Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40398.[MT7]-YVPYVGDSK[MT7].2y4_1.heavy 658.36 / 550.295 1456.0 29.10260073343913 42 18 10 6 8 5.268138559709078 18.982036798501042 0.038700103759765625 4 0.9853028559727516 10.167461773403195 1456.0 0.24285714285714288 1.0 - - - - - - - 246.4 2 15 ISYNA1 inositol-3-phosphate synthase 1 3 1 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40398.[MT7]-YVPYVGDSK[MT7].2y5_1.heavy 658.36 / 649.364 N/A 29.10260073343913 42 18 10 6 8 5.268138559709078 18.982036798501042 0.038700103759765625 4 0.9853028559727516 10.167461773403195 2351.0 3.7259151785714284 7.0 - - - - - - - 720.0 12 14 ISYNA1 inositol-3-phosphate synthase 1 5 1 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40398.[MT7]-YVPYVGDSK[MT7].2y6_1.heavy 658.36 / 812.427 896.0 29.10260073343913 42 18 10 6 8 5.268138559709078 18.982036798501042 0.038700103759765625 4 0.9853028559727516 10.167461773403195 896.0 6.52 1.0 - - - - - - - 149.33333333333334 2 9 ISYNA1 inositol-3-phosphate synthase 1 7 1 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40398.[MT7]-YVPYVGDSK[MT7].2y7_1.heavy 658.36 / 909.48 7054.0 29.10260073343913 42 18 10 6 8 5.268138559709078 18.982036798501042 0.038700103759765625 4 0.9853028559727516 10.167461773403195 7054.0 59.581107142857135 0.0 - - - - - - - 183.27272727272728 14 11 ISYNA1 inositol-3-phosphate synthase 1 9 2 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40730.[MT7]-K[MT7]AEALEAAIENLNEAK[MT7].3b6_1.heavy 716.074 / 930.55 1164.0 36.638075828552246 30 8 10 6 6 0.5736469161394677 93.5713586782523 0.036296844482421875 6 0.7576300004894724 2.4543314628169948 1164.0 5.281525201968806 0.0 - - - - - - - 203.06666666666666 2 15 ANAPC5 anaphase promoting complex subunit 5 11 2 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40730.[MT7]-K[MT7]AEALEAAIENLNEAK[MT7].3b4_1.heavy 716.074 / 688.423 1612.0 36.638075828552246 30 8 10 6 6 0.5736469161394677 93.5713586782523 0.036296844482421875 6 0.7576300004894724 2.4543314628169948 1612.0 0.7196428571428571 8.0 - - - - - - - 705.3125 5 16 ANAPC5 anaphase promoting complex subunit 5 13 2 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40730.[MT7]-K[MT7]AEALEAAIENLNEAK[MT7].3y4_1.heavy 716.074 / 605.338 3493.0 36.638075828552246 30 8 10 6 6 0.5736469161394677 93.5713586782523 0.036296844482421875 6 0.7576300004894724 2.4543314628169948 3493.0 11.472201923076923 0.0 - - - - - - - 304.53333333333336 6 15 ANAPC5 anaphase promoting complex subunit 5 15 2 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40730.[MT7]-K[MT7]AEALEAAIENLNEAK[MT7].3b7_2.heavy 716.074 / 501.297 9763.0 36.638075828552246 30 8 10 6 6 0.5736469161394677 93.5713586782523 0.036296844482421875 6 0.7576300004894724 2.4543314628169948 9763.0 18.616141501833308 0.0 - - - - - - - 291.25 19 16 ANAPC5 anaphase promoting complex subunit 5 17 3 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40633.[MT7]-RSDSYVLLEHSVK[MT7].4b5_1.heavy 456.008 / 753.365 3423.0 27.92530059814453 42 12 10 10 10 2.2692332591883644 44.06774825597566 0.0 3 0.8808934403569407 3.5398639960463556 3423.0 9.308525710626688 0.0 - - - - - - - 205.0 6 18 ANAPC5 anaphase promoting complex subunit 5 19 3 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40633.[MT7]-RSDSYVLLEHSVK[MT7].4y3_1.heavy 456.008 / 477.315 18082.0 27.92530059814453 42 12 10 10 10 2.2692332591883644 44.06774825597566 0.0 3 0.8808934403569407 3.5398639960463556 18082.0 25.38930622769246 0.0 - - - - - - - 721.6666666666666 36 9 ANAPC5 anaphase promoting complex subunit 5 21 3 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40633.[MT7]-RSDSYVLLEHSVK[MT7].4b3_1.heavy 456.008 / 503.269 1141.0 27.92530059814453 42 12 10 10 10 2.2692332591883644 44.06774825597566 0.0 3 0.8808934403569407 3.5398639960463556 1141.0 0.3900113938473225 14.0 - - - - - - - 623.2 10 10 ANAPC5 anaphase promoting complex subunit 5 23 3 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40633.[MT7]-RSDSYVLLEHSVK[MT7].4b6_1.heavy 456.008 / 852.433 3599.0 27.92530059814453 42 12 10 10 10 2.2692332591883644 44.06774825597566 0.0 3 0.8808934403569407 3.5398639960463556 3599.0 28.67506049083996 0.0 - - - - - - - 219.5 7 12 ANAPC5 anaphase promoting complex subunit 5 25 4 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20365.[MT7]-IVQAVVYSC[CAM]GAR.2y8_1.heavy 733.899 / 911.44 3592.0 31.320600509643555 39 10 9 10 10 0.7141111240311884 80.43274701875922 0.0 3 0.8354865015021435 2.9999877078032395 3592.0 21.78606516290727 0.0 - - - - - - - 216.125 7 8 ACSL5 acyl-CoA synthetase long-chain family member 5 27 4 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20365.[MT7]-IVQAVVYSC[CAM]GAR.2y9_1.heavy 733.899 / 982.477 N/A 31.320600509643555 39 10 9 10 10 0.7141111240311884 80.43274701875922 0.0 3 0.8354865015021435 2.9999877078032395 2927.0 10.152226645043983 2.0 - - - - - - - 266.0 8 7 ACSL5 acyl-CoA synthetase long-chain family member 5 29 4 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20365.[MT7]-IVQAVVYSC[CAM]GAR.2y10_1.heavy 733.899 / 1110.54 3193.0 31.320600509643555 39 10 9 10 10 0.7141111240311884 80.43274701875922 0.0 3 0.8354865015021435 2.9999877078032395 3193.0 17.8856015037594 0.0 - - - - - - - 243.83333333333334 6 6 ACSL5 acyl-CoA synthetase long-chain family member 5 31 4 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20365.[MT7]-IVQAVVYSC[CAM]GAR.2y11_1.heavy 733.899 / 1209.6 2129.0 31.320600509643555 39 10 9 10 10 0.7141111240311884 80.43274701875922 0.0 3 0.8354865015021435 2.9999877078032395 2129.0 23.2109022556391 0.0 - - - - - - - 243.83333333333334 4 6 ACSL5 acyl-CoA synthetase long-chain family member 5 33 5 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46041.[MT7]-LLHAK[MT7].2b3_1.heavy 435.294 / 508.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA2;EXOSC10 inositol(myo)-1(or 4)-monophosphatase 2;exosome component 10 35 5 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46041.[MT7]-LLHAK[MT7].2y4_1.heavy 435.294 / 612.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA2;EXOSC10 inositol(myo)-1(or 4)-monophosphatase 2;exosome component 10 37 5 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46041.[MT7]-LLHAK[MT7].2y3_1.heavy 435.294 / 499.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA2;EXOSC10 inositol(myo)-1(or 4)-monophosphatase 2;exosome component 10 39 6 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20220.[MT7]-C[CAM]LGWC[CAM]PQPVPVLGGR.3y6_1.heavy 613.987 / 598.367 49390.0 37.5578498840332 45 20 10 5 10 5.660140296386133 17.66740659482375 0.04010009765625 3 0.9932948877313763 15.063170011601903 49390.0 124.00380638017842 0.0 - - - - - - - 208.4 98 10 ANAPC11 anaphase promoting complex subunit 11 41 6 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20220.[MT7]-C[CAM]LGWC[CAM]PQPVPVLGGR.3b4_1.heavy 613.987 / 661.325 16675.0 37.5578498840332 45 20 10 5 10 5.660140296386133 17.66740659482375 0.04010009765625 3 0.9932948877313763 15.063170011601903 16675.0 36.81223261317563 0.0 - - - - - - - 770.4 33 10 ANAPC11 anaphase promoting complex subunit 11 43 6 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20220.[MT7]-C[CAM]LGWC[CAM]PQPVPVLGGR.3b5_1.heavy 613.987 / 821.356 23743.0 37.5578498840332 45 20 10 5 10 5.660140296386133 17.66740659482375 0.04010009765625 3 0.9932948877313763 15.063170011601903 23743.0 99.85368030744027 0.0 - - - - - - - 217.4 47 10 ANAPC11 anaphase promoting complex subunit 11 45 6 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20220.[MT7]-C[CAM]LGWC[CAM]PQPVPVLGGR.3y8_1.heavy 613.987 / 794.488 53921.0 37.5578498840332 45 20 10 5 10 5.660140296386133 17.66740659482375 0.04010009765625 3 0.9932948877313763 15.063170011601903 53921.0 242.9161202469938 0.0 - - - - - - - 238.72727272727272 107 11 ANAPC11 anaphase promoting complex subunit 11 47 7 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43800.[MT7]-LMDALK[MT7].2y4_1.heavy 489.798 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5;VPS35 anaphase promoting complex subunit 5;vacuolar protein sorting 35 homolog (S. cerevisiae) 49 7 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43800.[MT7]-LMDALK[MT7].2b3_1.heavy 489.798 / 504.261 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5;VPS35 anaphase promoting complex subunit 5;vacuolar protein sorting 35 homolog (S. cerevisiae) 51 7 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43800.[MT7]-LMDALK[MT7].2y5_1.heavy 489.798 / 721.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5;VPS35 anaphase promoting complex subunit 5;vacuolar protein sorting 35 homolog (S. cerevisiae) 53 7 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43800.[MT7]-LMDALK[MT7].2b4_1.heavy 489.798 / 575.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5;VPS35 anaphase promoting complex subunit 5;vacuolar protein sorting 35 homolog (S. cerevisiae) 55 8 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46711.[MT7]-SQTTGFPSLITIFSAPNYLDVYNNK[MT7].3b9_1.heavy 1026.87 / 1063.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 57 8 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46711.[MT7]-SQTTGFPSLITIFSAPNYLDVYNNK[MT7].3b6_1.heavy 1026.87 / 766.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 59 8 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46711.[MT7]-SQTTGFPSLITIFSAPNYLDVYNNK[MT7].3b5_1.heavy 1026.87 / 619.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 61 8 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46711.[MT7]-SQTTGFPSLITIFSAPNYLDVYNNK[MT7].3y4_1.heavy 1026.87 / 682.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 63 9 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535842.[MT7]-SQTPLVTLFK[MT7].3b6_1.heavy 474.625 / 770.453 7144.0 39.458075523376465 42 18 10 6 8 5.801470258318177 17.237009852221426 0.038898468017578125 4 0.9875584211033319 11.052825523679012 7144.0 44.90104417670683 0.0 - - - - - - - 186.75 14 12 POMC proopiomelanocortin 65 9 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535842.[MT7]-SQTPLVTLFK[MT7].3y3_1.heavy 474.625 / 551.367 19854.0 39.458075523376465 42 18 10 6 8 5.801470258318177 17.237009852221426 0.038898468017578125 4 0.9875584211033319 11.052825523679012 19854.0 52.08504936132489 1.0 - - - - - - - 308.2857142857143 68 7 POMC proopiomelanocortin 67 9 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535842.[MT7]-SQTPLVTLFK[MT7].3b5_1.heavy 474.625 / 671.385 33893.0 39.458075523376465 42 18 10 6 8 5.801470258318177 17.237009852221426 0.038898468017578125 4 0.9875584211033319 11.052825523679012 33893.0 101.25771177485608 0.0 - - - - - - - 348.6 67 5 POMC proopiomelanocortin 69 9 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535842.[MT7]-SQTPLVTLFK[MT7].3y4_1.heavy 474.625 / 652.415 28410.0 39.458075523376465 42 18 10 6 8 5.801470258318177 17.237009852221426 0.038898468017578125 4 0.9875584211033319 11.052825523679012 28410.0 147.0298747335914 0.0 - - - - - - - 276.6666666666667 56 9 POMC proopiomelanocortin 71 10 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20379.[MT7]-SQWSPALTVSK[MT7].2y4_1.heavy 746.424 / 578.363 1724.0 31.259050369262695 33 16 4 5 8 3.5022861319127996 28.5527784519948 0.0485992431640625 4 0.9636577363881959 6.454049026799061 1724.0 3.57741216655823 2.0 - - - - - - - 265.3333333333333 8 9 UBE2D4;UBE2D1 ubiquitin-conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) 73 10 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20379.[MT7]-SQWSPALTVSK[MT7].2y8_1.heavy 746.424 / 946.569 2785.0 31.259050369262695 33 16 4 5 8 3.5022861319127996 28.5527784519948 0.0485992431640625 4 0.9636577363881959 6.454049026799061 2785.0 16.81509433962264 1.0 - - - - - - - 265.22222222222223 15 9 UBE2D4;UBE2D1 ubiquitin-conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) 75 10 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20379.[MT7]-SQWSPALTVSK[MT7].2b4_1.heavy 746.424 / 633.311 2387.0 31.259050369262695 33 16 4 5 8 3.5022861319127996 28.5527784519948 0.0485992431640625 4 0.9636577363881959 6.454049026799061 2387.0 4.414099051290938 0.0 - - - - - - - 782.5 4 10 UBE2D4;UBE2D1 ubiquitin-conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) 77 10 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20379.[MT7]-SQWSPALTVSK[MT7].2y7_1.heavy 746.424 / 859.537 3978.0 31.259050369262695 33 16 4 5 8 3.5022861319127996 28.5527784519948 0.0485992431640625 4 0.9636577363881959 6.454049026799061 3978.0 44.75653499787204 0.0 - - - - - - - 212.4 7 5 UBE2D4;UBE2D1 ubiquitin-conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) 79 11 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40721.[MT7]-TQEALDSDGWLHTGDIGR.3y7_1.heavy 705.679 / 755.38 10434.0 33.8671989440918 44 14 10 10 10 1.9182851775980403 41.81175042250887 0.0 3 0.9418940485049111 5.094790953274458 10434.0 15.868738016205183 0.0 - - - - - - - 204.6 20 10 ACSL5 acyl-CoA synthetase long-chain family member 5 81 11 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40721.[MT7]-TQEALDSDGWLHTGDIGR.3y6_1.heavy 705.679 / 618.321 9358.0 33.8671989440918 44 14 10 10 10 1.9182851775980403 41.81175042250887 0.0 3 0.9418940485049111 5.094790953274458 9358.0 22.791682263195284 0.0 - - - - - - - 779.75 18 8 ACSL5 acyl-CoA synthetase long-chain family member 5 83 11 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40721.[MT7]-TQEALDSDGWLHTGDIGR.3b4_1.heavy 705.679 / 574.295 4733.0 33.8671989440918 44 14 10 10 10 1.9182851775980403 41.81175042250887 0.0 3 0.9418940485049111 5.094790953274458 4733.0 10.127206523499497 0.0 - - - - - - - 200.07142857142858 9 14 ACSL5 acyl-CoA synthetase long-chain family member 5 85 11 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40721.[MT7]-TQEALDSDGWLHTGDIGR.3b3_1.heavy 705.679 / 503.258 2904.0 33.8671989440918 44 14 10 10 10 1.9182851775980403 41.81175042250887 0.0 3 0.9418940485049111 5.094790953274458 2904.0 4.144010454414693 1.0 - - - - - - - 706.8571428571429 6 7 ACSL5 acyl-CoA synthetase long-chain family member 5 87 12 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40720.[MT7]-RSEVEEVDFAGWLC[CAM]K[MT7].3y3_1.heavy 705.026 / 564.33 4744.0 38.761749267578125 34 9 10 5 10 0.626811515290737 83.94766870168934 0.04090118408203125 3 0.8042416730617571 2.7425123402144163 4744.0 37.23259777259777 0.0 - - - - - - - 183.8181818181818 9 11 MAP2K2 mitogen-activated protein kinase kinase 2 89 12 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40720.[MT7]-RSEVEEVDFAGWLC[CAM]K[MT7].3b3_1.heavy 705.026 / 517.285 791.0 38.761749267578125 34 9 10 5 10 0.626811515290737 83.94766870168934 0.04090118408203125 3 0.8042416730617571 2.7425123402144163 791.0 1.5756759455950506 10.0 - - - - - - - 269.53333333333336 2 15 MAP2K2 mitogen-activated protein kinase kinase 2 91 12 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40720.[MT7]-RSEVEEVDFAGWLC[CAM]K[MT7].3b8_1.heavy 705.026 / 1088.53 1845.0 38.761749267578125 34 9 10 5 10 0.626811515290737 83.94766870168934 0.04090118408203125 3 0.8042416730617571 2.7425123402144163 1845.0 23.342045454545456 0.0 - - - - - - - 149.5 3 10 MAP2K2 mitogen-activated protein kinase kinase 2 93 12 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40720.[MT7]-RSEVEEVDFAGWLC[CAM]K[MT7].3b8_2.heavy 705.026 / 544.771 5534.0 38.761749267578125 34 9 10 5 10 0.626811515290737 83.94766870168934 0.04090118408203125 3 0.8042416730617571 2.7425123402144163 5534.0 49.05136363636363 0.0 - - - - - - - 228.6 11 10 MAP2K2 mitogen-activated protein kinase kinase 2 95 13 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40388.[MT7]-DSDLLHWK[MT7].3y3_1.heavy 434.575 / 614.353 5738.0 32.421600341796875 43 13 10 10 10 2.1984640702084923 45.48630171177483 0.0 3 0.9061506005046671 3.99659461116258 5738.0 25.213160302201842 0.0 - - - - - - - 210.3846153846154 11 13 ANAPC5 anaphase promoting complex subunit 5 97 13 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40388.[MT7]-DSDLLHWK[MT7].3b4_1.heavy 434.575 / 575.279 26864.0 32.421600341796875 43 13 10 10 10 2.1984640702084923 45.48630171177483 0.0 3 0.9061506005046671 3.99659461116258 26864.0 247.78536516357207 0.0 - - - - - - - 228.0 53 4 ANAPC5 anaphase promoting complex subunit 5 99 13 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40388.[MT7]-DSDLLHWK[MT7].3b5_1.heavy 434.575 / 688.363 10042.0 32.421600341796875 43 13 10 10 10 2.1984640702084923 45.48630171177483 0.0 3 0.9061506005046671 3.99659461116258 10042.0 81.60038717292936 0.0 - - - - - - - 234.4 20 5 ANAPC5 anaphase promoting complex subunit 5 101 13 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40388.[MT7]-DSDLLHWK[MT7].3b3_1.heavy 434.575 / 462.195 27777.0 32.421600341796875 43 13 10 10 10 2.1984640702084923 45.48630171177483 0.0 3 0.9061506005046671 3.99659461116258 27777.0 130.76672054991124 0.0 - - - - - - - 260.7 55 10 ANAPC5 anaphase promoting complex subunit 5 103 14 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535521.[MT7]-DFLIPIGK[MT7].2b3_1.heavy 595.873 / 520.289 26583.0 38.57160186767578 46 16 10 10 10 2.179105916664543 45.890380653486275 0.0 3 0.9678975603187929 6.86949205217645 26583.0 87.80445454545455 0.0 - - - - - - - 232.0 53 11 PDHB pyruvate dehydrogenase (lipoamide) beta 105 14 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535521.[MT7]-DFLIPIGK[MT7].2y4_1.heavy 595.873 / 558.373 48678.0 38.57160186767578 46 16 10 10 10 2.179105916664543 45.890380653486275 0.0 3 0.9678975603187929 6.86949205217645 48678.0 118.74481818181818 0.0 - - - - - - - 242.0 97 8 PDHB pyruvate dehydrogenase (lipoamide) beta 107 14 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535521.[MT7]-DFLIPIGK[MT7].2y5_1.heavy 595.873 / 671.457 7570.0 38.57160186767578 46 16 10 10 10 2.179105916664543 45.890380653486275 0.0 3 0.9678975603187929 6.86949205217645 7570.0 15.204700854700853 0.0 - - - - - - - 270.7692307692308 15 13 PDHB pyruvate dehydrogenase (lipoamide) beta 109 14 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535521.[MT7]-DFLIPIGK[MT7].2b4_1.heavy 595.873 / 633.373 19982.0 38.57160186767578 46 16 10 10 10 2.179105916664543 45.890380653486275 0.0 3 0.9678975603187929 6.86949205217645 19982.0 30.102468181949583 1.0 - - - - - - - 242.0 46 12 PDHB pyruvate dehydrogenase (lipoamide) beta 111 15 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535900.[MT7]-IYASSSPPDTGQR.3y7_1.heavy 508.259 / 770.379 14076.0 22.606199264526367 47 17 10 10 10 4.976745055765751 20.093454432460057 0.0 3 0.9766460185113284 8.059963087969699 14076.0 32.44476264807588 0.0 - - - - - - - 726.2222222222222 28 9 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 113 15 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535900.[MT7]-IYASSSPPDTGQR.3y6_1.heavy 508.259 / 673.326 64748.0 22.606199264526367 47 17 10 10 10 4.976745055765751 20.093454432460057 0.0 3 0.9766460185113284 8.059963087969699 64748.0 37.036697640984194 0.0 - - - - - - - 914.8 129 5 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 115 15 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535900.[MT7]-IYASSSPPDTGQR.3b4_1.heavy 508.259 / 579.326 11512.0 22.606199264526367 47 17 10 10 10 4.976745055765751 20.093454432460057 0.0 3 0.9766460185113284 8.059963087969699 11512.0 19.43051728258272 0.0 - - - - - - - 690.0909090909091 23 11 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 117 15 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535900.[MT7]-IYASSSPPDTGQR.3y5_1.heavy 508.259 / 576.274 10657.0 22.606199264526367 47 17 10 10 10 4.976745055765751 20.093454432460057 0.0 3 0.9766460185113284 8.059963087969699 10657.0 20.253601990049752 0.0 - - - - - - - 674.6666666666666 21 12 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 119 16 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20371.[MT7]-ILYPSTLFLLR.2b3_1.heavy 740.456 / 534.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 121 16 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20371.[MT7]-ILYPSTLFLLR.2y8_1.heavy 740.456 / 946.572 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 123 16 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20371.[MT7]-ILYPSTLFLLR.2y9_1.heavy 740.456 / 1109.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 125 16 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20371.[MT7]-ILYPSTLFLLR.2y10_1.heavy 740.456 / 1222.72 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 127 17 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40488.[MT7]-LSVEIWDWDR.2y5_1.heavy 731.876 / 777.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCA protein kinase C, alpha 129 17 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40488.[MT7]-LSVEIWDWDR.2b4_1.heavy 731.876 / 573.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCA protein kinase C, alpha 131 17 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40488.[MT7]-LSVEIWDWDR.2y9_1.heavy 731.876 / 1205.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCA protein kinase C, alpha 133 17 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40488.[MT7]-LSVEIWDWDR.2y7_1.heavy 731.876 / 1019.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCA protein kinase C, alpha 135 18 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40380.[MT7]-AQQLEQIRR.3y3_1.heavy 429.253 / 444.304 5821.0 21.50480079650879 46 16 10 10 10 1.9837422595798424 39.32764373863968 0.0 3 0.9635210432866739 6.441871071071966 5821.0 15.770066902641098 0.0 - - - - - - - 689.4285714285714 11 7 ISYNA1 inositol-3-phosphate synthase 1 137 18 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40380.[MT7]-AQQLEQIRR.3b4_1.heavy 429.253 / 585.348 11443.0 21.50480079650879 46 16 10 10 10 1.9837422595798424 39.32764373863968 0.0 3 0.9635210432866739 6.441871071071966 11443.0 36.5238150107604 0.0 - - - - - - - 271.3 22 20 ISYNA1 inositol-3-phosphate synthase 1 139 18 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40380.[MT7]-AQQLEQIRR.3b3_1.heavy 429.253 / 472.264 33534.0 21.50480079650879 46 16 10 10 10 1.9837422595798424 39.32764373863968 0.0 3 0.9635210432866739 6.441871071071966 33534.0 183.20932057548015 0.0 - - - - - - - 254.64705882352942 67 17 ISYNA1 inositol-3-phosphate synthase 1 141 18 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40380.[MT7]-AQQLEQIRR.3y8_2.heavy 429.253 / 535.807 18508.0 21.50480079650879 46 16 10 10 10 1.9837422595798424 39.32764373863968 0.0 3 0.9635210432866739 6.441871071071966 18508.0 145.75501784471726 0.0 - - - - - - - 194.15 37 20 ISYNA1 inositol-3-phosphate synthase 1 143 19 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40624.[MT7]-VIDVTGGGSFSPEEVR.2b3_1.heavy 896.964 / 472.289 25171.0 33.78459930419922 47 17 10 10 10 1.3154365165024828 47.41324861398427 0.0 3 0.971789757844829 7.33048447410145 25171.0 73.34027935323383 0.0 - - - - - - - 254.125 50 8 PHKG1 phosphorylase kinase, gamma 1 (muscle) 145 19 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40624.[MT7]-VIDVTGGGSFSPEEVR.2y12_1.heavy 896.964 / 1222.57 11247.0 33.78459930419922 47 17 10 10 10 1.3154365165024828 47.41324861398427 0.0 3 0.971789757844829 7.33048447410145 11247.0 145.0547663551402 0.0 - - - - - - - 227.375 22 8 PHKG1 phosphorylase kinase, gamma 1 (muscle) 147 19 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40624.[MT7]-VIDVTGGGSFSPEEVR.2y11_1.heavy 896.964 / 1121.52 8569.0 33.78459930419922 47 17 10 10 10 1.3154365165024828 47.41324861398427 0.0 3 0.971789757844829 7.33048447410145 8569.0 64.20076323987539 0.0 - - - - - - - 231.83333333333334 17 6 PHKG1 phosphorylase kinase, gamma 1 (muscle) 149 20 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40623.[MT7]-VYTSDFEPVTNPK[MT7].3b7_1.heavy 595.648 / 986.459 7447.0 30.749799728393555 37 13 4 10 10 2.6920447173885362 37.14648547777717 0.0 3 0.9126881024436205 4.145852996636349 7447.0 28.210033573202434 1.0 - - - - - - - 214.0 15 9 NLK nemo-like kinase 151 20 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40623.[MT7]-VYTSDFEPVTNPK[MT7].3b4_1.heavy 595.648 / 595.321 N/A 30.749799728393555 37 13 4 10 10 2.6920447173885362 37.14648547777717 0.0 3 0.9126881024436205 4.145852996636349 45712.0 2.0089304395528513 8.0 - - - - - - - 15858.0 154 2 NLK nemo-like kinase 153 20 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40623.[MT7]-VYTSDFEPVTNPK[MT7].3b5_1.heavy 595.648 / 710.348 20545.0 30.749799728393555 37 13 4 10 10 2.6920447173885362 37.14648547777717 0.0 3 0.9126881024436205 4.145852996636349 20545.0 169.84011879518908 0.0 - - - - - - - 192.33333333333334 41 6 NLK nemo-like kinase 155 20 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40623.[MT7]-VYTSDFEPVTNPK[MT7].3y4_1.heavy 595.648 / 603.358 13868.0 30.749799728393555 37 13 4 10 10 2.6920447173885362 37.14648547777717 0.0 3 0.9126881024436205 4.145852996636349 13868.0 33.72739060931182 0.0 - - - - - - - 293.42857142857144 27 7 NLK nemo-like kinase 157 21 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40201.[MT7]-HFFALK[MT7].2b3_1.heavy 525.821 / 576.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKX protein kinase, X-linked 159 21 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40201.[MT7]-HFFALK[MT7].2y4_1.heavy 525.821 / 622.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKX protein kinase, X-linked 161 21 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40201.[MT7]-HFFALK[MT7].2y5_1.heavy 525.821 / 769.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKX protein kinase, X-linked 163 21 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40201.[MT7]-HFFALK[MT7].2y3_1.heavy 525.821 / 475.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKX protein kinase, X-linked 165 22 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535529.[MT7]-VFLYQILR.2b3_1.heavy 598.37 / 504.33 6108.0 43.967623710632324 44 18 10 6 10 3.4074216851327557 25.063605252223958 0.035099029541015625 3 0.9807650348293235 8.884194605584796 6108.0 26.506415094339623 0.0 - - - - - - - 187.0625 12 16 NLK nemo-like kinase 167 22 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535529.[MT7]-VFLYQILR.2y5_1.heavy 598.37 / 692.409 8208.0 43.967623710632324 44 18 10 6 10 3.4074216851327557 25.063605252223958 0.035099029541015625 3 0.9807650348293235 8.884194605584796 8208.0 134.81602781136638 0.0 - - - - - - - 156.45454545454547 16 11 NLK nemo-like kinase 169 22 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535529.[MT7]-VFLYQILR.2y6_1.heavy 598.37 / 805.493 6108.0 43.967623710632324 44 18 10 6 10 3.4074216851327557 25.063605252223958 0.035099029541015625 3 0.9807650348293235 8.884194605584796 6108.0 37.27387584143605 0.0 - - - - - - - 144.46666666666667 12 15 NLK nemo-like kinase 171 22 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535529.[MT7]-VFLYQILR.2y7_1.heavy 598.37 / 952.562 14761.0 43.967623710632324 44 18 10 6 10 3.4074216851327557 25.063605252223958 0.035099029541015625 3 0.9807650348293235 8.884194605584796 14761.0 190.30353172280167 0.0 - - - - - - - 148.55555555555554 29 9 NLK nemo-like kinase 173 23 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40105.[MT7]-EVPFK[MT7].2b3_1.heavy 454.278 / 470.273 1880.0 26.652174949645996 46 20 10 6 10 6.793504649680686 14.719942821368393 0.035900115966796875 3 0.9929303063305472 14.669181384152251 1880.0 5.207707496935156 1.0 - - - - - - - 736.2857142857143 3 7 ZAK sterile alpha motif and leucine zipper containing kinase AZK 175 23 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40105.[MT7]-EVPFK[MT7].2y4_1.heavy 454.278 / 634.404 10377.0 26.652174949645996 46 20 10 6 10 6.793504649680686 14.719942821368393 0.035900115966796875 3 0.9929303063305472 14.669181384152251 10377.0 51.16734738491998 0.0 - - - - - - - 199.0 20 21 ZAK sterile alpha motif and leucine zipper containing kinase AZK 177 23 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40105.[MT7]-EVPFK[MT7].2b4_1.heavy 454.278 / 617.341 2298.0 26.652174949645996 46 20 10 6 10 6.793504649680686 14.719942821368393 0.035900115966796875 3 0.9929303063305472 14.669181384152251 2298.0 6.932604774535809 1.0 - - - - - - - 670.25 4 8 ZAK sterile alpha motif and leucine zipper containing kinase AZK 179 23 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40105.[MT7]-EVPFK[MT7].2y3_1.heavy 454.278 / 535.336 33221.0 26.652174949645996 46 20 10 6 10 6.793504649680686 14.719942821368393 0.035900115966796875 3 0.9929303063305472 14.669181384152251 33221.0 79.79979112271539 0.0 - - - - - - - 742.7777777777778 66 9 ZAK sterile alpha motif and leucine zipper containing kinase AZK 181 24 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39692.[MT7]-AQQLEQIRR.2b4_1.heavy 643.376 / 585.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 183 24 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39692.[MT7]-AQQLEQIRR.2b6_1.heavy 643.376 / 842.449 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 185 24 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39692.[MT7]-AQQLEQIRR.2b5_1.heavy 643.376 / 714.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 187 24 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39692.[MT7]-AQQLEQIRR.2y7_1.heavy 643.376 / 942.548 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 189 25 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1099990.0 29.681499481201172 23 -3 10 6 10 null 0.0 0.03989982604980469 3 0.0 0.0 1099990.0 4324.28012098684 0.0 - - - - - - - 1220.0 2199 8 191 25 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 325469.0 29.681499481201172 23 -3 10 6 10 null 0.0 0.03989982604980469 3 0.0 0.0 325469.0 549.7719462432228 0.0 - - - - - - - 766.8888888888889 650 9 193 25 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 199877.0 29.681499481201172 23 -3 10 6 10 null 0.0 0.03989982604980469 3 0.0 0.0 199877.0 342.0949945967589 0.0 - - - - - - - 423.1111111111111 399 9 195 26 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40726.[MT7]-VFSVLREESESVLTLK[MT7].3y15_2.heavy 708.743 / 941.026 4946.0 42.348201751708984 45 15 10 10 10 2.880578649047894 28.929861649774544 0.0 3 0.9594659086805472 6.1090565651193165 4946.0 57.76350364963504 0.0 - - - - - - - 171.71428571428572 9 14 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 197 26 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40726.[MT7]-VFSVLREESESVLTLK[MT7].3b11_2.heavy 708.743 / 704.365 2748.0 42.348201751708984 45 15 10 10 10 2.880578649047894 28.929861649774544 0.0 3 0.9594659086805472 6.1090565651193165 2748.0 14.184660194174757 0.0 - - - - - - - 227.0 5 13 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 199 26 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40726.[MT7]-VFSVLREESESVLTLK[MT7].3y3_1.heavy 708.743 / 505.347 5015.0 42.348201751708984 45 15 10 10 10 2.880578649047894 28.929861649774544 0.0 3 0.9594659086805472 6.1090565651193165 5015.0 32.1448880523083 0.0 - - - - - - - 185.8235294117647 10 17 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 201 26 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40726.[MT7]-VFSVLREESESVLTLK[MT7].3y4_1.heavy 708.743 / 618.431 3366.0 42.348201751708984 45 15 10 10 10 2.880578649047894 28.929861649774544 0.0 3 0.9594659086805472 6.1090565651193165 3366.0 24.715028163831413 0.0 - - - - - - - 225.11111111111111 6 18 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 203 27 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40750.[MT7]-SSLVGVVVPDTDVLPSFAAK[MT7].2b3_1.heavy 1145.15 / 432.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 205 27 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40750.[MT7]-SSLVGVVVPDTDVLPSFAAK[MT7].2b4_1.heavy 1145.15 / 531.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 207 27 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40750.[MT7]-SSLVGVVVPDTDVLPSFAAK[MT7].2y6_1.heavy 1145.15 / 764.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 209 27 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40750.[MT7]-SSLVGVVVPDTDVLPSFAAK[MT7].2b5_1.heavy 1145.15 / 588.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 211 28 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40378.[MT7]-AALFENTPK[MT7].2y5_1.heavy 639.868 / 732.401 1686.0 29.243600368499756 35 12 10 3 10 1.5540297289209044 53.818879351586915 0.07579994201660156 3 0.8998354615368198 3.8664449211502614 1686.0 7.800181998021761 0.0 - - - - - - - 196.5 3 12 PHKG1 phosphorylase kinase, gamma 1 (muscle) 213 28 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40378.[MT7]-AALFENTPK[MT7].2b4_1.heavy 639.868 / 547.336 1124.0 29.243600368499756 35 12 10 3 10 1.5540297289209044 53.818879351586915 0.07579994201660156 3 0.8998354615368198 3.8664449211502614 1124.0 5.356888888888889 3.0 - - - - - - - 198.69230769230768 2 13 PHKG1 phosphorylase kinase, gamma 1 (muscle) 215 28 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40378.[MT7]-AALFENTPK[MT7].2y6_1.heavy 639.868 / 879.469 4947.0 29.243600368499756 35 12 10 3 10 1.5540297289209044 53.818879351586915 0.07579994201660156 3 0.8998354615368198 3.8664449211502614 4947.0 13.94554896142433 0.0 - - - - - - - 196.66666666666666 9 12 PHKG1 phosphorylase kinase, gamma 1 (muscle) 217 28 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40378.[MT7]-AALFENTPK[MT7].2b5_1.heavy 639.868 / 676.379 1124.0 29.243600368499756 35 12 10 3 10 1.5540297289209044 53.818879351586915 0.07579994201660156 3 0.8998354615368198 3.8664449211502614 1124.0 3.496888888888889 1.0 - - - - - - - 198.76923076923077 2 13 PHKG1 phosphorylase kinase, gamma 1 (muscle) 219 29 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20482.[MT7]-LTSEEVFDLDGIPR.2y8_1.heavy 867.955 / 932.484 2985.0 39.794376373291016 37 15 10 6 6 2.2601115187788254 44.24560432930832 0.0381011962890625 5 0.9594420331812947 6.107245838230958 2985.0 15.961508727573296 0.0 - - - - - - - 221.0 5 16 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 221 29 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20482.[MT7]-LTSEEVFDLDGIPR.2b4_1.heavy 867.955 / 575.316 3377.0 39.794376373291016 37 15 10 6 6 2.2601115187788254 44.24560432930832 0.0381011962890625 5 0.9594420331812947 6.107245838230958 3377.0 2.8648992576882293 1.0 - - - - - - - 205.6153846153846 8 13 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 223 29 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20482.[MT7]-LTSEEVFDLDGIPR.2y6_1.heavy 867.955 / 670.388 3770.0 39.794376373291016 37 15 10 6 6 2.2601115187788254 44.24560432930832 0.0381011962890625 5 0.9594420331812947 6.107245838230958 3770.0 16.621336769258196 0.0 - - - - - - - 260.3125 7 16 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 225 29 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20482.[MT7]-LTSEEVFDLDGIPR.2b5_1.heavy 867.955 / 704.358 3456.0 39.794376373291016 37 15 10 6 6 2.2601115187788254 44.24560432930832 0.0381011962890625 5 0.9594420331812947 6.107245838230958 3456.0 10.345987261146496 1.0 - - - - - - - 176.875 7 16 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 227 30 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20389.[MT7]-ISALPVVDESGK[MT7].2y4_1.heavy 751.937 / 564.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 229 30 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20389.[MT7]-ISALPVVDESGK[MT7].2y8_1.heavy 751.937 / 974.528 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 231 30 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20389.[MT7]-ISALPVVDESGK[MT7].2y5_1.heavy 751.937 / 679.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 233 30 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20389.[MT7]-ISALPVVDESGK[MT7].2b4_1.heavy 751.937 / 529.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 235 31 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40754.[MT7]-GIIWGEDTLMEYLENPK[MT7].3b6_1.heavy 766.064 / 800.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYCS cytochrome c, somatic 237 31 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40754.[MT7]-GIIWGEDTLMEYLENPK[MT7].3b5_1.heavy 766.064 / 671.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYCS cytochrome c, somatic 239 31 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40754.[MT7]-GIIWGEDTLMEYLENPK[MT7].3b8_1.heavy 766.064 / 1016.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYCS cytochrome c, somatic 241 31 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40754.[MT7]-GIIWGEDTLMEYLENPK[MT7].3b7_1.heavy 766.064 / 915.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYCS cytochrome c, somatic 243 32 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536190.[MT7]-FNPDFAEAHYLSYLNNLR.3y7_1.heavy 776.722 / 879.468 3892.0 41.565348625183105 43 17 10 6 10 7.357023693983455 13.592453165779471 0.036602020263671875 3 0.9729196675487134 7.4825633358748505 3892.0 29.814615384615387 0.0 - - - - - - - 190.8125 7 16 ANAPC5 anaphase promoting complex subunit 5 245 32 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536190.[MT7]-FNPDFAEAHYLSYLNNLR.3b4_1.heavy 776.722 / 618.3 2432.0 41.565348625183105 43 17 10 6 10 7.357023693983455 13.592453165779471 0.036602020263671875 3 0.9729196675487134 7.4825633358748505 2432.0 9.869267252864375 0.0 - - - - - - - 259.42105263157896 4 19 ANAPC5 anaphase promoting complex subunit 5 247 32 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536190.[MT7]-FNPDFAEAHYLSYLNNLR.3y8_1.heavy 776.722 / 992.552 5768.0 41.565348625183105 43 17 10 6 10 7.357023693983455 13.592453165779471 0.036602020263671875 3 0.9729196675487134 7.4825633358748505 5768.0 48.34330935251798 0.0 - - - - - - - 208.1764705882353 11 17 ANAPC5 anaphase promoting complex subunit 5 249 32 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536190.[MT7]-FNPDFAEAHYLSYLNNLR.3y9_1.heavy 776.722 / 1155.62 4031.0 41.565348625183105 43 17 10 6 10 7.357023693983455 13.592453165779471 0.036602020263671875 3 0.9729196675487134 7.4825633358748505 4031.0 67.86420289855073 0.0 - - - - - - - 165.3846153846154 8 13 ANAPC5 anaphase promoting complex subunit 5 251 33 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 411952.0 15.441499710083008 24 -3 10 7 10 null 0.0 0.02760028839111328 3 0.0 0.0 411952.0 2666.6951010217213 0.0 - - - - - - - 675.0 823 11 253 33 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 797637.0 15.441499710083008 24 -3 10 7 10 null 0.0 0.02760028839111328 3 0.0 0.0 797637.0 5127.914525016503 0.0 - - - - - - - 147.0 1595 4 255 33 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 274788.0 15.441499710083008 24 -3 10 7 10 null 0.0 0.02760028839111328 3 0.0 0.0 274788.0 741.1955693787082 0.0 - - - - - - - 656.1428571428571 549 7 257 34 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44441.[MT7]-AHYGGDIFITSVDAATTFEELC[CAM]EEVR.3b6_1.heavy 1025.49 / 745.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 259 34 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44441.[MT7]-AHYGGDIFITSVDAATTFEELC[CAM]EEVR.3b18_2.heavy 1025.49 / 1006.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 261 34 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44441.[MT7]-AHYGGDIFITSVDAATTFEELC[CAM]EEVR.3b7_1.heavy 1025.49 / 858.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 263 34 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44441.[MT7]-AHYGGDIFITSVDAATTFEELC[CAM]EEVR.3y9_1.heavy 1025.49 / 1210.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 265 35 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20385.