900115966796875 3 0.9936826458703593 15.519076019136655 3725.0 8.425595238095237 2.0 - - - - - - - 767.6666666666666 8 9 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 1555 199 B20140219_SF055_05 B20140219_SF055_05 TB469378.[MT7]-C[CAM]LAC[CAM]IK[MT7].2y3_1.heavy 526.795 / 564.33 7548.0 26.031275749206543 46 20 10 6 10 6.2813528591288055 15.920137308425232 0.035900115966796875 3 0.9936826458703593 15.519076019136655 7548.0 16.092263980917043 0.0 - - - - - - - 756.0 15 7 RARRES2 retinoic acid receptor responder (tazarotene induced) 2 1557 200 B20140219_SF055_05 B20140219_SF055_05 TB469759.[MT7]-DMNAYIRPSPTRGTLGGVTR.4b4_1.heavy 577.309 / 576.257 N/A 27.54829978942871 40 10 10 10 10 1.0125439604313582 64.84046497581883 0.0 3 0.8487927456787357 3.1328913168770622 5670.0 2.986014895949055 1.0 - - - - - - - 324.9230769230769 11 13 MMAA methylmalonic aciduria (cobalamin deficiency) cblA type 1559 200 B20140219_SF055_05 B20140219_SF055_05 TB469759.[MT7]-DMNAYIRPSPTRGTLGGVTR.4b5_1.heavy 577.309 / 739.32 4653.0 27.54829978942871 40 10 10 10 10 1.0125439604313582 64.84046497581883 0.0 3 0.8487927456787357 3.1328913168770622 4653.0 23.497514871116987 0.0 - - - - - - - 183.1904761904762 9 21 MMAA methylmalonic aciduria (cobalamin deficiency) cblA type 1561 200 B20140219_SF055_05 B20140219_SF055_05 TB469759.[MT7]-DMNAYIRPSPTRGTLGGVTR.4y13_2.heavy 577.309 / 649.862 11981.0 27.54829978942871 40 10 10 10 10 1.0125439604313582 64.84046497581883 0.0 3 0.8487927456787357 3.1328913168770622 11981.0 29.177455973043426 0.0 - - - - - - - 270.4117647058824 23 17 MMAA methylmalonic aciduria (cobalamin deficiency) cblA type 1563 200 B20140219_SF055_05 B20140219_SF055_05 TB469759.[MT7]-DMNAYIRPSPTRGTLGGVTR.4b3_1.heavy 577.309 / 505.22 6793.0 27.54829978942871 40 10 10 10 10 1.0125439604313582 64.84046497581883 0.0 3 0.8487927456787357 3.1328913168770622 6793.0 7.408582235500703 0.0 - - - - - - - 1164.7777777777778 13 9 MMAA methylmalonic aciduria (cobalamin deficiency) cblA type 1565 201 B20140219_SF055_05 B20140219_SF055_05 TB469744.[MT7]-EELMFFLWAPELAPLK[MT7].4b4_1.heavy 556.31 / 647.319 1992.0 50.04240036010742 41 11 10 10 10 2.256062877892705 44.32500573450588 0.0 3 0.8664558342277272 3.3388268753334267 1992.0 42.05333333333332 0.0 - - - - - - - 93.18181818181819 3 11 DSTN destrin (actin depolymerizing factor) 1567 201 B20140219_SF055_05 B20140219_SF055_05 TB469744.[MT7]-EELMFFLWAPELAPLK[MT7].4b5_1.heavy 556.31 / 794.388 969.0 50.04240036010742 41 11 10 10 10 2.256062877892705 44.32500573450588 0.0 3 0.8664558342277272 3.3388268753334267 969.0 8.613333333333332 0.0 - - - - - - - 0.0 1 0 DSTN destrin (actin depolymerizing factor) 1569 201 B20140219_SF055_05 B20140219_SF055_05 TB469744.[MT7]-EELMFFLWAPELAPLK[MT7].4y3_1.heavy 556.31 / 501.352 3284.0 50.04240036010742 41 11 10 10 10 2.256062877892705 44.32500573450588 0.0 3 0.8664558342277272 3.3388268753334267 3284.0 17.068842076277022 0.0 - - - - - - - 140.2 6 15 DSTN destrin (actin depolymerizing factor) 1571 201 B20140219_SF055_05 B20140219_SF055_05 TB469744.[MT7]-EELMFFLWAPELAPLK[MT7].4b3_1.heavy 556.31 / 516.279 915.0 50.04240036010742 41 11 10 10 10 2.256062877892705 44.32500573450588 0.0 3 0.8664558342277272 3.3388268753334267 915.0 8.472222222222221 0.0 - - - - - - - 0.0 1 0 DSTN destrin (actin depolymerizing factor) 1573 202 B20140219_SF055_05 B20140219_SF055_05 TB469569.[MT7]-AVEDAFVPVIK[MT7].2y4_1.heavy 738.439 / 600.42 12829.0 37.04140090942383 46 16 10 10 10 3.537018084338709 28.272402802457336 0.0 3 0.9629444950699801 6.391248645957301 12829.0 28.75790410434916 0.0 - - - - - - - 703.7 25 10 PAPOLG poly(A) polymerase gamma 1575 202 B20140219_SF055_05 B20140219_SF055_05 TB469569.[MT7]-AVEDAFVPVIK[MT7].2b4_1.heavy 738.439 / 559.284 6657.0 37.04140090942383 46 16 10 10 10 3.537018084338709 28.272402802457336 0.0 3 0.9629444950699801 6.391248645957301 6657.0 20.504358923200286 0.0 - - - - - - - 666.4444444444445 13 9 PAPOLG poly(A) polymerase gamma 1577 202 B20140219_SF055_05 B20140219_SF055_05 TB469569.[MT7]-AVEDAFVPVIK[MT7].2b6_1.heavy 738.439 / 777.39 4889.0 37.04140090942383 46 16 10 10 10 3.537018084338709 28.272402802457336 0.0 3 0.9629444950699801 6.391248645957301 4889.0 27.911717315606204 0.0 - - - - - - - 245.48 9 25 PAPOLG poly(A) polymerase gamma 1579 202 B20140219_SF055_05 B20140219_SF055_05 TB469569.[MT7]-AVEDAFVPVIK[MT7].2b5_1.heavy 738.439 / 630.321 3849.0 37.04140090942383 46 16 10 10 10 3.537018084338709 28.272402802457336 0.0 3 0.9629444950699801 6.391248645957301 3849.0 14.490555924660002 0.0 - - - - - - - 335.75 7 16 PAPOLG poly(A) polymerase gamma 1581 203 B20140219_SF055_05 B20140219_SF055_05 TB244844.[MT7]-RSSPK[MT7].2y4_1.heavy 431.771 / 562.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZBTB11;CLK4;PRDM2;TSGA14 zinc finger and BTB domain containing 11;CDC-like kinase 4;PR domain containing 2, with ZNF domain;testis specific, 14 1583 204 B20140219_SF055_05 B20140219_SF055_05 TB469563.[MT7]-ELSVLEEDIK[MT7].3y3_1.heavy 488.28 / 519.326 119465.0 36.495399475097656 50 20 10 10 10 11.403956476206803 8.768886500806964 0.0 3 0.9970214875839291 22.607618060915954 119465.0 108.91724625153441 0.0 - - - - - - - 739.5714285714286 238 7 RFWD2 ring finger and WD repeat domain 2 1585 204 B20140219_SF055_05 B20140219_SF055_05 TB469563.[MT7]-ELSVLEEDIK[MT7].3b4_1.heavy 488.28 / 573.336 172351.0 36.495399475097656 50 20 10 10 10 11.403956476206803 8.768886500806964 0.0 3 0.9970214875839291 22.607618060915954 172351.0 296.6067972851324 0.0 - - - - - - - 763.4444444444445 344 9 RFWD2 ring finger and WD repeat domain 2 1587 204 B20140219_SF055_05 B20140219_SF055_05 TB469563.