[MT7]-DALAHPYLDEGR.3y7_1.heavy 500.924 / 849.41 17502.0 26.95680046081543 48 18 10 10 10 3.1638566007110582 25.310479646388664 0.0 3 0.9836138594838659 9.62784763042895 17502.0 107.80407842046719 0.0 - - - - - - - 187.26315789473685 35 19 NLK nemo-like kinase 267 35 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20385.[MT7]-DALAHPYLDEGR.3y6_1.heavy 500.924 / 752.357 20522.0 26.95680046081543 48 18 10 10 10 3.1638566007110582 25.310479646388664 0.0 3 0.9836138594838659 9.62784763042895 20522.0 94.63103086471293 0.0 - - - - - - - 224.4 41 10 NLK nemo-like kinase 269 35 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20385.[MT7]-DALAHPYLDEGR.3b3_1.heavy 500.924 / 444.258 N/A 26.95680046081543 48 18 10 10 10 3.1638566007110582 25.310479646388664 0.0 3 0.9836138594838659 9.62784763042895 18818.0 9.158818043240363 0.0 - - - - - - - 1161.5714285714287 37 7 NLK nemo-like kinase 271 35 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20385.[MT7]-DALAHPYLDEGR.3y5_1.heavy 500.924 / 589.294 24239.0 26.95680046081543 48 18 10 10 10 3.1638566007110582 25.310479646388664 0.0 3 0.9836138594838659 9.62784763042895 24239.0 50.580571328497044 0.0 - - - - - - - 697.0 48 10 NLK nemo-like kinase 273 36 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20489.[MT7]-FHWTAPAALQVTVR.3y7_1.heavy 580.994 / 786.483 12239.0 36.84579849243164 50 20 10 10 10 10.227696723333478 9.777372433410143 0.0 3 0.9951336509357708 17.684161177137174 12239.0 46.860958987525756 0.0 - - - - - - - 247.92857142857142 24 14 PDHB pyruvate dehydrogenase (lipoamide) beta 275 36 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20489.[MT7]-FHWTAPAALQVTVR.3y8_1.heavy 580.994 / 857.52 9316.0 36.84579849243164 50 20 10 10 10 10.227696723333478 9.777372433410143 0.0 3 0.9951336509357708 17.684161177137174 9316.0 105.84696005090373 0.0 - - - - - - - 156.42857142857142 18 14 PDHB pyruvate dehydrogenase (lipoamide) beta 277 36 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20489.[MT7]-FHWTAPAALQVTVR.3y5_1.heavy 580.994 / 602.362 18267.0 36.84579849243164 50 20 10 10 10 10.227696723333478 9.777372433410143 0.0 3 0.9951336509357708 17.684161177137174 18267.0 46.667518248175185 0.0 - - - - - - - 649.4444444444445 36 9 PDHB pyruvate dehydrogenase (lipoamide) beta 279 36 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20489.[MT7]-FHWTAPAALQVTVR.3y9_1.heavy 580.994 / 954.573 12604.0 36.84579849243164 50 20 10 10 10 10.227696723333478 9.777372433410143 0.0 3 0.9951336509357708 17.684161177137174 12604.0 170.27068613578203 0.0 - - - - - - - 215.72727272727272 25 11 PDHB pyruvate dehydrogenase (lipoamide) beta 281 37 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535915.[MT7]-LVVFDTTLQVK[MT7].3b6_1.heavy 517.651 / 819.473 5667.0 40.099849700927734 42 16 10 6 10 2.4590389736109577 35.649993142885265 0.0345001220703125 3 0.9633150502830249 6.423647669962408 5667.0 52.281240521686385 0.0 - - - - - - - 196.78571428571428 11 14 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 283 37 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535915.[MT7]-LVVFDTTLQVK[MT7].3b4_1.heavy 517.651 / 603.399 12199.0 40.099849700927734 42 16 10 6 10 2.4590389736109577 35.649993142885265 0.0345001220703125 3 0.9633150502830249 6.423647669962408 12199.0 29.274974441754104 0.0 - - - - - - - 220.53333333333333 24 15 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 285 37 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535915.[MT7]-LVVFDTTLQVK[MT7].3b5_1.heavy 517.651 / 718.426 16607.0 40.099849700927734 42 16 10 6 10 2.4590389736109577 35.649993142885265 0.0345001220703125 3 0.9633150502830249 6.423647669962408 16607.0 59.866020465715906 0.0 - - - - - - - 226.88235294117646 33 17 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 287 37 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535915.[MT7]-LVVFDTTLQVK[MT7].3y4_1.heavy 517.651 / 631.426 15348.0 40.099849700927734 42 16 10 6 10 2.4590389736109577 35.649993142885265 0.0345001220703125 3 0.9633150502830249 6.423647669962408 15348.0 57.06842455341926 0.0 - - - - - - - 281.23809523809524 30 21 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 289 38 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20709.[MT7]-SQTTGFPSLITIFSAPNYLDVYNNK[MT7].4b5_1.heavy 770.406 / 619.317 679.0 50.0093994140625 48 18 10 10 10 2.5095813018163673 30.84601649093607 0.0 3 0.9881293168906838 11.316026650573841 679.0 16.36816425120773 0.0 - - - - - - - 0.0 1 0 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 291 38 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20709.[MT7]-SQTTGFPSLITIFSAPNYLDVYNNK[MT7].4y3_1.heavy 770.406 / 519.301 648.0 50.0093994140625 48 18 10 10 10 2.5095813018163673 30.84601649093607 0.0 3 0.9881293168906838 11.316026650573841 648.0 7.08554188906939 0.0 - - - - - - - 0.0 1 0 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 293 38 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20709.[MT7]-SQTTGFPSLITIFSAPNYLDVYNNK[MT7].4y6_1.heavy 770.406 / 896.459 710.0 50.0093994140625 48 18 10 10 10 2.5095813018163673 30.84601649093607 0.0 3 0.9881293168906838 11.316026650573841 710.0 13.502428006775833 0.0 - - - - - - - 0.0 1 0 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 295 38 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20709.[MT7]-SQTTGFPSLITIFSAPNYLDVYNNK[MT7].4b6_1.heavy 770.406 / 766.385 1666.0 50.0093994140625 48 18 10 10 10 2.5095813018163673 30.84601649093607 0.0 3 0.9881293168906838 11.316026650573841 1666.0 18.705402022147325 0.0 - - - - - - - 90.15 3 20 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 297 39 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46055.[MT7]-LAVSSK[MT7].2b3_1.heavy 446.789 / 428.299 3331.0 21.23872470855713 38 15 10 3 10 1.8274069644424862 49.01486201400508 0.06850051879882812 3 0.9526184513440185 5.647130906357771 3331.0 1.6693919552091858 0.0 - - - - - - - 686.9090909090909 6 11 ACSL5 acyl-CoA synthetase long-chain family member 5 299 39 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46055.[MT7]-LAVSSK[MT7].2y4_1.heavy 446.789 / 564.347 2585.0 21.23872470855713 38 15 10 3 10 1.8274069644424862 49.01486201400508 0.06850051879882812 3 0.9526184513440185 5.647130906357771 2585.0 16.180442890871173 0.0 - - - - - - - 292.72222222222223 5 18 ACSL5 acyl-CoA synthetase long-chain family member 5 301 39 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46055.[MT7]-LAVSSK[MT7].2y5_1.heavy 446.789 / 635.385 5916.0 21.23872470855713 38 15 10 3 10 1.8274069644424862 49.01486201400508 0.06850051879882812 3 0.9526184513440185 5.647130906357771 5916.0 13.512105263157894 0.0 - - - - - - - 760.0 11 7 ACSL5 acyl-CoA synthetase long-chain family member 5 303 39 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46055.[MT7]-LAVSSK[MT7].2y3_1.heavy 446.789 / 465.279 5071.0 21.23872470855713 38 15 10 3 10 1.8274069644424862 49.01486201400508 0.06850051879882812 3 0.9526184513440185 5.647130906357771 5071.0 16.140475893642517 0.0 - - - - - - - 270.95 10 20 ACSL5 acyl-CoA synthetase long-chain family member 5 305 40 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44344.[MT7]-VFLLGEEVAQYDGAYK[MT7].2y4_1.heavy 1045.56 / 582.337 1646.0 42.348201751708984 41 11 10 10 10 0.8081257115543128 80.15223904168334 0.0 3 0.8778018557324193 3.4938560899096713 1646.0 29.616188265090756 0.0 - - - - - - - 156.85714285714286 3 7 PDHB pyruvate dehydrogenase (lipoamide) beta 307 40 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44344.[MT7]-VFLLGEEVAQYDGAYK[MT7].2b3_1.heavy 1045.56 / 504.33 3360.0 42.348201751708984 41 11 10 10 10 0.8081257115543128 80.15223904168334 0.0 3 0.8778018557324193 3.4938560899096713 3360.0 20.074041527886045 0.0 - - - - - - - 137.25 6 8 PDHB pyruvate dehydrogenase (lipoamide) beta 309 40 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44344.[MT7]-VFLLGEEVAQYDGAYK[MT7].2y8_1.heavy 1045.56 / 1059.52 1440.0 42.348201751708984 41 11 10 10 10 0.8081257115543128 80.15223904168334 0.0 3 0.8778018557324193 3.4938560899096713 1440.0 30.30854966677245 0.0 - - - - - - - 84.11111111111111 2 9 PDHB pyruvate dehydrogenase (lipoamide) beta 311 40 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44344.[MT7]-VFLLGEEVAQYDGAYK[MT7].2b4_1.heavy 1045.56 / 617.414 2606.0 42.348201751708984 41 11 10 10 10 0.8081257115543128 80.15223904168334 0.0 3 0.8778018557324193 3.4938560899096713 2606.0 69.11565217391305 0.0 - - - - - - - 103.25 5 4 PDHB pyruvate dehydrogenase (lipoamide) beta 313 41 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40092.[MT7]-VSIAVLR.2y4_1.heavy 451.301 / 458.309 9010.0 32.76110076904297 47 17 10 10 10 1.101682435991995 55.318412778204376 0.0 3 0.9707191330422431 7.1945719333419165 9010.0 26.650241298225467 0.0 - - - - - - - 626.0 18 9 MAP2K2 mitogen-activated protein kinase kinase 2 315 41 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40092.[MT7]-VSIAVLR.2b4_1.heavy 451.301 / 515.331 12765.0 32.76110076904297 47 17 10 10 10 1.101682435991995 55.318412778204376 0.0 3 0.9707191330422431 7.1945719333419165 12765.0 23.16496494184763 0.0 - - - - - - - 626.0 25 7 MAP2K2 mitogen-activated protein kinase kinase 2 317 41 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40092.[MT7]-VSIAVLR.2y6_1.heavy 451.301 / 658.425 53561.0 32.76110076904297 47 17 10 10 10 1.101682435991995 55.318412778204376 0.0 3 0.9707191330422431 7.1945719333419165 53561.0 100.36171237188469 0.0 - - - - - - - 312.5 107 4 MAP2K2 mitogen-activated protein kinase kinase 2 319 41 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40092.[MT7]-VSIAVLR.2b5_1.heavy 451.301 / 614.399 15267.0 32.76110076904297 47 17 10 10 10 1.101682435991995 55.318412778204376 0.0 3 0.9707191330422431 7.1945719333419165 15267.0 50.185855950266436 0.0 - - - - - - - 263.8888888888889 30 9 MAP2K2 mitogen-activated protein kinase kinase 2 321 42 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40083.[MT7]-NDLDK[MT7].2y4_1.heavy 446.753 / 634.353 1318.0 16.906150817871094 39 13 10 6 10 1.9025971761461689 40.72207740055679 0.030300140380859375 3 0.9220533561372115 4.391384606370672 1318.0 5.7437124923296325 1.0 - - - - - - - 202.95652173913044 2 23 PTEN phosphatase and tensin homolog 323 42 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40083.[MT7]-NDLDK[MT7].2b3_1.heavy 446.753 / 487.263 1016.0 16.906150817871094 39 13 10 6 10 1.9025971761461689 40.72207740055679 0.030300140380859375 3 0.9220533561372115 4.391384606370672 1016.0 0.9177990272997602 2.0 - - - - - - - 243.25 2 28 PTEN phosphatase and tensin homolog 325 42 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40083.[MT7]-NDLDK[MT7].2b4_1.heavy 446.753 / 602.29 3598.0 16.906150817871094 39 13 10 6 10 1.9025971761461689 40.72207740055679 0.030300140380859375 3 0.9220533561372115 4.391384606370672 3598.0 7.660194559372407 0.0 - - - - - - - 584.7142857142857 7 7 PTEN phosphatase and tensin homolog 327 42 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40083.[MT7]-NDLDK[MT7].2y3_1.heavy 446.753 / 519.326 2170.0 16.906150817871094 39 13 10 6 10 1.9025971761461689 40.72207740055679 0.030300140380859375 3 0.9220533561372115 4.391384606370672 2170.0 5.341509576803695 1.0 - - - - - - - 231.56521739130434 4 23 PTEN phosphatase and tensin homolog 329 43 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20702.[MT7]-RIDQSEFEGFEYINPLLLSTEESV.3b9_1.heavy 987.161 / 1206.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 331 43 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20702.[MT7]-RIDQSEFEGFEYINPLLLSTEESV.3b11_2.heavy 987.161 / 741.853 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 333 43 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20702.[MT7]-RIDQSEFEGFEYINPLLLSTEESV.3b6_1.heavy 987.161 / 873.455 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 335 43 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20702.[MT7]-RIDQSEFEGFEYINPLLLSTEESV.3b3_1.heavy 987.161 / 529.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 337 44 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20089.[MT7]-WISQDK[MT7].2b3_1.heavy 532.803 / 531.305 1675.0 26.297874927520752 39 13 10 6 10 1.338266156722471 66.47642877970462 0.03529930114746094 3 0.9004774496590636 3.8791109221791666 1675.0 2.9705908936567305 2.0 - - - - - - - 767.625 3 8 ZAK sterile alpha motif and leucine zipper containing kinase AZK 339 44 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20089.[MT7]-WISQDK[MT7].2y4_1.heavy 532.803 / 621.332 9282.0 26.297874927520752 39 13 10 6 10 1.338266156722471 66.47642877970462 0.03529930114746094 3 0.9004774496590636 3.8791109221791666 9282.0 23.781484733647595 0.0 - - - - - - - 248.75 18 16 ZAK sterile alpha motif and leucine zipper containing kinase AZK 341 44 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20089.[MT7]-WISQDK[MT7].2y5_1.heavy 532.803 / 734.417 9562.0 26.297874927520752 39 13 10 6 10 1.338266156722471 66.47642877970462 0.03529930114746094 3 0.9004774496590636 3.8791109221791666 9562.0 22.835331629599903 0.0 - - - - - - - 227.8421052631579 19 19 ZAK sterile alpha motif and leucine zipper containing kinase AZK 343 44 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20089.[MT7]-WISQDK[MT7].2b5_1.heavy 532.803 / 774.39 6630.0 26.297874927520752 39 13 10 6 10 1.338266156722471 66.47642877970462 0.03529930114746094 3 0.9004774496590636 3.8791109221791666 6630.0 21.86032288874511 0.0 - - - - - - - 123.14285714285714 13 21 ZAK sterile alpha motif and leucine zipper containing kinase AZK 345 45 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40616.[MT7]-AAPPPPPPPPPPPGADR.3y7_1.heavy 591.325 / 709.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 347 45 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40616.[MT7]-AAPPPPPPPPPPPGADR.3y8_1.heavy 591.325 / 806.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 349 45 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40616.[MT7]-AAPPPPPPPPPPPGADR.3y10_1.heavy 591.325 / 1000.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 351 45 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40616.[MT7]-AAPPPPPPPPPPPGADR.3y9_1.heavy 591.325 / 903.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 353 46 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535714.[MT7]-AALFENTPK[MT7].3b6_1.heavy 426.915 / 790.422 8217.0 29.234175205230713 46 20 10 6 10 16.59371333703008 6.026378663348529 0.03809928894042969 3 0.9973217023763814 23.841631617981044 8217.0 106.32814159292036 0.0 - - - - - - - 187.83333333333334 16 6 PHKG1 phosphorylase kinase, gamma 1 (muscle) 355 46 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535714.[MT7]-AALFENTPK[MT7].3b4_1.heavy 426.915 / 547.336 30841.0 29.234175205230713 46 20 10 6 10 16.59371333703008 6.026378663348529 0.03809928894042969 3 0.9973217023763814 23.841631617981044 30841.0 41.59367225542831 0.0 - - - - - - - 323.625 61 8 PHKG1 phosphorylase kinase, gamma 1 (muscle) 357 46 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535714.[MT7]-AALFENTPK[MT7].3b5_1.heavy 426.915 / 676.379 26226.0 29.234175205230713 46 20 10 6 10 16.59371333703008 6.026378663348529 0.03809928894042969 3 0.9973217023763814 23.841631617981044 26226.0 71.00481172291296 0.0 - - - - - - - 787.7142857142857 52 7 PHKG1 phosphorylase kinase, gamma 1 (muscle) 359 46 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535714.[MT7]-AALFENTPK[MT7].3b3_1.heavy 426.915 / 400.268 80818.0 29.234175205230713 46 20 10 6 10 16.59371333703008 6.026378663348529 0.03809928894042969 3 0.9973217023763814 23.841631617981044 80818.0 26.552023417930513 0.0 - - - - - - - 844.0 161 2 PHKG1 phosphorylase kinase, gamma 1 (muscle) 361 47 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536184.[MT7]-SSLVGVVVPDTDVLPSFAAK[MT7].4b7_1.heavy 573.079 / 786.484 7493.0 42.11130142211914 42 12 10 10 10 0.955449577992462 69.7751803990986 0.0 3 0.8918683149403366 3.7187115352595885 7493.0 45.66320067409904 0.0 - - - - - - - 220.8 14 15 ACSL5 acyl-CoA synthetase long-chain family member 5 363 47 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536184.[MT7]-SSLVGVVVPDTDVLPSFAAK[MT7].4b5_1.heavy 573.079 / 588.347 9451.0 42.11130142211914 42 12 10 10 10 0.955449577992462 69.7751803990986 0.0 3 0.8918683149403366 3.7187115352595885 9451.0 84.35892592592593 0.0 - - - - - - - 260.64285714285717 18 14 ACSL5 acyl-CoA synthetase long-chain family member 5 365 47 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536184.[MT7]-SSLVGVVVPDTDVLPSFAAK[MT7].4y6_1.heavy 573.079 / 764.442 17484.0 42.11130142211914 42 12 10 10 10 0.955449577992462 69.7751803990986 0.0 3 0.8918683149403366 3.7187115352595885 17484.0 30.0222882983211 0.0 - - - - - - - 185.91666666666666 34 12 ACSL5 acyl-CoA synthetase long-chain family member 5 367 47 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536184.[MT7]-SSLVGVVVPDTDVLPSFAAK[MT7].4b6_1.heavy 573.079 / 687.416 16606.0 42.11130142211914 42 12 10 10 10 0.955449577992462 69.7751803990986 0.0 3 0.8918683149403366 3.7187115352595885 16606.0 39.386099928551246 0.0 - - - - - - - 263.5 33 10 ACSL5 acyl-CoA synthetase long-chain family member 5 369 48 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20200.[MT7]-ADLIAYLK[MT7].2y4_1.heavy 597.87 / 638.399 20745.0 38.82320022583008 47 17 10 10 10 2.4919151428083643 31.763316099308508 0.0 3 0.9781436600879411 8.332579300984753 20745.0 73.04968002160192 0.0 - - - - - - - 172.0 41 14 CYCS cytochrome c, somatic 371 48 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20200.[MT7]-ADLIAYLK[MT7].2y5_1.heavy 597.87 / 751.483 9124.0 38.82320022583008 47 17 10 10 10 2.4919151428083643 31.763316099308508 0.0 3 0.9781436600879411 8.332579300984753 9124.0 65.42403100775194 0.0 - - - - - - - 152.88888888888889 18 9 CYCS cytochrome c, somatic 373 48 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20200.[MT7]-ADLIAYLK[MT7].2b4_1.heavy 597.87 / 557.341 16355.0 38.82320022583008 47 17 10 10 10 2.4919151428083643 31.763316099308508 0.0 3 0.9781436600879411 8.332579300984753 16355.0 29.35273435658358 0.0 - - - - - - - 731.75 32 8 CYCS cytochrome c, somatic 375 48 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20200.[MT7]-ADLIAYLK[MT7].2y3_1.heavy 597.87 / 567.362 11621.0 38.82320022583008 47 17 10 10 10 2.4919151428083643 31.763316099308508 0.0 3 0.9781436600879411 8.332579300984753 11621.0 120.09819654913728 0.0 - - - - - - - 656.5 23 8 CYCS cytochrome c, somatic 377 49 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20396.[MT7]-VVSPWNSEDAK[MT7].3b4_1.heavy 507.271 / 527.331 7431.0 29.50589942932129 46 16 10 10 10 5.931077743003098 16.860342138993232 0.0 3 0.9657825526662649 6.652614417540537 7431.0 22.733822033898306 0.0 - - - - - - - 696.2 14 10 PDHB pyruvate dehydrogenase (lipoamide) beta 379 49 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20396.[MT7]-VVSPWNSEDAK[MT7].3b5_1.heavy 507.271 / 713.41 15215.0 29.50589942932129 46 16 10 10 10 5.931077743003098 16.860342138993232 0.0 3 0.9657825526662649 6.652614417540537 15215.0 29.011652542372882 0.0 - - - - - - - 837.8 30 10 PDHB pyruvate dehydrogenase (lipoamide) beta 381 49 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20396.[MT7]-VVSPWNSEDAK[MT7].3y4_1.heavy 507.271 / 606.321 17220.0 29.50589942932129 46 16 10 10 10 5.931077743003098 16.860342138993232 0.0 3 0.9657825526662649 6.652614417540537 17220.0 18.460821284802982 0.0 - - - - - - - 401.2 34 5 PDHB pyruvate dehydrogenase (lipoamide) beta 383 49 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20396.[MT7]-VVSPWNSEDAK[MT7].3y5_1.heavy 507.271 / 693.354 26656.0 29.50589942932129 46 16 10 10 10 5.931077743003098 16.860342138993232 0.0 3 0.9657825526662649 6.652614417540537 26656.0 34.93969362324356 0.0 - - - - - - - 722.75 53 8 PDHB pyruvate dehydrogenase (lipoamide) beta 385 50 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40362.[MT7]-AHEAQDAGYR.2y8_1.heavy 631.306 / 909.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 387 50 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40362.[MT7]-AHEAQDAGYR.2y9_1.heavy 631.306 / 1046.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 389 50 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40362.[MT7]-AHEAQDAGYR.2b6_1.heavy 631.306 / 796.371 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 391 50 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40362.[MT7]-AHEAQDAGYR.2y7_1.heavy 631.306 / 780.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 393 51 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46044.[MT7]-TLGIGK[MT7].2b3_1.heavy 438.791 / 416.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - PFKM;GFOD1 phosphofructokinase, muscle;glucose-fructose oxidoreductase domain containing 1 395 51 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46044.[MT7]-TLGIGK[MT7].2y4_1.heavy 438.791 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PFKM;GFOD1 phosphofructokinase, muscle;glucose-fructose oxidoreductase domain containing 1 397 51 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46044.[MT7]-TLGIGK[MT7].2y5_1.heavy 438.791 / 631.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - PFKM;GFOD1 phosphofructokinase, muscle;glucose-fructose oxidoreductase domain containing 1 399 51 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46044.[MT7]-TLGIGK[MT7].2y3_1.heavy 438.791 / 461.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - PFKM;GFOD1 phosphofructokinase, muscle;glucose-fructose oxidoreductase domain containing 1 401 52 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46045.[MT7]-AIEEK[MT7].2b3_1.heavy 439.265 / 458.273 1222.0 18.447599411010742 44 20 6 10 8 8.798021535081622 11.366191774054606 0.0 4 0.9948563799962591 17.200521001611275 1222.0 3.993561811505508 1.0 - - - - - - - 272.7391304347826 2 23 SUPT16H;MAP3K5;EXOSC9 suppressor of Ty 16 homolog (S. cerevisiae);mitogen-activated protein kinase kinase kinase 5;exosome component 9 403 52 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46045.[MT7]-AIEEK[MT7].2y4_1.heavy 439.265 / 662.384 3382.0 18.447599411010742 44 20 6 10 8 8.798021535081622 11.366191774054606 0.0 4 0.9948563799962591 17.200521001611275 3382.0 26.525490196078433 2.0 - - - - - - - 166.8095238095238 9 21 SUPT16H;MAP3K5;EXOSC9 suppressor of Ty 16 homolog (S. cerevisiae);mitogen-activated protein kinase kinase kinase 5;exosome component 9 405 52 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46045.[MT7]-AIEEK[MT7].2b4_1.heavy 439.265 / 587.316 N/A 18.447599411010742 44 20 6 10 8 8.798021535081622 11.366191774054606 0.0 4 0.9948563799962591 17.200521001611275 1467.0 0.24822335025380704 3.0 - - - - - - - 315.625 3 16 SUPT16H;MAP3K5;EXOSC9 suppressor of Ty 16 homolog (S. cerevisiae);mitogen-activated protein kinase kinase kinase 5;exosome component 9 407 52 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46045.[MT7]-AIEEK[MT7].2y3_1.heavy 439.265 / 549.3 1997.0 18.447599411010742 44 20 6 10 8 8.798021535081622 11.366191774054606 0.0 4 0.9948563799962591 17.200521001611275 1997.0 12.376365546218487 0.0 - - - - - - - 246.23809523809524 3 21 SUPT16H;MAP3K5;EXOSC9 suppressor of Ty 16 homolog (S. cerevisiae);mitogen-activated protein kinase kinase kinase 5;exosome component 9 409 53 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 551281.0 18.096500396728516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 551281.0 1281.7309556849016 0.0 - - - - - - - 201.125 1102 8 411 53 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 283265.0 18.096500396728516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 283265.0 2153.6218859180035 0.0 - - - - - - - 164.6 566 5 413 53 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 320393.0 18.096500396728516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 320393.0 2715.2040901174882 0.0 - - - - - - - 127.1 640 10 415 54 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40227.[MT7]-EELDVSVR.2b3_1.heavy 545.797 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 417 54 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40227.[MT7]-EELDVSVR.2y5_1.heavy 545.797 / 575.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 419 54 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40227.[MT7]-EELDVSVR.2b4_1.heavy 545.797 / 631.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 421 54 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40227.[MT7]-EELDVSVR.2y6_1.heavy 545.797 / 688.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 423 55 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20110.[MT7]-MIFVGIK[MT7].2b3_1.heavy 548.346 / 536.302 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYCS cytochrome c, somatic 425 55 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20110.[MT7]-MIFVGIK[MT7].2y4_1.heavy 548.346 / 560.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYCS cytochrome c, somatic 427 55 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20110.[MT7]-MIFVGIK[MT7].2y5_1.heavy 548.346 / 707.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYCS cytochrome c, somatic 429 55 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20110.[MT7]-MIFVGIK[MT7].2y6_1.heavy 548.346 / 820.541 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYCS cytochrome c, somatic 431 56 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20213.[MT7]-IINEGAAILR.3b5_1.heavy 405.251 / 671.385 7110.0 34.507473945617676 41 15 10 6 10 2.7408238231632804 28.270088250802957 0.033100128173828125 3 0.9570570191742938 5.934029969066431 7110.0 37.761605985037406 0.0 - - - - - - - 200.125 14 8 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 433 56 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20213.[MT7]-IINEGAAILR.3y4_1.heavy 405.251 / 472.324 29040.0 34.507473945617676 41 15 10 6 10 2.7408238231632804 28.270088250802957 0.033100128173828125 3 0.9570570191742938 5.934029969066431 29040.0 77.29282333834826 0.0 - - - - - - - 236.45454545454547 58 11 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 435 56 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20213.[MT7]-IINEGAAILR.3b3_1.heavy 405.251 / 485.32 19126.0 34.507473945617676 41 15 10 6 10 2.7408238231632804 28.270088250802957 0.033100128173828125 3 0.9570570191742938 5.934029969066431 19126.0 120.12623710482528 0.0 - - - - - - - 225.25 38 16 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 437 56 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20213.[MT7]-IINEGAAILR.3y5_1.heavy 405.251 / 543.361 10314.0 34.507473945617676 41 15 10 6 10 2.7408238231632804 28.270088250802957 0.033100128173828125 3 0.9570570191742938 5.934029969066431 10314.0 39.108300297509146 0.0 - - - - - - - 221.64285714285714 20 14 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 439 57 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40222.[MT7]-ADNLIPGSR.2y8_1.heavy 543.805 / 871.463 6873.0 26.773733139038086 46 20 10 6 10 11.397121997349089 8.774144913361415 0.03440093994140625 3 0.9974744859843053 24.552517795743206 6873.0 77.47298357456496 0.0 - - - - - - - 179.08333333333334 13 12 ISYNA1 inositol-3-phosphate synthase 1 441 57 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40222.[MT7]-ADNLIPGSR.2y5_1.heavy 543.805 / 529.309 N/A 26.773733139038086 46 20 10 6 10 11.397121997349089 8.774144913361415 0.03440093994140625 3 0.9974744859843053 24.552517795743206 10309.0 4.99862921502922 0.0 - - - - - - - 608.5 20 2 ISYNA1 inositol-3-phosphate synthase 1 443 57 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40222.[MT7]-ADNLIPGSR.2b4_1.heavy 543.805 / 558.3 13531.0 26.773733139038086 46 20 10 6 10 11.397121997349089 8.774144913361415 0.03440093994140625 3 0.9974744859843053 24.552517795743206 13531.0 44.907278242368726 0.0 - - - - - - - 302.7692307692308 27 13 ISYNA1 inositol-3-phosphate synthase 1 445 57 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40222.[MT7]-ADNLIPGSR.2y7_1.heavy 543.805 / 756.436 9879.0 26.773733139038086 46 20 10 6 10 11.397121997349089 8.774144913361415 0.03440093994140625 3 0.9974744859843053 24.552517795743206 9879.0 37.68536137239917 0.0 - - - - - - - 243.46666666666667 19 15 ISYNA1 inositol-3-phosphate synthase 1 447 58 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20219.[MT7]-IYSSNSGPTR.2b8_1.heavy 613.318 / 950.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTEN phosphatase and tensin homolog 449 58 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20219.[MT7]-IYSSNSGPTR.2y8_1.heavy 613.318 / 805.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTEN phosphatase and tensin homolog 451 58 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20219.[MT7]-IYSSNSGPTR.2y9_1.heavy 613.318 / 968.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTEN phosphatase and tensin homolog 453 58 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20219.[MT7]-IYSSNSGPTR.2y7_1.heavy 613.318 / 718.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTEN phosphatase and tensin homolog 455 59 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40224.[MT7]-NNIDDVVR.2y5_1.heavy 544.794 / 603.31 1920.0 24.951499938964844 28 12 0 10 6 1.9370414982909525 40.536936789729495 0.0 5 0.8975585897030134 3.8224820349653807 1920.0 8.477599891709634 0.0 - - - - - - - 246.8181818181818 3 22 PTEN phosphatase and tensin homolog 457 59 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40224.[MT7]-NNIDDVVR.2b4_1.heavy 544.794 / 601.306 6198.0 24.951499938964844 28 12 0 10 6 1.9370414982909525 40.536936789729495 0.0 5 0.8975585897030134 3.8224820349653807 6198.0 19.005797364386588 1.0 - - - - - - - 665.125 16 8 PTEN phosphatase and tensin homolog 459 59 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40224.[MT7]-NNIDDVVR.2b6_1.heavy 544.794 / 815.402 2468.0 24.951499938964844 28 12 0 10 6 1.9370414982909525 40.536936789729495 0.0 5 0.8975585897030134 3.8224820349653807 2468.0 16.514682765151512 3.0 - - - - - - - 210.8421052631579 71 19 PTEN phosphatase and tensin homolog 461 59 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40224.[MT7]-NNIDDVVR.2y7_1.heavy 544.794 / 830.437 4991.0 24.951499938964844 28 12 0 10 6 1.9370414982909525 40.536936789729495 0.0 5 0.8975585897030134 3.8224820349653807 4991.0 31.198876441892637 0.0 - - - - - - - 224.66666666666666 9 21 PTEN phosphatase and tensin homolog 463 60 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20118.[MT7]-ALNIFVER.2y4_1.heavy 553.328 / 550.298 5110.0 36.7289981842041 44 18 10 6 10 3.9980995239088974 19.91703687945434 0.03639984130859375 3 0.9830436356592062 9.464123785142979 5110.0 9.441835968228995 0.0 - - - - - - - 647.6666666666666 10 9 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 465 60 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20118.[MT7]-ALNIFVER.2b4_1.heavy 553.328 / 556.357 5289.0 36.7289981842041 44 18 10 6 10 3.9980995239088974 19.91703687945434 0.03639984130859375 3 0.9830436356592062 9.464123785142979 5289.0 10.157015827230794 0.0 - - - - - - - 258.4117647058824 10 17 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 467 60 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20118.[MT7]-ALNIFVER.2y6_1.heavy 553.328 / 777.425 6634.0 36.7289981842041 44 18 10 6 10 3.9980995239088974 19.91703687945434 0.03639984130859375 3 0.9830436356592062 9.464123785142979 6634.0 31.32076920015917 0.0 - - - - - - - 297.0625 13 16 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 469 60 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20118.[MT7]-ALNIFVER.2y7_1.heavy 553.328 / 890.509 8069.0 36.7289981842041 44 18 10 6 10 3.9980995239088974 19.91703687945434 0.03639984130859375 3 0.9830436356592062 9.464123785142979 8069.0 33.14053571428572 0.0 - - - - - - - 244.16666666666666 16 18 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 471 61 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40455.[MT7]-RLEAFLTQK[MT7].2b8_1.heavy 697.424 / 1103.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K1;MAP2K2 mitogen-activated protein kinase kinase 1;mitogen-activated protein kinase kinase 2 473 61 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40455.[MT7]-RLEAFLTQK[MT7].2b3_1.heavy 697.424 / 543.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K1;MAP2K2 mitogen-activated protein kinase kinase 1;mitogen-activated protein kinase kinase 2 475 61 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40455.[MT7]-RLEAFLTQK[MT7].2y3_1.heavy 697.424 / 520.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K1;MAP2K2 mitogen-activated protein kinase kinase 1;mitogen-activated protein kinase kinase 2 477 61 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40455.[MT7]-RLEAFLTQK[MT7].2b5_1.heavy 697.424 / 761.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K1;MAP2K2 mitogen-activated protein kinase kinase 1;mitogen-activated protein kinase kinase 2 479 62 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40673.[MT7]-K[MT7]LEELELDEQQK[MT7].3b4_1.heavy 645.365 / 788.476 2940.0 28.89699935913086 43 13 10 10 10 1.7046522475214214 47.34360605781549 0.0 3 0.9235588816506627 4.4349910654969795 2940.0 22.926605504587155 0.0 - - - - - - - 207.1 5 10 MAP2K2 mitogen-activated protein kinase kinase 2 481 62 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40673.[MT7]-K[MT7]LEELELDEQQK[MT7].3b3_1.heavy 645.365 / 659.433 1525.0 28.89699935913086 43 13 10 10 10 1.7046522475214214 47.34360605781549 0.0 3 0.9235588816506627 4.4349910654969795 1525.0 4.383792048929664 2.0 - - - - - - - 239.8 5 15 MAP2K2 mitogen-activated protein kinase kinase 2 483 62 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40673.[MT7]-K[MT7]LEELELDEQQK[MT7].3y4_1.heavy 645.365 / 676.375 2831.0 28.89699935913086 43 13 10 10 10 1.7046522475214214 47.34360605781549 0.0 3 0.9235588816506627 4.4349910654969795 2831.0 19.652507645259938 0.0 - - - - - - - 245.25 5 12 MAP2K2 mitogen-activated protein kinase kinase 2 485 62 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40673.[MT7]-K[MT7]LEELELDEQQK[MT7].3y5_1.heavy 645.365 / 791.402 4029.0 28.89699935913086 43 13 10 10 10 1.7046522475214214 47.34360605781549 0.0 3 0.9235588816506627 4.4349910654969795 4029.0 40.10518348623853 0.0 - - - - - - - 227.9090909090909 8 11 MAP2K2 mitogen-activated protein kinase kinase 2 487 63 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40353.[MT7]-FLVVQPQNR.2y4_1.heavy 622.865 / 514.273 6696.0 31.487099647521973 41 16 10 5 10 6.932403744795149 14.425010960315175 0.04680061340332031 3 0.9618764712836559 6.3005192260092615 6696.0 8.465853658536586 0.0 - - - - - - - 262.8333333333333 13 6 PHKG1 phosphorylase kinase, gamma 1 (muscle) 489 63 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40353.[MT7]-FLVVQPQNR.2y8_1.heavy 622.865 / 953.553 4595.0 31.487099647521973 41 16 10 5 10 6.932403744795149 14.425010960315175 0.04680061340332031 3 0.9618764712836559 6.3005192260092615 4595.0 27.61824612534018 0.0 - - - - - - - 240.83333333333334 9 6 PHKG1 phosphorylase kinase, gamma 1 (muscle) 491 63 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40353.[MT7]-FLVVQPQNR.2y6_1.heavy 622.865 / 741.4 6827.0 31.487099647521973 41 16 10 5 10 6.932403744795149 14.425010960315175 0.04680061340332031 3 0.9618764712836559 6.3005192260092615 6827.0 12.627301148240413 1.0 - - - - - - - 225.0 13 7 PHKG1 phosphorylase kinase, gamma 1 (muscle) 493 63 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40353.[MT7]-FLVVQPQNR.2y7_1.heavy 622.865 / 840.469 5514.0 31.487099647521973 41 16 10 5 10 6.932403744795149 14.425010960315175 0.04680061340332031 3 0.9618764712836559 6.3005192260092615 5514.0 40.862304182509504 0.0 - - - - - - - 240.83333333333334 11 6 PHKG1 phosphorylase kinase, gamma 1 (muscle) 495 64 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40453.[MT7]-LFEVGGSPANTR.2b3_1.heavy 696.374 / 534.304 5569.0 32.0447998046875 43 13 10 10 10 1.24503332681491 56.01198470986603 0.0 3 0.917181247244439 4.258475362848065 5569.0 29.000830188679245 0.0 - - - - - - - 189.57142857142858 11 7 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 497 64 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40453.[MT7]-LFEVGGSPANTR.2y8_1.heavy 696.374 / 759.374 4243.0 32.0447998046875 43 13 10 10 10 1.24503332681491 56.01198470986603 0.0 3 0.917181247244439 4.258475362848065 4243.0 15.267014548559374 1.0 - - - - - - - 265.3333333333333 8 3 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 499 64 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40453.[MT7]-LFEVGGSPANTR.2y9_1.heavy 696.374 / 858.443 1989.0 32.0447998046875 43 13 10 10 10 1.24503332681491 56.01198470986603 0.0 3 0.917181247244439 4.258475362848065 1989.0 6.780264150943396 1.0 - - - - - - - 265.0 3 4 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 501 64 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40453.[MT7]-LFEVGGSPANTR.2y11_1.heavy 696.374 / 1134.55 2917.0 32.0447998046875 43 13 10 10 10 1.24503332681491 56.01198470986603 0.0 3 0.917181247244439 4.258475362848065 2917.0 24.79455510635886 0.0 - - - - - - - 166.125 5 8 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 503 65 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46281.[MT7]-K[MT7]RPSFK[MT7].2b3_1.heavy 597.888 / 670.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 505 65 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46281.[MT7]-K[MT7]RPSFK[MT7].2y4_1.heavy 597.888 / 622.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 507 65 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46281.[MT7]-K[MT7]RPSFK[MT7].2y5_1.heavy 597.888 / 778.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 509 65 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46281.[MT7]-K[MT7]RPSFK[MT7].2y3_1.heavy 597.888 / 525.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 511 66 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40351.[MT7]-LSFSQVFK[MT7].2y5_1.heavy 622.368 / 752.442 3270.0 38.10940170288086 46 16 10 10 10 7.527191136210939 13.285168157738362 0.0 3 0.9662483374423194 6.698624623901038 3270.0 11.709443894027514 0.0 - - - - - - - 188.92307692307693 6 13 ANAPC5 anaphase promoting complex subunit 5 513 66 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40351.[MT7]-LSFSQVFK[MT7].2y3_1.heavy 622.368 / 537.352 3179.0 38.10940170288086 46 16 10 10 10 7.527191136210939 13.285168157738362 0.0 3 0.9662483374423194 6.698624623901038 3179.0 12.723391715318321 0.0 - - - - - - - 258.7692307692308 6 13 ANAPC5 anaphase promoting complex subunit 5 515 66 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40351.[MT7]-LSFSQVFK[MT7].2b5_1.heavy 622.368 / 707.385 1817.0 38.10940170288086 46 16 10 10 10 7.527191136210939 13.285168157738362 0.0 3 0.9662483374423194 6.698624623901038 1817.0 17.17164835164835 0.0 - - - - - - - 206.63636363636363 3 11 ANAPC5 anaphase promoting complex subunit 5 517 66 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40351.[MT7]-LSFSQVFK[MT7].2y7_1.heavy 622.368 / 986.543 4542.0 38.10940170288086 46 16 10 10 10 7.527191136210939 13.285168157738362 0.0 3 0.9662483374423194 6.698624623901038 4542.0 65.88395604395605 0.0 - - - - - - - 159.16666666666666 9 12 ANAPC5 anaphase promoting complex subunit 5 519 67 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535557.[MT7]-LILTGAESK[MT7].3b6_1.heavy 407.255 / 713.468 6560.0 30.238000869750977 47 17 10 10 10 2.1881644206165243 31.89117400988469 0.0 3 0.9713475086703722 7.273420831392084 6560.0 11.78402564789725 1.0 - - - - - - - 265.42857142857144 18 7 ANAPC5 anaphase promoting complex subunit 5 521 67 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535557.[MT7]-LILTGAESK[MT7].3y3_1.heavy 407.255 / 507.289 28590.0 30.238000869750977 47 17 10 10 10 2.1881644206165243 31.89117400988469 0.0 3 0.9713475086703722 7.273420831392084 28590.0 55.48786165369364 0.0 - - - - - - - 300.85714285714283 57 7 ANAPC5 anaphase promoting complex subunit 5 523 67 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535557.[MT7]-LILTGAESK[MT7].3b5_1.heavy 407.255 / 642.431 18688.0 30.238000869750977 47 17 10 10 10 2.1881644206165243 31.89117400988469 0.0 3 0.9713475086703722 7.273420831392084 18688.0 60.56440458493288 0.0 - - - - - - - 336.0 37 7 ANAPC5 anaphase promoting complex subunit 5 525 67 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535557.[MT7]-LILTGAESK[MT7].3b3_1.heavy 407.255 / 484.362 21288.0 30.238000869750977 47 17 10 10 10 2.1881644206165243 31.89117400988469 0.0 3 0.9713475086703722 7.273420831392084 21288.0 62.25388091154129 0.0 - - - - - - - 161.1 42 10 ANAPC5 anaphase promoting complex subunit 5 527 68 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 1302380.0 36.91809844970703 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1302380.0 275.377229916122 0.0 - - - - - - - 209.3 2604 10 529 68 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 541827.0 36.91809844970703 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 541827.0 265.6800407537205 0.0 - - - - - - - 221.0 1083 7 531 68 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 860266.0 36.91809844970703 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 860266.0 419.92872859798655 0.0 - - - - - - - 227.5 1720 6 533 69 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40777.[MT7]-FDDLQFFENC[CAM]GGGSFGSVYR.2b3_1.heavy 1223.55 / 522.232 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 535 69 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40777.[MT7]-FDDLQFFENC[CAM]GGGSFGSVYR.2b4_1.heavy 1223.55 / 635.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 537 69 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40777.[MT7]-FDDLQFFENC[CAM]GGGSFGSVYR.2b5_1.heavy 1223.55 / 763.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 539 69 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40777.[MT7]-FDDLQFFENC[CAM]GGGSFGSVYR.2y11_1.heavy 1223.55 / 1146.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 541 70 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20323.[MT7]-RLEAFLTQK[MT7].3y3_1.heavy 465.285 / 520.321 98041.0 31.60059928894043 40 10 10 10 10 1.4004797022110127 57.662308602798674 0.0 3 0.8356488900630159 3.001512669585532 98041.0 150.01256688963213 0.0 - - - - - - - 372.4 196 5 MAP2K1;MAP2K2 mitogen-activated protein kinase kinase 1;mitogen-activated protein kinase kinase 2 543 70 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20323.[MT7]-RLEAFLTQK[MT7].3b4_1.heavy 465.285 / 614.374 27366.0 31.60059928894043 40 10 10 10 10 1.4004797022110127 57.662308602798674 0.0 3 0.8356488900630159 3.001512669585532 27366.0 58.00360287578891 0.0 - - - - - - - 280.77777777777777 54 9 MAP2K1;MAP2K2 mitogen-activated protein kinase kinase 1;mitogen-activated protein kinase kinase 2 545 70 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20323.[MT7]-RLEAFLTQK[MT7].3b5_1.heavy 465.285 / 761.443 51013.0 31.60059928894043 40 10 10 10 10 1.4004797022110127 57.662308602798674 0.0 3 0.8356488900630159 3.001512669585532 51013.0 469.21731829573935 0.0 - - - - - - - 229.72727272727272 102 11 MAP2K1;MAP2K2 mitogen-activated protein kinase kinase 1;mitogen-activated protein kinase kinase 2 547 70 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20323.[MT7]-RLEAFLTQK[MT7].3b3_1.heavy 465.285 / 543.337 7174.0 31.60059928894043 40 10 10 10 10 1.4004797022110127 57.662308602798674 0.0 3 0.8356488900630159 3.001512669585532 7174.0 14.377635623595163 0.0 - - - - - - - 228.0 14 7 MAP2K1;MAP2K2 mitogen-activated protein kinase kinase 1;mitogen-activated protein kinase kinase 2 549 71 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20325.[MT7]-EAEILSVLSHR.3y6_1.heavy 466.6 / 698.394 82366.0 37.180198669433594 43 13 10 10 10 1.3103964425455437 52.168788272377896 0.0 3 0.9217118634396972 4.38166814848373 82366.0 543.4172802254097 0.0 - - - - - - - 199.36363636363637 164 11 ZAK sterile alpha motif and leucine zipper containing kinase AZK 551 71 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20325.[MT7]-EAEILSVLSHR.3b4_1.heavy 466.6 / 587.316 124327.0 37.180198669433594 43 13 10 10 10 1.3103964425455437 52.168788272377896 0.0 3 0.9217118634396972 4.38166814848373 124327.0 377.72618520159506 0.0 - - - - - - - 280.3333333333333 248 15 ZAK sterile alpha motif and leucine zipper containing kinase AZK 553 71 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20325.[MT7]-EAEILSVLSHR.3y4_1.heavy 466.6 / 512.294 129446.0 37.180198669433594 43 13 10 10 10 1.3103964425455437 52.168788272377896 0.0 3 0.9217118634396972 4.38166814848373 129446.0 351.59162438845976 0.0 - - - - - - - 248.14285714285714 258 7 ZAK sterile alpha motif and leucine zipper containing kinase AZK 555 71 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20325.[MT7]-EAEILSVLSHR.3b3_1.heavy 466.6 / 474.232 98547.0 37.180198669433594 43 13 10 10 10 1.3103964425455437 52.168788272377896 0.0 3 0.9217118634396972 4.38166814848373 98547.0 289.6231156511403 0.0 - - - - - - - 246.07692307692307 197 13 ZAK sterile alpha motif and leucine zipper containing kinase AZK 557 72 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40354.[MT7]-FLVVQPQNR.3b6_1.heavy 415.579 / 828.51 N/A 31.463699340820312 50 20 10 10 10 9.393271694298697 10.645917977726079 0.0 3 0.9962525325711091 20.15383588272619 397.0 -0.2105303030303034 0.0 - - - - - - - 0.0 0 0 PHKG1 phosphorylase kinase, gamma 1 (muscle) 559 72 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40354.[MT7]-FLVVQPQNR.3b4_1.heavy 415.579 / 603.399 9133.0 31.463699340820312 50 20 10 10 10 9.393271694298697 10.645917977726079 0.0 3 0.9962525325711091 20.15383588272619 9133.0 9.951142972300978 0.0 - - - - - - - 248.125 18 8 PHKG1 phosphorylase kinase, gamma 1 (muscle) 561 72 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40354.[MT7]-FLVVQPQNR.3y4_1.heavy 415.579 / 514.273 35737.0 31.463699340820312 50 20 10 10 10 9.393271694298697 10.645917977726079 0.0 3 0.9962525325711091 20.15383588272619 35737.0 97.14765421552886 0.0 - - - - - - - 238.2 71 5 PHKG1 phosphorylase kinase, gamma 1 (muscle) 563 72 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40354.[MT7]-FLVVQPQNR.3b3_1.heavy 415.579 / 504.33 30442.0 31.463699340820312 50 20 10 10 10 9.393271694298697 10.645917977726079 0.0 3 0.9962525325711091 20.15383588272619 30442.0 121.28544818769169 0.0 - - - - - - - 238.2 60 5 PHKG1 phosphorylase kinase, gamma 1 (muscle) 565 73 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20125.[MT7]-LIDAYAFR.2y5_1.heavy 556.815 / 627.325 12152.0 36.85469913482666 44 18 10 6 10 5.343583168457557 18.714034543391477 0.035602569580078125 3 0.9894899495326915 12.02759684779613 12152.0 33.10735699238373 0.0 - - - - - - - 673.5714285714286 24 7 PHKG1 phosphorylase kinase, gamma 1 (muscle) 567 73 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20125.[MT7]-LIDAYAFR.2y6_1.heavy 556.815 / 742.352 6620.0 36.85469913482666 44 18 10 6 10 5.343583168457557 18.714034543391477 0.035602569580078125 3 0.9894899495326915 12.02759684779613 6620.0 16.923329894108065 0.0 - - - - - - - 759.375 13 8 PHKG1 phosphorylase kinase, gamma 1 (muscle) 569 73 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20125.[MT7]-LIDAYAFR.2b5_1.heavy 556.815 / 720.405 1632.0 36.85469913482666 44 18 10 6 10 5.343583168457557 18.714034543391477 0.035602569580078125 3 0.9894899495326915 12.02759684779613 1632.0 1.4410596026490068 2.0 - - - - - - - 314.6470588235294 3 17 PHKG1 phosphorylase kinase, gamma 1 (muscle) 571 73 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20125.[MT7]-LIDAYAFR.2y7_1.heavy 556.815 / 855.436 10066.0 36.85469913482666 44 18 10 6 10 5.343583168457557 18.714034543391477 0.035602569580078125 3 0.9894899495326915 12.02759684779613 10066.0 26.01034721694271 0.0 - - - - - - - 214.27272727272728 20 11 PHKG1 phosphorylase kinase, gamma 1 (muscle) 573 74 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20696.[MT7]-YHLADSLVTGITALNSIEGVYRK[MT7].4y9_1.heavy 702.893 / 1209.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 575 74 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20696.[MT7]-YHLADSLVTGITALNSIEGVYRK[MT7].4b5_1.heavy 702.893 / 744.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 577 74 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20696.[MT7]-YHLADSLVTGITALNSIEGVYRK[MT7].4y6_1.heavy 702.893 / 895.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 579 74 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20696.[MT7]-YHLADSLVTGITALNSIEGVYRK[MT7].4b3_1.heavy 702.893 / 558.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 581 75 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40069.[MT7]-VFSVLR.2y5_1.heavy 432.775 / 621.372 19161.0 34.454001108805336 46 20 10 6 10 33.67485052063165 2.9695751712018073 0.033901214599609375 3 0.9998857566372714 115.46297574658902 19161.0 171.7866536150417 0.0 - - - - - - - 220.45454545454547 38 11 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 583 75 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40069.[MT7]-VFSVLR.2b4_1.heavy 432.775 / 577.347 2737.0 34.454001108805336 46 20 10 6 10 33.67485052063165 2.9695751712018073 0.033901214599609375 3 0.9998857566372714 115.46297574658902 2737.0 5.29469995964059 0.0 - - - - - - - 263.2857142857143 5 14 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 585 75 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40069.[MT7]-VFSVLR.2b5_1.heavy 432.775 / 690.431 1369.0 34.454001108805336 46 20 10 6 10 33.67485052063165 2.9695751712018073 0.033901214599609375 3 0.9998857566372714 115.46297574658902 1369.0 3.3382728751760373 0.0 - - - - - - - 225.78571428571428 2 14 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 587 76 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40156.[MT7]-IQDSLGGR.2b3_1.heavy 495.278 / 501.279 11060.0 24.07472562789917 42 15 10 7 10 2.7062271940247107 36.951812553209784 0.027700424194335938 3 0.950674279622532 5.533808521194446 11060.0 28.989344435013617 0.0 - - - - - - - 668.5555555555555 22 9 ACSL5 acyl-CoA synthetase long-chain family member 5 589 76 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40156.[MT7]-IQDSLGGR.2b4_1.heavy 495.278 / 588.311 2109.0 24.07472562789917 42 15 10 7 10 2.7062271940247107 36.951812553209784 0.027700424194335938 3 0.950674279622532 5.533808521194446 2109.0 9.402193900305326 0.0 - - - - - - - 266.6363636363636 4 22 ACSL5 acyl-CoA synthetase long-chain family member 5 591 76 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40156.[MT7]-IQDSLGGR.2y6_1.heavy 495.278 / 604.305 4424.0 24.07472562789917 42 15 10 7 10 2.7062271940247107 36.951812553209784 0.027700424194335938 3 0.950674279622532 5.533808521194446 4424.0 4.556157121780034 0.0 - - - - - - - 681.5833333333334 8 12 ACSL5 acyl-CoA synthetase long-chain family member 5 593 76 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40156.[MT7]-IQDSLGGR.2y7_1.heavy 495.278 / 732.364 13941.0 24.07472562789917 42 15 10 7 10 2.7062271940247107 36.951812553209784 0.027700424194335938 3 0.950674279622532 5.533808521194446 13941.0 26.375020280210638 0.0 - - - - - - - 703.0 27 9 ACSL5 acyl-CoA synthetase long-chain family member 5 595 77 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19988.[MT7]-LSWPTR.2b3_1.heavy 452.262 / 531.305 6775.0 31.72142505645752 45 20 10 5 10 19.026037668116313 5.255955115004278 0.044300079345703125 3 0.9986405853909189 33.46857273065618 6775.0 12.777381107245816 0.0 - - - - - - - 683.0 13 7 ISYNA1 inositol-3-phosphate synthase 1 597 77 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19988.[MT7]-LSWPTR.2y4_1.heavy 452.262 / 559.299 6510.0 31.72142505645752 45 20 10 5 10 19.026037668116313 5.255955115004278 0.044300079345703125 3 0.9986405853909189 33.46857273065618 6510.0 9.816371236533998 0.0 - - - - - - - 266.0 13 6 ISYNA1 inositol-3-phosphate synthase 1 599 77 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19988.[MT7]-LSWPTR.2y5_1.heavy 452.262 / 646.331 43839.0 31.72142505645752 45 20 10 5 10 19.026037668116313 5.255955115004278 0.044300079345703125 3 0.9986405853909189 33.46857273065618 43839.0 46.04197585542924 1.0 - - - - - - - 133.0 87 1 ISYNA1 inositol-3-phosphate synthase 1 601 77 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19988.[MT7]-LSWPTR.2b4_1.heavy 452.262 / 628.357 1196.0 31.72142505645752 45 20 10 5 10 19.026037668116313 5.255955115004278 0.044300079345703125 3 0.9986405853909189 33.46857273065618 1196.0 1.2073677920428194 4.0 - - - - - - - 319.2 3 10 ISYNA1 inositol-3-phosphate synthase 1 603 78 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19964.[MT7]-GFLNK[MT7].2b3_1.heavy 433.771 / 462.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 605 78 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19964.[MT7]-GFLNK[MT7].2y4_1.heavy 433.771 / 665.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 607 78 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19964.[MT7]-GFLNK[MT7].2b4_1.heavy 433.771 / 576.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 609 78 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19964.[MT7]-GFLNK[MT7].2y3_1.heavy 433.771 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 611 79 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20064.[MT7]-TAC[CAM]EGAK[MT7].2y4_1.heavy 512.77 / 548.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLK nemo-like kinase 613 79 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20064.[MT7]-TAC[CAM]EGAK[MT7].2y5_1.heavy 512.77 / 708.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLK nemo-like kinase 615 79 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20064.[MT7]-TAC[CAM]EGAK[MT7].2b4_1.heavy 512.77 / 606.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLK nemo-like kinase 617 79 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20064.[MT7]-TAC[CAM]EGAK[MT7].2y6_1.heavy 512.77 / 779.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLK nemo-like kinase 619 80 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40256.[MT7]-VEELDESR.2b3_1.heavy 560.784 / 502.263 2705.0 23.027100086212158 43 17 10 6 10 4.880616727147288 20.489213882289388 0.03320121765136719 3 0.9779093399922474 8.288105652084298 2705.0 4.1239316239316235 1.0 - - - - - - - 233.61904761904762 5 21 NLK nemo-like kinase 621 80 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40256.[MT7]-VEELDESR.2b6_1.heavy 560.784 / 859.417 4959.0 23.027100086212158 43 17 10 6 10 4.880616727147288 20.489213882289388 0.03320121765136719 3 0.9779093399922474 8.288105652084298 4959.0 45.578866445182726 0.0 - - - - - - - 114.76470588235294 9 17 NLK nemo-like kinase 623 80 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40256.[MT7]-VEELDESR.2b5_1.heavy 560.784 / 730.374 6412.0 23.027100086212158 43 17 10 6 10 4.880616727147288 20.489213882289388 0.03320121765136719 3 0.9779093399922474 8.288105652084298 6412.0 70.93008425720622 0.0 - - - - - - - 211.0 12 14 NLK nemo-like kinase 625 80 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40256.[MT7]-VEELDESR.2y7_1.heavy 560.784 / 877.39 8516.0 23.027100086212158 43 17 10 6 10 4.880616727147288 20.489213882289388 0.03320121765136719 3 0.9779093399922474 8.288105652084298 8516.0 47.4667866962306 0.0 - - - - - - - 133.38888888888889 17 18 NLK nemo-like kinase 627 81 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20593.[MT7]-VFLLGEEVAQYDGAYK[MT7].4y4_1.heavy 523.282 / 582.337 17929.0 42.348201751708984 46 16 10 10 10 1.9284583313798136 40.66105747981604 0.0 3 0.9683096264239422 6.9142496315206925 17929.0 65.64514521926671 0.0 - - - - - - - 278.6666666666667 35 12 PDHB pyruvate dehydrogenase (lipoamide) beta 629 81 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20593.[MT7]-VFLLGEEVAQYDGAYK[MT7].4b7_1.heavy 523.282 / 932.521 7894.0 42.348201751708984 46 16 10 10 10 1.9284583313798136 40.66105747981604 0.0 3 0.9683096264239422 6.9142496315206925 7894.0 140.79597014925372 0.0 - - - - - - - 147.3 15 10 PDHB pyruvate dehydrogenase (lipoamide) beta 631 81 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20593.[MT7]-VFLLGEEVAQYDGAYK[MT7].4b6_1.heavy 523.282 / 803.478 5686.0 42.348201751708984 46 16 10 10 10 1.9284583313798136 40.66105747981604 0.0 3 0.9683096264239422 6.9142496315206925 5686.0 44.17842613280901 0.0 - - - - - - - 176.45454545454547 11 11 PDHB pyruvate dehydrogenase (lipoamide) beta 633 81 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20593.[MT7]-VFLLGEEVAQYDGAYK[MT7].4b3_1.heavy 523.282 / 504.33 26559.0 42.348201751708984 46 16 10 10 10 1.9284583313798136 40.66105747981604 0.0 3 0.9683096264239422 6.9142496315206925 26559.0 113.02227682623771 0.0 - - - - - - - 221.46153846153845 53 13 PDHB pyruvate dehydrogenase (lipoamide) beta 635 82 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20594.[MT7]-SFAELLHQC[CAM]WEADAK[MT7].3y6_1.heavy 698.35 / 863.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 637 82 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20594.[MT7]-SFAELLHQC[CAM]WEADAK[MT7].3b4_1.heavy 698.35 / 579.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 639 82 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20594.[MT7]-SFAELLHQC[CAM]WEADAK[MT7].3b5_1.heavy 698.35 / 692.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 641 82 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20594.[MT7]-SFAELLHQC[CAM]WEADAK[MT7].3y4_1.heavy 698.35 / 548.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 643 83 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20121.[MT7]-DIIFAIK[MT7].2y4_1.heavy 554.354 / 622.404 15668.0 38.399898529052734 48 18 10 10 10 6.144355084601171 16.275101068071 0.0 3 0.9896279403088367 12.107480348562461 15668.0 50.898870056497174 0.0 - - - - - - - 233.54545454545453 31 11 PDHB pyruvate dehydrogenase (lipoamide) beta 645 83 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20121.[MT7]-DIIFAIK[MT7].2y5_1.heavy 554.354 / 735.489 5931.0 38.399898529052734 48 18 10 10 10 6.144355084601171 16.275101068071 0.0 3 0.9896279403088367 12.107480348562461 5931.0 21.209931514710945 0.0 - - - - - - - 192.0 11 12 PDHB pyruvate dehydrogenase (lipoamide) beta 647 83 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20121.[MT7]-DIIFAIK[MT7].2b4_1.heavy 554.354 / 633.373 5842.0 38.399898529052734 48 18 10 10 10 6.144355084601171 16.275101068071 0.0 3 0.9896279403088367 12.107480348562461 5842.0 18.733500146663097 0.0 - - - - - - - 231.69230769230768 11 13 PDHB pyruvate dehydrogenase (lipoamide) beta 649 83 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20121.[MT7]-DIIFAIK[MT7].2b5_1.heavy 554.354 / 704.41 4957.0 38.399898529052734 48 18 10 10 10 6.144355084601171 16.275101068071 0.0 3 0.9896279403088367 12.107480348562461 4957.0 43.12870056497175 0.0 - - - - - - - 161.27272727272728 9 11 PDHB pyruvate dehydrogenase (lipoamide) beta 651 84 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535049.[MT7]-NDETK[MT7].2y4_1.heavy 447.742 / 636.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 653 84 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535049.[MT7]-NDETK[MT7].2b3_1.heavy 447.742 / 503.222 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 655 84 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535049.[MT7]-NDETK[MT7].2y3_1.heavy 447.742 / 521.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 657 85 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20596.[MT7]-FC[CAM]EVIPGLNDTAENLLR.3y6_1.heavy 702.365 / 715.41 6939.0 43.37337398529053 40 14 10 6 10 1.1108572856355152 59.526785068661155 0.037502288818359375 3 0.9395932889832622 4.995845057015194 6939.0 42.48730263354706 0.0 - - - - - - - 205.25 13 20 ISYNA1 inositol-3-phosphate synthase 1 659 85 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20596.[MT7]-FC[CAM]EVIPGLNDTAENLLR.3b4_1.heavy 702.365 / 680.319 24287.0 43.37337398529053 40 14 10 6 10 1.1108572856355152 59.526785068661155 0.037502288818359375 3 0.9395932889832622 4.995845057015194 24287.0 76.21520106406561 0.0 - - - - - - - 223.07142857142858 48 14 ISYNA1 inositol-3-phosphate synthase 1 661 85 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20596.[MT7]-FC[CAM]EVIPGLNDTAENLLR.3b5_1.heavy 702.365 / 793.404 14745.0 43.37337398529053 40 14 10 6 10 1.1108572856355152 59.526785068661155 0.037502288818359375 3 0.9395932889832622 4.995845057015194 14745.0 95.40882352941176 0.0 - - - - - - - 204.05882352941177 29 17 ISYNA1 inositol-3-phosphate synthase 1 663 85 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20596.[MT7]-FC[CAM]EVIPGLNDTAENLLR.3b3_1.heavy 702.365 / 581.251 13820.0 43.37337398529053 40 14 10 6 10 1.1108572856355152 59.526785068661155 0.037502288818359375 3 0.9395932889832622 4.995845057015194 13820.0 46.14991521529342 0.0 - - - - - - - 219.73333333333332 27 15 ISYNA1 inositol-3-phosphate synthase 1 665 86 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46087.[MT7]-DDDFER.2y4_1.heavy 470.71 / 566.257 3507.0 19.812700271606445 45 15 10 10 10 3.311560198028306 30.197246620955205 0.0 3 0.9548382966982756 5.7853422074073535 3507.0 18.102039094360848 0.0 - - - - - - - 193.625 7 16 MAP2K2 mitogen-activated protein kinase kinase 2 667 86 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46087.[MT7]-DDDFER.2b3_1.heavy 470.71 / 490.19 9337.0 19.812700271606445 45 15 10 10 10 3.311560198028306 30.197246620955205 0.0 3 0.9548382966982756 5.7853422074073535 9337.0 28.72572549461276 0.0 - - - - - - - 240.78571428571428 18 14 MAP2K2 mitogen-activated protein kinase kinase 2 669 86 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46087.[MT7]-DDDFER.2y5_1.heavy 470.71 / 681.284 3780.0 19.812700271606445 45 15 10 10 10 3.311560198028306 30.197246620955205 0.0 3 0.9548382966982756 5.7853422074073535 3780.0 24.151162945862634 0.0 - - - - - - - 156.05263157894737 7 19 MAP2K2 mitogen-activated protein kinase kinase 2 671 86 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46087.[MT7]-DDDFER.2b4_1.heavy 470.71 / 637.259 2824.0 19.812700271606445 45 15 10 10 10 3.311560198028306 30.197246620955205 0.0 3 0.9548382966982756 5.7853422074073535 2824.0 26.688351648351645 0.0 - - - - - - - 225.11111111111111 5 18 MAP2K2 mitogen-activated protein kinase kinase 2 673 87 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535698.[MT7]-IC[CAM]SFEEAK[MT7].2y4_1.heavy 636.331 / 620.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 675 87 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535698.[MT7]-IC[CAM]SFEEAK[MT7].2y5_1.heavy 636.331 / 767.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 677 87 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535698.[MT7]-IC[CAM]SFEEAK[MT7].2y6_1.heavy 636.331 / 854.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 679 87 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535698.[MT7]-IC[CAM]SFEEAK[MT7].2y7_1.heavy 636.331 / 1014.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 681 88 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535945.[MT7]-TLK[MT7]PTLFPAVPR.3y6_1.heavy 543.343 / 686.398 22984.0 34.317800521850586 39 16 10 3 10 1.4667089742819244 52.044431967898916 0.07360076904296875 3 0.9677269320893336 6.8512098450781584 22984.0 39.22402308011623 0.0 - - - - - - - 257.5 45 10 ACSL5 acyl-CoA synthetase long-chain family member 5 683 88 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535945.[MT7]-TLK[MT7]PTLFPAVPR.3b3_1.heavy 543.343 / 631.438 6184.0 34.317800521850586 39 16 10 3 10 1.4667089742819244 52.044431967898916 0.07360076904296875 3 0.9677269320893336 6.8512098450781584 6184.0 2.3075488019874504 1.0 - - - - - - - 709.8888888888889 12 9 ACSL5 acyl-CoA synthetase long-chain family member 5 685 88 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535945.[MT7]-TLK[MT7]PTLFPAVPR.3y5_1.heavy 543.343 / 539.33 52667.0 34.317800521850586 39 16 10 3 10 1.4667089742819244 52.044431967898916 0.07360076904296875 3 0.9677269320893336 6.8512098450781584 52667.0 134.24030940192495 0.0 - - - - - - - 240.33333333333334 105 3 ACSL5 acyl-CoA synthetase long-chain family member 5 687 88 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535945.[MT7]-TLK[MT7]PTLFPAVPR.3y9_1.heavy 543.343 / 997.583 11234.0 34.317800521850586 39 16 10 3 10 1.4667089742819244 52.044431967898916 0.07360076904296875 3 0.9677269320893336 6.8512098450781584 11234.0 64.5039664855499 0.0 - - - - - - - 250.14285714285714 22 7 ACSL5 acyl-CoA synthetase long-chain family member 5 689 89 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20080.[MT7]-DLEIFK[MT7].2y4_1.heavy 526.815 / 680.41 5236.0 34.663299560546875 48 18 10 10 10 4.278086095814571 18.587381112336608 0.0 3 0.9884879212465885 11.491268588401775 5236.0 7.1126130633418025 0.0 - - - - - - - 236.8235294117647 10 17 PRKX protein kinase, X-linked 691 89 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20080.[MT7]-DLEIFK[MT7].2b3_1.heavy 526.815 / 502.263 9968.0 34.663299560546875 48 18 10 10 10 4.278086095814571 18.587381112336608 0.0 3 0.9884879212465885 11.491268588401775 9968.0 14.520291732705498 0.0 - - - - - - - 1118.7777777777778 19 9 PRKX protein kinase, X-linked 693 89 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20080.[MT7]-DLEIFK[MT7].2y5_1.heavy 526.815 / 793.494 6746.0 34.663299560546875 48 18 10 10 10 4.278086095814571 18.587381112336608 0.0 3 0.9884879212465885 11.491268588401775 6746.0 28.970341314314823 1.0 - - - - - - - 247.84615384615384 13 13 PRKX protein kinase, X-linked 695 89 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20080.[MT7]-DLEIFK[MT7].2y3_1.heavy 526.815 / 551.367 6142.0 34.663299560546875 48 18 10 10 10 4.278086095814571 18.587381112336608 0.0 3 0.9884879212465885 11.491268588401775 6142.0 10.036035725475529 0.0 - - - - - - - 677.3636363636364 12 11 PRKX protein kinase, X-linked 697 90 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40448.[MT7]-NVVIAADGVLK[MT7].2y6_1.heavy 693.932 / 746.453 1873.0 33.16389846801758 44 14 10 10 10 6.278314681035369 15.927841320548273 0.0 3 0.9394323300463916 4.98913395386485 1873.0 11.806303418803418 0.0 - - - - - - - 260.0 3 9 ZAK sterile alpha motif and leucine zipper containing kinase AZK 699 90 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40448.[MT7]-NVVIAADGVLK[MT7].2y4_1.heavy 693.932 / 560.389 1873.0 33.16389846801758 44 14 10 10 10 6.278314681035369 15.927841320548273 0.0 3 0.9394323300463916 4.98913395386485 1873.0 12.033091168091168 0.0 - - - - - - - 210.6 3 10 ZAK sterile alpha motif and leucine zipper containing kinase AZK 701 90 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40448.[MT7]-NVVIAADGVLK[MT7].2y8_1.heavy 693.932 / 930.574 2224.0 33.16389846801758 44 14 10 10 10 6.278314681035369 15.927841320548273 0.0 3 0.9394323300463916 4.98913395386485 2224.0 20.90940170940171 0.0 - - - - - - - 217.28571428571428 4 7 ZAK sterile alpha motif and leucine zipper containing kinase AZK 703 90 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40448.[MT7]-NVVIAADGVLK[MT7].2y7_1.heavy 693.932 / 817.49 2458.0 33.16389846801758 44 14 10 10 10 6.278314681035369 15.927841320548273 0.0 3 0.9394323300463916 4.98913395386485 2458.0 16.4917094017094 0.0 - - - - - - - 204.75 4 8 ZAK sterile alpha motif and leucine zipper containing kinase AZK 705 91 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19960.[MT7]-EAIDK[MT7].2b3_1.heavy 432.257 / 458.273 1518.0 17.793899536132812 43 13 10 10 10 1.374753108962076 48.24962861945723 0.0 3 0.9165158319485015 4.24122758560673 1518.0 9.842076124567473 1.0 - - - - - - - 245.88 3 25 ENO2;MYO3A;CDC27 enolase 2 (gamma, neuronal);myosin IIIA;cell division cycle 27 homolog (S. cerevisiae) 707 91 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19960.[MT7]-EAIDK[MT7].2y4_1.heavy 432.257 / 590.363 6938.0 17.793899536132812 43 13 10 10 10 1.374753108962076 48.24962861945723 0.0 3 0.9165158319485015 4.24122758560673 6938.0 20.495364455029595 0.0 - - - - - - - 312.2857142857143 13 14 ENO2;MYO3A;CDC27 enolase 2 (gamma, neuronal);myosin IIIA;cell division cycle 27 homolog (S. cerevisiae) 709 91 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19960.[MT7]-EAIDK[MT7].2b4_1.heavy 432.257 / 573.3 7083.0 17.793899536132812 43 13 10 10 10 1.374753108962076 48.24962861945723 0.0 3 0.9165158319485015 4.24122758560673 7083.0 24.28746249934668 0.0 - - - - - - - 280.1 14 20 ENO2;MYO3A;CDC27 enolase 2 (gamma, neuronal);myosin IIIA;cell division cycle 27 homolog (S. cerevisiae) 711 91 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19960.[MT7]-EAIDK[MT7].2y3_1.heavy 432.257 / 519.326 2674.0 17.793899536132812 43 13 10 10 10 1.374753108962076 48.24962861945723 0.0 3 0.9165158319485015 4.24122758560673 2674.0 8.638547086301887 0.0 - - - - - - - 297.1304347826087 5 23 ENO2;MYO3A;CDC27 enolase 2 (gamma, neuronal);myosin IIIA;cell division cycle 27 homolog (S. cerevisiae) 713 92 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40348.[MT7]-K[MT7]YIPGTK[MT7].3y3_1.heavy 413.599 / 449.284 18249.0 20.913650512695312 34 10 10 6 8 0.6279171942059799 87.23761312189598 0.035400390625 4 0.8467297569667855 3.111169044063985 18249.0 71.39608845021267 1.0 - - - - - - - 685.1428571428571 63 7 CYCS cytochrome c, somatic 715 92 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40348.[MT7]-K[MT7]YIPGTK[MT7].3y4_2.heavy 413.599 / 273.672 16469.0 20.913650512695312 34 10 10 6 8 0.6279171942059799 87.23761312189598 0.035400390625 4 0.8467297569667855 3.111169044063985 16469.0 71.24915985058672 0.0 - - - - - - - 273.23809523809524 32 21 CYCS cytochrome c, somatic 717 92 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40348.[MT7]-K[MT7]YIPGTK[MT7].3b3_2.heavy 413.599 / 347.23 51829.0 20.913650512695312 34 10 10 6 8 0.6279171942059799 87.23761312189598 0.035400390625 4 0.8467297569667855 3.111169044063985 51829.0 153.448787941084 0.0 - - - - - - - 719.6666666666666 103 9 CYCS cytochrome c, somatic 719 92 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40348.[MT7]-K[MT7]YIPGTK[MT7].3y4_1.heavy 413.599 / 546.337 56132.0 20.913650512695312 34 10 10 6 8 0.6279171942059799 87.23761312189598 0.035400390625 4 0.8467297569667855 3.111169044063985 56132.0 201.26054771644482 0.0 - - - - - - - 235.38095238095238 112 21 CYCS cytochrome c, somatic 721 93 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20336.[MT7]-FDVINLAAEK[MT7].3y3_1.heavy 469.941 / 491.295 135696.0 36.989601135253906 42 12 10 10 10 0.9514457314969118 60.15846701159368 0.0 3 0.8904408859179036 3.693949049237801 135696.0 202.7952091171781 0.0 - - - - - - - 304.8888888888889 271 9 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 723 93 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20336.[MT7]-FDVINLAAEK[MT7].3b4_1.heavy 469.941 / 619.357 36484.0 36.989601135253906 42 12 10 10 10 0.9514457314969118 60.15846701159368 0.0 3 0.8904408859179036 3.693949049237801 36484.0 93.67311330498177 0.0 - - - - - - - 243.66666666666666 72 12 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 725 93 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20336.[MT7]-FDVINLAAEK[MT7].3b5_1.heavy 469.941 / 733.4 66933.0 36.989601135253906 42 12 10 10 10 0.9514457314969118 60.15846701159368 0.0 3 0.8904408859179036 3.693949049237801 66933.0 326.1838682709854 0.0 - - - - - - - 238.92307692307693 133 13 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 727 93 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20336.[MT7]-FDVINLAAEK[MT7].3b3_1.heavy 469.941 / 506.273 60990.0 36.989601135253906 42 12 10 10 10 0.9514457314969118 60.15846701159368 0.0 3 0.8904408859179036 3.693949049237801 60990.0 53.802958765112265 0.0 - - - - - - - 326.57142857142856 121 7 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 729 94 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20335.[MT7]-SIDWDLLEK[MT7].2y8_1.heavy 703.892 / 1175.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 731 94 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20335.[MT7]-SIDWDLLEK[MT7].2y3_1.heavy 703.892 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 733 94 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20335.[MT7]-SIDWDLLEK[MT7].2y6_1.heavy 703.892 / 947.532 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 735 94 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20335.[MT7]-SIDWDLLEK[MT7].2y7_1.heavy 703.892 / 1062.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 737 95 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20473.[MT7]-ISQGLGLQDFDLIR.2y11_1.heavy 859.982 / 1246.68 1460.0 43.628400802612305 43 17 10 6 10 2.3060295593447204 30.95075853237134 0.03639984130859375 3 0.9774647682341662 8.205638637035422 1460.0 14.35042735042735 0.0 - - - - - - - 148.54545454545453 2 11 PRKCZ protein kinase C, zeta 739 95 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20473.[MT7]-ISQGLGLQDFDLIR.2y5_1.heavy 859.982 / 663.382 1869.0 43.628400802612305 43 17 10 6 10 2.3060295593447204 30.95075853237134 0.03639984130859375 3 0.9774647682341662 8.205638637035422 1869.0 8.7576 0.0 - - - - - - - 151.73333333333332 3 15 PRKCZ protein kinase C, zeta 741 95 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20473.[MT7]-ISQGLGLQDFDLIR.2y9_1.heavy 859.982 / 1076.57 1986.0 43.628400802612305 43 17 10 6 10 2.3060295593447204 30.95075853237134 0.03639984130859375 3 0.9774647682341662 8.205638637035422 1986.0 14.639657142857143 0.0 - - - - - - - 181.8235294117647 3 17 PRKCZ protein kinase C, zeta 743 95 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20473.[MT7]-ISQGLGLQDFDLIR.2b4_1.heavy 859.982 / 530.305 1986.0 43.628400802612305 43 17 10 6 10 2.3060295593447204 30.95075853237134 0.03639984130859375 3 0.9774647682341662 8.205638637035422 1986.0 10.440685714285715 0.0 - - - - - - - 175.05263157894737 3 19 PRKCZ protein kinase C, zeta 745 96 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40149.[MT7]-VQNEAK[MT7].2y4_1.heavy 488.787 / 605.338 1426.0 14.807124853134155 43 16 10 7 10 2.587398873446019 38.64885349772736 0.02929973602294922 3 0.9682272826918799 6.905236222353269 1426.0 4.091058324170906 0.0 - - - - - - - 119.65384615384616 2 26 ACSL5 acyl-CoA synthetase long-chain family member 5 747 96 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40149.[MT7]-VQNEAK[MT7].2b3_1.heavy 488.787 / 486.279 432.0 14.807124853134155 43 16 10 7 10 2.587398873446019 38.64885349772736 0.02929973602294922 3 0.9682272826918799 6.905236222353269 432.0 2.68917905623788 0.0 - - - - - - - 0.0 0 0 ACSL5 acyl-CoA synthetase long-chain family member 5 749 96 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40149.[MT7]-VQNEAK[MT7].2y5_1.heavy 488.787 / 733.396 2183.0 14.807124853134155 43 16 10 7 10 2.587398873446019 38.64885349772736 0.02929973602294922 3 0.9682272826918799 6.905236222353269 2183.0 30.239120879120883 0.0 - - - - - - - 99.73076923076923 4 26 ACSL5 acyl-CoA synthetase long-chain family member 5 751 96 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40149.[MT7]-VQNEAK[MT7].2b4_1.heavy 488.787 / 615.322 1080.0 14.807124853134155 43 16 10 7 10 2.587398873446019 38.64885349772736 0.02929973602294922 3 0.9682272826918799 6.905236222353269 1080.0 6.225967096487328 0.0 - - - - - - - 113.0 2 22 ACSL5 acyl-CoA synthetase long-chain family member 5 753 97 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20683.[MT7]-RLPAGVGPVLPLLPHALHPQVAAR.4b7_1.heavy 656.65 / 795.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC11 anaphase promoting complex subunit 11 755 97 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20683.[MT7]-RLPAGVGPVLPLLPHALHPQVAAR.4b5_1.heavy 656.65 / 639.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC11 anaphase promoting complex subunit 11 757 97 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20683.[MT7]-RLPAGVGPVLPLLPHALHPQVAAR.4y7_1.heavy 656.65 / 778.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC11 anaphase promoting complex subunit 11 759 97 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20683.[MT7]-RLPAGVGPVLPLLPHALHPQVAAR.4y6_1.heavy 656.65 / 641.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC11 anaphase promoting complex subunit 11 761 98 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535802.[MT7]-NVVIAADGVLK[MT7].3b4_1.heavy 462.957 / 570.373 29479.0 33.16389846801758 47 17 10 10 10 4.934626682653196 20.264957499527217 0.0 3 0.9744901113530893 7.710463866243568 29479.0 68.08456926830897 0.0 - - - - - - - 707.625 58 8 ZAK sterile alpha motif and leucine zipper containing kinase AZK 763 98 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535802.[MT7]-NVVIAADGVLK[MT7].3b5_1.heavy 462.957 / 641.41 25313.0 33.16389846801758 47 17 10 10 10 4.934626682653196 20.264957499527217 0.0 3 0.9744901113530893 7.710463866243568 25313.0 58.22239954542002 0.0 - - - - - - - 213.66666666666666 50 6 ZAK sterile alpha motif and leucine zipper containing kinase AZK 765 98 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535802.[MT7]-NVVIAADGVLK[MT7].3y4_1.heavy 462.957 / 560.389 11535.0 33.16389846801758 47 17 10 10 10 4.934626682653196 20.264957499527217 0.0 3 0.9744901113530893 7.710463866243568 11535.0 66.86438574365404 0.0 - - - - - - - 223.36363636363637 23 11 ZAK sterile alpha motif and leucine zipper containing kinase AZK 767 98 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535802.[MT7]-NVVIAADGVLK[MT7].3y5_1.heavy 462.957 / 675.416 9933.0 33.16389846801758 47 17 10 10 10 4.934626682653196 20.264957499527217 0.0 3 0.9744901113530893 7.710463866243568 9933.0 58.766644706603344 0.0 - - - - - - - 267.0 19 16 ZAK sterile alpha motif and leucine zipper containing kinase AZK 769 99 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19974.[MT7]-EVDILR.2y4_1.heavy 444.767 / 516.314 2683.0 29.45937490463257 40 14 10 6 10 1.708620405358613 47.61725868831807 0.03650093078613281 3 0.9346520720673115 4.801230797036525 2683.0 4.399158704639412 3.0 - - - - - - - 721.0909090909091 5 11 DCP1B;PHKG1 DCP1 decapping enzyme homolog B (S. cerevisiae);phosphorylase kinase, gamma 1 (muscle) 771 99 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19974.[MT7]-EVDILR.2b3_1.heavy 444.767 / 488.247 7233.0 29.45937490463257 40 14 10 6 10 1.708620405358613 47.61725868831807 0.03650093078613281 3 0.9346520720673115 4.801230797036525 7233.0 15.187706243114214 0.0 - - - - - - - 699.8571428571429 14 7 DCP1B;PHKG1 DCP1 decapping enzyme homolog B (S. cerevisiae);phosphorylase kinase, gamma 1 (muscle) 773 99 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19974.[MT7]-EVDILR.2y5_1.heavy 444.767 / 615.382 2800.0 29.45937490463257 40 14 10 6 10 1.708620405358613 47.61725868831807 0.03650093078613281 3 0.9346520720673115 4.801230797036525 2800.0 5.031362467866323 0.0 - - - - - - - 329.0 5 11 DCP1B;PHKG1 DCP1 decapping enzyme homolog B (S. cerevisiae);phosphorylase kinase, gamma 1 (muscle) 775 99 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19974.