[MT7]-ELSVLEEDIK[MT7].3b5_1.heavy 488.28 / 686.42 87281.0 36.495399475097656 50 20 10 10 10 11.403956476206803 8.768886500806964 0.0 3 0.9970214875839291 22.607618060915954 87281.0 557.2520441489362 0.0 - - - - - - - 763.4444444444445 174 9 RFWD2 ring finger and WD repeat domain 2 1589 204 B20140219_SF055_05 B20140219_SF055_05 TB469563.[MT7]-ELSVLEEDIK[MT7].3y4_1.heavy 488.28 / 648.369 89634.0 36.495399475097656 50 20 10 10 10 11.403956476206803 8.768886500806964 0.0 3 0.9970214875839291 22.607618060915954 89634.0 239.43398751763348 0.0 - - - - - - - 364.5 179 4 RFWD2 ring finger and WD repeat domain 2 1591 205 B20140219_SF055_05 B20140219_SF055_05 TB244840.[MT7]-QLEDGR.2b3_1.heavy 431.231 / 515.295 10120.0 16.172700881958008 44 14 10 10 10 3.928656720695114 25.453992829973338 0.0 3 0.9498102693078704 5.4855674735436875 10120.0 20.12991452991453 0.0 - - - - - - - 669.3333333333334 20 9 LOC100128355;RPS27A;UBA52;UBB;UBC similar to hCG1790904;ribosomal protein S27a;ubiquitin A-52 residue ribosomal protein fusion product 1;ubiquitin B;ubiquitin C 1593 205 B20140219_SF055_05 B20140219_SF055_05 TB244840.[MT7]-QLEDGR.2y5_1.heavy 431.231 / 589.294 N/A 16.172700881958008 44 14 10 10 10 3.928656720695114 25.453992829973338 0.0 3 0.9498102693078704 5.4855674735436875 26266.0 34.88445897426839 1.0 - - - - - - - 304.2 106 5 LOC100128355;RPS27A;UBA52;UBB;UBC similar to hCG1790904;ribosomal protein S27a;ubiquitin A-52 residue ribosomal protein fusion product 1;ubiquitin B;ubiquitin C 1595 205 B20140219_SF055_05 B20140219_SF055_05 TB244840.[MT7]-QLEDGR.2b4_1.heavy 431.231 / 630.321 75228.0 16.172700881958008 44 14 10 10 10 3.928656720695114 25.453992829973338 0.0 3 0.9498102693078704 5.4855674735436875 75228.0 208.75562719637176 0.0 - - - - - - - 363.6666666666667 150 9 LOC100128355;RPS27A;UBA52;UBB;UBC similar to hCG1790904;ribosomal protein S27a;ubiquitin A-52 residue ribosomal protein fusion product 1;ubiquitin B;ubiquitin C 1597 205 B20140219_SF055_05 B20140219_SF055_05 TB244840.[MT7]-QLEDGR.2b5_1.heavy 431.231 / 687.343 3568.0 16.172700881958008 44 14 10 10 10 3.928656720695114 25.453992829973338 0.0 3 0.9498102693078704 5.4855674735436875 3568.0 9.39268376068376 0.0 - - - - - - - 274.2307692307692 7 13 LOC100128355;RPS27A;UBA52;UBB;UBC similar to hCG1790904;ribosomal protein S27a;ubiquitin A-52 residue ribosomal protein fusion product 1;ubiquitin B;ubiquitin C 1599 206 B20140219_SF055_05 B20140219_SF055_05 TB469564.[MT7]-TGAVYVAEIGAK[MT7].2y4_1.heavy 733.927 / 532.357 7104.0 30.416500091552734 50 20 10 10 10 17.399991304323112 5.747129308918362 0.0 3 0.9992362463572947 44.65376447915292 7104.0 39.059793814432986 0.0 - - - - - - - 212.45 14 20 NHLRC3 NHL repeat containing 3 1601 206 B20140219_SF055_05 B20140219_SF055_05 TB469564.[MT7]-TGAVYVAEIGAK[MT7].2y8_1.heavy 733.927 / 994.569 5939.0 30.416500091552734 50 20 10 10 10 17.399991304323112 5.747129308918362 0.0 3 0.9992362463572947 44.65376447915292 5939.0 40.745563475699555 0.0 - - - - - - - 165.69230769230768 11 13 NHLRC3 NHL repeat containing 3 1603 206 B20140219_SF055_05 B20140219_SF055_05 TB469564.[MT7]-TGAVYVAEIGAK[MT7].2y6_1.heavy 733.927 / 732.437 7977.0 30.416500091552734 50 20 10 10 10 17.399991304323112 5.747129308918362 0.0 3 0.9992362463572947 44.65376447915292 7977.0 38.800858369098705 0.0 - - - - - - - 229.61111111111111 15 18 NHLRC3 NHL repeat containing 3 1605 206 B20140219_SF055_05 B20140219_SF055_05 TB469564.[MT7]-TGAVYVAEIGAK[MT7].2b5_1.heavy 733.927 / 636.347 7802.0 30.416500091552734 50 20 10 10 10 17.399991304323112 5.747129308918362 0.0 3 0.9992362463572947 44.65376447915292 7802.0 25.450732767333736 0.0 - - - - - - - 189.125 15 16 NHLRC3 NHL repeat containing 3 1607 207 B20140219_SF055_05 B20140219_SF055_05 TB244986.[MT7]-QC[CAM]QPSDTVC[CAM]ASVR.3y6_1.heavy 551.26 / 691.356 11178.0 21.58330011367798 45 18 10 7 10 10.93707435133401 9.143212964242386 0.027601242065429688 3 0.9894061353390242 11.979839729986292 11178.0 54.20532607003891 0.0 - - - - - - - 674.5714285714286 22 7 LY6H lymphocyte antigen 6 complex, locus H 1609 207 B20140219_SF055_05 B20140219_SF055_05 TB244986.[MT7]-QC[CAM]QPSDTVC[CAM]ASVR.3b3_1.heavy 551.26 / 561.257 35749.0 21.58330011367798 45 18 10 7 10 10.93707435133401 9.143212964242386 0.027601242065429688 3 0.9894061353390242 11.979839729986292 35749.0 45.6445196022856 0.0 - - - - - - - 313.25 71 4 LY6H lymphocyte antigen 6 complex, locus H 1611 207 B20140219_SF055_05 B20140219_SF055_05 TB244986.[MT7]-QC[CAM]QPSDTVC[CAM]ASVR.3y8_1.heavy 551.26 / 907.43 6456.0 21.58330011367798 45 18 10 7 10 10.93707435133401 9.143212964242386 0.027601242065429688 3 0.9894061353390242 11.979839729986292 6456.0 9.845053763155027 1.0 - - - - - - - 166.93333333333334 12 15 LY6H lymphocyte antigen 6 complex, locus H 1613 207 B20140219_SF055_05 B20140219_SF055_05 TB244986.[MT7]-QC[CAM]QPSDTVC[CAM]ASVR.3y5_1.heavy 551.26 / 592.287 57879.0 21.58330011367798 45 18 10 7 10 10.93707435133401 9.143212964242386 0.027601242065429688 3 0.9894061353390242 11.979839729986292 57879.0 128.5164848364277 0.0 - - - - - - - 774.4444444444445 115 9 LY6H lymphocyte antigen 6 complex, locus H 1615 208 B20140219_SF055_05 B20140219_SF055_05 TB469360.[MT7]-ILENEK[MT7].2b3_1.heavy 517.31 / 500.32 N/A 23.381266911824543 47 20 10 7 10 10.721515857673106 9.327039322376475 0.024400711059570312 3 0.9966492800151031 21.314343503503533 18988.0 8.1251939437336 1.0 - - - - - - - 1949.0 37 1 TBCA tubulin folding cofactor A 1617 208 B20140219_SF055_05 B20140219_SF055_05 TB469360.