[MT7]-EVDILR.2b4_1.heavy 444.767 / 601.331 4783.0 29.45937490463257 40 14 10 6 10 1.708620405358613 47.61725868831807 0.03650093078613281 3 0.9346520720673115 4.801230797036525 4783.0 4.244635870835704 1.0 - - - - - - - 716.5714285714286 9 7 DCP1B;PHKG1 DCP1 decapping enzyme homolog B (S. cerevisiae);phosphorylase kinase, gamma 1 (muscle) 777 100 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20581.[MT7]-RRFHWTAPAALQVTVR.3y7_1.heavy 685.061 / 786.483 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHB pyruvate dehydrogenase (lipoamide) beta 779 100 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20581.[MT7]-RRFHWTAPAALQVTVR.3y8_1.heavy 685.061 / 857.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHB pyruvate dehydrogenase (lipoamide) beta 781 100 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20581.[MT7]-RRFHWTAPAALQVTVR.3y5_1.heavy 685.061 / 602.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHB pyruvate dehydrogenase (lipoamide) beta 783 100 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20581.[MT7]-RRFHWTAPAALQVTVR.3y9_1.heavy 685.061 / 954.573 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHB pyruvate dehydrogenase (lipoamide) beta 785 101 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44036.[MT7]-TREEIQEVR.2y5_1.heavy 652.358 / 644.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHA1;PDHA2 pyruvate dehydrogenase (lipoamide) alpha 1;pyruvate dehydrogenase (lipoamide) alpha 2 787 101 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44036.[MT7]-TREEIQEVR.2b4_1.heavy 652.358 / 660.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHA1;PDHA2 pyruvate dehydrogenase (lipoamide) alpha 1;pyruvate dehydrogenase (lipoamide) alpha 2 789 101 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44036.[MT7]-TREEIQEVR.2b7_1.heavy 652.358 / 1030.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHA1;PDHA2 pyruvate dehydrogenase (lipoamide) alpha 1;pyruvate dehydrogenase (lipoamide) alpha 2 791 101 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44036.[MT7]-TREEIQEVR.2y7_1.heavy 652.358 / 902.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHA1;PDHA2 pyruvate dehydrogenase (lipoamide) alpha 1;pyruvate dehydrogenase (lipoamide) alpha 2 793 102 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20074.[MT7]-AVHFGLPR.2y4_1.heavy 520.81 / 442.277 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 795 102 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20074.[MT7]-AVHFGLPR.2y5_1.heavy 520.81 / 589.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 797 102 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20074.[MT7]-AVHFGLPR.2y6_1.heavy 520.81 / 726.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 799 102 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20074.[MT7]-AVHFGLPR.2y7_1.heavy 520.81 / 825.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 801 103 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40141.[MT7]-SSAGLDK[MT7].2y4_1.heavy 483.279 / 576.347 2104.0 17.371699810028076 39 13 10 6 10 1.724494480055591 48.8288743643931 0.03759956359863281 3 0.9220227311333938 4.39051064358293 2104.0 9.578736842105265 0.0 - - - - - - - 199.3913043478261 4 23 ISYNA1 inositol-3-phosphate synthase 1 803 103 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40141.[MT7]-SSAGLDK[MT7].2y5_1.heavy 483.279 / 647.385 1169.0 17.371699810028076 39 13 10 6 10 1.724494480055591 48.8288743643931 0.03759956359863281 3 0.9220227311333938 4.39051064358293 1169.0 7.342112301496846 0.0 - - - - - - - 151.5185185185185 2 27 ISYNA1 inositol-3-phosphate synthase 1 805 103 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40141.[MT7]-SSAGLDK[MT7].2b6_1.heavy 483.279 / 675.343 6165.0 17.371699810028076 39 13 10 6 10 1.724494480055591 48.8288743643931 0.03759956359863281 3 0.9220227311333938 4.39051064358293 6165.0 16.886798809426157 0.0 - - - - - - - 166.5 12 20 ISYNA1 inositol-3-phosphate synthase 1 807 103 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40141.[MT7]-SSAGLDK[MT7].2y6_1.heavy 483.279 / 734.417 3243.0 17.371699810028076 39 13 10 6 10 1.724494480055591 48.8288743643931 0.03759956359863281 3 0.9220227311333938 4.39051064358293 3243.0 34.896120297148336 0.0 - - - - - - - 173.95652173913044 6 23 ISYNA1 inositol-3-phosphate synthase 1 809 104 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 605996.0 34.097801208496094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 605996.0 191.80167523720684 0.0 - - - - - - - 306.0 1211 1 811 104 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 135153.0 34.097801208496094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 135153.0 243.2455009481017 0.0 - - - - - - - 204.0 270 9 813 104 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 210884.0 34.097801208496094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 210884.0 502.2505079551914 0.0 - - - - - - - 1252.142857142857 421 7 815 105 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40246.[MT7]-VVDIYSK[MT7].2y4_1.heavy 556.334 / 654.394 4534.0 28.381399154663086 46 16 10 10 10 1.8769501297349334 37.411960152592684 0.0 3 0.9611832127513745 6.243636978489924 4534.0 7.360898100172712 0.0 - - - - - - - 289.1818181818182 9 11 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 817 105 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40246.[MT7]-VVDIYSK[MT7].2y5_1.heavy 556.334 / 769.421 3280.0 28.381399154663086 46 16 10 10 10 1.8769501297349334 37.411960152592684 0.0 3 0.9611832127513745 6.243636978489924 3280.0 18.127806563039723 0.0 - - - - - - - 213.42857142857142 6 14 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 819 105 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40246.[MT7]-VVDIYSK[MT7].2y3_1.heavy 556.334 / 541.31 N/A 28.381399154663086 46 16 10 10 10 1.8769501297349334 37.411960152592684 0.0 3 0.9611832127513745 6.243636978489924 7910.0 7.964460108028563 1.0 - - - - - - - 1323.0 15 7 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 821 105 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40246.[MT7]-VVDIYSK[MT7].2y6_1.heavy 556.334 / 868.49 6174.0 28.381399154663086 46 16 10 10 10 1.8769501297349334 37.411960152592684 0.0 3 0.9611832127513745 6.243636978489924 6174.0 45.67323233590906 0.0 - - - - - - - 163.7 12 10 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 823 106 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46355.[MT7]-SQYFEGVVK[MT7].2b3_1.heavy 672.874 / 523.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 825 106 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46355.[MT7]-SQYFEGVVK[MT7].2y4_1.heavy 672.874 / 546.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 827 106 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46355.[MT7]-SQYFEGVVK[MT7].2y6_1.heavy 672.874 / 822.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 829 106 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46355.[MT7]-SQYFEGVVK[MT7].2y7_1.heavy 672.874 / 985.547 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 831 107 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20077.[MT7]-EEIQEVR.2y4_1.heavy 523.784 / 531.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHA1;PDHA2 pyruvate dehydrogenase (lipoamide) alpha 1;pyruvate dehydrogenase (lipoamide) alpha 2 833 107 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20077.[MT7]-EEIQEVR.2b3_1.heavy 523.784 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHA1;PDHA2 pyruvate dehydrogenase (lipoamide) alpha 1;pyruvate dehydrogenase (lipoamide) alpha 2 835 108 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20586.[MT7]-SPDPTPPALDQETSSLLR.2y13_2.heavy 1034.54 / 713.88 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC11 anaphase promoting complex subunit 11 837 108 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20586.[MT7]-SPDPTPPALDQETSSLLR.2y8_1.heavy 1034.54 / 933.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC11 anaphase promoting complex subunit 11 839 108 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20586.[MT7]-SPDPTPPALDQETSSLLR.2y9_1.heavy 1034.54 / 1048.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC11 anaphase promoting complex subunit 11 841 108 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20586.[MT7]-SPDPTPPALDQETSSLLR.2y7_1.heavy 1034.54 / 805.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC11 anaphase promoting complex subunit 11 843 109 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20686.[MT7]-YTAEEALAHPFFQQYLVEEVR.3b6_1.heavy 895.454 / 809.38 3021.0 43.004751205444336 44 18 10 6 10 3.290933124218065 30.386518420595458 0.03980255126953125 3 0.9821263802708512 9.217371988039362 3021.0 24.072095238095237 0.0 - - - - - - - 200.8125 6 16 PHKG1 phosphorylase kinase, gamma 1 (muscle) 845 109 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20686.[MT7]-YTAEEALAHPFFQQYLVEEVR.3b4_1.heavy 895.454 / 609.3 1070.0 43.004751205444336 44 18 10 6 10 3.290933124218065 30.386518420595458 0.03980255126953125 3 0.9821263802708512 9.217371988039362 1070.0 5.661375661375661 0.0 - - - - - - - 177.88235294117646 2 17 PHKG1 phosphorylase kinase, gamma 1 (muscle) 847 109 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20686.[MT7]-YTAEEALAHPFFQQYLVEEVR.3b5_1.heavy 895.454 / 738.343 1888.0 43.004751205444336 44 18 10 6 10 3.290933124218065 30.386518420595458 0.03980255126953125 3 0.9821263802708512 9.217371988039362 1888.0 11.070758051197357 0.0 - - - - - - - 180.0 3 14 PHKG1 phosphorylase kinase, gamma 1 (muscle) 849 109 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20686.[MT7]-YTAEEALAHPFFQQYLVEEVR.3b7_1.heavy 895.454 / 922.464 1825.0 43.004751205444336 44 18 10 6 10 3.290933124218065 30.386518420595458 0.03980255126953125 3 0.9821263802708512 9.217371988039362 1825.0 33.89285714285714 0.0 - - - - - - - 120.75 3 12 PHKG1 phosphorylase kinase, gamma 1 (muscle) 851 110 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20687.[MT7]-YTAEEALAHPFFQQYLVEEVR.4y4_1.heavy 671.842 / 532.273 3380.0 42.97489929199219 39 9 10 10 10 0.6307703588873989 79.59573934362223 0.0 3 0.8095775362605095 2.7820030285193353 3380.0 17.970805588822355 0.0 - - - - - - - 187.71428571428572 6 14 PHKG1 phosphorylase kinase, gamma 1 (muscle) 853 110 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20687.[MT7]-YTAEEALAHPFFQQYLVEEVR.4y5_1.heavy 671.842 / 631.341 7510.0 42.97489929199219 39 9 10 10 10 0.6307703588873989 79.59573934362223 0.0 3 0.8095775362605095 2.7820030285193353 7510.0 74.30106382978724 0.0 - - - - - - - 173.5909090909091 15 22 PHKG1 phosphorylase kinase, gamma 1 (muscle) 855 110 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20687.[MT7]-YTAEEALAHPFFQQYLVEEVR.4b5_1.heavy 671.842 / 738.343 1690.0 42.97489929199219 39 9 10 10 10 0.6307703588873989 79.59573934362223 0.0 3 0.8095775362605095 2.7820030285193353 1690.0 7.544664026579428 0.0 - - - - - - - 203.375 3 16 PHKG1 phosphorylase kinase, gamma 1 (muscle) 857 110 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20687.[MT7]-YTAEEALAHPFFQQYLVEEVR.4b6_1.heavy 671.842 / 809.38 1752.0 42.97489929199219 39 9 10 10 10 0.6307703588873989 79.59573934362223 0.0 3 0.8095775362605095 2.7820030285193353 1752.0 9.32450819114948 0.0 - - - - - - - 183.66666666666666 3 15 PHKG1 phosphorylase kinase, gamma 1 (muscle) 859 111 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20444.[MT7]-SVLVDFLIGSGLK[MT7].2y6_1.heavy 818.5 / 718.458 428.0 49.35129928588867 50 20 10 10 10 15.349183209932962 6.515004650885052 0.0 3 0.9957610294027621 18.948665743101856 428.0 4.954275099513489 1.0 - - - - - - - 0.0 0 0 ISYNA1 inositol-3-phosphate synthase 1 861 111 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20444.[MT7]-SVLVDFLIGSGLK[MT7].2b5_1.heavy 818.5 / 658.389 857.0 49.35129928588867 50 20 10 10 10 15.349183209932962 6.515004650885052 0.0 3 0.9957610294027621 18.948665743101856 857.0 15.309680638722556 1.0 - - - - - - - 0.0 1 0 ISYNA1 inositol-3-phosphate synthase 1 863 111 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20444.[MT7]-SVLVDFLIGSGLK[MT7].2y5_1.heavy 818.5 / 605.374 1023.0 49.35129928588867 50 20 10 10 10 15.349183209932962 6.515004650885052 0.0 3 0.9957610294027621 18.948665743101856 1023.0 37.77544910179641 0.0 - - - - - - - 92.52941176470588 2 17 ISYNA1 inositol-3-phosphate synthase 1 865 111 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20444.[MT7]-SVLVDFLIGSGLK[MT7].2y9_1.heavy 818.5 / 1093.64 452.0 49.35129928588867 50 20 10 10 10 15.349183209932962 6.515004650885052 0.0 3 0.9957610294027621 18.948665743101856 452.0 18.88638497652582 0.0 - - - - - - - 0.0 0 0 ISYNA1 inositol-3-phosphate synthase 1 867 112 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20446.[MT7]-SVLVDFLIGSGLK[MT7].3b6_1.heavy 546.002 / 805.458 17788.0 49.35129928588867 39 9 10 10 10 0.9231812779777275 70.69902414007147 0.0 3 0.8089251536854644 2.7770872527613557 17788.0 402.48131030375225 0.0 - - - - - - - 140.14285714285714 35 14 ISYNA1 inositol-3-phosphate synthase 1 869 112 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20446.[MT7]-SVLVDFLIGSGLK[MT7].3b4_1.heavy 546.002 / 543.362 4789.0 49.35129928588867 39 9 10 10 10 0.9231812779777275 70.69902414007147 0.0 3 0.8089251536854644 2.7770872527613557 4789.0 21.329923500697923 1.0 - - - - - - - 154.71428571428572 11 14 ISYNA1 inositol-3-phosphate synthase 1 871 112 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20446.[MT7]-SVLVDFLIGSGLK[MT7].3b5_1.heavy 546.002 / 658.389 23010.0 49.35129928588867 39 9 10 10 10 0.9231812779777275 70.69902414007147 0.0 3 0.8089251536854644 2.7770872527613557 23010.0 310.7580115830116 0.0 - - - - - - - 159.6 46 15 ISYNA1 inositol-3-phosphate synthase 1 873 112 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20446.[MT7]-SVLVDFLIGSGLK[MT7].3y5_1.heavy 546.002 / 605.374 38608.0 49.35129928588867 39 9 10 10 10 0.9231812779777275 70.69902414007147 0.0 3 0.8089251536854644 2.7770872527613557 38608.0 730.7012454212454 0.0 - - - - - - - 121.0625 77 16 ISYNA1 inositol-3-phosphate synthase 1 875 113 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40334.[MT7]-ALTPASLQK[MT7].3b6_1.heavy 406.255 / 685.4 9460.0 27.25599956512451 46 20 10 6 10 12.79850615883736 7.813411874709304 0.033199310302734375 3 0.9995048123798695 55.457406718829404 9460.0 19.517574173633605 0.0 - - - - - - - 241.63636363636363 18 11 ANAPC5 anaphase promoting complex subunit 5 877 113 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40334.[MT7]-ALTPASLQK[MT7].3y3_1.heavy 406.255 / 532.357 13447.0 27.25599956512451 46 20 10 6 10 12.79850615883736 7.813411874709304 0.033199310302734375 3 0.9995048123798695 55.457406718829404 13447.0 35.66237320259212 0.0 - - - - - - - 248.72727272727272 26 11 ANAPC5 anaphase promoting complex subunit 5 879 113 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40334.[MT7]-ALTPASLQK[MT7].3b5_1.heavy 406.255 / 598.368 16262.0 27.25599956512451 46 20 10 6 10 12.79850615883736 7.813411874709304 0.033199310302734375 3 0.9995048123798695 55.457406718829404 16262.0 88.6784726342711 0.0 - - - - - - - 203.26666666666668 32 15 ANAPC5 anaphase promoting complex subunit 5 881 113 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40334.[MT7]-ALTPASLQK[MT7].3b3_1.heavy 406.255 / 430.278 65986.0 27.25599956512451 46 20 10 6 10 12.79850615883736 7.813411874709304 0.033199310302734375 3 0.9995048123798695 55.457406718829404 65986.0 130.23008681774024 0.0 - - - - - - - 720.7777777777778 131 9 ANAPC5 anaphase promoting complex subunit 5 883 114 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40795.[MT7]-TNHLVTVEGGWPQFGVGAEIC[CAM]AR.3y7_1.heavy 881.447 / 776.372 3526.0 38.52870178222656 48 18 10 10 10 3.3243586148238915 24.035590051307256 0.0 3 0.9869079633117458 10.774169532723812 3526.0 7.869448329311984 0.0 - - - - - - - 290.8 7 10 PDHB pyruvate dehydrogenase (lipoamide) beta 885 114 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40795.[MT7]-TNHLVTVEGGWPQFGVGAEIC[CAM]AR.3b4_1.heavy 881.447 / 610.343 2116.0 38.52870178222656 48 18 10 10 10 3.3243586148238915 24.035590051307256 0.0 3 0.9869079633117458 10.774169532723812 2116.0 6.663957044730371 0.0 - - - - - - - 258.46666666666664 4 15 PDHB pyruvate dehydrogenase (lipoamide) beta 887 114 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40795.[MT7]-TNHLVTVEGGWPQFGVGAEIC[CAM]AR.3b5_1.heavy 881.447 / 709.411 3350.0 38.52870178222656 48 18 10 10 10 3.3243586148238915 24.035590051307256 0.0 3 0.9869079633117458 10.774169532723812 3350.0 2.1678926052800565 0.0 - - - - - - - 250.76923076923077 6 13 PDHB pyruvate dehydrogenase (lipoamide) beta 889 114 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40795.[MT7]-TNHLVTVEGGWPQFGVGAEIC[CAM]AR.3y10_1.heavy 881.447 / 1079.53 2204.0 38.52870178222656 48 18 10 10 10 3.3243586148238915 24.035590051307256 0.0 3 0.9869079633117458 10.774169532723812 2204.0 8.085717302686508 1.0 - - - - - - - 189.6153846153846 4 13 PDHB pyruvate dehydrogenase (lipoamide) beta 891 115 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40335.[MT7]-LILTGAESK[MT7].2y8_1.heavy 610.379 / 962.564 1242.0 30.238000869750977 46 16 10 10 10 2.5618477617661046 30.94700580718694 0.0 3 0.9683668042311695 6.920529014386585 1242.0 5.809677419354838 4.0 - - - - - - - 273.0 5 10 ANAPC5 anaphase promoting complex subunit 5 893 115 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40335.[MT7]-LILTGAESK[MT7].2y5_1.heavy 610.379 / 635.348 3352.0 30.238000869750977 46 16 10 10 10 2.5618477617661046 30.94700580718694 0.0 3 0.9683668042311695 6.920529014386585 3352.0 17.292809724170173 0.0 - - - - - - - 259.45454545454544 6 11 ANAPC5 anaphase promoting complex subunit 5 895 115 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40335.[MT7]-LILTGAESK[MT7].2y6_1.heavy 610.379 / 736.396 4966.0 30.238000869750977 46 16 10 10 10 2.5618477617661046 30.94700580718694 0.0 3 0.9683668042311695 6.920529014386585 4966.0 11.19549114331723 0.0 - - - - - - - 330.8888888888889 9 9 ANAPC5 anaphase promoting complex subunit 5 897 115 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40335.[MT7]-LILTGAESK[MT7].2y7_1.heavy 610.379 / 849.48 2235.0 30.238000869750977 46 16 10 10 10 2.5618477617661046 30.94700580718694 0.0 3 0.9683668042311695 6.920529014386585 2235.0 5.416038550057537 1.0 - - - - - - - 248.0 5 6 ANAPC5 anaphase promoting complex subunit 5 899 116 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40796.[MT7]-EESSRSPDPTPPALDQETSSLLR.3y8_1.heavy 886.111 / 933.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC11 anaphase promoting complex subunit 11 901 116 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40796.[MT7]-EESSRSPDPTPPALDQETSSLLR.3b8_1.heavy 886.111 / 1032.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC11 anaphase promoting complex subunit 11 903 116 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40796.[MT7]-EESSRSPDPTPPALDQETSSLLR.3b8_2.heavy 886.111 / 516.739 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC11 anaphase promoting complex subunit 11 905 116 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40796.[MT7]-EESSRSPDPTPPALDQETSSLLR.3y9_1.heavy 886.111 / 1048.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC11 anaphase promoting complex subunit 11 907 117 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19951.[MT7]-EATLK[MT7].2b3_1.heavy 425.268 / 446.237 2162.0 18.480600357055664 36 20 0 10 6 8.059493480992979 12.407727636461765 0.0 5 0.9933574929737604 15.13406743856167 2162.0 6.192735439453072 4.0 - - - - - - - 284.0 4 20 PHKG1;TULP4 phosphorylase kinase, gamma 1 (muscle);tubby like protein 4 909 117 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19951.[MT7]-EATLK[MT7].2y4_1.heavy 425.268 / 576.384 9579.0 18.480600357055664 36 20 0 10 6 8.059493480992979 12.407727636461765 0.0 5 0.9933574929737604 15.13406743856167 9579.0 57.66647656366068 0.0 - - - - - - - 279.6 19 20 PHKG1;TULP4 phosphorylase kinase, gamma 1 (muscle);tubby like protein 4 911 117 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19951.[MT7]-EATLK[MT7].2b4_1.heavy 425.268 / 559.321 N/A 18.480600357055664 36 20 0 10 6 8.059493480992979 12.407727636461765 0.0 5 0.9933574929737604 15.13406743856167 1441.0 0.8232898536773199 12.0 - - - - - - - 1253.4285714285713 277 7 PHKG1;TULP4 phosphorylase kinase, gamma 1 (muscle);tubby like protein 4 913 117 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19951.[MT7]-EATLK[MT7].2y3_1.heavy 425.268 / 505.347 3772.0 18.480600357055664 36 20 0 10 6 8.059493480992979 12.407727636461765 0.0 5 0.9933574929737604 15.13406743856167 3772.0 11.41883582864882 2.0 - - - - - - - 235.5 12 18 PHKG1;TULP4 phosphorylase kinase, gamma 1 (muscle);tubby like protein 4 915 118 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46162.[MT7]-AEVADEK[MT7].2y6_1.heavy 525.289 / 834.432 583.0 17.019500732421875 44 14 10 10 10 2.330209366655886 33.755485382084174 0.0 3 0.9379077094998682 4.926860962049017 583.0 5.520520728008089 0.0 - - - - - - - 0.0 1 0 PRKCA protein kinase C, alpha 917 118 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46162.[MT7]-AEVADEK[MT7].2y4_1.heavy 525.289 / 606.321 859.0 17.019500732421875 44 14 10 10 10 2.330209366655886 33.755485382084174 0.0 3 0.9379077094998682 4.926860962049017 859.0 7.690665339306454 0.0 - - - - - - - 0.0 1 0 PRKCA protein kinase C, alpha 919 118 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46162.[MT7]-AEVADEK[MT7].2b5_1.heavy 525.289 / 630.321 1656.0 17.019500732421875 44 14 10 10 10 2.330209366655886 33.755485382084174 0.0 3 0.9379077094998682 4.926860962049017 1656.0 14.572166427546628 0.0 - - - - - - - 135.57692307692307 3 26 PRKCA protein kinase C, alpha 921 118 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46162.[MT7]-AEVADEK[MT7].2y3_1.heavy 525.289 / 535.284 460.0 17.019500732421875 44 14 10 10 10 2.330209366655886 33.755485382084174 0.0 3 0.9379077094998682 4.926860962049017 460.0 11.353225806451611 0.0 - - - - - - - 0.0 0 0 PRKCA protein kinase C, alpha 923 119 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20346.[MT7]-SQTPLVTLFK[MT7].2y4_1.heavy 711.434 / 652.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - POMC proopiomelanocortin 925 119 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20346.[MT7]-SQTPLVTLFK[MT7].2y5_1.heavy 711.434 / 751.483 N/A N/A - - - - - - - - - 0.0 - - - - - - - POMC proopiomelanocortin 927 119 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20346.[MT7]-SQTPLVTLFK[MT7].2y3_1.heavy 711.434 / 551.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - POMC proopiomelanocortin 929 119 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20346.[MT7]-SQTPLVTLFK[MT7].2y7_1.heavy 711.434 / 961.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - POMC proopiomelanocortin 931 120 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40470.[MT7]-IRDVVYFQAR.3b5_1.heavy 470.937 / 727.458 9970.0 31.124399185180664 43 13 10 10 10 3.3374721826731877 29.96279654978392 0.0 3 0.9278677484391196 4.56721910486814 9970.0 147.61782945736434 0.0 - - - - - - - 188.0 19 11 ANAPC5 anaphase promoting complex subunit 5 933 120 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40470.[MT7]-IRDVVYFQAR.3b3_1.heavy 470.937 / 529.321 4014.0 31.124399185180664 43 13 10 10 10 3.3374721826731877 29.96279654978392 0.0 3 0.9278677484391196 4.56721910486814 4014.0 5.383616692426584 2.0 - - - - - - - 748.0 8 9 ANAPC5 anaphase promoting complex subunit 5 935 120 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40470.[MT7]-IRDVVYFQAR.3y4_1.heavy 470.937 / 521.283 23048.0 31.124399185180664 43 13 10 10 10 3.3374721826731877 29.96279654978392 0.0 3 0.9278677484391196 4.56721910486814 23048.0 58.41601004466189 0.0 - - - - - - - 758.1428571428571 46 7 ANAPC5 anaphase promoting complex subunit 5 937 120 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40470.[MT7]-IRDVVYFQAR.3y5_1.heavy 470.937 / 684.346 27838.0 31.124399185180664 43 13 10 10 10 3.3374721826731877 29.96279654978392 0.0 3 0.9278677484391196 4.56721910486814 27838.0 68.78888030888031 0.0 - - - - - - - 258.6666666666667 55 9 ANAPC5 anaphase promoting complex subunit 5 939 121 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20240.[MT7]-AHEAQDAGYR.3y6_1.heavy 421.206 / 709.326 3752.0 14.902600288391113 45 18 10 7 10 4.564298727925823 21.909170709657626 0.029399871826171875 3 0.9850640052028147 10.085635185846023 3752.0 94.81156862745098 0.0 - - - - - - - 94.16666666666667 7 18 PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 941 121 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20240.[MT7]-AHEAQDAGYR.3b3_1.heavy 421.206 / 482.248 3983.0 14.902600288391113 45 18 10 7 10 4.564298727925823 21.909170709657626 0.029399871826171875 3 0.9850640052028147 10.085635185846023 3983.0 18.966666666666665 0.0 - - - - - - - 169.17241379310346 7 29 PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 943 121 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20240.[MT7]-AHEAQDAGYR.3y4_1.heavy 421.206 / 466.241 14263.0 14.902600288391113 45 18 10 7 10 4.564298727925823 21.909170709657626 0.029399871826171875 3 0.9850640052028147 10.085635185846023 14263.0 94.46922077922078 0.0 - - - - - - - 187.10714285714286 28 28 PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 945 121 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20240.[MT7]-AHEAQDAGYR.3y5_1.heavy 421.206 / 581.268 15239.0 14.902600288391113 45 18 10 7 10 4.564298727925823 21.909170709657626 0.029399871826171875 3 0.9850640052028147 10.085635185846023 15239.0 212.4239338464739 0.0 - - - - - - - 185.73076923076923 30 26 PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 947 122 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40135.[MT7]-VAFTTK[MT7].2b3_1.heavy 477.797 / 462.283 N/A 25.3448003133138 42 15 10 7 10 3.332624216578606 30.006383408767178 0.027898788452148438 3 0.9573804958859263 5.956669806165318 6679.0 5.961311039209843 2.0 - - - - - - - 1196.857142857143 13 7 UBE2D4 ubiquitin-conjugating enzyme E2D 4 (putative) 949 122 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40135.[MT7]-VAFTTK[MT7].2y4_1.heavy 477.797 / 640.379 4641.0 25.3448003133138 42 15 10 7 10 3.332624216578606 30.006383408767178 0.027898788452148438 3 0.9573804958859263 5.956669806165318 4641.0 4.708584966270479 0.0 - - - - - - - 249.7058823529412 9 17 UBE2D4 ubiquitin-conjugating enzyme E2D 4 (putative) 951 122 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40135.[MT7]-VAFTTK[MT7].2y5_1.heavy 477.797 / 711.416 15905.0 25.3448003133138 42 15 10 7 10 3.332624216578606 30.006383408767178 0.027898788452148438 3 0.9573804958859263 5.956669806165318 15905.0 73.7088714100259 0.0 - - - - - - - 209.8235294117647 31 17 UBE2D4 ubiquitin-conjugating enzyme E2D 4 (putative) 953 122 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40135.[MT7]-VAFTTK[MT7].2y3_1.heavy 477.797 / 493.31 6622.0 25.3448003133138 42 15 10 7 10 3.332624216578606 30.006383408767178 0.027898788452148438 3 0.9573804958859263 5.956669806165318 6622.0 17.367406893311692 0.0 - - - - - - - 599.8 13 10 UBE2D4 ubiquitin-conjugating enzyme E2D 4 (putative) 955 123 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19942.[MT7]-EIVYR.2b3_1.heavy 412.243 / 486.304 8053.0 22.836000442504883 46 20 8 10 8 5.714133871647316 17.5004650304371 0.0 4 0.9933117430525917 15.08215992803993 8053.0 31.54502028213356 1.0 - - - - - - - 220.83333333333334 35 18 PRKX protein kinase, X-linked 957 123 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19942.[MT7]-EIVYR.2y4_1.heavy 412.243 / 550.335 13322.0 22.836000442504883 46 20 8 10 8 5.714133871647316 17.5004650304371 0.0 4 0.9933117430525917 15.08215992803993 13322.0 36.15553504789362 0.0 - - - - - - - 248.57142857142858 26 21 PRKX protein kinase, X-linked 959 123 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19942.[MT7]-EIVYR.2y3_1.heavy 412.243 / 437.251 3678.0 22.836000442504883 46 20 8 10 8 5.714133871647316 17.5004650304371 0.0 4 0.9933117430525917 15.08215992803993 3678.0 14.524152762482599 0.0 - - - - - - - 208.38095238095238 7 21 PRKX protein kinase, X-linked 961 124 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40134.[MT7]-EGRVDEEIALR.3y6_1.heavy 477.596 / 730.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 963 124 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40134.[MT7]-EGRVDEEIALR.3y5_1.heavy 477.596 / 601.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 965 124 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40134.[MT7]-EGRVDEEIALR.3b7_1.heavy 477.596 / 959.455 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 967 124 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40134.[MT7]-EGRVDEEIALR.3b7_2.heavy 477.596 / 480.231 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 969 125 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20241.[MT7]-ALNIFVERR.3b4_1.heavy 421.255 / 556.357 19864.0 33.029701232910156 44 14 10 10 10 2.861958614927321 34.94110623348042 0.0 3 0.9461979950052279 5.296591557300087 19864.0 58.794782608695655 0.0 - - - - - - - 239.375 39 8 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 971 125 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20241.[MT7]-ALNIFVERR.3y4_1.heavy 421.255 / 559.331 37455.0 33.029701232910156 44 14 10 10 10 2.861958614927321 34.94110623348042 0.0 3 0.9461979950052279 5.296591557300087 37455.0 54.793103448275865 0.0 - - - - - - - 314.25 74 8 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 973 125 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20241.[MT7]-ALNIFVERR.3b3_1.heavy 421.255 / 443.273 37574.0 33.029701232910156 44 14 10 10 10 2.861958614927321 34.94110623348042 0.0 3 0.9461979950052279 5.296591557300087 37574.0 174.47467158250998 0.0 - - - - - - - 256.5 75 14 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 975 125 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20241.[MT7]-ALNIFVERR.3y5_1.heavy 421.255 / 706.399 3590.0 33.029701232910156 44 14 10 10 10 2.861958614927321 34.94110623348042 0.0 3 0.9461979950052279 5.296591557300087 3590.0 33.01916666666666 0.0 - - - - - - - 188.14285714285714 7 7 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 977 126 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39895.[MT7]-IIVSPQPLSSDHVK[MT7].3b6_1.heavy 603.356 / 782.489 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLK nemo-like kinase 979 126 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39895.[MT7]-IIVSPQPLSSDHVK[MT7].3y3_1.heavy 603.356 / 527.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLK nemo-like kinase 981 126 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39895.[MT7]-IIVSPQPLSSDHVK[MT7].3y6_1.heavy 603.356 / 816.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLK nemo-like kinase 983 126 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39895.[MT7]-IIVSPQPLSSDHVK[MT7].3b4_1.heavy 603.356 / 557.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLK nemo-like kinase 985 127 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20245.[MT7]-C[CAM]EIEATLER.2y8_1.heavy 632.82 / 960.5 3890.0 28.64299964904785 50 20 10 10 10 22.265582811385446 4.491236580111672 0.0 3 0.9977553035038116 26.043675993594658 3890.0 73.79885714285714 0.0 - - - - - - - 280.0 7 3 ZAK sterile alpha motif and leucine zipper containing kinase AZK 987 127 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20245.[MT7]-C[CAM]EIEATLER.2y5_1.heavy 632.82 / 589.33 4205.0 28.64299964904785 50 20 10 10 10 22.265582811385446 4.491236580111672 0.0 3 0.9977553035038116 26.043675993594658 4205.0 9.1987859608818 0.0 - - - - - - - 324.54545454545456 8 11 ZAK sterile alpha motif and leucine zipper containing kinase AZK 989 127 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20245.[MT7]-C[CAM]EIEATLER.2b4_1.heavy 632.82 / 676.309 1367.0 28.64299964904785 50 20 10 10 10 22.265582811385446 4.491236580111672 0.0 3 0.9977553035038116 26.043675993594658 1367.0 10.215238095238096 2.0 - - - - - - - 186.66666666666666 2 9 ZAK sterile alpha motif and leucine zipper containing kinase AZK 991 127 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20245.[MT7]-C[CAM]EIEATLER.2y7_1.heavy 632.82 / 831.457 3259.0 28.64299964904785 50 20 10 10 10 22.265582811385446 4.491236580111672 0.0 3 0.9977553035038116 26.043675993594658 3259.0 15.827068260003621 0.0 - - - - - - - 190.9090909090909 6 11 ZAK sterile alpha motif and leucine zipper containing kinase AZK 993 128 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20248.[MT7]-VFVGGDDFK[MT7].2y8_1.heavy 636.347 / 1028.52 2217.0 32.0447998046875 46 16 10 10 10 4.1301417663897535 24.21224395098965 0.0 3 0.9655616570807717 6.631120756803832 2217.0 8.778842931475438 0.0 - - - - - - - 260.72727272727275 4 11 ISYNA1 inositol-3-phosphate synthase 1 995 128 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20248.[MT7]-VFVGGDDFK[MT7].2y3_1.heavy 636.347 / 553.31 1435.0 32.0447998046875 46 16 10 10 10 4.1301417663897535 24.21224395098965 0.0 3 0.9655616570807717 6.631120756803832 1435.0 2.7148435661274375 3.0 - - - - - - - 246.22222222222223 3 9 ISYNA1 inositol-3-phosphate synthase 1 997 128 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20248.[MT7]-VFVGGDDFK[MT7].2y6_1.heavy 636.347 / 782.38 3651.0 32.0447998046875 46 16 10 10 10 4.1301417663897535 24.21224395098965 0.0 3 0.9655616570807717 6.631120756803832 3651.0 36.466958443855 0.0 - - - - - - - 208.5 7 10 ISYNA1 inositol-3-phosphate synthase 1 999 128 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20248.[MT7]-VFVGGDDFK[MT7].2y7_1.heavy 636.347 / 881.448 1826.0 32.0447998046875 46 16 10 10 10 4.1301417663897535 24.21224395098965 0.0 3 0.9655616570807717 6.631120756803832 1826.0 13.733784615384616 2.0 - - - - - - - 208.5 3 10 ISYNA1 inositol-3-phosphate synthase 1 1001 129 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40040.[MT7]-AQVAK[MT7].2b3_1.heavy 402.763 / 443.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA2;CDK12 ubiquitin-like modifier activating enzyme 2;cyclin-dependent kinase 12 1003 129 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40040.[MT7]-AQVAK[MT7].2y4_1.heavy 402.763 / 589.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA2;CDK12 ubiquitin-like modifier activating enzyme 2;cyclin-dependent kinase 12 1005 129 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40040.[MT7]-AQVAK[MT7].2y3_1.heavy 402.763 / 461.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA2;CDK12 ubiquitin-like modifier activating enzyme 2;cyclin-dependent kinase 12 1007 130 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 292199.0 22.472700119018555 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 292199.0 536.0223787510522 0.0 - - - - - - - 798.0 584 7 1009 130 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 463127.0 22.472700119018555 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 463127.0 3038.4740325265443 0.0 - - - - - - - 352.8 926 5 1011 130 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 1747020.0 22.472700119018555 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1747020.0 2341.026362568211 0.0 - - - - - - - 1213.0 3494 4 1013 131 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40133.[MT7]-GTNVFK[MT7].2y5_1.heavy 477.287 / 752.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1015 131 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40133.[MT7]-GTNVFK[MT7].2b4_1.heavy 477.287 / 516.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1017 131 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40133.[MT7]-GTNVFK[MT7].2y3_1.heavy 477.287 / 537.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1019 131 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40133.[MT7]-GTNVFK[MT7].2b5_1.heavy 477.287 / 663.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1021 132 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20042.[MT7]-WLSYK[MT7].2b3_1.heavy 492.791 / 531.305 2342.0 32.18119812011719 36 18 2 10 6 3.4987235066906774 28.581852726792512 0.0 6 0.9844028627990777 9.86901532177149 2342.0 5.611723058727198 4.0 - - - - - - - 617.875 7 8 ACSL5 acyl-CoA synthetase long-chain family member 5 1023 132 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20042.[MT7]-WLSYK[MT7].2y4_1.heavy 492.791 / 654.394 10668.0 32.18119812011719 36 18 2 10 6 3.4987235066906774 28.581852726792512 0.0 6 0.9844028627990777 9.86901532177149 10668.0 29.354340116524533 0.0 - - - - - - - 613.1428571428571 21 7 ACSL5 acyl-CoA synthetase long-chain family member 5 1025 132 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20042.[MT7]-WLSYK[MT7].2y3_1.heavy 492.791 / 541.31 8717.0 32.18119812011719 36 18 2 10 6 3.4987235066906774 28.581852726792512 0.0 6 0.9844028627990777 9.86901532177149 8717.0 52.637269230769235 1.0 - - - - - - - 224.54545454545453 50 11 ACSL5 acyl-CoA synthetase long-chain family member 5 1027 133 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20142.[MT7]-AQQLEQIR.2y4_1.heavy 565.326 / 545.304 3128.0 24.492650032043457 44 18 10 6 10 3.467259998694095 28.841217571703275 0.030200958251953125 3 0.9823939354275091 9.287353434291255 3128.0 15.213752620545073 0.0 - - - - - - - 242.28571428571428 6 21 ISYNA1 inositol-3-phosphate synthase 1 1029 133 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20142.[MT7]-AQQLEQIR.2y5_1.heavy 565.326 / 658.388 2332.0 24.492650032043457 44 18 10 6 10 3.467259998694095 28.841217571703275 0.030200958251953125 3 0.9823939354275091 9.287353434291255 2332.0 10.633333333333333 0.0 - - - - - - - 199.95454545454547 4 22 ISYNA1 inositol-3-phosphate synthase 1 1031 133 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20142.[MT7]-AQQLEQIR.2y6_1.heavy 565.326 / 786.447 3234.0 24.492650032043457 44 18 10 6 10 3.467259998694095 28.841217571703275 0.030200958251953125 3 0.9823939354275091 9.287353434291255 3234.0 15.2038679245283 0.0 - - - - - - - 171.23076923076923 6 26 ISYNA1 inositol-3-phosphate synthase 1 1033 133 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20142.[MT7]-AQQLEQIR.2y7_1.heavy 565.326 / 914.505 4559.0 24.492650032043457 44 18 10 6 10 3.467259998694095 28.841217571703275 0.030200958251953125 3 0.9823939354275091 9.287353434291255 4559.0 25.37556603773585 0.0 - - - - - - - 173.13333333333333 9 15 ISYNA1 inositol-3-phosphate synthase 1 1035 134 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20354.[MT7]-NSSSSGSSGAGQK[MT7].3b9_1.heavy 481.242 / 895.387 N/A N/A - - - - - - - - - 0.0 - - - - - - - POMC proopiomelanocortin 1037 134 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20354.[MT7]-NSSSSGSSGAGQK[MT7].3b6_1.heavy 481.242 / 664.302 N/A N/A - - - - - - - - - 0.0 - - - - - - - POMC proopiomelanocortin 1039 134 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20354.[MT7]-NSSSSGSSGAGQK[MT7].3y4_1.heavy 481.242 / 547.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - POMC proopiomelanocortin 1041 134 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20354.[MT7]-NSSSSGSSGAGQK[MT7].3y5_1.heavy 481.242 / 604.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - POMC proopiomelanocortin 1043 135 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40644.[MT7]-SQPVLQIFVHGESLR.3y6_1.heavy 618.683 / 698.358 7559.0 38.212350845336914 38 13 10 5 10 1.3088700667517257 47.65226497288916 0.040699005126953125 3 0.9298110968397864 4.630784661046421 7559.0 22.741606837606838 0.0 - - - - - - - 240.0 15 9 ACSL5 acyl-CoA synthetase long-chain family member 5 1045 135 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40644.[MT7]-SQPVLQIFVHGESLR.3b4_1.heavy 618.683 / 556.321 5219.0 38.212350845336914 38 13 10 5 10 1.3088700667517257 47.65226497288916 0.040699005126953125 3 0.9298110968397864 4.630784661046421 5219.0 8.762765432098766 0.0 - - - - - - - 247.5 10 12 ACSL5 acyl-CoA synthetase long-chain family member 5 1047 135 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40644.[MT7]-SQPVLQIFVHGESLR.3b5_1.heavy 618.683 / 669.405 3240.0 38.212350845336914 38 13 10 5 10 1.3088700667517257 47.65226497288916 0.040699005126953125 3 0.9298110968397864 4.630784661046421 3240.0 12.550588235294118 0.0 - - - - - - - 216.0 6 10 ACSL5 acyl-CoA synthetase long-chain family member 5 1049 135 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40644.[MT7]-SQPVLQIFVHGESLR.3y8_1.heavy 618.683 / 944.495 2250.0 38.212350845336914 38 13 10 5 10 1.3088700667517257 47.65226497288916 0.040699005126953125 3 0.9298110968397864 4.630784661046421 2250.0 10.208333333333334 2.0 - - - - - - - 180.0 4 9 ACSL5 acyl-CoA synthetase long-chain family member 5 1051 136 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40466.[MT7]-FDVINLAAEK[MT7].2y4_1.heavy 704.408 / 562.332 2547.0 36.95389938354492 44 14 10 10 10 2.4506012884888357 40.80631168755528 0.0 3 0.9428339002630962 5.136912249466522 2547.0 3.4208791208791207 0.0 - - - - - - - 227.5 5 18 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1053 136 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40466.[MT7]-FDVINLAAEK[MT7].2b3_1.heavy 704.408 / 506.273 3093.0 36.95389938354492 44 14 10 10 10 2.4506012884888357 40.80631168755528 0.0 3 0.9428339002630962 5.136912249466522 3093.0 3.3017896389324966 0.0 - - - - - - - 266.5 6 14 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1055 136 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40466.[MT7]-FDVINLAAEK[MT7].2y6_1.heavy 704.408 / 789.459 2911.0 36.95389938354492 44 14 10 10 10 2.4506012884888357 40.80631168755528 0.0 3 0.9428339002630962 5.136912249466522 2911.0 37.21388278388278 0.0 - - - - - - - 151.66666666666666 5 12 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1057 136 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40466.[MT7]-FDVINLAAEK[MT7].2y7_1.heavy 704.408 / 902.543 1910.0 36.95389938354492 44 14 10 10 10 2.4506012884888357 40.80631168755528 0.0 3 0.9428339002630962 5.136912249466522 1910.0 6.401648351648352 0.0 - - - - - - - 224.46666666666667 3 15 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1059 137 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40320.[MT7]-FDDTFEK[MT7].2y4_1.heavy 595.303 / 668.374 3519.0 29.115500768025715 46 20 10 6 10 9.375345895238294 10.666273129270854 0.038700103759765625 3 0.9978996660788191 26.924159435253785 3519.0 11.004872727272726 0.0 - - - - - - - 228.46153846153845 7 13 NLK nemo-like kinase 1061 137 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40320.[MT7]-FDDTFEK[MT7].2b3_1.heavy 595.303 / 522.232 3849.0 29.115500768025715 46 20 10 6 10 9.375345895238294 10.666273129270854 0.038700103759765625 3 0.9978996660788191 26.924159435253785 3849.0 14.56496590909091 0.0 - - - - - - - 259.2857142857143 7 14 NLK nemo-like kinase 1063 137 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40320.[MT7]-FDDTFEK[MT7].2y3_1.heavy 595.303 / 567.326 N/A 29.115500768025715 46 20 10 6 10 9.375345895238294 10.666273129270854 0.038700103759765625 3 0.9978996660788191 26.924159435253785 2419.0 1.7992561983471076 10.0 - - - - - - - 1225.7142857142858 6 7 NLK nemo-like kinase 1065 137 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40320.[MT7]-FDDTFEK[MT7].2y6_1.heavy 595.303 / 898.427 1539.0 29.115500768025715 46 20 10 6 10 9.375345895238294 10.666273129270854 0.038700103759765625 3 0.9978996660788191 26.924159435253785 1539.0 11.309318181818181 0.0 - - - - - - - 188.57142857142858 3 7 NLK nemo-like kinase 1067 138 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40321.[MT7]-AAPLWESK[MT7].2y4_1.heavy 595.345 / 693.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1069 138 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40321.[MT7]-AAPLWESK[MT7].2y5_1.heavy 595.345 / 806.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1071 138 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40321.[MT7]-AAPLWESK[MT7].2y3_1.heavy 595.345 / 507.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1073 138 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40321.[MT7]-AAPLWESK[MT7].2y6_1.heavy 595.345 / 903.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1075 139 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40322.[MT7]-YFSPNFK[MT7].2y4_1.heavy 595.826 / 649.379 3372.0 32.421600341796875 45 15 10 10 10 2.444717456723841 40.9045224121767 0.0 3 0.9577348636770171 5.981768672447138 3372.0 16.393491620610266 0.0 - - - - - - - 216.22222222222223 6 9 PTEN phosphatase and tensin homolog 1077 139 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40322.[MT7]-YFSPNFK[MT7].2y5_1.heavy 595.826 / 736.411 1946.0 32.421600341796875 45 15 10 10 10 2.444717456723841 40.9045224121767 0.0 3 0.9577348636770171 5.981768672447138 1946.0 5.275350560450936 0.0 - - - - - - - 230.55555555555554 3 9 PTEN phosphatase and tensin homolog 1079 139 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40322.[MT7]-YFSPNFK[MT7].2y3_1.heavy 595.826 / 552.326 649.0 32.421600341796875 45 15 10 10 10 2.444717456723841 40.9045224121767 0.0 3 0.9577348636770171 5.981768672447138 649.0 1.4881953727506427 19.0 - - - - - - - 273.77777777777777 3 9 PTEN phosphatase and tensin homolog 1081 139 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40322.[MT7]-YFSPNFK[MT7].2y6_1.heavy 595.826 / 883.479 1427.0 32.421600341796875 45 15 10 10 10 2.444717456723841 40.9045224121767 0.0 3 0.9577348636770171 5.981768672447138 1427.0 11.307288276270935 0.0 - - - - - - - 187.55555555555554 2 9 PTEN phosphatase and tensin homolog 1083 140 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536150.[MT7]-VFSVLREESESVLTLK[MT7].4y4_1.heavy 531.809 / 618.431 7465.0 42.348201751708984 40 10 10 10 10 0.9531272775809178 68.37698561930861 0.0 3 0.8239791751359514 2.8973020638212215 7465.0 31.066252949791195 0.0 - - - - - - - 261.7857142857143 14 14 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 1085 140 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536150.[MT7]-VFSVLREESESVLTLK[MT7].4b11_2.heavy 531.809 / 704.365 30334.0 42.348201751708984 40 10 10 10 10 0.9531272775809178 68.37698561930861 0.0 3 0.8239791751359514 2.8973020638212215 30334.0 188.75642250714716 0.0 - - - - - - - 203.75 60 8 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 1087 140 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536150.[MT7]-VFSVLREESESVLTLK[MT7].4y3_1.heavy 531.809 / 505.347 21716.0 42.348201751708984 40 10 10 10 10 0.9531272775809178 68.37698561930861 0.0 3 0.8239791751359514 2.8973020638212215 21716.0 49.12132678132678 1.0 - - - - - - - 223.52941176470588 43 17 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 1089 140 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536150.[MT7]-VFSVLREESESVLTLK[MT7].4b10_2.heavy 531.809 / 660.849 10586.0 42.348201751708984 40 10 10 10 10 0.9531272775809178 68.37698561930861 0.0 3 0.8239791751359514 2.8973020638212215 10586.0 28.972210526315784 0.0 - - - - - - - 186.75 21 12 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 1091 141 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19997.[MT7]-EVHLK[MT7].2b3_1.heavy 457.289 / 510.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - IGF1;WDR11 insulin-like growth factor 1 (somatomedin C);WD repeat domain 11 1093 141 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19997.[MT7]-EVHLK[MT7].2y4_1.heavy 457.289 / 640.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - IGF1;WDR11 insulin-like growth factor 1 (somatomedin C);WD repeat domain 11 1095 141 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19997.[MT7]-EVHLK[MT7].2y3_2.heavy 457.289 / 271.183 N/A N/A - - - - - - - - - 0.0 - - - - - - - IGF1;WDR11 insulin-like growth factor 1 (somatomedin C);WD repeat domain 11 1097 141 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB19997.[MT7]-EVHLK[MT7].2y3_1.heavy 457.289 / 541.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - IGF1;WDR11 insulin-like growth factor 1 (somatomedin C);WD repeat domain 11 1099 142 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40125.[MT7]-VHPTSTR.2y6_1.heavy 471.268 / 698.358 4271.0 13.639633178710938 46 20 10 6 10 3.972410972378171 25.1736289863616 0.03610038757324219 3 0.9913668199470964 13.27284520787173 4271.0 109.53362462006078 0.0 - - - - - - - 73.35 8 20 ISYNA1 inositol-3-phosphate synthase 1 1101 142 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40125.[MT7]-VHPTSTR.2y4_1.heavy 471.268 / 464.246 N/A 13.639633178710938 46 20 10 6 10 3.972410972378171 25.1736289863616 0.03610038757324219 3 0.9913668199470964 13.27284520787173 188.0 1.5327433628318583 4.0 - - - - - - - 0.0 0 0 ISYNA1 inositol-3-phosphate synthase 1 1103 142 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40125.[MT7]-VHPTSTR.2y6_2.heavy 471.268 / 349.683 1561.0 13.639633178710938 46 20 10 6 10 3.972410972378171 25.1736289863616 0.03610038757324219 3 0.9913668199470964 13.27284520787173 1561.0 26.821824629271436 0.0 - - - - - - - 102.70833333333333 3 24 ISYNA1 inositol-3-phosphate synthase 1 1105 142 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40125.[MT7]-VHPTSTR.2y5_1.heavy 471.268 / 561.299 8560.0 13.639633178710938 46 20 10 6 10 3.972410972378171 25.1736289863616 0.03610038757324219 3 0.9913668199470964 13.27284520787173 8560.0 78.31489361702128 0.0 - - - - - - - 104.5 17 20 ISYNA1 inositol-3-phosphate synthase 1 1107 143 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40127.[MT7]-ASHVLK[MT7].2y4_1.heavy 471.802 / 640.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 1109 143 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40127.[MT7]-ASHVLK[MT7].2y5_1.heavy 471.802 / 727.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 1111 143 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40127.[MT7]-ASHVLK[MT7].2b4_1.heavy 471.802 / 539.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 1113 143 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40127.[MT7]-ASHVLK[MT7].2y3_1.heavy 471.802 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCZ protein kinase C, zeta 1115 144 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 450970.0 31.510499954223633 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 450970.0 630.483099489358 1.0 - - - - - - - 232.75 916 4 1117 144 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 473585.0 31.510499954223633 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 473585.0 481.6329281714079 0.0 - - - - - - - 186.2 947 5 1119 144 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 809882.0 31.510499954223633 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 809882.0 1111.8028017381048 0.0 - - - - - - - 399.0 1619 1 1121 145 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20155.[MT7]-EILAELTGR.2b3_1.heavy 573.336 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHA1 pyruvate dehydrogenase (lipoamide) alpha 1 1123 145 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20155.[MT7]-EILAELTGR.2y8_1.heavy 573.336 / 872.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHA1 pyruvate dehydrogenase (lipoamide) alpha 1 1125 145 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20155.[MT7]-EILAELTGR.2y6_1.heavy 573.336 / 646.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHA1 pyruvate dehydrogenase (lipoamide) alpha 1 1127 145 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20155.[MT7]-EILAELTGR.2y7_1.heavy 573.336 / 759.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHA1 pyruvate dehydrogenase (lipoamide) alpha 1 1129 146 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535961.[MT7]-YVYYYSYLLK[MT7].3y3_1.heavy 554.972 / 517.383 12408.0 42.03099822998047 44 14 10 10 10 1.513627654201949 44.21600496405554 0.0 3 0.9378010967552571 4.922591922454629 12408.0 11.997629877848595 1.0 - - - - - - - 785.4285714285714 25 7 PTEN phosphatase and tensin homolog 1131 146 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535961.[MT7]-YVYYYSYLLK[MT7].3b4_1.heavy 554.972 / 733.368 10504.0 42.03099822998047 44 14 10 10 10 1.513627654201949 44.21600496405554 0.0 3 0.9378010967552571 4.922591922454629 10504.0 94.61049645390071 0.0 - - - - - - - 258.3333333333333 21 12 PTEN phosphatase and tensin homolog 1133 146 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535961.[MT7]-YVYYYSYLLK[MT7].3b3_1.heavy 554.972 / 570.304 11914.0 42.03099822998047 44 14 10 10 10 1.513627654201949 44.21600496405554 0.0 3 0.9378010967552571 4.922591922454629 11914.0 72.40965055804966 0.0 - - - - - - - 234.58333333333334 23 12 PTEN phosphatase and tensin homolog 1135 146 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535961.[MT7]-YVYYYSYLLK[MT7].3y5_1.heavy 554.972 / 767.478 3595.0 42.03099822998047 44 14 10 10 10 1.513627654201949 44.21600496405554 0.0 3 0.9378010967552571 4.922591922454629 3595.0 39.72734193808611 0.0 - - - - - - - 176.0 7 10 PTEN phosphatase and tensin homolog 1137 147 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535549.[MT7]-IINEGAAILR.2y8_1.heavy 607.373 / 843.468 5978.0 34.507473945617676 46 20 10 6 10 4.6753665417544115 16.826530501979466 0.033100128173828125 3 0.9938115528944286 15.680045054120113 5978.0 31.340970873786407 0.0 - - - - - - - 247.2 11 15 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1139 147 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535549.[MT7]-IINEGAAILR.2y9_1.heavy 607.373 / 956.552 10616.0 34.507473945617676 46 20 10 6 10 4.6753665417544115 16.826530501979466 0.033100128173828125 3 0.9938115528944286 15.680045054120113 10616.0 43.443145631067964 0.0 - - - - - - - 242.78571428571428 21 14 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1141 147 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535549.[MT7]-IINEGAAILR.2y6_1.heavy 607.373 / 600.383 6287.0 34.507473945617676 46 20 10 6 10 4.6753665417544115 16.826530501979466 0.033100128173828125 3 0.9938115528944286 15.680045054120113 6287.0 15.862698440717859 0.0 - - - - - - - 631.0 12 8 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1143 147 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535549.[MT7]-IINEGAAILR.2y7_1.heavy 607.373 / 729.425 2989.0 34.507473945617676 46 20 10 6 10 4.6753665417544115 16.826530501979466 0.033100128173828125 3 0.9938115528944286 15.680045054120113 2989.0 13.05873786407767 0.0 - - - - - - - 260.52941176470586 5 17 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1145 148 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40266.[MT7]-LNQPGTPTR.2b3_1.heavy 564.318 / 500.295 7879.0 19.188175201416016 42 16 10 6 10 2.2322828159342816 35.45913622618714 0.0308990478515625 3 0.9667349443846766 6.7477180908195935 7879.0 42.817139693216305 0.0 - - - - - - - 195.21052631578948 15 19 MAP2K2 mitogen-activated protein kinase kinase 2 1147 148 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40266.[MT7]-LNQPGTPTR.2y8_1.heavy 564.318 / 870.443 6670.0 19.188175201416016 42 16 10 6 10 2.2322828159342816 35.45913622618714 0.0308990478515625 3 0.9667349443846766 6.7477180908195935 6670.0 204.19460699942624 0.0 - - - - - - - 121.76923076923077 13 13 MAP2K2 mitogen-activated protein kinase kinase 2 1149 148 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40266.[MT7]-LNQPGTPTR.2y6_1.heavy 564.318 / 628.341 10131.0 19.188175201416016 42 16 10 6 10 2.2322828159342816 35.45913622618714 0.0308990478515625 3 0.9667349443846766 6.7477180908195935 10131.0 65.64903280542985 0.0 - - - - - - - 157.8421052631579 20 19 MAP2K2 mitogen-activated protein kinase kinase 2 1151 148 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40266.[MT7]-LNQPGTPTR.2y7_1.heavy 564.318 / 756.4 1334.0 19.188175201416016 42 16 10 6 10 2.2322828159342816 35.45913622618714 0.0308990478515625 3 0.9667349443846766 6.7477180908195935 1334.0 9.643373493975904 1.0 - - - - - - - 101.83333333333333 3 18 MAP2K2 mitogen-activated protein kinase kinase 2 1153 149 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46289.[MT7]-ALTPASLQK[MT7].2y4_1.heavy 608.879 / 619.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 1155 149 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46289.[MT7]-ALTPASLQK[MT7].2y5_1.heavy 608.879 / 690.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 1157 149 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46289.[MT7]-ALTPASLQK[MT7].2y3_1.heavy 608.879 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 1159 149 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46289.[MT7]-ALTPASLQK[MT7].2y6_1.heavy 608.879 / 787.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 1161 150 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20153.[MT7]-DVVYFQAR.2y5_1.heavy 571.31 / 684.346 5111.0 30.150299072265625 47 17 10 10 10 2.184028044387865 36.56323022943615 0.0 3 0.9733365267560724 7.541092603863469 5111.0 18.5622029853821 0.0 - - - - - - - 270.1666666666667 10 12 ANAPC5 anaphase promoting complex subunit 5 1163 150 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20153.[MT7]-DVVYFQAR.2b4_1.heavy 571.31 / 621.336 1994.0 30.150299072265625 47 17 10 10 10 2.184028044387865 36.56323022943615 0.0 3 0.9733365267560724 7.541092603863469 1994.0 4.984622792937399 0.0 - - - - - - - 228.41666666666666 3 12 ANAPC5 anaphase promoting complex subunit 5 1165 150 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20153.[MT7]-DVVYFQAR.2y6_1.heavy 571.31 / 783.415 4363.0 30.150299072265625 47 17 10 10 10 2.184028044387865 36.56323022943615 0.0 3 0.9733365267560724 7.541092603863469 4363.0 25.100157313746966 0.0 - - - - - - - 287.7692307692308 8 13 ANAPC5 anaphase promoting complex subunit 5 1167 150 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20153.[MT7]-DVVYFQAR.2y7_1.heavy 571.31 / 882.483 3490.0 30.150299072265625 47 17 10 10 10 2.184028044387865 36.56323022943615 0.0 3 0.9733365267560724 7.541092603863469 3490.0 8.269646576679763 1.0 - - - - - - - 187.0 9 8 ANAPC5 anaphase promoting complex subunit 5 1169 151 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536018.[MT7]-VIDVTGGGSFSPEEVR.3y7_1.heavy 598.311 / 863.426 22924.0 33.80525016784668 45 20 10 5 10 7.145725506801211 13.994380263392607 0.041301727294921875 3 0.9936827278308642 15.519176797564144 22924.0 125.64034829586082 0.0 - - - - - - - 196.08333333333334 45 12 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1171 151 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536018.[MT7]-VIDVTGGGSFSPEEVR.3y6_1.heavy 598.311 / 716.357 82589.0 33.80525016784668 45 20 10 5 10 7.145725506801211 13.994380263392607 0.041301727294921875 3 0.9936827278308642 15.519176797564144 82589.0 157.4664928720965 0.0 - - - - - - - 614.125 165 8 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1173 151 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536018.[MT7]-VIDVTGGGSFSPEEVR.3b4_1.heavy 598.311 / 571.357 50658.0 33.80525016784668 45 20 10 5 10 7.145725506801211 13.994380263392607 0.041301727294921875 3 0.9936827278308642 15.519176797564144 50658.0 97.9506267077114 0.0 - - - - - - - 294.125 101 8 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1175 151 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536018.[MT7]-VIDVTGGGSFSPEEVR.3y4_1.heavy 598.311 / 532.273 19240.0 33.80525016784668 45 20 10 5 10 7.145725506801211 13.994380263392607 0.041301727294921875 3 0.9936827278308642 15.519176797564144 19240.0 54.91832841340934 0.0 - - - - - - - 688.5454545454545 38 11 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1177 152 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40054.[MT7]-ELAVK[MT7].2b3_1.heavy 424.278 / 458.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K2;KIF1A mitogen-activated protein kinase kinase kinase 2;kinesin family member 1A 1179 152 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40054.[MT7]-ELAVK[MT7].2y4_1.heavy 424.278 / 574.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K2;KIF1A mitogen-activated protein kinase kinase kinase 2;kinesin family member 1A 1181 152 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40054.[MT7]-ELAVK[MT7].2b4_1.heavy 424.278 / 557.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K2;KIF1A mitogen-activated protein kinase kinase kinase 2;kinesin family member 1A 1183 152 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40054.[MT7]-ELAVK[MT7].2y3_1.heavy 424.278 / 461.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K2;KIF1A mitogen-activated protein kinase kinase kinase 2;kinesin family member 1A 1185 153 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39770.[MT7]-QEQHVHNEK[MT7].3y3_1.heavy 479.588 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKX protein kinase, X-linked 1187 153 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39770.[MT7]-QEQHVHNEK[MT7].3b4_1.heavy 479.588 / 667.328 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKX protein kinase, X-linked 1189 153 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39770.[MT7]-QEQHVHNEK[MT7].3y4_1.heavy 479.588 / 671.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKX protein kinase, X-linked 1191 153 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39770.[MT7]-QEQHVHNEK[MT7].3b3_1.heavy 479.588 / 530.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKX protein kinase, X-linked 1193 154 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40053.[MT7]-GVSSVVR.2y5_1.heavy 424.26 / 547.32 5270.0 21.349199295043945 43 13 10 10 10 1.0626471443733667 62.7364097477337 0.0 3 0.9004098814306729 3.87777211601575 5270.0 2.735477102718482 1.0 - - - - - - - 193.73684210526315 10 19 PHKG1;PHKG2 phosphorylase kinase, gamma 1 (muscle);phosphorylase kinase, gamma 2 (testis) 1195 154 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40053.[MT7]-GVSSVVR.2b4_1.heavy 424.26 / 475.263 N/A 21.349199295043945 43 13 10 10 10 1.0626471443733667 62.7364097477337 0.0 3 0.9004098814306729 3.87777211601575 3579.0 5.665960930865617 2.0 - - - - - - - 720.8571428571429 7 14 PHKG1;PHKG2 phosphorylase kinase, gamma 1 (muscle);phosphorylase kinase, gamma 2 (testis) 1197 154 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40053.[MT7]-GVSSVVR.2y6_1.heavy 424.26 / 646.388 5518.0 21.349199295043945 43 13 10 10 10 1.0626471443733667 62.7364097477337 0.0 3 0.9004098814306729 3.87777211601575 5518.0 52.40713567839196 0.0 - - - - - - - 145.8125 11 16 PHKG1;PHKG2 phosphorylase kinase, gamma 1 (muscle);phosphorylase kinase, gamma 2 (testis) 1199 154 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40053.[MT7]-GVSSVVR.2b5_1.heavy 424.26 / 574.332 6811.0 21.349199295043945 43 13 10 10 10 1.0626471443733667 62.7364097477337 0.0 3 0.9004098814306729 3.87777211601575 6811.0 38.56358158082638 0.0 - - - - - - - 282.8125 13 16 PHKG1;PHKG2 phosphorylase kinase, gamma 1 (muscle);phosphorylase kinase, gamma 2 (testis) 1201 155 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536135.[MT7]-VFLLGEEVAQYDGAYK[MT7].3b4_1.heavy 697.373 / 617.414 30696.0 42.348201751708984 46 16 10 10 10 4.661888810393374 17.07294811627833 0.0 3 0.9642614477782231 6.508664891496724 30696.0 233.10400332441628 0.0 - - - - - - - 207.84615384615384 61 13 PDHB pyruvate dehydrogenase (lipoamide) beta 1203 155 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536135.[MT7]-VFLLGEEVAQYDGAYK[MT7].3y4_1.heavy 697.373 / 582.337 49127.0 42.348201751708984 46 16 10 10 10 4.661888810393374 17.07294811627833 0.0 3 0.9642614477782231 6.508664891496724 49127.0 129.9479788388497 0.0 - - - - - - - 300.25 98 12 PDHB pyruvate dehydrogenase (lipoamide) beta 1205 155 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536135.[MT7]-VFLLGEEVAQYDGAYK[MT7].3b3_1.heavy 697.373 / 504.33 29518.0 42.348201751708984 46 16 10 10 10 4.661888810393374 17.07294811627833 0.0 3 0.9642614477782231 6.508664891496724 29518.0 118.62193861605449 0.0 - - - - - - - 266.53846153846155 59 13 PDHB pyruvate dehydrogenase (lipoamide) beta 1207 155 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536135.[MT7]-VFLLGEEVAQYDGAYK[MT7].3b7_1.heavy 697.373 / 932.521 38041.0 42.348201751708984 46 16 10 10 10 4.661888810393374 17.07294811627833 0.0 3 0.9642614477782231 6.508664891496724 38041.0 590.3772227700582 0.0 - - - - - - - 296.7857142857143 76 14 PDHB pyruvate dehydrogenase (lipoamide) beta 1209 156 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536038.[MT7]-C[CAM]LGWC[CAM]PQPVPVLGGR.2y8_1.heavy 920.478 / 794.488 2869.0 37.5578498840332 41 16 10 5 10 2.9526619514280483 33.867744308363925 0.04010009765625 3 0.9623608475482182 6.341189721326054 2869.0 16.99696940561536 0.0 - - - - - - - 179.33333333333334 5 12 ANAPC11 anaphase promoting complex subunit 11 1211 156 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536038.[MT7]-C[CAM]LGWC[CAM]PQPVPVLGGR.2y6_1.heavy 920.478 / 598.367 4482.0 37.5578498840332 41 16 10 5 10 2.9526619514280483 33.867744308363925 0.04010009765625 3 0.9623608475482182 6.341189721326054 4482.0 46.72512778904665 0.0 - - - - - - - 189.22222222222223 8 9 ANAPC11 anaphase promoting complex subunit 11 1213 156 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536038.[MT7]-C[CAM]LGWC[CAM]PQPVPVLGGR.2y10_1.heavy 920.478 / 1019.6 4661.0 37.5578498840332 41 16 10 5 10 2.9526619514280483 33.867744308363925 0.04010009765625 3 0.9623608475482182 6.341189721326054 4661.0 74.71776846679082 0.0 - - - - - - - 169.44444444444446 9 9 ANAPC11 anaphase promoting complex subunit 11 1215 156 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536038.[MT7]-C[CAM]LGWC[CAM]PQPVPVLGGR.2y11_1.heavy 920.478 / 1179.63 2779.0 37.5578498840332 41 16 10 5 10 2.9526619514280483 33.867744308363925 0.04010009765625 3 0.9623608475482182 6.341189721326054 2779.0 40.89985501858736 0.0 - - - - - - - 157.0 5 8 ANAPC11 anaphase promoting complex subunit 11 1217 157 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20034.[MT7]-YIPGTK[MT7].2y4_1.heavy 483.797 / 546.337 45546.0 25.205900192260742 50 20 10 10 10 1.7540006121268632 32.11577564684476 0.0 3 0.9950752634875009 17.578931617801135 45546.0 115.4667022425929 0.0 - - - - - - - 674.9230769230769 91 13 CYCS cytochrome c, somatic 1219 157 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20034.[MT7]-YIPGTK[MT7].2y5_1.heavy 483.797 / 659.421 5980.0 25.205900192260742 50 20 10 10 10 1.7540006121268632 32.11577564684476 0.0 3 0.9950752634875009 17.578931617801135 5980.0 15.066333525530142 0.0 - - - - - - - 656.5 11 12 CYCS cytochrome c, somatic 1221 157 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20034.[MT7]-YIPGTK[MT7].2y3_1.heavy 483.797 / 449.284 4862.0 25.205900192260742 50 20 10 10 10 1.7540006121268632 32.11577564684476 0.0 3 0.9950752634875009 17.578931617801135 4862.0 2.5732479100692625 4.0 - - - - - - - 1751.0666666666666 9 15 CYCS cytochrome c, somatic 1223 158 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40529.[MT7]-ILEDNSIPQVK[MT7].3y3_1.heavy 515.303 / 518.342 12962.0 31.895766576131184 41 16 10 5 10 2.229961567708028 37.80964699625252 0.04419898986816406 3 0.9634221518585494 6.4331033588651705 12962.0 6.028021903067093 1.0 - - - - - - - 397.0 25 2 PDHB pyruvate dehydrogenase (lipoamide) beta 1225 158 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40529.[MT7]-ILEDNSIPQVK[MT7].3b6_1.heavy 515.303 / 816.422 25130.0 31.895766576131184 41 16 10 5 10 2.229961567708028 37.80964699625252 0.04419898986816406 3 0.9634221518585494 6.4331033588651705 25130.0 193.80560606060604 0.0 - - - - - - - 245.71428571428572 50 7 PDHB pyruvate dehydrogenase (lipoamide) beta 1227 158 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40529.[MT7]-ILEDNSIPQVK[MT7].3b5_1.heavy 515.303 / 729.39 16004.0 31.895766576131184 41 16 10 5 10 2.229961567708028 37.80964699625252 0.04419898986816406 3 0.9634221518585494 6.4331033588651705 16004.0 26.169111531190925 0.0 - - - - - - - 623.4285714285714 32 7 PDHB pyruvate dehydrogenase (lipoamide) beta 1229 158 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40529.[MT7]-ILEDNSIPQVK[MT7].3b3_1.heavy 515.303 / 500.32 N/A 31.895766576131184 41 16 10 5 10 2.229961567708028 37.80964699625252 0.04419898986816406 3 0.9634221518585494 6.4331033588651705 11110.0 5.760314022923064 1.0 - - - - - - - 661.5 30 2 PDHB pyruvate dehydrogenase (lipoamide) beta 1231 159 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20030.[MT7]-VTLSEK[MT7].2b3_1.heavy 482.799 / 458.31 4301.0 23.135099411010742 46 16 10 10 10 2.2866205239502553 43.73266090835432 0.0 3 0.9683715012542208 6.921045606344978 4301.0 3.6046476190476193 0.0 - - - - - - - 1228.5714285714287 8 7 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1233 159 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20030.[MT7]-VTLSEK[MT7].2y4_1.heavy 482.799 / 620.374 4301.0 23.135099411010742 46 16 10 10 10 2.2866205239502553 43.73266090835432 0.0 3 0.9683715012542208 6.921045606344978 4301.0 6.666549999999999 1.0 - - - - - - - 271.42857142857144 8 21 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1235 159 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20030.[MT7]-VTLSEK[MT7].2y5_1.heavy 482.799 / 721.421 15205.0 23.135099411010742 46 16 10 10 10 2.2866205239502553 43.73266090835432 0.0 3 0.9683715012542208 6.921045606344978 15205.0 49.09042857142857 0.0 - - - - - - - 197.05882352941177 30 17 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1237 159 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20030.[MT7]-VTLSEK[MT7].2y3_1.heavy 482.799 / 507.289 7602.0 23.135099411010742 46 16 10 10 10 2.2866205239502553 43.73266090835432 0.0 3 0.9683715012542208 6.921045606344978 7602.0 30.575995335924485 0.0 - - - - - - - 236.11111111111111 15 18 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1239 160 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20175.[MT7]-EVDILRK[MT7].2y4_1.heavy 580.866 / 673.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHKG1 phosphorylase kinase, gamma 1 (muscle) 1241 160 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20175.[MT7]-EVDILRK[MT7].2y5_1.heavy 580.866 / 788.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHKG1 phosphorylase kinase, gamma 1 (muscle) 1243 160 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20175.[MT7]-EVDILRK[MT7].2b4_1.heavy 580.866 / 601.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHKG1 phosphorylase kinase, gamma 1 (muscle) 1245 160 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20175.[MT7]-EVDILRK[MT7].2y6_1.heavy 580.866 / 887.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHKG1 phosphorylase kinase, gamma 1 (muscle) 1247 161 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20550.[MT7]-QTLQSATVEAIEAEK[MT7].3b4_1.heavy 636.017 / 615.358 13431.0 35.05375003814697 42 16 10 6 10 4.122149417415588 24.259188562528074 0.033000946044921875 3 0.964793223944248 6.557929750669425 13431.0 61.58843474208655 0.0 - - - - - - - 332.25 26 16 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1249 161 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20550.[MT7]-QTLQSATVEAIEAEK[MT7].3y4_1.heavy 636.017 / 620.337 26397.0 35.05375003814697 42 16 10 6 10 4.122149417415588 24.259188562528074 0.033000946044921875 3 0.964793223944248 6.557929750669425 26397.0 68.7737843848866 0.0 - - - - - - - 243.66666666666666 52 18 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1251 161 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20550.[MT7]-QTLQSATVEAIEAEK[MT7].3b7_1.heavy 636.017 / 874.475 6529.0 35.05375003814697 42 16 10 6 10 4.122149417415588 24.259188562528074 0.033000946044921875 3 0.964793223944248 6.557929750669425 6529.0 34.98928858674837 0.0 - - - - - - - 248.8 13 15 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1253 161 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20550.[MT7]-QTLQSATVEAIEAEK[MT7].3y5_1.heavy 636.017 / 733.421 14271.0 35.05375003814697 42 16 10 6 10 4.122149417415588 24.259188562528074 0.033000946044921875 3 0.964793223944248 6.557929750669425 14271.0 59.061465358675655 0.0 - - - - - - - 235.68421052631578 28 19 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1255 162 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 322874.0 26.1906000773112 23 -3 10 6 10 null 0.0 0.03330039978027344 3 0.0 0.0 322874.0 941.4342246107624 0.0 - - - - - - - 1267.0 645 3 1257 162 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 391902.0 26.1906000773112 23 -3 10 6 10 null 0.0 0.03330039978027344 3 0.0 0.0 391902.0 1812.609328567262 0.0 - - - - - - - 1222.0 783 1 1259 162 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 530356.0 26.1906000773112 23 -3 10 6 10 null 0.0 0.03330039978027344 3 0.0 0.0 530356.0 3653.3051376079816 0.0 - - - - - - - 2443.0 1060 1 1261 163 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535179.[MT7]-LFEVGGSPANTR.3b6_1.heavy 464.585 / 747.416 6962.0 32.0447998046875 50 20 10 10 10 41.4839219445516 2.4105724654882534 0.0 3 0.999171568271444 42.87498897254708 6962.0 33.97833506364688 0.0 - - - - - - - 236.3 13 10 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 1263 163 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535179.[MT7]-LFEVGGSPANTR.3b4_1.heavy 464.585 / 633.373 4466.0 32.0447998046875 50 20 10 10 10 41.4839219445516 2.4105724654882534 0.0 3 0.999171568271444 42.87498897254708 4466.0 15.617968425404255 1.0 - - - - - - - 262.75 10 8 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 1265 163 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535179.[MT7]-LFEVGGSPANTR.3b3_1.heavy 464.585 / 534.304 24302.0 32.0447998046875 50 20 10 10 10 41.4839219445516 2.4105724654882534 0.0 3 0.999171568271444 42.87498897254708 24302.0 68.14371366459626 0.0 - - - - - - - 732.0 48 7 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 1267 163 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535179.[MT7]-LFEVGGSPANTR.3y5_1.heavy 464.585 / 558.299 26273.0 32.0447998046875 50 20 10 10 10 41.4839219445516 2.4105724654882534 0.0 3 0.999171568271444 42.87498897254708 26273.0 54.12415820642978 0.0 - - - - - - - 262.75 52 4 PPP3CA;PPP3CB protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme 1269 164 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535393.[MT7]-IENIYNR.2b3_1.heavy 533.294 / 501.279 4537.0 26.610000610351562 44 14 10 10 10 9.088655758877625 11.002727207741575 0.0 3 0.9455232666626516 5.263386598214072 4537.0 3.794061092387525 0.0 - - - - - - - 659.7272727272727 9 11 ACSL5 acyl-CoA synthetase long-chain family member 5 1271 164 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535393.[MT7]-IENIYNR.2y5_1.heavy 533.294 / 679.352 6212.0 26.610000610351562 44 14 10 10 10 9.088655758877625 11.002727207741575 0.0 3 0.9455232666626516 5.263386598214072 6212.0 8.979460003491798 0.0 - - - - - - - 297.8666666666667 12 15 ACSL5 acyl-CoA synthetase long-chain family member 5 1273 164 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535393.[MT7]-IENIYNR.2b4_1.heavy 533.294 / 614.363 6212.0 26.610000610351562 44 14 10 10 10 9.088655758877625 11.002727207741575 0.0 3 0.9455232666626516 5.263386598214072 6212.0 6.866534300369825 0.0 - - - - - - - 843.3333333333334 12 12 ACSL5 acyl-CoA synthetase long-chain family member 5 1275 164 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535393.[MT7]-IENIYNR.2y6_1.heavy 533.294 / 808.395 18635.0 26.610000610351562 44 14 10 10 10 9.088655758877625 11.002727207741575 0.0 3 0.9455232666626516 5.263386598214072 18635.0 21.47252741078799 0.0 - - - - - - - 1221.4285714285713 37 14 ACSL5 acyl-CoA synthetase long-chain family member 5 1277 165 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535455.[MT7]-ELNNLLK[MT7].2b3_1.heavy 566.352 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 1279 165 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535455.[MT7]-ELNNLLK[MT7].2b4_1.heavy 566.352 / 615.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 1281 165 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535455.[MT7]-ELNNLLK[MT7].2y6_1.heavy 566.352 / 858.553 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 1283 165 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535455.[MT7]-ELNNLLK[MT7].2b5_1.heavy 566.352 / 728.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC5 anaphase promoting complex subunit 5 1285 166 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20429.[MT7]-SVDWEAVPQRK[MT7].3b6_1.heavy 534.966 / 832.396 6091.0 26.810925006866455 46 20 10 6 10 7.292585316541421 13.712558120256034 0.03429985046386719 3 0.991002805683559 13.001176730588147 6091.0 63.371554572271386 0.0 - - - - - - - 156.58333333333334 12 12 PRKX protein kinase, X-linked 1287 166 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20429.[MT7]-SVDWEAVPQRK[MT7].3y6_1.heavy 534.966 / 842.533 4587.0 26.810925006866455 46 20 10 6 10 7.292585316541421 13.712558120256034 0.03429985046386719 3 0.991002805683559 13.001176730588147 4587.0 16.23716814159292 0.0 - - - - - - - 183.25 9 16 PRKX protein kinase, X-linked 1289 166 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20429.[MT7]-SVDWEAVPQRK[MT7].3b5_1.heavy 534.966 / 761.359 6617.0 26.810925006866455 46 20 10 6 10 7.292585316541421 13.712558120256034 0.03429985046386719 3 0.991002805683559 13.001176730588147 6617.0 29.04625529849131 0.0 - - - - - - - 213.0 13 18 PRKX protein kinase, X-linked 1291 166 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20429.[MT7]-SVDWEAVPQRK[MT7].3y4_1.heavy 534.966 / 672.427 14588.0 26.810925006866455 46 20 10 6 10 7.292585316541421 13.712558120256034 0.03429985046386719 3 0.991002805683559 13.001176730588147 14588.0 33.89210301893229 0.0 - - - - - - - 687.5714285714286 29 7 PRKX protein kinase, X-linked 1293 167 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39401.[MT7]-IQFDR.2y4_1.heavy 411.733 / 565.273 18113.0 26.488266626993816 41 15 10 6 10 1.091535031122523 57.89471719470336 0.03320121765136719 3 0.9539255726881771 5.727309343698862 18113.0 28.41423698739732 0.0 - - - - - - - 791.2222222222222 36 9 ANAPC5 anaphase promoting complex subunit 5 1295 167 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39401.[MT7]-IQFDR.2b4_1.heavy 411.733 / 648.347 10232.0 26.488266626993816 41 15 10 6 10 1.091535031122523 57.89471719470336 0.03320121765136719 3 0.9539255726881771 5.727309343698862 10232.0 44.12892931262623 0.0 - - - - - - - 236.47368421052633 20 19 ANAPC5 anaphase promoting complex subunit 5 1297 167 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39401.[MT7]-IQFDR.2y3_1.heavy 411.733 / 437.214 3526.0 26.488266626993816 41 15 10 6 10 1.091535031122523 57.89471719470336 0.03320121765136719 3 0.9539255726881771 5.727309343698862 3526.0 6.536262781939772 1.0 - - - - - - - 760.5 7 10 ANAPC5 anaphase promoting complex subunit 5 1299 168 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40586.[MT7]-GSFEELC[CAM]QNQVVR.2y8_1.heavy 855.424 / 1016.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1301 168 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40586.