[MT7]-ILENEK[MT7].2y4_1.heavy 517.31 / 663.343 13754.0 23.381266911824543 47 20 10 7 10 10.721515857673106 9.327039322376475 0.024400711059570312 3 0.9966492800151031 21.314343503503533 13754.0 27.617086024580644 0.0 - - - - - - - 677.7777777777778 27 9 TBCA tubulin folding cofactor A 1619 208 B20140219_SF055_05 B20140219_SF055_05 TB469360.[MT7]-ILENEK[MT7].2y5_1.heavy 517.31 / 776.427 30684.0 23.381266911824543 47 20 10 7 10 10.721515857673106 9.327039322376475 0.024400711059570312 3 0.9966492800151031 21.314343503503533 30684.0 59.71120784146601 0.0 - - - - - - - 780.625 61 8 TBCA tubulin folding cofactor A 1621 208 B20140219_SF055_05 B20140219_SF055_05 TB469360.[MT7]-ILENEK[MT7].2y3_1.heavy 517.31 / 534.3 12274.0 23.381266911824543 47 20 10 7 10 10.721515857673106 9.327039322376475 0.024400711059570312 3 0.9966492800151031 21.314343503503533 12274.0 32.60294913834599 0.0 - - - - - - - 291.06666666666666 24 15 TBCA tubulin folding cofactor A 1623 209 B20140219_SF055_05 B20140219_SF055_05 TB469362.[MT7]-AVNC[CAM]RK[MT7].2y4_1.heavy 518.302 / 721.39 926.0 13.646100044250488 48 18 10 10 10 4.532774939893936 22.061540960235703 0.0 3 0.9895913567999037 12.086147406174511 926.0 15.119738751814223 0.0 - - - - - - - 0.0 1 0 UBA52 ubiquitin A-52 residue ribosomal protein fusion product 1 1625 209 B20140219_SF055_05 B20140219_SF055_05 TB469362.[MT7]-AVNC[CAM]RK[MT7].2y5_1.heavy 518.302 / 820.458 1666.0 13.646100044250488 48 18 10 10 10 4.532774939893936 22.061540960235703 0.0 3 0.9895913567999037 12.086147406174511 1666.0 34.577358490566034 0.0 - - - - - - - 97.7 3 20 UBA52 ubiquitin A-52 residue ribosomal protein fusion product 1 1627 209 B20140219_SF055_05 B20140219_SF055_05 TB469362.[MT7]-AVNC[CAM]RK[MT7].2y3_1.heavy 518.302 / 607.347 661.0 13.646100044250488 48 18 10 10 10 4.532774939893936 22.061540960235703 0.0 3 0.9895913567999037 12.086147406174511 661.0 3.495854774156661 1.0 - - - - - - - 0.0 1 0 UBA52 ubiquitin A-52 residue ribosomal protein fusion product 1 1629 209 B20140219_SF055_05 B20140219_SF055_05 TB469362.[MT7]-AVNC[CAM]RK[MT7].2b5_1.heavy 518.302 / 745.39 529.0 13.646100044250488 48 18 10 10 10 4.532774939893936 22.061540960235703 0.0 3 0.9895913567999037 12.086147406174511 529.0 19.194484760522496 1.0 - - - - - - - 0.0 1 0 UBA52 ubiquitin A-52 residue ribosomal protein fusion product 1 1631 210 B20140219_SF055_05 B20140219_SF055_05 TB469748.[MT7]-DQPIFLRLEDYFWVK[MT7].4b11_2.heavy 565.062 / 767.905 18357.0 48.10559844970703 43 13 10 10 10 1.2451169501649366 55.042532959573215 0.0 3 0.9273167725945487 4.549660632557122 18357.0 347.6666134724567 0.0 - - - - - - - 145.88888888888889 36 9 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 1633 210 B20140219_SF055_05 B20140219_SF055_05 TB469748.