[MT7]-GSFEELC[CAM]QNQVVR.2b4_1.heavy 855.424 / 565.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1303 168 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40586.[MT7]-GSFEELC[CAM]QNQVVR.2b5_1.heavy 855.424 / 694.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1305 168 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40586.[MT7]-GSFEELC[CAM]QNQVVR.2y7_1.heavy 855.424 / 903.446 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1307 169 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20025.[MT7]-LYFTK[MT7].2b3_1.heavy 480.294 / 568.325 1588.0 31.416900634765625 44 16 10 10 8 3.5722936148133657 20.597767001311507 0.0 4 0.9665840761208924 6.732382661211103 1588.0 5.5534971644612465 1.0 - - - - - - - 661.5714285714286 5 7 PTEN phosphatase and tensin homolog 1309 169 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20025.[MT7]-LYFTK[MT7].2y4_1.heavy 480.294 / 702.394 13368.0 31.416900634765625 44 16 10 10 8 3.5722936148133657 20.597767001311507 0.0 4 0.9665840761208924 6.732382661211103 13368.0 32.82986928537571 0.0 - - - - - - - 297.75 26 8 PTEN phosphatase and tensin homolog 1311 169 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20025.[MT7]-LYFTK[MT7].2y3_1.heavy 480.294 / 539.331 9265.0 31.416900634765625 44 16 10 10 8 3.5722936148133657 20.597767001311507 0.0 4 0.9665840761208924 6.732382661211103 9265.0 16.886531282005148 0.0 - - - - - - - 661.7 18 10 PTEN phosphatase and tensin homolog 1313 170 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20541.[MT7]-IMEGPAFNFLDAPAVR.3y7_1.heavy 631.333 / 741.425 3875.0 44.32605171203613 43 17 10 6 10 2.276354133894177 31.685192218388224 0.035900115966796875 3 0.97459932892102 7.727093766520771 3875.0 19.819716690697945 0.0 - - - - - - - 298.4117647058824 7 17 PDHB pyruvate dehydrogenase (lipoamide) beta 1315 170 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20541.[MT7]-IMEGPAFNFLDAPAVR.3y6_1.heavy 631.333 / 628.341 6889.0 44.32605171203613 43 17 10 6 10 2.276354133894177 31.685192218388224 0.035900115966796875 3 0.97459932892102 7.727093766520771 6889.0 15.344408352668212 1.0 - - - - - - - 219.52941176470588 13 17 PDHB pyruvate dehydrogenase (lipoamide) beta 1317 170 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20541.[MT7]-IMEGPAFNFLDAPAVR.3b6_1.heavy 631.333 / 743.388 4497.0 44.32605171203613 43 17 10 6 10 2.276354133894177 31.685192218388224 0.035900115966796875 3 0.97459932892102 7.727093766520771 4497.0 60.96743462343096 0.0 - - - - - - - 170.95238095238096 8 21 PDHB pyruvate dehydrogenase (lipoamide) beta 1319 170 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20541.[MT7]-IMEGPAFNFLDAPAVR.3y5_1.heavy 631.333 / 513.314 5932.0 44.32605171203613 43 17 10 6 10 2.276354133894177 31.685192218388224 0.035900115966796875 3 0.97459932892102 7.727093766520771 5932.0 24.851180770612274 0.0 - - - - - - - 191.42105263157896 11 19 PDHB pyruvate dehydrogenase (lipoamide) beta 1321 171 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 161888.0 36.031700134277344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 161888.0 171.99161502686812 0.0 - - - - - - - 292.1333333333333 323 15 1323 171 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 357226.0 36.031700134277344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 357226.0 120.12686719030894 0.0 - - - - - - - 210.71428571428572 714 14 1325 171 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 362771.0 36.031700134277344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 362771.0 161.6856332118273 0.0 - - - - - - - 704.375 725 8 1327 172 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44127.[MT7]-C[CAM]YDIVPTSSK[MT7].2y4_1.heavy 729.381 / 566.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1329 172 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44127.[MT7]-C[CAM]YDIVPTSSK[MT7].2b3_1.heavy 729.381 / 583.23 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1331 172 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44127.[MT7]-C[CAM]YDIVPTSSK[MT7].2y5_1.heavy 729.381 / 663.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1333 172 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44127.[MT7]-C[CAM]YDIVPTSSK[MT7].2y6_1.heavy 729.381 / 762.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1335 173 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40286.[MT7]-SC[CAM]IENILR.2y4_1.heavy 574.814 / 515.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 1337 173 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40286.[MT7]-SC[CAM]IENILR.2b4_1.heavy 574.814 / 634.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 1339 173 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40286.[MT7]-SC[CAM]IENILR.2b5_1.heavy 574.814 / 748.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 1341 173 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40286.[MT7]-SC[CAM]IENILR.2y7_1.heavy 574.814 / 917.487 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 1343 174 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39903.[MT7]-GLEGLQVAWLVVEK[MT7].2b8_1.heavy 915.042 / 912.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 1345 174 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39903.[MT7]-GLEGLQVAWLVVEK[MT7].2b4_1.heavy 915.042 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 1347 174 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39903.[MT7]-GLEGLQVAWLVVEK[MT7].2b6_1.heavy 915.042 / 742.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 1349 174 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39903.[MT7]-GLEGLQVAWLVVEK[MT7].2b5_1.heavy 915.042 / 614.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 1351 175 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20548.[MT7]-LTDFGFSC[CAM]QLEPGER.2y4_1.heavy 950.455 / 458.236 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHKG1 phosphorylase kinase, gamma 1 (muscle) 1353 175 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20548.[MT7]-LTDFGFSC[CAM]QLEPGER.2y9_1.heavy 950.455 / 1075.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHKG1 phosphorylase kinase, gamma 1 (muscle) 1355 175 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20548.[MT7]-LTDFGFSC[CAM]QLEPGER.2y10_1.heavy 950.455 / 1222.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHKG1 phosphorylase kinase, gamma 1 (muscle) 1357 175 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20548.[MT7]-LTDFGFSC[CAM]QLEPGER.2b5_1.heavy 950.455 / 678.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHKG1 phosphorylase kinase, gamma 1 (muscle) 1359 176 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536121.[MT7]-SPDPTPPALDQETSSLLR.3y6_1.heavy 690.027 / 676.399 6455.0 35.5004997253418 42 12 10 10 10 1.8863914380303533 53.01126690037009 0.0 3 0.8961929539936185 3.7968062408175802 6455.0 11.570054716296102 0.0 - - - - - - - 209.25 12 12 ANAPC11 anaphase promoting complex subunit 11 1361 176 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536121.[MT7]-SPDPTPPALDQETSSLLR.3b5_1.heavy 690.027 / 642.321 14972.0 35.5004997253418 42 12 10 10 10 1.8863914380303533 53.01126690037009 0.0 3 0.8961929539936185 3.7968062408175802 14972.0 47.449791908142565 0.0 - - - - - - - 784.375 29 8 ANAPC11 anaphase promoting complex subunit 11 1363 176 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536121.[MT7]-SPDPTPPALDQETSSLLR.3y8_1.heavy 690.027 / 933.5 3945.0 35.5004997253418 42 12 10 10 10 1.8863914380303533 53.01126690037009 0.0 3 0.8961929539936185 3.7968062408175802 3945.0 15.427374301675975 0.0 - - - - - - - 211.35714285714286 7 14 ANAPC11 anaphase promoting complex subunit 11 1365 176 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536121.[MT7]-SPDPTPPALDQETSSLLR.3y9_1.heavy 690.027 / 1048.53 3945.0 35.5004997253418 42 12 10 10 10 1.8863914380303533 53.01126690037009 0.0 3 0.8961929539936185 3.7968062408175802 3945.0 16.378794642857144 0.0 - - - - - - - 192.21428571428572 7 14 ANAPC11 anaphase promoting complex subunit 11 1367 177 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40189.[MT7]-EVSGLLK[MT7].2y4_1.heavy 517.328 / 574.404 1943.0 28.966824531555176 42 16 10 6 10 2.33569456479914 36.73776048975777 0.037899017333984375 3 0.9653979752928605 6.615326809266511 1943.0 5.415212962962963 3.0 - - - - - - - 688.5 3 8 PDHB pyruvate dehydrogenase (lipoamide) beta 1369 177 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40189.[MT7]-EVSGLLK[MT7].2y5_1.heavy 517.328 / 661.437 3563.0 28.966824531555176 42 16 10 6 10 2.33569456479914 36.73776048975777 0.037899017333984375 3 0.9653979752928605 6.615326809266511 3563.0 7.257962962962964 0.0 - - - - - - - 586.2857142857143 7 7 PDHB pyruvate dehydrogenase (lipoamide) beta 1371 177 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40189.[MT7]-EVSGLLK[MT7].2y6_1.heavy 517.328 / 760.505 3671.0 28.966824531555176 42 16 10 6 10 2.33569456479914 36.73776048975777 0.037899017333984375 3 0.9653979752928605 6.615326809266511 3671.0 19.091466049382717 0.0 - - - - - - - 216.0 7 13 PDHB pyruvate dehydrogenase (lipoamide) beta 1373 177 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40189.[MT7]-EVSGLLK[MT7].2b5_1.heavy 517.328 / 630.358 2591.0 28.966824531555176 42 16 10 6 10 2.33569456479914 36.73776048975777 0.037899017333984375 3 0.9653979752928605 6.615326809266511 2591.0 5.540718694885362 1.0 - - - - - - - 688.5 5 8 PDHB pyruvate dehydrogenase (lipoamide) beta 1375 178 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40698.[MT7]-FGHYQQAELALQEAIR.3y7_1.heavy 673.357 / 800.463 4149.0 36.94494915008545 40 14 10 6 10 8.510603160801377 11.750048511318884 0.035800933837890625 3 0.9474501233552555 5.359892546767509 4149.0 28.629630996309963 0.0 - - - - - - - 222.0 8 13 ANAPC5 anaphase promoting complex subunit 5 1377 178 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40698.[MT7]-FGHYQQAELALQEAIR.3y6_1.heavy 673.357 / 729.425 3879.0 36.94494915008545 40 14 10 6 10 8.510603160801377 11.750048511318884 0.035800933837890625 3 0.9474501233552555 5.359892546767509 3879.0 20.403894471077674 0.0 - - - - - - - 270.75 7 12 ANAPC5 anaphase promoting complex subunit 5 1379 178 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40698.[MT7]-FGHYQQAELALQEAIR.3b4_1.heavy 673.357 / 649.321 3157.0 36.94494915008545 40 14 10 6 10 8.510603160801377 11.750048511318884 0.035800933837890625 3 0.9474501233552555 5.359892546767509 3157.0 6.521397635376642 1.0 - - - - - - - 676.5 6 8 ANAPC5 anaphase promoting complex subunit 5 1381 178 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40698.[MT7]-FGHYQQAELALQEAIR.3y11_2.heavy 673.357 / 621.346 1804.0 36.94494915008545 40 14 10 6 10 8.510603160801377 11.750048511318884 0.035800933837890625 3 0.9474501233552555 5.359892546767509 1804.0 6.342730627306274 1.0 - - - - - - - 204.05263157894737 3 19 ANAPC5 anaphase promoting complex subunit 5 1383 179 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40696.[MT7]-EIVIRDPYALRPLRR.4y4_1.heavy 503.557 / 541.357 4419.0 30.396400451660156 30 5 10 5 10 0.44391038865631943 102.96744457699685 0.046600341796875 3 0.6534383548787346 2.032575830667361 4419.0 11.13494722955145 0.0 - - - - - - - 700.2727272727273 8 11 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1385 179 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40696.[MT7]-EIVIRDPYALRPLRR.4b8_2.heavy 503.557 / 565.82 1136.0 30.396400451660156 30 5 10 5 10 0.44391038865631943 102.96744457699685 0.046600341796875 3 0.6534383548787346 2.032575830667361 1136.0 2.7004754358161644 3.0 - - - - - - - 221.08333333333334 3 12 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1387 179 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40696.[MT7]-EIVIRDPYALRPLRR.4y9_2.heavy 503.557 / 571.351 8459.0 30.396400451660156 30 5 10 5 10 0.44391038865631943 102.96744457699685 0.046600341796875 3 0.6534383548787346 2.032575830667361 8459.0 16.607173804047402 0.0 - - - - - - - 631.4285714285714 16 7 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1389 179 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40696.[MT7]-EIVIRDPYALRPLRR.4b9_2.heavy 503.557 / 601.339 2020.0 30.396400451660156 30 5 10 5 10 0.44391038865631943 102.96744457699685 0.046600341796875 3 0.6534383548787346 2.032575830667361 2020.0 2.7961038997245544 2.0 - - - - - - - 231.66666666666666 4 6 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1391 180 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535793.[MT7]-EYLVLTLTK[MT7].3y3_1.heavy 456.618 / 505.347 16020.0 38.98809814453125 46 16 10 10 10 4.0129157353422285 24.91953646554002 0.0 3 0.9619770332759744 6.308899055033915 16020.0 16.512390485403063 1.0 - - - - - - - 184.5 32 12 PTEN phosphatase and tensin homolog 1393 180 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535793.[MT7]-EYLVLTLTK[MT7].3b4_1.heavy 456.618 / 649.368 32210.0 38.98809814453125 46 16 10 10 10 4.0129157353422285 24.91953646554002 0.0 3 0.9619770332759744 6.308899055033915 32210.0 410.3984850926672 0.0 - - - - - - - 159.625 64 8 PTEN phosphatase and tensin homolog 1395 180 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535793.[MT7]-EYLVLTLTK[MT7].3y4_1.heavy 456.618 / 606.394 15168.0 38.98809814453125 46 16 10 10 10 4.0129157353422285 24.91953646554002 0.0 3 0.9619770332759744 6.308899055033915 15168.0 81.58140845070423 0.0 - - - - - - - 205.83333333333334 30 12 PTEN phosphatase and tensin homolog 1397 180 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535793.[MT7]-EYLVLTLTK[MT7].3b3_1.heavy 456.618 / 550.299 33318.0 38.98809814453125 46 16 10 10 10 4.0129157353422285 24.91953646554002 0.0 3 0.9619770332759744 6.308899055033915 33318.0 242.90267940600899 0.0 - - - - - - - 216.9090909090909 66 11 PTEN phosphatase and tensin homolog 1399 181 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40592.[MT7]-GLTPTGMLPSGVLAGGR.2y12_1.heavy 864.483 / 1114.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1401 181 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40592.[MT7]-GLTPTGMLPSGVLAGGR.2y9_1.heavy 864.483 / 813.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1403 181 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40592.[MT7]-GLTPTGMLPSGVLAGGR.2b6_1.heavy 864.483 / 671.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1405 181 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40592.[MT7]-GLTPTGMLPSGVLAGGR.2b7_1.heavy 864.483 / 802.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1407 182 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535464.[MT7]-TSVVGLFLR.2y8_1.heavy 568.351 / 890.546 18098.0 41.9278507232666 39 14 10 5 10 3.7795563003681187 26.45813213319782 0.041301727294921875 3 0.9464613593307837 5.309721802762079 18098.0 197.3898503098681 0.0 - - - - - - - 144.72727272727272 36 11 ANAPC5 anaphase promoting complex subunit 5 1409 182 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535464.[MT7]-TSVVGLFLR.2y5_1.heavy 568.351 / 605.377 13392.0 41.9278507232666 39 14 10 5 10 3.7795563003681187 26.45813213319782 0.041301727294921875 3 0.9464613593307837 5.309721802762079 13392.0 64.89035516969219 0.0 - - - - - - - 217.08333333333334 26 12 ANAPC5 anaphase promoting complex subunit 5 1411 182 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535464.[MT7]-TSVVGLFLR.2y6_1.heavy 568.351 / 704.445 15781.0 41.9278507232666 39 14 10 5 10 3.7795563003681187 26.45813213319782 0.041301727294921875 3 0.9464613593307837 5.309721802762079 15781.0 56.813566492253116 0.0 - - - - - - - 202.6 31 15 ANAPC5 anaphase promoting complex subunit 5 1413 182 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535464.[MT7]-TSVVGLFLR.2b5_1.heavy 568.351 / 588.347 4923.0 41.9278507232666 39 14 10 5 10 3.7795563003681187 26.45813213319782 0.041301727294921875 3 0.9464613593307837 5.309721802762079 4923.0 26.685298033948545 0.0 - - - - - - - 155.0 9 14 ANAPC5 anaphase promoting complex subunit 5 1415 183 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40191.[MT7]-GFTPSLK[MT7].2y4_1.heavy 519.315 / 588.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1417 183 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40191.[MT7]-GFTPSLK[MT7].2y5_1.heavy 519.315 / 689.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1419 183 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40191.[MT7]-GFTPSLK[MT7].2y3_1.heavy 519.315 / 491.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1421 183 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40191.[MT7]-GFTPSLK[MT7].2y6_1.heavy 519.315 / 836.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1423 184 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535858.[MT7]-VIVLWTANTER.2y8_1.heavy 723.415 / 990.5 6798.0 38.614601135253906 46 16 10 10 10 3.1714953861697515 31.530867248327 0.0 3 0.9656662367582984 6.641270800306282 6798.0 48.74037735849056 0.0 - - - - - - - 176.54545454545453 13 11 ISYNA1 inositol-3-phosphate synthase 1 1425 184 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535858.[MT7]-VIVLWTANTER.2y9_1.heavy 723.415 / 1089.57 2913.0 38.614601135253906 46 16 10 10 10 3.1714953861697515 31.530867248327 0.0 3 0.9656662367582984 6.641270800306282 2913.0 14.098221656934728 0.0 - - - - - - - 200.54545454545453 5 11 ISYNA1 inositol-3-phosphate synthase 1 1427 184 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535858.[MT7]-VIVLWTANTER.2y10_1.heavy 723.415 / 1202.65 2737.0 38.614601135253906 46 16 10 10 10 3.1714953861697515 31.530867248327 0.0 3 0.9656662367582984 6.641270800306282 2737.0 33.58199134199134 0.0 - - - - - - - 163.92857142857142 5 14 ISYNA1 inositol-3-phosphate synthase 1 1429 184 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535858.[MT7]-VIVLWTANTER.2y7_1.heavy 723.415 / 877.416 7063.0 38.614601135253906 46 16 10 10 10 3.1714953861697515 31.530867248327 0.0 3 0.9656662367582984 6.641270800306282 7063.0 18.66453150889946 0.0 - - - - - - - 208.54545454545453 14 11 ISYNA1 inositol-3-phosphate synthase 1 1431 185 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536117.[MT7]-RRFHWTAPAALQVTVR.4y5_1.heavy 514.048 / 602.362 22033.0 31.075700759887695 45 15 10 10 10 2.087524706364869 38.25566894575191 0.0 3 0.9576844681046679 5.978180122933938 22033.0 47.99760410870546 0.0 - - - - - - - 682.2 44 10 PDHB pyruvate dehydrogenase (lipoamide) beta 1433 185 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536117.[MT7]-RRFHWTAPAALQVTVR.4b7_2.heavy 514.048 / 550.305 12197.0 31.075700759887695 45 15 10 10 10 2.087524706364869 38.25566894575191 0.0 3 0.9576844681046679 5.978180122933938 12197.0 44.19472773536896 0.0 - - - - - - - 262.0 24 8 PDHB pyruvate dehydrogenase (lipoamide) beta 1435 185 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536117.[MT7]-RRFHWTAPAALQVTVR.4b9_2.heavy 514.048 / 634.35 20590.0 31.075700759887695 45 15 10 10 10 2.087524706364869 38.25566894575191 0.0 3 0.9576844681046679 5.978180122933938 20590.0 61.350211603265045 0.0 - - - - - - - 205.85714285714286 41 7 PDHB pyruvate dehydrogenase (lipoamide) beta 1437 185 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536117.[MT7]-RRFHWTAPAALQVTVR.4b10_2.heavy 514.048 / 669.869 34623.0 31.075700759887695 45 15 10 10 10 2.087524706364869 38.25566894575191 0.0 3 0.9576844681046679 5.978180122933938 34623.0 60.4401858590102 0.0 - - - - - - - 674.7142857142857 69 7 PDHB pyruvate dehydrogenase (lipoamide) beta 1439 186 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40549.[MT7]-TQIDSLYEHIQD.2b8_1.heavy 803.397 / 1094.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1441 186 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40549.[MT7]-TQIDSLYEHIQD.2b4_1.heavy 803.397 / 602.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1443 186 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40549.[MT7]-TQIDSLYEHIQD.2b6_1.heavy 803.397 / 802.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1445 186 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40549.[MT7]-TQIDSLYEHIQD.2b5_1.heavy 803.397 / 689.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1447 187 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20013.[MT7]-IFIMK[MT7].2b3_1.heavy 470.301 / 518.346 1263.0 35.25076548258463 39 17 10 6 6 2.4169598148283056 41.37429153206825 0.033100128173828125 6 0.9729075613624787 7.480883744134968 1263.0 2.8642678925966423 5.0 - - - - - - - 777.0 4 12 CYCS cytochrome c, somatic 1449 187 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20013.[MT7]-IFIMK[MT7].2y4_1.heavy 470.301 / 682.408 3691.0 35.25076548258463 39 17 10 6 6 2.4169598148283056 41.37429153206825 0.033100128173828125 6 0.9729075613624787 7.480883744134968 3691.0 16.23042922156324 0.0 - - - - - - - 216.53846153846155 7 13 CYCS cytochrome c, somatic 1451 187 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20013.[MT7]-IFIMK[MT7].2y3_1.heavy 470.301 / 535.339 1943.0 35.25076548258463 39 17 10 6 6 2.4169598148283056 41.37429153206825 0.033100128173828125 6 0.9729075613624787 7.480883744134968 1943.0 2.158907046375885 2.0 - - - - - - - 354.0 6 14 CYCS cytochrome c, somatic 1453 188 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535275.[MT7]-SQWSPALTVSK[MT7].3b6_1.heavy 497.952 / 801.401 33095.0 31.27120018005371 48 18 10 10 10 2.8973170071579673 23.567892717269455 0.0 3 0.981449035240611 9.047017754969854 33095.0 265.44575150250205 0.0 - - - - - - - 239.4 66 5 UBE2D4;UBE2D1 ubiquitin-conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) 1455 188 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535275.[MT7]-SQWSPALTVSK[MT7].3b4_1.heavy 497.952 / 633.311 38677.0 31.27120018005371 48 18 10 10 10 2.8973170071579673 23.567892717269455 0.0 3 0.981449035240611 9.047017754969854 38677.0 58.9165770609319 0.0 - - - - - - - 683.5714285714286 77 7 UBE2D4;UBE2D1 ubiquitin-conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) 1457 188 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535275.[MT7]-SQWSPALTVSK[MT7].3b3_1.heavy 497.952 / 546.279 12095.0 31.27120018005371 48 18 10 10 10 2.8973170071579673 23.567892717269455 0.0 3 0.981449035240611 9.047017754969854 12095.0 9.857586257430611 0.0 - - - - - - - 319.2 24 5 UBE2D4;UBE2D1 ubiquitin-conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) 1459 188 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535275.[MT7]-SQWSPALTVSK[MT7].3y4_1.heavy 497.952 / 578.363 43993.0 31.27120018005371 48 18 10 10 10 2.8973170071579673 23.567892717269455 0.0 3 0.981449035240611 9.047017754969854 43993.0 107.59772301722047 0.0 - - - - - - - 228.0 87 7 UBE2D4;UBE2D1 ubiquitin-conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) 1461 189 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43779.[MT7]-LGPAGNK[MT7].2y6_1.heavy 472.792 / 687.391 9659.0 14.361499786376953 50 20 10 10 10 32.30502485848259 3.0954936712807446 0.0 2 0.9985409210368816 32.305030236199215 9659.0 131.92071438808614 0.0 - - - - - - - 149.71428571428572 19 14 PRKCA protein kinase C, alpha 1463 189 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43779.[MT7]-LGPAGNK[MT7].2y5_1.heavy 472.792 / 630.369 2139.0 14.361499786376953 50 20 10 10 10 32.30502485848259 3.0954936712807446 0.0 2 0.9985409210368816 32.305030236199215 2139.0 93.73864095744682 0.0 - - - - - - - 129.0 4 21 PRKCA protein kinase C, alpha 1465 190 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20538.[MT7]-LTEQSNTPLLLPLAAR.2y5_1.heavy 941.05 / 527.33 7332.0 40.85719966888428 38 12 10 6 10 1.4328337384272016 55.226743812545735 0.034000396728515625 3 0.8888973092988995 3.6677070174275537 7332.0 33.255230280004284 0.0 - - - - - - - 232.83333333333334 14 18 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1467 190 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20538.[MT7]-LTEQSNTPLLLPLAAR.2b4_1.heavy 941.05 / 616.342 2993.0 40.85719966888428 38 12 10 6 10 1.4328337384272016 55.226743812545735 0.034000396728515625 3 0.8888973092988995 3.6677070174275537 2993.0 19.309354515050167 0.0 - - - - - - - 233.75 5 16 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1469 190 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20538.[MT7]-LTEQSNTPLLLPLAAR.2y9_1.heavy 941.05 / 963.635 3890.0 40.85719966888428 38 12 10 6 10 1.4328337384272016 55.226743812545735 0.034000396728515625 3 0.8888973092988995 3.6677070174275537 3890.0 39.83545238095238 0.0 - - - - - - - 135.6875 7 16 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1471 190 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20538.[MT7]-LTEQSNTPLLLPLAAR.2b6_1.heavy 941.05 / 817.417 973.0 40.85719966888428 38 12 10 6 10 1.4328337384272016 55.226743812545735 0.034000396728515625 3 0.8888973092988995 3.6677070174275537 973.0 0.0 2.0 - - - - - - - 194.66666666666666 2 15 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1473 191 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20537.[MT7]-LTEQSNTPLLLPLAAR.3y7_1.heavy 627.702 / 753.498 35768.0 40.85719966888428 41 15 10 6 10 7.723741843762422 12.947092487400843 0.034000396728515625 3 0.951789156577668 5.597957107988159 35768.0 44.9504712801327 0.0 - - - - - - - 222.0 71 6 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1475 191 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20537.[MT7]-LTEQSNTPLLLPLAAR.3y6_1.heavy 627.702 / 640.414 43454.0 40.85719966888428 41 15 10 6 10 7.723741843762422 12.947092487400843 0.034000396728515625 3 0.951789156577668 5.597957107988159 43454.0 50.39405036524134 0.0 - - - - - - - 766.75 86 8 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1477 191 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20537.[MT7]-LTEQSNTPLLLPLAAR.3y5_1.heavy 627.702 / 527.33 116985.0 40.85719966888428 41 15 10 6 10 7.723741843762422 12.947092487400843 0.034000396728515625 3 0.951789156577668 5.597957107988159 116985.0 191.49075078110786 0.0 - - - - - - - 320.6666666666667 233 3 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1479 191 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20537.[MT7]-LTEQSNTPLLLPLAAR.3y9_1.heavy 627.702 / 963.635 34955.0 40.85719966888428 41 15 10 6 10 7.723741843762422 12.947092487400843 0.034000396728515625 3 0.951789156577668 5.597957107988159 34955.0 51.14393090608687 0.0 - - - - - - - 235.36363636363637 69 11 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1481 192 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20015.[MT7]-DVYEK[MT7].2b3_1.heavy 471.263 / 522.268 2259.0 19.25007438659668 40 14 10 6 10 1.8359976527205333 45.85116018488623 0.0308990478515625 3 0.9382516320311254 4.94070748335213 2259.0 0.6372355430183356 1.0 - - - - - - - 189.27272727272728 4 22 FNBP1L;TRIP10 formin binding protein 1-like;thyroid hormone receptor interactor 10 1483 192 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20015.[MT7]-DVYEK[MT7].2y4_1.heavy 471.263 / 682.389 6246.0 19.25007438659668 40 14 10 6 10 1.8359976527205333 45.85116018488623 0.0308990478515625 3 0.9382516320311254 4.94070748335213 6246.0 40.68195106986732 0.0 - - - - - - - 187.66666666666666 12 21 FNBP1L;TRIP10 formin binding protein 1-like;thyroid hormone receptor interactor 10 1485 192 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20015.[MT7]-DVYEK[MT7].2b4_1.heavy 471.263 / 651.311 2481.0 19.25007438659668 40 14 10 6 10 1.8359976527205333 45.85116018488623 0.0308990478515625 3 0.9382516320311254 4.94070748335213 2481.0 8.48305803538921 0.0 - - - - - - - 209.3181818181818 4 22 FNBP1L;TRIP10 formin binding protein 1-like;thyroid hormone receptor interactor 10 1487 192 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20015.[MT7]-DVYEK[MT7].2y3_1.heavy 471.263 / 583.321 5803.0 19.25007438659668 40 14 10 6 10 1.8359976527205333 45.85116018488623 0.0308990478515625 3 0.9382516320311254 4.94070748335213 5803.0 11.36908363545443 0.0 - - - - - - - 270.36842105263156 11 19 FNBP1L;TRIP10 formin binding protein 1-like;thyroid hormone receptor interactor 10 1489 193 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20309.[MT7]-AVLLSLAEEDY.2b4_1.heavy 683.865 / 541.383 35296.0 44.63990020751953 43 13 10 10 10 1.760072724666244 56.81583414058224 0.0 3 0.9103611929871006 4.090868587605034 35296.0 183.97258973648894 0.0 - - - - - - - 265.26666666666665 70 15 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1491 193 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20309.[MT7]-AVLLSLAEEDY.2b6_1.heavy 683.865 / 741.499 23531.0 44.63990020751953 43 13 10 10 10 1.760072724666244 56.81583414058224 0.0 3 0.9103611929871006 4.090868587605034 23531.0 127.90672070145101 0.0 - - - - - - - 184.5 47 16 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1493 193 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20309.[MT7]-AVLLSLAEEDY.2b7_1.heavy 683.865 / 812.536 33071.0 44.63990020751953 43 13 10 10 10 1.760072724666244 56.81583414058224 0.0 3 0.9103611929871006 4.090868587605034 33071.0 162.02883339676634 0.0 - - - - - - - 192.42857142857142 66 14 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1495 193 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20309.[MT7]-AVLLSLAEEDY.2b5_1.heavy 683.865 / 628.415 37178.0 44.63990020751953 43 13 10 10 10 1.760072724666244 56.81583414058224 0.0 3 0.9103611929871006 4.090868587605034 37178.0 81.05454823521977 0.0 - - - - - - - 213.76923076923077 74 13 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1497 194 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 296322.0 38.86410140991211 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 296322.0 205.01066890454763 0.0 - - - - - - - 374.0 592 5 1499 194 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 576314.0 38.86410140991211 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 576314.0 226.24839528449337 0.0 - - - - - - - 680.0 1152 2 1501 194 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 712411.0 38.86410140991211 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 712411.0 299.7345865185229 0.0 - - - - - - - 425.0 1424 1 1503 195 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43977.[MT7]-TMYEVFQR.2b4_1.heavy 609.309 / 669.303 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1505 195 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43977.[MT7]-TMYEVFQR.2y6_1.heavy 609.309 / 841.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1507 195 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43977.[MT7]-TMYEVFQR.2b5_1.heavy 609.309 / 768.372 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1509 195 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43977.[MT7]-TMYEVFQR.2y7_1.heavy 609.309 / 972.461 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1511 196 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 672296.0 34.1349983215332 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 672296.0 351.4135371893475 0.0 - - - - - - - 1266.4285714285713 1344 7 1513 196 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 97913.0 34.1349983215332 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 97913.0 466.27501456310677 0.0 - - - - - - - 695.6666666666666 210 12 1515 196 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 76784.0 34.1349983215332 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 76784.0 94.06026720580917 0.0 - - - - - - - 738.5833333333334 153 12 1517 197 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20407.[MT7]-AQEALDFYGEVR.2b4_1.heavy 771.389 / 544.285 7195.0 34.90132427215576 41 15 10 6 10 1.617251402113117 42.35831568066375 0.033702850341796875 3 0.9543924874461015 5.7567796750195255 7195.0 20.2359375 0.0 - - - - - - - 262.7368421052632 14 19 PTEN phosphatase and tensin homolog 1519 197 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20407.[MT7]-AQEALDFYGEVR.2y9_1.heavy 771.389 / 1069.53 3837.0 34.90132427215576 41 15 10 6 10 1.617251402113117 42.35831568066375 0.033702850341796875 3 0.9543924874461015 5.7567796750195255 3837.0 27.978125 0.0 - - - - - - - 192.0 7 11 PTEN phosphatase and tensin homolog 1521 197 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20407.[MT7]-AQEALDFYGEVR.2y6_1.heavy 771.389 / 770.383 7099.0 34.90132427215576 41 15 10 6 10 1.617251402113117 42.35831568066375 0.033702850341796875 3 0.9543924874461015 5.7567796750195255 7099.0 21.18079613095238 0.0 - - - - - - - 304.0 14 12 PTEN phosphatase and tensin homolog 1523 197 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20407.[MT7]-AQEALDFYGEVR.2y10_1.heavy 771.389 / 1198.57 2590.0 34.90132427215576 41 15 10 6 10 1.617251402113117 42.35831568066375 0.033702850341796875 3 0.9543924874461015 5.7567796750195255 2590.0 35.005468750000006 0.0 - - - - - - - 168.0 5 8 PTEN phosphatase and tensin homolog 1525 198 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20186.[MT7]-VMSIPDVIR.2y8_1.heavy 587.343 / 930.508 3843.0 37.0443000793457 41 15 10 6 10 2.6557607271322876 37.65399457050516 0.03780364990234375 3 0.9572880161926495 5.950171055217918 3843.0 24.465 0.0 - - - - - - - 149.54545454545453 7 11 PRKX protein kinase, X-linked 1527 198 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20186.[MT7]-VMSIPDVIR.2y5_1.heavy 587.343 / 599.351 2562.0 37.0443000793457 41 15 10 6 10 2.6557607271322876 37.65399457050516 0.03780364990234375 3 0.9572880161926495 5.950171055217918 2562.0 14.040278873644363 1.0 - - - - - - - 238.92307692307693 5 13 PRKX protein kinase, X-linked 1529 198 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20186.[MT7]-VMSIPDVIR.2b4_1.heavy 587.343 / 575.334 1647.0 37.0443000793457 41 15 10 6 10 2.6557607271322876 37.65399457050516 0.03780364990234375 3 0.9572880161926495 5.950171055217918 1647.0 3.95048602673147 4.0 - - - - - - - 279.5882352941176 3 17 PRKX protein kinase, X-linked 1531 198 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20186.[MT7]-VMSIPDVIR.2y7_1.heavy 587.343 / 799.467 1281.0 37.0443000793457 41 15 10 6 10 2.6557607271322876 37.65399457050516 0.03780364990234375 3 0.9572880161926495 5.950171055217918 1281.0 13.373076923076923 1.0 - - - - - - - 224.27272727272728 2 11 PRKX protein kinase, X-linked 1533 199 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536105.[MT7]-TYNNLDITVTQALQHR.3y7_1.heavy 677.696 / 853.464 5579.0 36.068199157714844 48 18 10 10 10 6.63366008999766 15.074634310971348 0.0 3 0.9884717864227978 11.483208709302115 5579.0 18.36420833333333 0.0 - - - - - - - 731.25 11 8 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1535 199 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536105.[MT7]-TYNNLDITVTQALQHR.3b6_1.heavy 677.696 / 865.417 7738.0 36.068199157714844 48 18 10 10 10 6.63366008999766 15.074634310971348 0.0 3 0.9884717864227978 11.483208709302115 7738.0 58.75148148148148 0.0 - - - - - - - 218.57142857142858 15 14 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1537 199 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536105.[MT7]-TYNNLDITVTQALQHR.3b4_1.heavy 677.696 / 637.306 4589.0 36.068199157714844 48 18 10 10 10 6.63366008999766 15.074634310971348 0.0 3 0.9884717864227978 11.483208709302115 4589.0 12.917185185185186 0.0 - - - - - - - 270.0 9 17 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1539 199 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536105.[MT7]-TYNNLDITVTQALQHR.3y5_1.heavy 677.696 / 624.358 4229.0 36.068199157714844 48 18 10 10 10 6.63366008999766 15.074634310971348 0.0 3 0.9884717864227978 11.483208709302115 4229.0 7.971329365079365 0.0 - - - - - - - 251.05263157894737 8 19 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1541 200 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40160.[MT7]-LEEWK[MT7].2b3_1.heavy 496.786 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1;STAT2 chromosome 3 open reading frame 1;signal transducer and activator of transcription 2, 113kDa 1543 200 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40160.[MT7]-LEEWK[MT7].2y4_1.heavy 496.786 / 735.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1;STAT2 chromosome 3 open reading frame 1;signal transducer and activator of transcription 2, 113kDa 1545 200 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40160.[MT7]-LEEWK[MT7].2b4_1.heavy 496.786 / 702.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1;STAT2 chromosome 3 open reading frame 1;signal transducer and activator of transcription 2, 113kDa 1547 200 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40160.[MT7]-LEEWK[MT7].2y3_1.heavy 496.786 / 606.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1;STAT2 chromosome 3 open reading frame 1;signal transducer and activator of transcription 2, 113kDa 1549 201 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40166.[MT7]-GVSSVVRR.2b6_1.heavy 502.31 / 673.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHKG1;PHKG2 phosphorylase kinase, gamma 1 (muscle);phosphorylase kinase, gamma 2 (testis) 1551 201 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40166.[MT7]-GVSSVVRR.2y6_1.heavy 502.31 / 703.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHKG1;PHKG2 phosphorylase kinase, gamma 1 (muscle);phosphorylase kinase, gamma 2 (testis) 1553 201 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40166.[MT7]-GVSSVVRR.2b7_1.heavy 502.31 / 829.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHKG1;PHKG2 phosphorylase kinase, gamma 1 (muscle);phosphorylase kinase, gamma 2 (testis) 1555 201 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40166.[MT7]-GVSSVVRR.2b5_1.heavy 502.31 / 574.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHKG1;PHKG2 phosphorylase kinase, gamma 1 (muscle);phosphorylase kinase, gamma 2 (testis) 1557 202 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20668.[MT7]-FDDLQFFENC[CAM]GGGSFGSVYR.3b4_1.heavy 816.035 / 635.316 6573.0 42.894100189208984 43 13 10 10 10 1.6582292510793781 47.65804923699366 0.0 3 0.9212901675133163 4.3697566383469075 6573.0 20.773581121665813 0.0 - - - - - - - 246.9090909090909 13 11 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1559 202 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20668.[MT7]-FDDLQFFENC[CAM]GGGSFGSVYR.3b5_1.heavy 816.035 / 763.374 18330.0 42.894100189208984 43 13 10 10 10 1.6582292510793781 47.65804923699366 0.0 3 0.9212901675133163 4.3697566383469075 18330.0 60.30247674593367 0.0 - - - - - - - 234.71428571428572 36 7 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1561 202 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20668.[MT7]-FDDLQFFENC[CAM]GGGSFGSVYR.3b3_1.heavy 816.035 / 522.232 10429.0 42.894100189208984 43 13 10 10 10 1.6582292510793781 47.65804923699366 0.0 3 0.9212901675133163 4.3697566383469075 10429.0 24.407983609386694 0.0 - - - - - - - 259.0 20 10 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1563 202 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20668.[MT7]-FDDLQFFENC[CAM]GGGSFGSVYR.3y10_1.heavy 816.035 / 986.469 8406.0 42.894100189208984 43 13 10 10 10 1.6582292510793781 47.65804923699366 0.0 3 0.9212901675133163 4.3697566383469075 8406.0 24.27537871632335 0.0 - - - - - - - 221.1 16 10 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1565 203 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20003.[MT7]-VQYLTR.2y4_1.heavy 462.275 / 552.314 19437.0 25.44930076599121 46 16 10 10 10 3.1136738433995794 32.11640172652693 0.0 3 0.9626934620229615 6.369574126963964 19437.0 75.6165059905266 0.0 - - - - - - - 589.375 38 8 PLN phospholamban 1567 203 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20003.