[MT7]-DQPIFLRLEDYFWVK[MT7].4b4_1.heavy 565.062 / 598.332 1201.0 48.10559844970703 43 13 10 10 10 1.2451169501649366 55.042532959573215 0.0 3 0.9273167725945487 4.549660632557122 1201.0 20.357598076824715 0.0 - - - - - - - 251.4 2 5 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 1635 210 B20140219_SF055_05 B20140219_SF055_05 TB469748.[MT7]-DQPIFLRLEDYFWVK[MT7].4y3_1.heavy 565.062 / 576.363 15612.0 48.10559844970703 43 13 10 10 10 1.2451169501649366 55.042532959573215 0.0 3 0.9273167725945487 4.549660632557122 15612.0 104.0429250419826 0.0 - - - - - - - 157.1875 31 16 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 1637 210 B20140219_SF055_05 B20140219_SF055_05 TB469748.[MT7]-DQPIFLRLEDYFWVK[MT7].4b10_2.heavy 565.062 / 686.373 26649.0 48.10559844970703 43 13 10 10 10 1.2451169501649366 55.042532959573215 0.0 3 0.9273167725945487 4.549660632557122 26649.0 386.8290991432068 0.0 - - - - - - - 155.14285714285714 53 7 ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 1639 211 B20140219_SF055_05 B20140219_SF055_05 TB469749.[MT7]-YFGSVC[CAM]ELDIIFNFEK[MT7].3b9_1.heavy 757.053 / 1215.55 3427.0 48.982398986816406 33 13 2 10 8 1.7547712537672249 42.77904797944307 0.0 4 0.9070422574165659 4.016025696798105 3427.0 78.56010580645162 0.0 - - - - - - - 153.30769230769232 6 13 AP1S1;AP1S2 adaptor-related protein complex 1, sigma 1 subunit;adaptor-related protein complex 1, sigma 2 subunit 1641 211 B20140219_SF055_05 B20140219_SF055_05 TB469749.[MT7]-YFGSVC[CAM]ELDIIFNFEK[MT7].3b4_1.heavy 757.053 / 599.295 1807.0 48.982398986816406 33 13 2 10 8 1.7547712537672249 42.77904797944307 0.0 4 0.9070422574165659 4.016025696798105 1807.0 0.6442067736185382 0.0 - - - - - - - 193.52631578947367 3 19 AP1S1;AP1S2 adaptor-related protein complex 1, sigma 1 subunit;adaptor-related protein complex 1, sigma 2 subunit 1643 211 B20140219_SF055_05 B20140219_SF055_05 TB469749.[MT7]-YFGSVC[CAM]ELDIIFNFEK[MT7].3y4_1.heavy 757.053 / 681.369 5857.0 48.982398986816406 33 13 2 10 8 1.7547712537672249 42.77904797944307 0.0 4 0.9070422574165659 4.016025696798105 5857.0 30.365167969285615 0.0 - - - - - - - 190.26315789473685 11 19 AP1S1;AP1S2 adaptor-related protein complex 1, sigma 1 subunit;adaptor-related protein complex 1, sigma 2 subunit 1645 211 B20140219_SF055_05 B20140219_SF055_05 TB469749.[MT7]-YFGSVC[CAM]ELDIIFNFEK[MT7].3y5_1.heavy 757.053 / 828.437 5795.0 48.982398986816406 33 13 2 10 8 1.7547712537672249 42.77904797944307 0.0 4 0.9070422574165659 4.016025696798105 5795.0 42.775191335917185 1.0 - - - - - - - 232.0 23 18 AP1S1;AP1S2 adaptor-related protein complex 1, sigma 1 subunit;adaptor-related protein complex 1, sigma 2 subunit 1647 212 B20140219_SF055_05 B20140219_SF055_05 TB469366.[MT7]-VLYTAGK[MT7].2y5_1.heavy 520.323 / 683.385 10864.0 24.98150062561035 47 17 10 10 10 2.522856188098691 27.55314610759634 0.0 3 0.9755986419375873 7.8843932745943315 10864.0 22.403890882732526 0.0 - - - - - - - 764.4 21 10 IFT80 intraflagellar transport 80 homolog (Chlamydomonas) 1649 212 B20140219_SF055_05 B20140219_SF055_05 TB469366.[MT7]-VLYTAGK[MT7].2b4_1.heavy 520.323 / 621.373 3392.0 24.98150062561035 47 17 10 10 10 2.522856188098691 27.55314610759634 0.0 3 0.9755986419375873 7.8843932745943315 3392.0 3.937583697234352 1.0 - - - - - - - 761.2727272727273 6 11 IFT80 intraflagellar transport 80 homolog (Chlamydomonas) 1651 212 B20140219_SF055_05 B20140219_SF055_05 TB469366.[MT7]-VLYTAGK[MT7].2y3_1.heavy 520.323 / 419.273 10263.0 24.98150062561035 47 17 10 10 10 2.522856188098691 27.55314610759634 0.0 3 0.9755986419375873 7.8843932745943315 10263.0 16.632513766939045 0.0 - - - - - - - 769.4166666666666 20 12 IFT80 intraflagellar transport 80 homolog (Chlamydomonas) 1653 212 B20140219_SF055_05 B20140219_SF055_05 TB469366.[MT7]-VLYTAGK[MT7].2y6_1.heavy 520.323 / 796.469 14986.0 24.98150062561035 47 17 10 10 10 2.522856188098691 27.55314610759634 0.0 3 0.9755986419375873 7.8843932745943315 14986.0 95.88223014821062 0.0 - - - - - - - 219.61111111111111 29 18 IFT80 intraflagellar transport 80 homolog (Chlamydomonas) 1655 213 B20140219_SF055_05 B20140219_SF055_05 TB469367.[MT7]-YIGEYVR.2y5_1.heavy 522.286 / 623.315 32273.0 29.809025287628174 42 18 10 6 8 4.763562587991635 20.992691531352584 0.03510093688964844 4 0.9842908267654589 9.83366766242325 32273.0 45.9815463519151 0.0 - - - - - - - 1242.857142857143 64 7 RSPH1 radial spoke head 1 homolog (Chlamydomonas) 1657 213 B20140219_SF055_05 B20140219_SF055_05 TB469367.[MT7]-YIGEYVR.2b4_1.heavy 522.286 / 607.321 20516.0 29.809025287628174 42 18 10 6 8 4.763562587991635 20.992691531352584 0.03510093688964844 4 0.9842908267654589 9.83366766242325 20516.0 21.51340449681519 1.0 - - - - - - - 118.0 71 1 RSPH1 radial spoke head 1 homolog (Chlamydomonas) 1659 213 B20140219_SF055_05 B20140219_SF055_05 TB469367.[MT7]-YIGEYVR.2y6_1.heavy 522.286 / 736.399 52378.0 29.809025287628174 42 18 10 6 8 4.763562587991635 20.992691531352584 0.03510093688964844 4 0.9842908267654589 9.83366766242325 52378.0 29.49142521994135 1.0 - - - - - - - 293.8 104 5 RSPH1 radial spoke head 1 homolog (Chlamydomonas) 1661 213 B20140219_SF055_05 B20140219_SF055_05 TB469367.[MT7]-YIGEYVR.2b5_1.heavy 522.286 / 770.384 17283.0 29.809025287628174 42 18 10 6 8 4.763562587991635 20.992691531352584 0.03510093688964844 4 0.9842908267654589 9.83366766242325 17283.0 16.08927927927928 1.0 - - - - - - - 848.0 34 7 RSPH1 radial spoke head 1 homolog (Chlamydomonas)