[MT7]-VQYLTR.2b3_1.heavy 462.275 / 535.3 16877.0 25.44930076599121 46 16 10 10 10 3.1136738433995794 32.11640172652693 0.0 3 0.9626934620229615 6.369574126963964 16877.0 33.96775257161308 0.0 - - - - - - - 715.0 33 14 PLN phospholamban 1569 203 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20003.[MT7]-VQYLTR.2y5_1.heavy 462.275 / 680.373 71348.0 25.44930076599121 46 16 10 10 10 3.1136738433995794 32.11640172652693 0.0 3 0.9626934620229615 6.369574126963964 71348.0 236.59937057099435 0.0 - - - - - - - 218.25 142 12 PLN phospholamban 1571 203 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20003.[MT7]-VQYLTR.2b4_1.heavy 462.275 / 648.384 14316.0 25.44930076599121 46 16 10 10 10 3.1136738433995794 32.11640172652693 0.0 3 0.9626934620229615 6.369574126963964 14316.0 41.083774340254315 0.0 - - - - - - - 698.5 28 8 PLN phospholamban 1573 204 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40164.[MT7]-GVTIPSQR.2y5_1.heavy 501.297 / 600.346 2159.0 23.00219964981079 39 18 10 3 8 5.226652868237933 19.1327035716671 0.06640052795410156 4 0.9868317142806105 10.74286252910897 2159.0 5.047943483507643 1.0 - - - - - - - 317.1578947368421 4 19 PTEN phosphatase and tensin homolog 1575 204 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40164.[MT7]-GVTIPSQR.2b4_1.heavy 501.297 / 515.331 3264.0 23.00219964981079 39 18 10 3 8 5.226652868237933 19.1327035716671 0.06640052795410156 4 0.9868317142806105 10.74286252910897 3264.0 5.276991150442478 1.0 - - - - - - - 263.0 6 17 PTEN phosphatase and tensin homolog 1577 204 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40164.[MT7]-GVTIPSQR.2y6_1.heavy 501.297 / 701.394 3264.0 23.00219964981079 39 18 10 3 8 5.226652868237933 19.1327035716671 0.06640052795410156 4 0.9868317142806105 10.74286252910897 3264.0 13.91370420624152 0.0 - - - - - - - 190.0 6 23 PTEN phosphatase and tensin homolog 1579 204 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40164.[MT7]-GVTIPSQR.2y7_1.heavy 501.297 / 800.463 1808.0 23.00219964981079 39 18 10 3 8 5.226652868237933 19.1327035716671 0.06640052795410156 4 0.9868317142806105 10.74286252910897 1808.0 9.900261243582882 0.0 - - - - - - - 187.13636363636363 3 22 PTEN phosphatase and tensin homolog 1581 205 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39520.[MT7]-TFEQVK[MT7].2y4_1.heavy 520.305 / 647.385 1508.0 23.3531494140625 44 18 10 6 10 3.267041918007826 24.402631427277885 0.03170013427734375 3 0.9835343768760774 9.604517816888155 1508.0 6.586815454808401 0.0 - - - - - - - 214.17391304347825 3 23 ACSL5 acyl-CoA synthetase long-chain family member 5 1583 205 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39520.[MT7]-TFEQVK[MT7].2b3_1.heavy 520.305 / 522.268 2011.0 23.3531494140625 44 18 10 6 10 3.267041918007826 24.402631427277885 0.03170013427734375 3 0.9835343768760774 9.604517816888155 2011.0 6.856287979262117 0.0 - - - - - - - 246.9090909090909 4 22 ACSL5 acyl-CoA synthetase long-chain family member 5 1585 205 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39520.[MT7]-TFEQVK[MT7].2y5_1.heavy 520.305 / 794.453 3116.0 23.3531494140625 44 18 10 6 10 3.267041918007826 24.402631427277885 0.03170013427734375 3 0.9835343768760774 9.604517816888155 3116.0 17.837079190992625 0.0 - - - - - - - 174.6315789473684 6 19 ACSL5 acyl-CoA synthetase long-chain family member 5 1587 205 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39520.[MT7]-TFEQVK[MT7].2b4_1.heavy 520.305 / 650.327 1960.0 23.3531494140625 44 18 10 6 10 3.267041918007826 24.402631427277885 0.03170013427734375 3 0.9835343768760774 9.604517816888155 1960.0 7.18257281137978 0.0 - - - - - - - 203.42857142857142 3 21 ACSL5 acyl-CoA synthetase long-chain family member 5 1589 206 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20291.[MT7]-SQYFEGVVK[MT7].3b6_1.heavy 448.918 / 856.396 5517.0 30.238000869750977 47 17 10 10 10 3.9801423477210474 25.124729535680565 0.0 3 0.9756315786869635 7.889741662361959 5517.0 55.75027410358566 0.0 - - - - - - - 208.83333333333334 11 6 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1591 206 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20291.[MT7]-SQYFEGVVK[MT7].3b4_1.heavy 448.918 / 670.332 7022.0 30.238000869750977 47 17 10 10 10 3.9801423477210474 25.124729535680565 0.0 3 0.9756315786869635 7.889741662361959 7022.0 27.77609561752988 1.0 - - - - - - - 263.2 14 10 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1593 206 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20291.[MT7]-SQYFEGVVK[MT7].3y4_1.heavy 448.918 / 546.373 18306.0 30.238000869750977 47 17 10 10 10 3.9801423477210474 25.124729535680565 0.0 3 0.9756315786869635 7.889741662361959 18306.0 44.527510196682684 0.0 - - - - - - - 225.5 36 10 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1595 206 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20291.[MT7]-SQYFEGVVK[MT7].3b3_1.heavy 448.918 / 523.263 28212.0 30.238000869750977 47 17 10 10 10 3.9801423477210474 25.124729535680565 0.0 3 0.9756315786869635 7.889741662361959 28212.0 93.78989361702129 0.0 - - - - - - - 716.5714285714286 56 7 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1597 207 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20723.[MT7]-VAEETPDGAPALC[CAM]PSPEALSPEPPVYSLQDFDTLATVGTGTFGR.4b5_1.heavy 1176.83 / 674.348 3348.0 47.036099433898926 35 12 10 3 10 1.0799924003355044 61.72882943061117 0.059200286865234375 3 0.8961398765083496 3.7958184847721053 3348.0 1.217871598428148 1.0 - - - - - - - 189.25 6 20 PRKX protein kinase, X-linked 1599 207 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20723.[MT7]-VAEETPDGAPALC[CAM]PSPEALSPEPPVYSLQDFDTLATVGTGTFGR.4y12_1.heavy 1176.83 / 1180.63 495.0 47.036099433898926 35 12 10 3 10 1.0799924003355044 61.72882943061117 0.059200286865234375 3 0.8961398765083496 3.7958184847721053 495.0 15.702275151084255 1.0 - - - - - - - 0.0 1 0 PRKX protein kinase, X-linked 1601 207 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20723.[MT7]-VAEETPDGAPALC[CAM]PSPEALSPEPPVYSLQDFDTLATVGTGTFGR.4y7_1.heavy 1176.83 / 695.347 6696.0 47.036099433898926 35 12 10 3 10 1.0799924003355044 61.72882943061117 0.059200286865234375 3 0.8961398765083496 3.7958184847721053 6696.0 61.16281189877164 0.0 - - - - - - - 176.41176470588235 13 17 PRKX protein kinase, X-linked 1603 207 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20723.[MT7]-VAEETPDGAPALC[CAM]PSPEALSPEPPVYSLQDFDTLATVGTGTFGR.4b9_1.heavy 1176.83 / 1014.49 4396.0 47.036099433898926 35 12 10 3 10 1.0799924003355044 61.72882943061117 0.059200286865234375 3 0.8961398765083496 3.7958184847721053 4396.0 51.32461743377239 0.0 - - - - - - - 145.4375 8 16 PRKX protein kinase, X-linked 1605 208 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20292.[MT7]-EAILEDLQK[MT7].3b6_1.heavy 449.597 / 815.427 31266.0 33.8671989440918 50 20 10 10 10 3.3362338823914115 23.48760428887784 0.0 3 0.9912373624566577 13.174292593717697 31266.0 167.88157395464947 0.0 - - - - - - - 199.72727272727272 62 11 ACSL5 acyl-CoA synthetase long-chain family member 5 1607 208 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20292.[MT7]-EAILEDLQK[MT7].3b4_1.heavy 449.597 / 571.357 38899.0 33.8671989440918 50 20 10 10 10 3.3362338823914115 23.48760428887784 0.0 3 0.9912373624566577 13.174292593717697 38899.0 132.5585273790537 0.0 - - - - - - - 235.375 77 8 ACSL5 acyl-CoA synthetase long-chain family member 5 1609 208 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20292.[MT7]-EAILEDLQK[MT7].3b5_1.heavy 449.597 / 700.4 10352.0 33.8671989440918 50 20 10 10 10 3.3362338823914115 23.48760428887784 0.0 3 0.9912373624566577 13.174292593717697 10352.0 57.94002287136231 0.0 - - - - - - - 197.66666666666666 20 9 ACSL5 acyl-CoA synthetase long-chain family member 5 1611 208 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20292.[MT7]-EAILEDLQK[MT7].3b3_1.heavy 449.597 / 458.273 70374.0 33.8671989440918 50 20 10 10 10 3.3362338823914115 23.48760428887784 0.0 3 0.9912373624566577 13.174292593717697 70374.0 218.2641715244286 0.0 - - - - - - - 348.5 140 6 ACSL5 acyl-CoA synthetase long-chain family member 5 1613 209 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40416.[MT7]-EAILEDLQK[MT7].2y8_1.heavy 673.892 / 1073.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1615 209 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40416.[MT7]-EAILEDLQK[MT7].2b6_1.heavy 673.892 / 815.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1617 209 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40416.[MT7]-EAILEDLQK[MT7].2y3_1.heavy 673.892 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1619 209 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40416.[MT7]-EAILEDLQK[MT7].2y6_1.heavy 673.892 / 889.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL5 acyl-CoA synthetase long-chain family member 5 1621 210 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20290.[MT7]-ALVLIGNVEK[MT7].2y5_1.heavy 672.429 / 690.39 8052.0 35.53499984741211 44 14 10 10 10 2.3033446062856267 34.613187380760465 0.0 3 0.9495586445406866 5.471751197291889 8052.0 27.138397338030927 0.0 - - - - - - - 207.42857142857142 16 14 ACSL5 acyl-CoA synthetase long-chain family member 5 1623 210 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20290.[MT7]-ALVLIGNVEK[MT7].2b4_1.heavy 672.429 / 541.383 8801.0 35.53499984741211 44 14 10 10 10 2.3033446062856267 34.613187380760465 0.0 3 0.9495586445406866 5.471751197291889 8801.0 30.60309881255301 0.0 - - - - - - - 664.7 17 10 ACSL5 acyl-CoA synthetase long-chain family member 5 1625 210 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20290.[MT7]-ALVLIGNVEK[MT7].2y6_1.heavy 672.429 / 803.474 5336.0 35.53499984741211 44 14 10 10 10 2.3033446062856267 34.613187380760465 0.0 3 0.9495586445406866 5.471751197291889 5336.0 23.113155080213904 0.0 - - - - - - - 251.4375 10 16 ACSL5 acyl-CoA synthetase long-chain family member 5 1627 210 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20290.[MT7]-ALVLIGNVEK[MT7].2y7_1.heavy 672.429 / 916.558 4307.0 35.53499984741211 44 14 10 10 10 2.3033446062856267 34.613187380760465 0.0 3 0.9495586445406866 5.471751197291889 4307.0 52.882798515938525 0.0 - - - - - - - 213.92857142857142 8 14 ACSL5 acyl-CoA synthetase long-chain family member 5 1629 211 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535774.[MT7]-ALVLIGNVEK[MT7].3b6_1.heavy 448.622 / 711.489 13754.0 35.53499984741211 50 20 10 10 10 10.890629660436288 9.182205539802913 0.0 3 0.9963756592987719 20.49352213428452 13754.0 44.42173508637905 0.0 - - - - - - - 184.71428571428572 27 7 ACSL5 acyl-CoA synthetase long-chain family member 5 1631 211 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535774.[MT7]-ALVLIGNVEK[MT7].3y3_1.heavy 448.622 / 519.326 30555.0 35.53499984741211 50 20 10 10 10 10.890629660436288 9.182205539802913 0.0 3 0.9963756592987719 20.49352213428452 30555.0 42.17787061728435 0.0 - - - - - - - 319.6923076923077 61 13 ACSL5 acyl-CoA synthetase long-chain family member 5 1633 211 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535774.[MT7]-ALVLIGNVEK[MT7].3b4_1.heavy 448.622 / 541.383 97574.0 35.53499984741211 50 20 10 10 10 10.890629660436288 9.182205539802913 0.0 3 0.9963756592987719 20.49352213428452 97574.0 191.82504643962852 0.0 - - - - - - - 761.5 195 8 ACSL5 acyl-CoA synthetase long-chain family member 5 1635 211 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535774.[MT7]-ALVLIGNVEK[MT7].3y5_1.heavy 448.622 / 690.39 25386.0 35.53499984741211 50 20 10 10 10 10.890629660436288 9.182205539802913 0.0 3 0.9963756592987719 20.49352213428452 25386.0 170.69230344423846 0.0 - - - - - - - 192.33333333333334 50 12 ACSL5 acyl-CoA synthetase long-chain family member 5 1637 212 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535978.[MT7]-ISQGLGLQDFDLIR.3y6_1.heavy 573.657 / 778.409 23485.0 43.619300842285156 45 15 10 10 10 2.209623601783243 36.05239703025546 0.0 3 0.9550841132458981 5.801272509510856 23485.0 92.44770429764841 0.0 - - - - - - - 236.75 46 12 PRKCZ protein kinase C, zeta 1639 212 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535978.[MT7]-ISQGLGLQDFDLIR.3b6_1.heavy 573.657 / 700.411 39491.0 43.619300842285156 45 15 10 10 10 2.209623601783243 36.05239703025546 0.0 3 0.9550841132458981 5.801272509510856 39491.0 165.85919310799363 0.0 - - - - - - - 185.45454545454547 78 11 PRKCZ protein kinase C, zeta 1641 212 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535978.[MT7]-ISQGLGLQDFDLIR.3b4_1.heavy 573.657 / 530.305 24226.0 43.619300842285156 45 15 10 10 10 2.209623601783243 36.05239703025546 0.0 3 0.9550841132458981 5.801272509510856 24226.0 209.2235315060925 0.0 - - - - - - - 209.15384615384616 48 13 PRKCZ protein kinase C, zeta 1643 212 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535978.[MT7]-ISQGLGLQDFDLIR.3y5_1.heavy 573.657 / 663.382 12855.0 43.619300842285156 45 15 10 10 10 2.209623601783243 36.05239703025546 0.0 3 0.9550841132458981 5.801272509510856 12855.0 34.917376356429386 0.0 - - - - - - - 177.6875 25 16 PRKCZ protein kinase C, zeta 1645 213 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20315.[MT7]-DIIFAIK[MT7]K[MT7].3y3_1.heavy 460.638 / 676.496 1304.0 33.61399841308594 42 12 10 10 10 2.5160141156387796 31.131446956025613 0.0 3 0.8858326647769245 3.6171812777955807 1304.0 5.180529344073648 2.0 - - - - - - - 205.33333333333334 2 9 PDHB pyruvate dehydrogenase (lipoamide) beta 1647 213 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20315.[MT7]-DIIFAIK[MT7]K[MT7].3y4_1.heavy 460.638 / 747.533 2065.0 33.61399841308594 42 12 10 10 10 2.5160141156387796 31.131446956025613 0.0 3 0.8858326647769245 3.6171812777955807 2065.0 15.178021472392636 0.0 - - - - - - - 226.5 4 12 PDHB pyruvate dehydrogenase (lipoamide) beta 1649 213 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20315.[MT7]-DIIFAIK[MT7]K[MT7].3y5_1.heavy 460.638 / 894.602 543.0 33.61399841308594 42 12 10 10 10 2.5160141156387796 31.131446956025613 0.0 3 0.8858326647769245 3.6171812777955807 543.0 4.7816513761467885 2.0 - - - - - - - 0.0 1 0 PDHB pyruvate dehydrogenase (lipoamide) beta 1651 213 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20315.[MT7]-DIIFAIK[MT7]K[MT7].3y5_2.heavy 460.638 / 447.804 3804.0 33.61399841308594 42 12 10 10 10 2.5160141156387796 31.131446956025613 0.0 3 0.8858326647769245 3.6171812777955807 3804.0 24.34809852216749 0.0 - - - - - - - 263.7142857142857 7 7 PDHB pyruvate dehydrogenase (lipoamide) beta 1653 214 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535771.[MT7]-RIPEEILGK[MT7].3b6_1.heavy 448.281 / 882.516 612.0 29.755149841308594 38 14 10 6 8 2.213721286908081 37.77735977398338 0.039501190185546875 4 0.9453531739364504 5.255112839828657 612.0 1.1673024523160762 3.0 - - - - - - - 266.8181818181818 9 11 MAP2K2 mitogen-activated protein kinase kinase 2 1655 214 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535771.[MT7]-RIPEEILGK[MT7].3y3_1.heavy 448.281 / 461.32 33269.0 29.755149841308594 38 14 10 6 8 2.213721286908081 37.77735977398338 0.039501190185546875 4 0.9453531739364504 5.255112839828657 33269.0 46.9046855539782 0.0 - - - - - - - 326.3333333333333 66 3 MAP2K2 mitogen-activated protein kinase kinase 2 1657 214 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535771.[MT7]-RIPEEILGK[MT7].3b4_1.heavy 448.281 / 640.39 2813.0 29.755149841308594 38 14 10 6 8 2.213721286908081 37.77735977398338 0.039501190185546875 4 0.9453531739364504 5.255112839828657 2813.0 22.773147747190432 1.0 - - - - - - - 271.77777777777777 6 9 MAP2K2 mitogen-activated protein kinase kinase 2 1659 214 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535771.[MT7]-RIPEEILGK[MT7].3b5_1.heavy 448.281 / 769.432 19937.0 29.755149841308594 38 14 10 6 8 2.213721286908081 37.77735977398338 0.039501190185546875 4 0.9453531739364504 5.255112839828657 19937.0 243.4861987286718 0.0 - - - - - - - 171.0 39 5 MAP2K2 mitogen-activated protein kinase kinase 2 1661 215 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20412.[MT7]-ILEDNSIPQVK[MT7].2b3_1.heavy 772.45 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHB pyruvate dehydrogenase (lipoamide) beta 1663 215 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20412.[MT7]-ILEDNSIPQVK[MT7].2y3_1.heavy 772.45 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHB pyruvate dehydrogenase (lipoamide) beta 1665 215 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20412.[MT7]-ILEDNSIPQVK[MT7].2b6_1.heavy 772.45 / 816.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHB pyruvate dehydrogenase (lipoamide) beta 1667 215 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20412.[MT7]-ILEDNSIPQVK[MT7].2b5_1.heavy 772.45 / 729.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHB pyruvate dehydrogenase (lipoamide) beta 1669 216 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20413.[MT7]-LVVFDTTLQVK[MT7].2y8_1.heavy 775.973 / 1095.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1671 216 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20413.[MT7]-LVVFDTTLQVK[MT7].2y9_1.heavy 775.973 / 1194.69 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1673 216 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20413.[MT7]-LVVFDTTLQVK[MT7].2y6_1.heavy 775.973 / 833.521 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1675 216 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20413.[MT7]-LVVFDTTLQVK[MT7].2y7_1.heavy 775.973 / 948.548 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1677 217 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20310.[MT7]-EYLVLTLTK[MT7].2y4_1.heavy 684.423 / 606.394 3073.0 38.98809814453125 37 12 9 10 6 14.985277232120309 6.673216547883027 0.0 5 0.894929701255219 3.773499692371486 3073.0 12.574921106557378 0.0 - - - - - - - 244.4 6 15 PTEN phosphatase and tensin homolog 1679 217 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20310.[MT7]-EYLVLTLTK[MT7].2b3_1.heavy 684.423 / 550.299 2219.0 38.98809814453125 37 12 9 10 6 14.985277232120309 6.673216547883027 0.0 5 0.894929701255219 3.773499692371486 2219.0 0.46409000410446155 1.0 - - - - - - - 224.9090909090909 4 11 PTEN phosphatase and tensin homolog 1681 217 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20310.[MT7]-EYLVLTLTK[MT7].2y5_1.heavy 684.423 / 719.478 2646.0 38.98809814453125 37 12 9 10 6 14.985277232120309 6.673216547883027 0.0 5 0.894929701255219 3.773499692371486 2646.0 7.264850165910078 2.0 - - - - - - - 197.0 7 13 PTEN phosphatase and tensin homolog 1683 217 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20310.[MT7]-EYLVLTLTK[MT7].2b4_1.heavy 684.423 / 649.368 2902.0 38.98809814453125 37 12 9 10 6 14.985277232120309 6.673216547883027 0.0 5 0.894929701255219 3.773499692371486 2902.0 9.651674215902428 0.0 - - - - - - - 673.4444444444445 5 9 PTEN phosphatase and tensin homolog 1685 218 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20311.[MT7]-IINEGAAILRR.3y10_2.heavy 457.285 / 556.83 89575.0 32.1349983215332 41 11 10 10 10 0.9456742438959631 55.99703992031608 0.0 3 0.876742989530432 3.478494847754705 89575.0 185.94810267857142 0.0 - - - - - - - 256.0 179 4 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1687 218 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20311.[MT7]-IINEGAAILRR.3b5_1.heavy 457.285 / 671.385 30072.0 32.1349983215332 41 11 10 10 10 0.9456742438959631 55.99703992031608 0.0 3 0.876742989530432 3.478494847754705 30072.0 96.324375 0.0 - - - - - - - 731.4285714285714 60 7 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1689 218 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20311.[MT7]-IINEGAAILRR.3b3_1.heavy 457.285 / 485.32 23673.0 32.1349983215332 41 11 10 10 10 0.9456742438959631 55.99703992031608 0.0 3 0.876742989530432 3.478494847754705 23673.0 40.42376116071428 0.0 - - - - - - - 704.0 47 10 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1691 218 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20311.[MT7]-IINEGAAILRR.3y9_2.heavy 457.285 / 500.288 33655.0 32.1349983215332 41 11 10 10 10 0.9456742438959631 55.99703992031608 0.0 3 0.876742989530432 3.478494847754705 33655.0 81.508203125 0.0 - - - - - - - 341.3333333333333 67 6 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1693 219 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40559.[MT7]-SRNVVIAADGVLK[MT7].3b6_1.heavy 544.001 / 813.506 2632.0 29.47784996032715 34 12 10 6 6 0.9577270381666962 63.641922342547616 0.0373992919921875 5 0.8995931939417747 3.861696552649175 2632.0 16.61115890083632 0.0 - - - - - - - 191.5 5 10 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1695 219 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40559.[MT7]-SRNVVIAADGVLK[MT7].3b4_1.heavy 544.001 / 601.354 3349.0 29.47784996032715 34 12 10 6 6 0.9577270381666962 63.641922342547616 0.0373992919921875 5 0.8995931939417747 3.861696552649175 3349.0 10.24861204013378 2.0 - - - - - - - 306.4375 18 16 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1697 219 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40559.[MT7]-SRNVVIAADGVLK[MT7].3b5_1.heavy 544.001 / 700.422 7895.0 29.47784996032715 34 12 10 6 6 0.9577270381666962 63.641922342547616 0.0373992919921875 5 0.8995931939417747 3.861696552649175 7895.0 21.783862876254176 1.0 - - - - - - - 224.375 18 16 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1699 219 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40559.[MT7]-SRNVVIAADGVLK[MT7].3y4_1.heavy 544.001 / 560.389 11364.0 29.47784996032715 34 12 10 6 6 0.9577270381666962 63.641922342547616 0.0373992919921875 5 0.8995931939417747 3.861696552649175 11364.0 25.239246979253036 0.0 - - - - - - - 649.4285714285714 22 7 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1701 220 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20512.[MT7]-EIIHQFILEQQK[MT7].3b4_1.heavy 605.352 / 637.379 5872.0 33.78459930419922 40 10 10 10 10 0.8108771942410244 73.82042363991337 0.0 3 0.8456414883490339 3.0998842840520866 5872.0 10.100181211254172 0.0 - - - - - - - 256.3333333333333 11 9 NLK nemo-like kinase 1703 220 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20512.[MT7]-EIIHQFILEQQK[MT7].3y4_1.heavy 605.352 / 676.375 9228.0 33.78459930419922 40 10 10 10 10 0.8108771942410244 73.82042363991337 0.0 3 0.8456414883490339 3.0998842840520866 9228.0 55.636481418342996 0.0 - - - - - - - 209.9090909090909 18 11 NLK nemo-like kinase 1705 220 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20512.[MT7]-EIIHQFILEQQK[MT7].3b3_1.heavy 605.352 / 500.32 7970.0 33.78459930419922 40 10 10 10 10 0.8108771942410244 73.82042363991337 0.0 3 0.8456414883490339 3.0998842840520866 7970.0 12.428784197312702 0.0 - - - - - - - 644.0 15 7 NLK nemo-like kinase 1707 220 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20512.[MT7]-EIIHQFILEQQK[MT7].3y5_1.heavy 605.352 / 789.459 10172.0 33.78459930419922 40 10 10 10 10 0.8108771942410244 73.82042363991337 0.0 3 0.8456414883490339 3.0998842840520866 10172.0 49.45309876122286 0.0 - - - - - - - 283.3 20 10 NLK nemo-like kinase 1709 221 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20513.[MT7]-EIIHQFILEQQK[MT7].4b7_2.heavy 454.266 / 513.299 21227.0 33.78459930419922 38 8 10 10 10 0.9634442375875023 67.10611532918655 0.0 3 0.7531406303060005 2.4309114490144297 21227.0 24.06047446723374 0.0 - - - - - - - 657.4285714285714 42 7 NLK nemo-like kinase 1711 221 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20513.[MT7]-EIIHQFILEQQK[MT7].4b4_1.heavy 454.266 / 637.379 7424.0 33.78459930419922 38 8 10 10 10 0.9634442375875023 67.10611532918655 0.0 3 0.7531406303060005 2.4309114490144297 7424.0 15.72629520356465 0.0 - - - - - - - 657.4285714285714 14 7 NLK nemo-like kinase 1713 221 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20513.[MT7]-EIIHQFILEQQK[MT7].4b3_1.heavy 454.266 / 500.32 4706.0 33.78459930419922 38 8 10 10 10 0.9634442375875023 67.10611532918655 0.0 3 0.7531406303060005 2.4309114490144297 4706.0 10.50781499202552 0.0 - - - - - - - 275.54545454545456 9 11 NLK nemo-like kinase 1715 221 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20513.[MT7]-EIIHQFILEQQK[MT7].4b6_2.heavy 454.266 / 456.757 32312.0 33.78459930419922 38 8 10 10 10 0.9634442375875023 67.10611532918655 0.0 3 0.7531406303060005 2.4309114490144297 32312.0 62.72267506242535 0.0 - - - - - - - 268.85714285714283 64 7 NLK nemo-like kinase 1717 222 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39836.[MT7]-SRNVVIAADGVLK[MT7].2y4_1.heavy 815.498 / 560.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 1719 222 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39836.[MT7]-SRNVVIAADGVLK[MT7].2b6_1.heavy 815.498 / 813.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 1721 222 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39836.[MT7]-SRNVVIAADGVLK[MT7].2b9_1.heavy 815.498 / 1070.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 1723 222 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39836.[MT7]-SRNVVIAADGVLK[MT7].2b10_1.heavy 815.498 / 1127.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 1725 223 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20514.[MT7]-RYVYYYSYLLK[MT7].3y3_1.heavy 607.006 / 517.383 3552.0 37.40702533721924 38 12 10 6 10 5.864475388898159 17.05182362761836 0.039897918701171875 3 0.8892375253605546 3.6734441165207654 3552.0 8.421666131892257 0.0 - - - - - - - 637.2857142857143 7 7 PTEN phosphatase and tensin homolog 1727 223 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20514.[MT7]-RYVYYYSYLLK[MT7].3b4_1.heavy 607.006 / 726.406 2641.0 37.40702533721924 38 12 10 6 10 5.864475388898159 17.05182362761836 0.039897918701171875 3 0.8892375253605546 3.6734441165207654 2641.0 12.334340659340661 0.0 - - - - - - - 310.47058823529414 5 17 PTEN phosphatase and tensin homolog 1729 223 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20514.[MT7]-RYVYYYSYLLK[MT7].3b5_1.heavy 607.006 / 889.469 1639.0 37.40702533721924 38 12 10 6 10 5.864475388898159 17.05182362761836 0.039897918701171875 3 0.8892375253605546 3.6734441165207654 1639.0 16.20989010989011 0.0 - - - - - - - 200.2 3 10 PTEN phosphatase and tensin homolog 1731 223 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20514.[MT7]-RYVYYYSYLLK[MT7].3y5_1.heavy 607.006 / 767.478 1821.0 37.40702533721924 38 12 10 6 10 5.864475388898159 17.05182362761836 0.039897918701171875 3 0.8892375253605546 3.6734441165207654 1821.0 0.24996568291008917 1.0 - - - - - - - 201.5 4 14 PTEN phosphatase and tensin homolog 1733 224 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20515.[MT7]-VIILMDPFDDDLK[MT7].3b6_1.heavy 608.002 / 829.497 2768.0 47.149800300598145 44 18 10 6 10 6.234501529149224 16.039774716944574 0.033199310302734375 3 0.9870613076989624 10.837966285100686 2768.0 7.908571428571429 1.0 - - - - - - - 108.8125 5 16 ACSL5 acyl-CoA synthetase long-chain family member 5 1735 224 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20515.[MT7]-VIILMDPFDDDLK[MT7].3b4_1.heavy 608.002 / 583.43 4106.0 47.149800300598145 44 18 10 6 10 6.234501529149224 16.039774716944574 0.033199310302734375 3 0.9870613076989624 10.837966285100686 4106.0 31.610004946821668 0.0 - - - - - - - 147.2608695652174 8 23 ACSL5 acyl-CoA synthetase long-chain family member 5 1737 224 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20515.[MT7]-VIILMDPFDDDLK[MT7].3y4_1.heavy 608.002 / 634.353 1773.0 47.149800300598145 44 18 10 6 10 6.234501529149224 16.039774716944574 0.033199310302734375 3 0.9870613076989624 10.837966285100686 1773.0 11.85545165843331 0.0 - - - - - - - 103.13636363636364 3 22 ACSL5 acyl-CoA synthetase long-chain family member 5 1739 224 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20515.[MT7]-VIILMDPFDDDLK[MT7].3y5_1.heavy 608.002 / 749.38 3639.0 47.149800300598145 44 18 10 6 10 6.234501529149224 16.039774716944574 0.033199310302734375 3 0.9870613076989624 10.837966285100686 3639.0 54.823074232413525 0.0 - - - - - - - 151.0 7 21 ACSL5 acyl-CoA synthetase long-chain family member 5 1741 225 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20619.[MT7]-QSFVGMLTITDFINILHR.3y6_1.heavy 750.413 / 765.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1743 225 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20619.[MT7]-QSFVGMLTITDFINILHR.3b6_1.heavy 750.413 / 794.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1745 225 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20619.[MT7]-QSFVGMLTITDFINILHR.3b5_1.heavy 750.413 / 663.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1747 225 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20619.[MT7]-QSFVGMLTITDFINILHR.3b3_1.heavy 750.413 / 507.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1749 226 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535490.[MT7]-LTSEEVFDLDGIPR.3y7_1.heavy 578.973 / 785.415 29967.0 39.75657558441162 44 18 10 6 10 6.142567224602242 16.279838110599666 0.036899566650390625 3 0.9880232562282631 11.265710397366973 29967.0 74.04392671768625 0.0 - - - - - - - 284.5833333333333 59 12 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1751 226 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535490.[MT7]-LTSEEVFDLDGIPR.3b4_1.heavy 578.973 / 575.316 20429.0 39.75657558441162 44 18 10 6 10 6.142567224602242 16.279838110599666 0.036899566650390625 3 0.9880232562282631 11.265710397366973 20429.0 80.11361574336213 0.0 - - - - - - - 232.15384615384616 40 13 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1753 226 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535490.[MT7]-LTSEEVFDLDGIPR.3b5_1.heavy 578.973 / 704.358 75276.0 39.75657558441162 44 18 10 6 10 6.142567224602242 16.279838110599666 0.036899566650390625 3 0.9880232562282631 11.265710397366973 75276.0 97.00066149877219 0.0 - - - - - - - 856.6666666666666 150 9 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1755 226 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535490.[MT7]-LTSEEVFDLDGIPR.3y5_1.heavy 578.973 / 557.304 55801.0 39.75657558441162 44 18 10 6 10 6.142567224602242 16.279838110599666 0.036899566650390625 3 0.9880232562282631 11.265710397366973 55801.0 109.3146915600123 0.0 - - - - - - - 291.0 111 3 PPP3CB protein phosphatase 3, catalytic subunit, beta isozyme 1757 227 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43996.[MT7]-K[MT7]YIPGTK[MT7].2b3_1.heavy 619.895 / 693.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYCS cytochrome c, somatic 1759 227 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43996.[MT7]-K[MT7]YIPGTK[MT7].2y4_1.heavy 619.895 / 546.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYCS cytochrome c, somatic 1761 227 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43996.[MT7]-K[MT7]YIPGTK[MT7].2y3_1.heavy 619.895 / 449.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYCS cytochrome c, somatic 1763 227 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43996.[MT7]-K[MT7]YIPGTK[MT7].2y6_1.heavy 619.895 / 822.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYCS cytochrome c, somatic 1765 228 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43719.[MT7]-IETWR.2b3_1.heavy 424.741 / 488.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2;PRKAG3;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 3 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1767 228 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43719.[MT7]-IETWR.2y4_1.heavy 424.741 / 591.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2;PRKAG3;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 3 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1769 228 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43719.[MT7]-IETWR.2b4_1.heavy 424.741 / 674.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2;PRKAG3;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 3 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1771 228 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43719.[MT7]-IETWR.2y3_1.heavy 424.741 / 462.246 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2;PRKAG3;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 3 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1773 229 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20519.[MT7]-GLEGLQVAWLVVEK[MT7].3y3_1.heavy 610.364 / 519.326 38481.0 46.57789993286133 42 12 10 10 10 1.2312860235288001 59.476681317596686 0.0 3 0.8815902049998623 3.5504792078021614 38481.0 233.7699951957723 0.0 - - - - - - - 187.62962962962962 76 27 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1775 229 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20519.[MT7]-GLEGLQVAWLVVEK[MT7].3b6_1.heavy 610.364 / 742.422 20622.0 46.57789993286133 42 12 10 10 10 1.2312860235288001 59.476681317596686 0.0 3 0.8815902049998623 3.5504792078021614 20622.0 208.5211855036855 0.0 - - - - - - - 160.0909090909091 41 22 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1777 229 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20519.[MT7]-GLEGLQVAWLVVEK[MT7].3b4_1.heavy 610.364 / 501.279 9308.0 46.57789993286133 42 12 10 10 10 1.2312860235288001 59.476681317596686 0.0 3 0.8815902049998623 3.5504792078021614 9308.0 97.24959156785243 0.0 - - - - - - - 107.29629629629629 18 27 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1779 229 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20519.[MT7]-GLEGLQVAWLVVEK[MT7].3b8_1.heavy 610.364 / 912.527 20753.0 46.57789993286133 42 12 10 10 10 1.2312860235288001 59.476681317596686 0.0 3 0.8815902049998623 3.5504792078021614 20753.0 168.33700802716888 0.0 - - - - - - - 191.36363636363637 41 22 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1781 230 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39545.[MT7]-IC[CAM]DFGASR.2b3_1.heavy 535.264 / 533.251 8048.0 26.71500015258789 39 13 6 10 10 1.3865732805850965 45.92610252353668 0.0 3 0.902090956291739 3.911489247966779 8048.0 18.495482917040714 0.0 - - - - - - - 660.8888888888889 16 9 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1783 230 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39545.[MT7]-IC[CAM]DFGASR.2y5_1.heavy 535.264 / 537.278 7178.0 26.71500015258789 39 13 6 10 10 1.3865732805850965 45.92610252353668 0.0 3 0.902090956291739 3.911489247966779 7178.0 15.389280245022972 0.0 - - - - - - - 299.8 14 15 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1785 230 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39545.[MT7]-IC[CAM]DFGASR.2y6_1.heavy 535.264 / 652.305 2320.0 26.71500015258789 39 13 6 10 10 1.3865732805850965 45.92610252353668 0.0 3 0.902090956291739 3.911489247966779 2320.0 8.560209973753281 0.0 - - - - - - - 272.15 4 20 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1787 230 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39545.[MT7]-IC[CAM]DFGASR.2y7_1.heavy 535.264 / 812.336 N/A 26.71500015258789 39 13 6 10 10 1.3865732805850965 45.92610252353668 0.0 3 0.902090956291739 3.911489247966779 6380.0 11.305511811023623 2.0 - - - - - - - 564.3333333333334 26 9 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1789 231 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20501.[MT7]-APLVPPGSPVVNALFR.2b3_1.heavy 889.526 / 426.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 1791 231 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20501.[MT7]-APLVPPGSPVVNALFR.2y8_1.heavy 889.526 / 915.541 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 1793 231 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20501.[MT7]-APLVPPGSPVVNALFR.2y12_2.heavy 889.526 / 627.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 1795 231 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20501.[MT7]-APLVPPGSPVVNALFR.2b4_1.heavy 889.526 / 525.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 1797 232 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535757.[MT7]-YVPYVGDSK[MT7].3y3_1.heavy 439.243 / 493.274 10126.0 29.051900386810303 43 20 10 3 10 56.151369217433285 1.7809004730191522 0.07560157775878906 3 0.9940096833176858 15.937509011621971 10126.0 18.059274889385414 0.0 - - - - - - - 707.8888888888889 20 9 ISYNA1 inositol-3-phosphate synthase 1 1799 232 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535757.[MT7]-YVPYVGDSK[MT7].3b4_1.heavy 439.243 / 667.357 31402.0 29.051900386810303 43 20 10 3 10 56.151369217433285 1.7809004730191522 0.07560157775878906 3 0.9940096833176858 15.937509011621971 31402.0 80.74366758414216 0.0 - - - - - - - 298.75 62 8 ISYNA1 inositol-3-phosphate synthase 1 1801 232 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535757.[MT7]-YVPYVGDSK[MT7].3y4_1.heavy 439.243 / 550.295 45738.0 29.051900386810303 43 20 10 3 10 56.151369217433285 1.7809004730191522 0.07560157775878906 3 0.9940096833176858 15.937509011621971 45738.0 132.25486153846154 0.0 - - - - - - - 398.1666666666667 91 6 ISYNA1 inositol-3-phosphate synthase 1 1803 232 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535757.[MT7]-YVPYVGDSK[MT7].3y5_1.heavy 439.243 / 649.364 2389.0 29.051900386810303 43 20 10 3 10 56.151369217433285 1.7809004730191522 0.07560157775878906 3 0.9940096833176858 15.937509011621971 2389.0 2.663833410714044 2.0 - - - - - - - 227.58333333333334 16 12 ISYNA1 inositol-3-phosphate synthase 1 1805 233 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20502.[MT7]-APLVPPGSPVVNALFR.3y11_1.heavy 593.353 / 1156.65 4772.0 43.19230079650879 40 14 10 6 10 4.279019918282844 23.369837465054296 0.038600921630859375 3 0.9391601148918751 4.977844530559576 4772.0 86.95470942408377 0.0 - - - - - - - 281.85714285714283 9 7 ISYNA1 inositol-3-phosphate synthase 1 1807 233 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20502.[MT7]-APLVPPGSPVVNALFR.3b4_1.heavy 593.353 / 525.352 64707.0 43.19230079650879 40 14 10 6 10 4.279019918282844 23.369837465054296 0.038600921630859375 3 0.9391601148918751 4.977844530559576 64707.0 287.3949451761008 0.0 - - - - - - - 170.0 129 3 ISYNA1 inositol-3-phosphate synthase 1 1809 233 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20502.[MT7]-APLVPPGSPVVNALFR.3y8_1.heavy 593.353 / 915.541 16543.0 43.19230079650879 40 14 10 6 10 4.279019918282844 23.369837465054296 0.038600921630859375 3 0.9391601148918751 4.977844530559576 16543.0 137.41026237402374 0.0 - - - - - - - 152.8 33 5 ISYNA1 inositol-3-phosphate synthase 1 1811 233 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20502.[MT7]-APLVPPGSPVVNALFR.3y5_1.heavy 593.353 / 620.352 11834.0 43.19230079650879 40 14 10 6 10 4.279019918282844 23.369837465054296 0.038600921630859375 3 0.9391601148918751 4.977844530559576 11834.0 69.80932044569741 0.0 - - - - - - - 201.66666666666666 23 6 ISYNA1 inositol-3-phosphate synthase 1 1813 234 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 199292.0 42.30979919433594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 199292.0 515.0462266483992 0.0 - - - - - - - 299.2 398 5 1815 234 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 376365.0 42.30979919433594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 376365.0 506.67871350504174 0.0 - - - - - - - 391.0 752 4 1817 234 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 296662.0 42.30979919433594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 296662.0 367.1673844155844 0.0 - - - - - - - 244.8 593 5 1819 235 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46402.[MT7]-EILAELTGRK[MT7].3b3_1.heavy 473.292 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHA1 pyruvate dehydrogenase (lipoamide) alpha 1 1821 235 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46402.[MT7]-EILAELTGRK[MT7].3y8_1.heavy 473.292 / 1031.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHA1 pyruvate dehydrogenase (lipoamide) alpha 1 1823 235 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46402.[MT7]-EILAELTGRK[MT7].3y8_2.heavy 473.292 / 516.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHA1 pyruvate dehydrogenase (lipoamide) alpha 1 1825 235 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46402.[MT7]-EILAELTGRK[MT7].3y5_1.heavy 473.292 / 718.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHA1 pyruvate dehydrogenase (lipoamide) alpha 1 1827 236 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20605.[MT7]-K[MT7]AEALEAAIENLNEAK[MT7].4y4_1.heavy 537.307 / 605.338 20392.0 36.616868336995445 40 14 10 6 10 1.555146156654678 64.30263777593292 0.03639984130859375 3 0.946908779048997 5.332251158994015 20392.0 51.61337849331713 0.0 - - - - - - - 665.2727272727273 40 11 ANAPC5 anaphase promoting complex subunit 5 1829 236 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20605.[MT7]-K[MT7]AEALEAAIENLNEAK[MT7].4b8_2.heavy 537.307 / 536.816 N/A 36.616868336995445 40 14 10 6 10 1.555146156654678 64.30263777593292 0.03639984130859375 3 0.946908779048997 5.332251158994015 58616.0 11.810804817043138 0.0 - - - - - - - 2652.0 117 1 ANAPC5 anaphase promoting complex subunit 5 1831 236 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20605.[MT7]-K[MT7]AEALEAAIENLNEAK[MT7].4b7_2.heavy 537.307 / 501.297 32737.0 36.616868336995445 40 14 10 6 10 1.555146156654678 64.30263777593292 0.03639984130859375 3 0.946908779048997 5.332251158994015 32737.0 30.432243157121377 0.0 - - - - - - - 670.6666666666666 65 9 ANAPC5 anaphase promoting complex subunit 5 1833 236 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20605.[MT7]-K[MT7]AEALEAAIENLNEAK[MT7].4b4_1.heavy 537.307 / 688.423 2378.0 36.616868336995445 40 14 10 6 10 1.555146156654678 64.30263777593292 0.03639984130859375 3 0.946908779048997 5.332251158994015 2378.0 6.497267759562842 0.0 - - - - - - - 281.8333333333333 4 12 ANAPC5 anaphase promoting complex subunit 5 1835 237 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535896.[MT7]-ISALPVVDESGK[MT7].3b6_1.heavy 501.627 / 725.468 18752.0 32.421600341796875 48 18 10 10 10 4.991953816589222 20.032236609978398 0.0 3 0.9874699046063633 11.013634414771705 18752.0 28.340924927390965 0.0 - - - - - - - 236.0 37 6 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1837 237 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535896.[MT7]-ISALPVVDESGK[MT7].3b4_1.heavy 501.627 / 529.347 56020.0 32.421600341796875 48 18 10 10 10 4.991953816589222 20.032236609978398 0.0 3 0.9874699046063633 11.013634414771705 56020.0 39.143734735684454 0.0 - - - - - - - 393.3333333333333 112 3 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1839 237 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535896.[MT7]-ISALPVVDESGK[MT7].3y4_1.heavy 501.627 / 564.311 15332.0 32.421600341796875 48 18 10 10 10 4.991953816589222 20.032236609978398 0.0 3 0.9874699046063633 11.013634414771705 15332.0 20.841914977891417 0.0 - - - - - - - 265.5 30 8 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1841 237 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535896.[MT7]-ISALPVVDESGK[MT7].3y5_1.heavy 501.627 / 679.338 25474.0 32.421600341796875 48 18 10 10 10 4.991953816589222 20.032236609978398 0.0 3 0.9874699046063633 11.013634414771705 25474.0 18.206560869459523 1.0 - - - - - - - 354.0 50 3 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1843 238 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39941.[MT7]-EIVIRDPYALRPLRR.3b6_1.heavy 671.073 / 870.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHKG1 phosphorylase kinase, gamma 1 (muscle) 1845 238 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39941.[MT7]-EIVIRDPYALRPLRR.3b5_1.heavy 671.073 / 755.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHKG1 phosphorylase kinase, gamma 1 (muscle) 1847 238 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB39941.[MT7]-EIVIRDPYALRPLRR.3b7_1.heavy 671.073 / 967.569 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHKG1 phosphorylase kinase, gamma 1 (muscle) 1849 239 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44362.[MT7]-DAINQGMDEELERDEK[MT7].3y6_1.heavy 727.351 / 933.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHB pyruvate dehydrogenase (lipoamide) beta 1851 239 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44362.[MT7]-DAINQGMDEELERDEK[MT7].3b4_1.heavy 727.351 / 558.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHB pyruvate dehydrogenase (lipoamide) beta 1853 239 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44362.[MT7]-DAINQGMDEELERDEK[MT7].3b5_1.heavy 727.351 / 686.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHB pyruvate dehydrogenase (lipoamide) beta 1855 239 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44362.[MT7]-DAINQGMDEELERDEK[MT7].3b8_1.heavy 727.351 / 989.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHB pyruvate dehydrogenase (lipoamide) beta 1857 240 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43728.[MT7]-VDVLK[MT7].2b3_1.heavy 431.286 / 458.273 4751.0 26.271400451660156 36 20 0 10 6 10.848772769880012 9.217632456791332 0.0 5 0.9971891753780002 23.272536256834456 4751.0 4.543128263991255 1.0 - - - - - - - 610.375 9 8 PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 1859 240 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43728.[MT7]-VDVLK[MT7].2y4_1.heavy 431.286 / 618.394 15859.0 26.271400451660156 36 20 0 10 6 10.848772769880012 9.217632456791332 0.0 5 0.9971891753780002 23.272536256834456 15859.0 30.608329350835394 0.0 - - - - - - - 646.6666666666666 31 9 PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 1861 240 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43728.[MT7]-VDVLK[MT7].2b4_1.heavy 431.286 / 571.357 2342.0 26.271400451660156 36 20 0 10 6 10.848772769880012 9.217632456791332 0.0 5 0.9971891753780002 23.272536256834456 2342.0 2.7622701709574065 2.0 - - - - - - - 710.875 7 8 PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 1863 240 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43728.[MT7]-VDVLK[MT7].2y3_1.heavy 431.286 / 503.367 11242.0 26.271400451660156 36 20 0 10 6 10.848772769880012 9.217632456791332 0.0 5 0.9971891753780002 23.272536256834456 11242.0 12.985090693736531 2.0 - - - - - - - 312.6666666666667 249 3 PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 1865 241 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40716.[MT7]-SFAELLHQC[CAM]WEADAK[MT7].4b4_1.heavy 524.015 / 579.289 3419.0 39.3800745010376 31 17 0 6 8 2.4820491932707682 36.31637125495045 0.039699554443359375 4 0.9714092530737534 7.281308276217685 3419.0 15.893963267709186 1.0 - - - - - - - 274.07142857142856 49 14 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1867 241 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40716.[MT7]-SFAELLHQC[CAM]WEADAK[MT7].4b5_1.heavy 524.015 / 692.374 3502.0 39.3800745010376 31 17 0 6 8 2.4820491932707682 36.31637125495045 0.039699554443359375 4 0.9714092530737534 7.281308276217685 3502.0 6.254334237004537 0.0 - - - - - - - 264.1666666666667 7 12 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1869 241 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40716.[MT7]-SFAELLHQC[CAM]WEADAK[MT7].4b3_1.heavy 524.015 / 450.247 1918.0 39.3800745010376 31 17 0 6 8 2.4820491932707682 36.31637125495045 0.039699554443359375 4 0.9714092530737534 7.281308276217685 1918.0 4.019760479041916 0.0 - - - - - - - 245.35294117647058 3 17 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1871 241 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40716.[MT7]-SFAELLHQC[CAM]WEADAK[MT7].4b6_1.heavy 524.015 / 805.458 2418.0 39.3800745010376 31 17 0 6 8 2.4820491932707682 36.31637125495045 0.039699554443359375 4 0.9714092530737534 7.281308276217685 2418.0 7.444192805755396 0.0 - - - - - - - 218.0 4 13 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1873 242 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536097.[MT7]-STLNPQWNESFTFK[MT7].3b6_1.heavy 663.01 / 785.427 1911.0 37.34717559814453 46 20 10 6 10 6.64401834540854 15.051132432394121 0.0399017333984375 3 0.9969346181077425 22.284817082694996 1911.0 12.284999999999998 0.0 - - - - - - - 278.6875 3 16 PRKCA protein kinase C, alpha 1875 242 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536097.[MT7]-STLNPQWNESFTFK[MT7].3y3_1.heavy 663.01 / 539.331 2548.0 37.34717559814453 46 20 10 6 10 6.64401834540854 15.051132432394121 0.0399017333984375 3 0.9969346181077425 22.284817082694996 2548.0 7.3919999999999995 0.0 - - - - - - - 705.25 5 8 PRKCA protein kinase C, alpha 1877 242 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536097.[MT7]-STLNPQWNESFTFK[MT7].3b4_1.heavy 663.01 / 560.316 7097.0 37.34717559814453 46 20 10 6 10 6.64401834540854 15.051132432394121 0.0399017333984375 3 0.9969346181077425 22.284817082694996 7097.0 16.05202391015578 0.0 - - - - - - - 252.0 14 13 PRKCA protein kinase C, alpha 1879 242 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536097.[MT7]-STLNPQWNESFTFK[MT7].3y4_1.heavy 663.01 / 686.399 2184.0 37.34717559814453 46 20 10 6 10 6.64401834540854 15.051132432394121 0.0399017333984375 3 0.9969346181077425 22.284817082694996 2184.0 12.0 0.0 - - - - - - - 235.52941176470588 4 17 PRKCA protein kinase C, alpha 1881 243 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40718.[MT7]-FC[CAM]EVIPGLNDTAENLLR.2b3_1.heavy 1053.04 / 581.251 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 1883 243 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40718.[MT7]-FC[CAM]EVIPGLNDTAENLLR.2b4_1.heavy 1053.04 / 680.319 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 1885 243 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40718.[MT7]-FC[CAM]EVIPGLNDTAENLLR.2b5_1.heavy 1053.04 / 793.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 1887 243 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40718.[MT7]-FC[CAM]EVIPGLNDTAENLLR.2y7_1.heavy 1053.04 / 816.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 1889 244 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46020.[MT7]-ADVEK[MT7].2b3_1.heavy 425.25 / 430.242 2787.0 15.930999994277954 45 18 10 7 10 4.970856657535437 20.117256820996374 0.024399757385253906 3 0.9810809554697013 8.958301597116952 2787.0 10.316262509622788 0.0 - - - - - - - 246.2 5 30 AFG3L2;EDARADD;FNBP1;KCNMB1;FNBP1L;SMARCA5;TRIP10 AFG3 ATPase family gene 3-like 2 (S. cerevisiae);EDAR-associated death domain;formin binding protein 1;potassium large conductance calcium-activated channel, subfamily M, beta member 1;formin binding protein 1-like;SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5;thyroid hormone receptor interactor 10 1891 244 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46020.[MT7]-ADVEK[MT7].2y4_1.heavy 425.25 / 634.353 6305.0 15.930999994277954 45 18 10 7 10 4.970856657535437 20.117256820996374 0.024399757385253906 3 0.9810809554697013 8.958301597116952 6305.0 55.929329681794464 0.0 - - - - - - - 181.13333333333333 12 30 AFG3L2;EDARADD;FNBP1;KCNMB1;FNBP1L;SMARCA5;TRIP10 AFG3 ATPase family gene 3-like 2 (S. cerevisiae);EDAR-associated death domain;formin binding protein 1;potassium large conductance calcium-activated channel, subfamily M, beta member 1;formin binding protein 1-like;SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5;thyroid hormone receptor interactor 10 1893 244 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46020.[MT7]-ADVEK[MT7].2b4_1.heavy 425.25 / 559.284 3085.0 15.930999994277954 45 18 10 7 10 4.970856657535437 20.117256820996374 0.024399757385253906 3 0.9810809554697013 8.958301597116952 3085.0 10.237620408216397 0.0 - - - - - - - 687.3 6 10 AFG3L2;EDARADD;FNBP1;KCNMB1;FNBP1L;SMARCA5;TRIP10 AFG3 ATPase family gene 3-like 2 (S. cerevisiae);EDAR-associated death domain;formin binding protein 1;potassium large conductance calcium-activated channel, subfamily M, beta member 1;formin binding protein 1-like;SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5;thyroid hormone receptor interactor 10 1895 244 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46020.[MT7]-ADVEK[MT7].2y3_1.heavy 425.25 / 519.326 7442.0 15.930999994277954 45 18 10 7 10 4.970856657535437 20.117256820996374 0.024399757385253906 3 0.9810809554697013 8.958301597116952 7442.0 14.166680846272223 0.0 - - - - - - - 288.0 14 28 AFG3L2;EDARADD;FNBP1;KCNMB1;FNBP1L;SMARCA5;TRIP10 AFG3 ATPase family gene 3-like 2 (S. cerevisiae);EDAR-associated death domain;formin binding protein 1;potassium large conductance calcium-activated channel, subfamily M, beta member 1;formin binding protein 1-like;SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5;thyroid hormone receptor interactor 10 1897 245 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40507.[MT7]-VSGHPNIIQLK[MT7].3y3_1.heavy 498.64 / 532.357 20791.0 28.89699935913086 46 16 10 10 10 3.486271329824552 28.68394067452935 0.0 3 0.9613021539612675 6.253287674684018 20791.0 42.92758509628774 0.0 - - - - - - - 353.9 41 10 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1899 245 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40507.[MT7]-VSGHPNIIQLK[MT7].3b4_1.heavy 498.64 / 525.29 31187.0 28.89699935913086 46 16 10 10 10 3.486271329824552 28.68394067452935 0.0 3 0.9613021539612675 6.253287674684018 31187.0 77.79423700457139 0.0 - - - - - - - 803.8 62 10 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1901 245 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40507.[MT7]-VSGHPNIIQLK[MT7].3y4_1.heavy 498.64 / 645.442 26364.0 28.89699935913086 46 16 10 10 10 3.486271329824552 28.68394067452935 0.0 3 0.9613021539612675 6.253287674684018 26364.0 96.8746065128901 0.0 - - - - - - - 267.9 52 10 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1903 245 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40507.[MT7]-VSGHPNIIQLK[MT7].3y5_1.heavy 498.64 / 758.526 6966.0 28.89699935913086 46 16 10 10 10 3.486271329824552 28.68394067452935 0.0 3 0.9613021539612675 6.253287674684018 6966.0 17.553453818249128 0.0 - - - - - - - 311.0 13 10 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1905 246 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20634.[MT7]-SSLVGVVVPDTDVLPSFAAK[MT7].3b6_1.heavy 763.77 / 687.416 13747.0 42.11130142211914 43 13 10 10 10 1.158409921751144 61.823658326123166 0.0 3 0.922866800733941 4.414787632403947 13747.0 23.72685879709789 0.0 - - - - - - - 226.72727272727272 27 11 ACSL5 acyl-CoA synthetase long-chain family member 5 1907 246 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20634.[MT7]-SSLVGVVVPDTDVLPSFAAK[MT7].3b4_1.heavy 763.77 / 531.326 6469.0 42.11130142211914 43 13 10 10 10 1.158409921751144 61.823658326123166 0.0 3 0.922866800733941 4.414787632403947 6469.0 21.649683315270302 0.0 - - - - - - - 252.8125 12 16 ACSL5 acyl-CoA synthetase long-chain family member 5 1909 246 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20634.[MT7]-SSLVGVVVPDTDVLPSFAAK[MT7].3b5_1.heavy 763.77 / 588.347 7615.0 42.11130142211914 43 13 10 10 10 1.158409921751144 61.823658326123166 0.0 3 0.922866800733941 4.414787632403947 7615.0 28.607134799220148 0.0 - - - - - - - 283.06666666666666 15 15 ACSL5 acyl-CoA synthetase long-chain family member 5 1911 246 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20634.[MT7]-SSLVGVVVPDTDVLPSFAAK[MT7].3b7_1.heavy 763.77 / 786.484 13680.0 42.11130142211914 43 13 10 10 10 1.158409921751144 61.823658326123166 0.0 3 0.922866800733941 4.414787632403947 13680.0 39.583595496857015 0.0 - - - - - - - 232.11111111111111 27 9 ACSL5 acyl-CoA synthetase long-chain family member 5 1913 247 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536210.[MT7]-TNHLVTVEGGWPQFGVGAEIC[CAM]AR.4y9_1.heavy 661.337 / 932.462 2783.0 38.53942680358887 43 18 10 5 10 4.391591841780481 22.77078644891941 0.04290008544921875 3 0.9810162080038272 8.942963048760495 2783.0 10.68981396096072 0.0 - - - - - - - 228.85714285714286 5 14 PDHB pyruvate dehydrogenase (lipoamide) beta 1915 247 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536210.[MT7]-TNHLVTVEGGWPQFGVGAEIC[CAM]AR.4b4_1.heavy 661.337 / 610.343 2024.0 38.53942680358887 43 18 10 5 10 4.391591841780481 22.77078644891941 0.04290008544921875 3 0.9810162080038272 8.942963048760495 2024.0 4.1066666666666665 1.0 - - - - - - - 253.0 4 8 PDHB pyruvate dehydrogenase (lipoamide) beta 1917 247 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536210.[MT7]-TNHLVTVEGGWPQFGVGAEIC[CAM]AR.4b5_1.heavy 661.337 / 709.411 1855.0 38.53942680358887 43 18 10 5 10 4.391591841780481 22.77078644891941 0.04290008544921875 3 0.9810162080038272 8.942963048760495 1855.0 13.250557803400612 1.0 - - - - - - - 230.0909090909091 11 11 PDHB pyruvate dehydrogenase (lipoamide) beta 1919 247 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536210.[MT7]-TNHLVTVEGGWPQFGVGAEIC[CAM]AR.4y7_1.heavy 661.337 / 776.372 7506.0 38.53942680358887 43 18 10 5 10 4.391591841780481 22.77078644891941 0.04290008544921875 3 0.9810162080038272 8.942963048760495 7506.0 13.24294909853979 0.0 - - - - - - - 674.5714285714286 15 7 PDHB pyruvate dehydrogenase (lipoamide) beta 1921 248 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46017.[MT7]-NAIIK[MT7].2b3_1.heavy 423.786 / 443.273 1977.0 21.759024143218994 31 15 0 6 10 2.715273287437362 36.828705406069325 0.03709983825683594 3 0.9550739569028572 5.800611739444983 1977.0 5.73251758176773 0.0 - - - - - - - 290.17391304347825 33 23 POMC;C5orf42 proopiomelanocortin;chromosome 5 open reading frame 42 1923 248 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46017.[MT7]-NAIIK[MT7].2y4_1.heavy 423.786 / 588.42 4745.0 21.759024143218994 31 15 0 6 10 2.715273287437362 36.828705406069325 0.03709983825683594 3 0.9550739569028572 5.800611739444983 4745.0 9.588899419203479 0.0 - - - - - - - 670.8571428571429 9 7 POMC;C5orf42 proopiomelanocortin;chromosome 5 open reading frame 42 1925 248 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46017.[MT7]-NAIIK[MT7].2b4_1.heavy 423.786 / 556.357 988.0 21.759024143218994 31 15 0 6 10 2.715273287437362 36.828705406069325 0.03709983825683594 3 0.9550739569028572 5.800611739444983 988.0 1.750886075949367 11.0 - - - - - - - 679.625 3 8 POMC;C5orf42 proopiomelanocortin;chromosome 5 open reading frame 42 1927 248 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46017.[MT7]-NAIIK[MT7].2y3_1.heavy 423.786 / 517.383 2224.0 21.759024143218994 31 15 0 6 10 2.715273287437362 36.828705406069325 0.03709983825683594 3 0.9550739569028572 5.800611739444983 2224.0 7.71370781739079 0.0 - - - - - - - 280.05555555555554 4 18 POMC;C5orf42 proopiomelanocortin;chromosome 5 open reading frame 42 1929 249 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40308.[MT7]-SDGAK[MT7]PGPR.2y8_1.heavy 586.835 / 941.529 N/A N/A - - - - - - - - - 0.0 - - - - - - - POMC proopiomelanocortin 1931 249 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40308.[MT7]-SDGAK[MT7]PGPR.2y5_1.heavy 586.835 / 698.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - POMC proopiomelanocortin 1933 249 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40308.[MT7]-SDGAK[MT7]PGPR.2b5_1.heavy 586.835 / 747.424 N/A N/A - - - - - - - - - 0.0 - - - - - - - POMC proopiomelanocortin 1935 249 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40308.[MT7]-SDGAK[MT7]PGPR.2y7_1.heavy 586.835 / 826.502 N/A N/A - - - - - - - - - 0.0 - - - - - - - POMC proopiomelanocortin 1937 250 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535742.[MT7]-TREEIQEVR.3b6_2.heavy 435.241 / 451.247 3327.0 19.326200485229492 38 8 10 10 10 0.8533085453407379 72.67210323569333 0.0 3 0.7512241753000201 2.421104161748786 3327.0 3.565961199156046 0.0 - - - - - - - 326.11764705882354 6 17 PDHA1;PDHA2 pyruvate dehydrogenase (lipoamide) alpha 1;pyruvate dehydrogenase (lipoamide) alpha 2 1939 250 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535742.[MT7]-TREEIQEVR.3b4_1.heavy 435.241 / 660.343 981.0 19.326200485229492 38 8 10 10 10 0.8533085453407379 72.67210323569333 0.0 3 0.7512241753000201 2.421104161748786 981.0 4.910757042253521 0.0 - - - - - - - 0.0 1 0 PDHA1;PDHA2 pyruvate dehydrogenase (lipoamide) alpha 1;pyruvate dehydrogenase (lipoamide) alpha 2 1941 250 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535742.[MT7]-TREEIQEVR.3y5_1.heavy 435.241 / 644.373 1749.0 19.326200485229492 38 8 10 10 10 0.8533085453407379 72.67210323569333 0.0 3 0.7512241753000201 2.421104161748786 1749.0 4.628462322881531 0.0 - - - - - - - 155.13636363636363 3 22 PDHA1;PDHA2 pyruvate dehydrogenase (lipoamide) alpha 1;pyruvate dehydrogenase (lipoamide) alpha 2 1943 250 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535742.[MT7]-TREEIQEVR.3b7_2.heavy 435.241 / 515.768 7421.0 19.326200485229492 38 8 10 10 10 0.8533085453407379 72.67210323569333 0.0 3 0.7512241753000201 2.421104161748786 7421.0 5.657265525420063 0.0 - - - - - - - 226.625 14 16 PDHA1;PDHA2 pyruvate dehydrogenase (lipoamide) alpha 1;pyruvate dehydrogenase (lipoamide) alpha 2 1945 251 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536086.[MT7]-LTDFGFSC[CAM]QLEPGER.3y6_1.heavy 633.972 / 700.362 16918.0 37.98270034790039 46 16 10 10 10 2.338027950276324 36.12264834645869 0.0 3 0.9637089832777044 6.458632286090221 16918.0 95.1188270047796 0.0 - - - - - - - 294.42857142857144 33 14 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1947 251 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536086.[MT7]-LTDFGFSC[CAM]QLEPGER.3b4_1.heavy 633.972 / 621.336 8683.0 37.98270034790039 46 16 10 10 10 2.338027950276324 36.12264834645869 0.0 3 0.9637089832777044 6.458632286090221 8683.0 26.449522997164124 1.0 - - - - - - - 665.1428571428571 17 7 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1949 251 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536086.[MT7]-LTDFGFSC[CAM]QLEPGER.3b5_1.heavy 633.972 / 678.358 31329.0 37.98270034790039 46 16 10 10 10 2.338027950276324 36.12264834645869 0.0 3 0.9637089832777044 6.458632286090221 31329.0 120.3434901237031 0.0 - - - - - - - 252.63636363636363 62 11 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1951 251 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536086.[MT7]-LTDFGFSC[CAM]QLEPGER.3y5_1.heavy 633.972 / 587.278 22825.0 37.98270034790039 46 16 10 10 10 2.338027950276324 36.12264834645869 0.0 3 0.9637089832777044 6.458632286090221 22825.0 53.0433695971773 0.0 - - - - - - - 666.4444444444445 45 9 PHKG1 phosphorylase kinase, gamma 1 (muscle) 1953 252 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40706.[MT7]-GNRVPLC[CAM]INPQSAAFK[MT7].3y7_1.heavy 687.382 / 892.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLK nemo-like kinase 1955 252 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40706.[MT7]-GNRVPLC[CAM]INPQSAAFK[MT7].3b9_1.heavy 687.382 / 1168.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLK nemo-like kinase 1957 252 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40706.[MT7]-GNRVPLC[CAM]INPQSAAFK[MT7].3y3_1.heavy 687.382 / 509.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLK nemo-like kinase 1959 252 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40706.[MT7]-GNRVPLC[CAM]INPQSAAFK[MT7].3y5_1.heavy 687.382 / 667.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLK nemo-like kinase 1961 253 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43745.[MT7]-EGGVLK[MT7].2y4_1.heavy 445.781 / 560.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 1963 253 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43745.[MT7]-EGGVLK[MT7].2y5_1.heavy 445.781 / 617.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 1965 253 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43745.[MT7]-EGGVLK[MT7].2b4_1.heavy 445.781 / 487.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 1967 253 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43745.[MT7]-EGGVLK[MT7].2b5_1.heavy 445.781 / 600.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISYNA1 inositol-3-phosphate synthase 1 1969 254 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44288.[MT7]-IMEGPAFNFLDAPAVR.2b3_1.heavy 946.496 / 518.276 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHB pyruvate dehydrogenase (lipoamide) beta 1971 254 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44288.[MT7]-IMEGPAFNFLDAPAVR.2y8_1.heavy 946.496 / 888.494 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHB pyruvate dehydrogenase (lipoamide) beta 1973 254 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44288.[MT7]-IMEGPAFNFLDAPAVR.2y5_1.heavy 946.496 / 513.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHB pyruvate dehydrogenase (lipoamide) beta 1975 254 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44288.[MT7]-IMEGPAFNFLDAPAVR.2y9_1.heavy 946.496 / 1002.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDHB pyruvate dehydrogenase (lipoamide) beta 1977 255 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40517.[MT7]-VVSPWNSEDAK[MT7].2y6_1.heavy 760.403 / 807.396 N/A 29.50589942932129 43 15 10 10 8 1.8611612560911353 53.729895608305796 0.0 4 0.9593760548862506 6.102250303503287 232.0 1.2653295128939828 5.0 - - - - - - - 0.0 0 0 PDHB pyruvate dehydrogenase (lipoamide) beta 1979 255 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40517.[MT7]-VVSPWNSEDAK[MT7].2y8_1.heavy 760.403 / 1090.53 4765.0 29.50589942932129 43 15 10 10 8 1.8611612560911353 53.729895608305796 0.0 4 0.9593760548862506 6.102250303503287 4765.0 57.303232758620695 0.0 - - - - - - - 180.55555555555554 9 9 PDHB pyruvate dehydrogenase (lipoamide) beta 1981 255 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40517.[MT7]-VVSPWNSEDAK[MT7].2y5_1.heavy 760.403 / 693.354 581.0 29.50589942932129 43 15 10 10 8 1.8611612560911353 53.729895608305796 0.0 4 0.9593760548862506 6.102250303503287 581.0 3.990069595395712 11.0 - - - - - - - 0.0 1 0 PDHB pyruvate dehydrogenase (lipoamide) beta 1983 255 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40517.[MT7]-VVSPWNSEDAK[MT7].2y9_1.heavy 760.403 / 1177.56 2905.0 29.50589942932129 43 15 10 10 8 1.8611612560911353 53.729895608305796 0.0 4 0.9593760548862506 6.102250303503287 2905.0 45.828879310344824 0.0 - - - - - - - 174.125 5 8 PDHB pyruvate dehydrogenase (lipoamide) beta 1985 256 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43741.[MT7]-FLSVK[MT7].2y4_1.heavy 441.289 / 590.399 4737.0 30.19300079345703 50 20 10 10 10 18.134766938645523 5.514269929044313 0.0 2 0.9953722976671031 18.134769391312524 4737.0 14.78139139241049 0.0 - - - - - - - 340.1818181818182 9 11 PRKCZ protein kinase C, zeta 1987 256 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB43741.[MT7]-FLSVK[MT7].2y3_1.heavy 441.289 / 477.315 3864.0 30.19300079345703 50 20 10 10 10 18.134766938645523 5.514269929044313 0.0 2 0.9953722976671031 18.134769391312524 3864.0 2.118998307640032 0.0 - - - - - - - 277.22222222222223 7 9 PRKCZ protein kinase C, zeta 1989 257 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40310.[MT7]-LTIPSSC[CAM]PR.2y8_1.heavy 587.822 / 917.451 13383.0 27.915425300598145 44 18 10 6 10 5.045063896808103 19.8213545051962 0.039501190185546875 3 0.9815926035358091 9.08233969091859 13383.0 24.792312830521478 0.0 - - - - - - - 709.1428571428571 26 7 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1991 257 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40310.[MT7]-LTIPSSC[CAM]PR.2y5_1.heavy 587.822 / 606.266 2038.0 27.915425300598145 44 18 10 6 10 5.045063896808103 19.8213545051962 0.039501190185546875 3 0.9815926035358091 9.08233969091859 2038.0 4.8480452094306505 0.0 - - - - - - - 277.73333333333335 4 15 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1993 257 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40310.[MT7]-LTIPSSC[CAM]PR.2y6_1.heavy 587.822 / 703.319 51137.0 27.915425300598145 44 18 10 6 10 5.045063896808103 19.8213545051962 0.039501190185546875 3 0.9815926035358091 9.08233969091859 51137.0 47.44965613327962 0.0 - - - - - - - 251.33333333333334 102 6 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1995 257 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40310.[MT7]-LTIPSSC[CAM]PR.2y7_1.heavy 587.822 / 816.403 7090.0 27.915425300598145 44 18 10 6 10 5.045063896808103 19.8213545051962 0.039501190185546875 3 0.9815926035358091 9.08233969091859 7090.0 29.359068299273567 0.0 - - - - - - - 221.625 14 8 ZAK sterile alpha motif and leucine zipper containing kinase AZK 1997 258 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40519.[MT7]-IYASSSPPDTGQR.2b6_1.heavy 761.885 / 753.39 N/A 22.583932876586914 42 16 10 6 10 2.37570357122892 35.582612169971185 0.03339958190917969 3 0.9683407790625911 6.917668772067461 5129.0 3.9352941176470586 1.0 - - - - - - - 697.2727272727273 10 11 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 1999 258 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40519.[MT7]-IYASSSPPDTGQR.2y10_1.heavy 761.885 / 1031.48 3273.0 22.583932876586914 42 16 10 6 10 2.37570357122892 35.582612169971185 0.03339958190917969 3 0.9683407790625911 6.917668772067461 3273.0 1.9140350877192982 0.0 - - - - - - - 167.42857142857142 6 14 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 2001 258 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40519.[MT7]-IYASSSPPDTGQR.2y11_1.heavy 761.885 / 1102.51 2101.0 22.583932876586914 42 16 10 6 10 2.37570357122892 35.582612169971185 0.03339958190917969 3 0.9683407790625911 6.917668772067461 2101.0 43.74299361462376 0.0 - - - - - - - 192.33333333333334 4 15 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 2003 258 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40519.[MT7]-IYASSSPPDTGQR.2y7_1.heavy 761.885 / 770.379 5716.0 22.583932876586914 42 16 10 6 10 2.37570357122892 35.582612169971185 0.03339958190917969 3 0.9683407790625911 6.917668772067461 5716.0 19.972615540883695 0.0 - - - - - - - 247.85714285714286 11 14 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 2005 259 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44097.[MT7]-YLFLGDYVDR.2y4_1.heavy 702.868 / 552.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 2007 259 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44097.[MT7]-YLFLGDYVDR.2y8_1.heavy 702.868 / 984.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 2009 259 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44097.[MT7]-YLFLGDYVDR.2y6_1.heavy 702.868 / 724.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 2011 259 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44097.[MT7]-YLFLGDYVDR.2y7_1.heavy 702.868 / 837.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 2013 260 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40315.[MT7]-IYNLC[CAM]AER.2y3_1.heavy 591.807 / 375.199 960.0 28.381399154663086 50 20 10 10 10 5.202478172374152 19.221608757728813 0.0 3 0.9970900183746148 22.87240721127344 960.0 9.5 2.0 - - - - - - - 0.0 1 0 PTEN phosphatase and tensin homolog 2015 260 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40315.[MT7]-IYNLC[CAM]AER.2y6_1.heavy 591.807 / 762.356 2111.0 28.381399154663086 50 20 10 10 10 5.202478172374152 19.221608757728813 0.0 3 0.9970900183746148 22.87240721127344 2111.0 4.096307829711223 1.0 - - - - - - - 249.6 6 15 PTEN phosphatase and tensin homolog 2017 260 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40315.[MT7]-IYNLC[CAM]AER.2y7_1.heavy 591.807 / 925.42 11709.0 28.381399154663086 50 20 10 10 10 5.202478172374152 19.221608757728813 0.0 3 0.9970900183746148 22.87240721127344 11709.0 89.44375 0.0 - - - - - - - 208.0 23 12 PTEN phosphatase and tensin homolog 2019 261 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20629.[MT7]-QIISILESMSNDTSLPDK[MT7].3b6_1.heavy 760.406 / 812.536 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 2021 261 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20629.[MT7]-QIISILESMSNDTSLPDK[MT7].3y3_1.heavy 760.406 / 503.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 2023 261 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20629.[MT7]-QIISILESMSNDTSLPDK[MT7].3b4_1.heavy 760.406 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 2025 261 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB20629.[MT7]-QIISILESMSNDTSLPDK[MT7].3b5_1.heavy 760.406 / 699.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZAK sterile alpha motif and leucine zipper containing kinase AZK 2027 262 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46007.[MT7]-NLSSVR.2y4_1.heavy 410.244 / 448.251 5590.0 19.510799407958984 46 20 10 6 10 6.92213629550308 14.446407255078801 0.034999847412109375 3 0.9966877599486983 21.437864459594493 5590.0 27.577741288086116 0.0 - - - - - - - 216.25 11 20 NLK nemo-like kinase 2029 262 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46007.[MT7]-NLSSVR.2y5_1.heavy 410.244 / 561.336 9241.0 19.510799407958984 46 20 10 6 10 6.92213629550308 14.446407255078801 0.034999847412109375 3 0.9966877599486983 21.437864459594493 9241.0 38.23535112541582 0.0 - - - - - - - 229.52380952380952 18 21 NLK nemo-like kinase 2031 262 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46007.[MT7]-NLSSVR.2b4_1.heavy 410.244 / 546.3 3471.0 19.510799407958984 46 20 10 6 10 6.92213629550308 14.446407255078801 0.034999847412109375 3 0.9966877599486983 21.437864459594493 3471.0 9.892283716213548 1.0 - - - - - - - 292.04347826086956 6 23 NLK nemo-like kinase 2033 262 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46007.[MT7]-NLSSVR.2b5_1.heavy 410.244 / 645.369 1443.0 19.510799407958984 46 20 10 6 10 6.92213629550308 14.446407255078801 0.034999847412109375 3 0.9966877599486983 21.437864459594493 1443.0 4.886268984621262 1.0 - - - - - - - 256.69565217391306 13 23 NLK nemo-like kinase 2035 263 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46006.[MT7]-LHAGK[MT7].2b3_1.heavy 407.263 / 466.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBB;KIF26B;ZNF419 inhibin, beta B;kinesin family member 26B;zinc finger protein 419 2037 263 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46006.[MT7]-LHAGK[MT7].2y4_1.heavy 407.263 / 556.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBB;KIF26B;ZNF419 inhibin, beta B;kinesin family member 26B;zinc finger protein 419 2039 263 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46006.[MT7]-LHAGK[MT7].2y4_2.heavy 407.263 / 278.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBB;KIF26B;ZNF419 inhibin, beta B;kinesin family member 26B;zinc finger protein 419 2041 263 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB46006.[MT7]-LHAGK[MT7].2y3_1.heavy 407.263 / 419.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBB;KIF26B;ZNF419 inhibin, beta B;kinesin family member 26B;zinc finger protein 419 2043 264 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44384.[MT7]-GIIWGEDTLMEYLENPK[MT7].2y8_1.heavy 1148.59 / 1167.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYCS cytochrome c, somatic 2045 264 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44384.[MT7]-GIIWGEDTLMEYLENPK[MT7].2y3_1.heavy 1148.59 / 502.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYCS cytochrome c, somatic 2047 264 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44384.[MT7]-GIIWGEDTLMEYLENPK[MT7].2b5_1.heavy 1148.59 / 671.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYCS cytochrome c, somatic 2049 264 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB44384.[MT7]-GIIWGEDTLMEYLENPK[MT7].2b9_1.heavy 1148.59 / 1129.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYCS cytochrome c, somatic 2051 265 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40514.[MT7]-YAALNLAALHC[CAM]R.3b4_1.heavy 506.277 / 563.331 8733.0 33.47700119018555 47 17 10 10 10 3.4791234536933793 28.742871970766565 0.0 3 0.9740046506565774 7.637816524070303 8733.0 19.681043243384313 0.0 - - - - - - - 322.0 17 10 ANAPC5 anaphase promoting complex subunit 5 2053 265 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40514.[MT7]-YAALNLAALHC[CAM]R.3b5_1.heavy 506.277 / 677.374 23442.0 33.47700119018555 47 17 10 10 10 3.4791234536933793 28.742871970766565 0.0 3 0.9740046506565774 7.637816524070303 23442.0 47.51980816420797 0.0 - - - - - - - 282.27272727272725 46 11 ANAPC5 anaphase promoting complex subunit 5 2055 265 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40514.[MT7]-YAALNLAALHC[CAM]R.3y4_1.heavy 506.277 / 585.293 5746.0 33.47700119018555 47 17 10 10 10 3.4791234536933793 28.742871970766565 0.0 3 0.9740046506565774 7.637816524070303 5746.0 17.989289907620517 0.0 - - - - - - - 207.0 11 10 ANAPC5 anaphase promoting complex subunit 5 2057 265 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB40514.[MT7]-YAALNLAALHC[CAM]R.3y5_1.heavy 506.277 / 656.33 17697.0 33.47700119018555 47 17 10 10 10 3.4791234536933793 28.742871970766565 0.0 3 0.9740046506565774 7.637816524070303 17697.0 45.224608342443865 0.0 - - - - - - - 301.875 35 8 ANAPC5 anaphase promoting complex subunit 5 2059 266 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536090.[MT7]-K[MT7]LEELELDEQQK[MT7].4b8_2.heavy 484.276 / 629.86 43136.0 28.89699935913086 41 11 10 10 10 0.7545496032484782 84.48163472274918 0.0 3 0.8701345491250347 3.3868774658470193 43136.0 119.35524789816924 0.0 - - - - - - - 292.3333333333333 86 9 MAP2K2 mitogen-activated protein kinase kinase 2 2061 266 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536090.[MT7]-K[MT7]LEELELDEQQK[MT7].4b4_1.heavy 484.276 / 788.476 3890.0 28.89699935913086 41 11 10 10 10 0.7545496032484782 84.48163472274918 0.0 3 0.8701345491250347 3.3868774658470193 3890.0 6.693089339363489 1.0 - - - - - - - 246.30769230769232 7 13 MAP2K2 mitogen-activated protein kinase kinase 2 2063 266 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536090.[MT7]-K[MT7]LEELELDEQQK[MT7].4b6_1.heavy 484.276 / 1030.6 N/A 28.89699935913086 41 11 10 10 10 0.7545496032484782 84.48163472274918 0.0 3 0.8701345491250347 3.3868774658470193 0.0 -0.0 0.0 - - - - - - - 0.0 0 0 MAP2K2 mitogen-activated protein kinase kinase 2 2065 266 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB536090.[MT7]-K[MT7]LEELELDEQQK[MT7].4b6_2.heavy 484.276 / 515.805 68194.0 28.89699935913086 41 11 10 10 10 0.7545496032484782 84.48163472274918 0.0 3 0.8701345491250347 3.3868774658470193 68194.0 124.10709642613571 0.0 - - - - - - - 735.5714285714286 136 7 MAP2K2 mitogen-activated protein kinase kinase 2 2067 267 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535731.[MT7]-AAALAAALGPAEAGMLEK[MT7].3b6_1.heavy 648.367 / 613.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 2069 267 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535731.[MT7]-AAALAAALGPAEAGMLEK[MT7].3b5_1.heavy 648.367 / 542.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 2071 267 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535731.[MT7]-AAALAAALGPAEAGMLEK[MT7].3y5_1.heavy 648.367 / 721.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit 2073 267 B20140220_KEGG1700_set01_04 B20140220_KEGG1700_set01_04 TB535731.[MT7]-AAALAAALGPAEAGMLEK[MT7].3b7_1.heavy 648.367 / 684.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit