Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140220_SF056_06 B20140220_SF056_06 TB469932.[MT7]-RGQVVGTR.2b5_1.heavy 508.808 / 684.427 237.0 14.637200355529785 47 17 10 10 10 6.22664498340742 16.060013099586865 0.0 3 0.9797244149197734 8.652450655967447 237.0 0.3060885608856089 11.0 - - - - - - - 0.0 1 0 PAPSS2;PAPSS1 3'-phosphoadenosine 5'-phosphosulfate synthase 2;3'-phosphoadenosine 5'-phosphosulfate synthase 1 3 1 B20140220_SF056_06 B20140220_SF056_06 TB469932.[MT7]-RGQVVGTR.2b4_1.heavy 508.808 / 585.359 407.0 14.637200355529785 47 17 10 10 10 6.22664498340742 16.060013099586865 0.0 3 0.9797244149197734 8.652450655967447 407.0 1.5960784313725491 2.0 - - - - - - - 0.0 0 0 PAPSS2;PAPSS1 3'-phosphoadenosine 5'-phosphosulfate synthase 2;3'-phosphoadenosine 5'-phosphosulfate synthase 1 5 1 B20140220_SF056_06 B20140220_SF056_06 TB469932.[MT7]-RGQVVGTR.2b6_1.heavy 508.808 / 741.449 373.0 14.637200355529785 47 17 10 10 10 6.22664498340742 16.060013099586865 0.0 3 0.9797244149197734 8.652450655967447 373.0 13.16470588235294 0.0 - - - - - - - 0.0 0 0 PAPSS2;PAPSS1 3'-phosphoadenosine 5'-phosphosulfate synthase 2;3'-phosphoadenosine 5'-phosphosulfate synthase 1 7 1 B20140220_SF056_06 B20140220_SF056_06 TB469932.[MT7]-RGQVVGTR.2y7_1.heavy 508.808 / 716.405 2270.0 14.637200355529785 47 17 10 10 10 6.22664498340742 16.060013099586865 0.0 3 0.9797244149197734 8.652450655967447 2270.0 73.44117647058823 0.0 - - - - - - - 113.70588235294117 4 17 PAPSS2;PAPSS1 3'-phosphoadenosine 5'-phosphosulfate synthase 2;3'-phosphoadenosine 5'-phosphosulfate synthase 1 9 2 B20140220_SF056_06 B20140220_SF056_06 TB470438.[MT7]-LTFVDFLTYDILDQNRIFDPK[MT7].4b4_1.heavy 716.139 / 605.378 3574.0 50.06740188598633 48 18 10 10 10 5.29619543379095 18.88147845941955 0.0 3 0.9867451960994579 10.70766656752004 3574.0 25.93635882788533 0.0 - - - - - - - 171.83333333333334 7 6 GSTM3 glutathione S-transferase mu 3 (brain) 11 2 B20140220_SF056_06 B20140220_SF056_06 TB470438.[MT7]-LTFVDFLTYDILDQNRIFDPK[MT7].4b5_1.heavy 716.139 / 720.405 12303.0 50.06740188598633 48 18 10 10 10 5.29619543379095 18.88147845941955 0.0 3 0.9867451960994579 10.70766656752004 12303.0 267.45652173913044 0.0 - - - - - - - 86.0 24 8 GSTM3 glutathione S-transferase mu 3 (brain) 13 2 B20140220_SF056_06 B20140220_SF056_06 TB470438.[MT7]-LTFVDFLTYDILDQNRIFDPK[MT7].4b3_1.heavy 716.139 / 506.31 5155.0 50.06740188598633 48 18 10 10 10 5.29619543379095 18.88147845941955 0.0 3 0.9867451960994579 10.70766656752004 5155.0 14.98546511627907 0.0 - - - - - - - 151.4 10 5 GSTM3 glutathione S-transferase mu 3 (brain) 15 2 B20140220_SF056_06 B20140220_SF056_06 TB470438.[MT7]-LTFVDFLTYDILDQNRIFDPK[MT7].4b6_1.heavy 716.139 / 867.473 4468.0 50.06740188598633 48 18 10 10 10 5.29619543379095 18.88147845941955 0.0 3 0.9867451960994579 10.70766656752004 4468.0 128.21217391304347 0.0 - - - - - - - 69.0 8 3 GSTM3 glutathione S-transferase mu 3 (brain) 17 3 B20140220_SF056_06 B20140220_SF056_06 TB317316.[MT7]-IESQTQEEVR.2y8_1.heavy 681.853 / 976.469 3198.0 20.69392442703247 47 20 10 7 10 4.911486202114935 20.3604359016501 0.027898788452148438 3 0.9920842283075194 13.862094076238055 3198.0 33.918181818181814 0.0 - - - - - - - 140.68421052631578 6 19 SCG2 secretogranin II 19 3 B20140220_SF056_06 B20140220_SF056_06 TB317316.[MT7]-IESQTQEEVR.2y9_1.heavy 681.853 / 1105.51 5571.0 20.69392442703247 47 20 10 7 10 4.911486202114935 20.3604359016501 0.027898788452148438 3 0.9920842283075194 13.862094076238055 5571.0 108.79393939393938 0.0 - - - - - - - 144.1578947368421 11 19 SCG2 secretogranin II 21 3 B20140220_SF056_06 B20140220_SF056_06 TB317316.[MT7]-IESQTQEEVR.2y6_1.heavy 681.853 / 761.379 1418.0 20.69392442703247 47 20 10 7 10 4.911486202114935 20.3604359016501 0.027898788452148438 3 0.9920842283075194 13.862094076238055 1418.0 74.33757575757576 0.0 - - - - - - - 121.6875 2 16 SCG2 secretogranin II 23 3 B20140220_SF056_06 B20140220_SF056_06 TB317316.[MT7]-IESQTQEEVR.2y7_1.heavy 681.853 / 889.437 989.0 20.69392442703247 47 20 10 7 10 4.911486202114935 20.3604359016501 0.027898788452148438 3 0.9920842283075194 13.862094076238055 989.0 11.987878787878788 0.0 - - - - - - - 0.0 1 0 SCG2 secretogranin II 25 4 B20140220_SF056_06 B20140220_SF056_06 TB317729.[MT7]-YAGLQPYLDQINVIEEQVAALEQAAYK[MT7].4b4_1.heavy 832.194 / 549.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 27 4 B20140220_SF056_06 B20140220_SF056_06 TB317729.[MT7]-YAGLQPYLDQINVIEEQVAALEQAAYK[MT7].4b5_1.heavy 832.194 / 677.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 29 4 B20140220_SF056_06 B20140220_SF056_06 TB317729.[MT7]-YAGLQPYLDQINVIEEQVAALEQAAYK[MT7].4y6_1.heavy 832.194 / 853.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 31 4 B20140220_SF056_06 B20140220_SF056_06 TB317729.[MT7]-YAGLQPYLDQINVIEEQVAALEQAAYK[MT7].4y3_1.heavy 832.194 / 525.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 33 5 B20140220_SF056_06 B20140220_SF056_06 TB317728.[MT7]-YAGLQPYLDQINVIEEQVAALEQAAYK[MT7].3b9_1.heavy 1109.26 / 1165.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 35 5 B20140220_SF056_06 B20140220_SF056_06 TB317728.[MT7]-YAGLQPYLDQINVIEEQVAALEQAAYK[MT7].3b4_1.heavy 1109.26 / 549.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 37 5 B20140220_SF056_06 B20140220_SF056_06 TB317728.[MT7]-YAGLQPYLDQINVIEEQVAALEQAAYK[MT7].3b5_1.heavy 1109.26 / 677.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 39 5 B20140220_SF056_06 B20140220_SF056_06 TB317728.[MT7]-YAGLQPYLDQINVIEEQVAALEQAAYK[MT7].3y9_1.heavy 1109.26 / 1108.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 41 6 B20140220_SF056_06 B20140220_SF056_06 TB470161.[MT7]-DIQTNVYIK[MT7].2b3_1.heavy 691.4 / 501.279 7980.0 28.457849979400635 43 17 10 6 10 3.2531421424436733 24.52358686268595 0.031000137329101562 3 0.9717693647757994 7.32782373764184 7980.0 54.86681818181818 0.0 - - - - - - - 251.48 15 25 PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 43 6 B20140220_SF056_06 B20140220_SF056_06 TB470161.[MT7]-DIQTNVYIK[MT7].2y3_1.heavy 691.4 / 567.362 9865.0 28.457849979400635 43 17 10 6 10 3.2531421424436733 24.52358686268595 0.031000137329101562 3 0.9717693647757994 7.32782373764184 9865.0 57.36454817671988 0.0 - - - - - - - 224.89473684210526 19 19 PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 45 6 B20140220_SF056_06 B20140220_SF056_06 TB470161.[MT7]-DIQTNVYIK[MT7].2y6_1.heavy 691.4 / 881.521 8734.0 28.457849979400635 43 17 10 6 10 3.2531421424436733 24.52358686268595 0.031000137329101562 3 0.9717693647757994 7.32782373764184 8734.0 78.4547619047619 0.0 - - - - - - - 174.66666666666666 17 18 PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 47 6 B20140220_SF056_06 B20140220_SF056_06 TB470161.[MT7]-DIQTNVYIK[MT7].2b5_1.heavy 691.4 / 716.37 5592.0 28.457849979400635 43 17 10 6 10 3.2531421424436733 24.52358686268595 0.031000137329101562 3 0.9717693647757994 7.32782373764184 5592.0 14.45543397440292 0.0 - - - - - - - 216.5 11 18 PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 49 7 B20140220_SF056_06 B20140220_SF056_06 TB317310.[MT7]-TLSSPTEPVK[MT7].2b4_1.heavy 673.892 / 533.305 3867.0 23.54789924621582 44 14 10 10 10 1.7132704302192248 47.778474093693646 0.0 3 0.93067537112901 4.6599058297202065 3867.0 65.50439672801636 0.0 - - - - - - - 178.78571428571428 7 14 PSMB10 proteasome (prosome, macropain) subunit, beta type, 10 51 7 B20140220_SF056_06 B20140220_SF056_06 TB317310.[MT7]-TLSSPTEPVK[MT7].2y9_1.heavy 673.892 / 1101.63 926.0 23.54789924621582 44 14 10 10 10 1.7132704302192248 47.778474093693646 0.0 3 0.93067537112901 4.6599058297202065 926.0 -0.4473429951690821 2.0 - - - - - - - 113.25 2 12 PSMB10 proteasome (prosome, macropain) subunit, beta type, 10 53 7 B20140220_SF056_06 B20140220_SF056_06 TB317310.[MT7]-TLSSPTEPVK[MT7].2y6_1.heavy 673.892 / 814.479 5774.0 23.54789924621582 44 14 10 10 10 1.7132704302192248 47.778474093693646 0.0 3 0.93067537112901 4.6599058297202065 5774.0 74.69119266055046 0.0 - - - - - - - 204.125 11 16 PSMB10 proteasome (prosome, macropain) subunit, beta type, 10 55 7 B20140220_SF056_06 B20140220_SF056_06 TB317310.[MT7]-TLSSPTEPVK[MT7].2y7_1.heavy 673.892 / 901.511 2288.0 23.54789924621582 44 14 10 10 10 1.7132704302192248 47.778474093693646 0.0 3 0.93067537112901 4.6599058297202065 2288.0 31.486238532110086 0.0 - - - - - - - 123.63636363636364 4 11 PSMB10 proteasome (prosome, macropain) subunit, beta type, 10 57 8 B20140220_SF056_06 B20140220_SF056_06 TB470234.[MT7]-LSHETVTIELK[MT7].3y3_1.heavy 519.975 / 533.341 50070.0 30.18814992904663 43 17 10 6 10 20.357745841982503 4.912135202797171 0.03420066833496094 3 0.9741287405977951 7.656191708251455 50070.0 31.81892561665135 0.0 - - - - - - - 445.0 100 1 SNRPD1 small nuclear ribonucleoprotein D1 polypeptide 16kDa 59 8 B20140220_SF056_06 B20140220_SF056_06 TB470234.[MT7]-LSHETVTIELK[MT7].3b4_1.heavy 519.975 / 611.327 11706.0 30.18814992904663 43 17 10 6 10 20.357745841982503 4.912135202797171 0.03420066833496094 3 0.9741287405977951 7.656191708251455 11706.0 15.34429265394667 0.0 - - - - - - - 721.1111111111111 23 9 SNRPD1 small nuclear ribonucleoprotein D1 polypeptide 16kDa 61 8 B20140220_SF056_06 B20140220_SF056_06 TB470234.[MT7]-LSHETVTIELK[MT7].3y4_1.heavy 519.975 / 646.426 25003.0 30.18814992904663 43 17 10 6 10 20.357745841982503 4.912135202797171 0.03420066833496094 3 0.9741287405977951 7.656191708251455 25003.0 18.78133392082744 0.0 - - - - - - - 1181.5714285714287 50 7 SNRPD1 small nuclear ribonucleoprotein D1 polypeptide 16kDa 63 8 B20140220_SF056_06 B20140220_SF056_06 TB470234.[MT7]-LSHETVTIELK[MT7].3y5_1.heavy 519.975 / 747.473 27357.0 30.18814992904663 43 17 10 6 10 20.357745841982503 4.912135202797171 0.03420066833496094 3 0.9741287405977951 7.656191708251455 27357.0 44.08288498844695 0.0 - - - - - - - 755.625 54 8 SNRPD1 small nuclear ribonucleoprotein D1 polypeptide 16kDa 65 9 B20140220_SF056_06 B20140220_SF056_06 TB470169.[MT7]-LAASAPLRAQVR.3b4_1.heavy 466.288 / 487.3 24320.0 25.473400115966797 41 13 10 10 8 1.9466793146693409 45.73180357779724 0.0 4 0.9122169883153234 4.1345453116361615 24320.0 14.236212818707308 1.0 - - - - - - - 1255.625 62 8 EFS embryonal Fyn-associated substrate 67 9 B20140220_SF056_06 B20140220_SF056_06 TB470169.[MT7]-LAASAPLRAQVR.3y11_2.heavy 466.288 / 570.336 142221.0 25.473400115966797 41 13 10 10 8 1.9466793146693409 45.73180357779724 0.0 4 0.9122169883153234 4.1345453116361615 142221.0 113.96546925398403 0.0 - - - - - - - 321.25 284 4 EFS embryonal Fyn-associated substrate 69 9 B20140220_SF056_06 B20140220_SF056_06 TB470169.[MT7]-LAASAPLRAQVR.3b5_1.heavy 466.288 / 558.337 23414.0 25.473400115966797 41 13 10 10 8 1.9466793146693409 45.73180357779724 0.0 4 0.9122169883153234 4.1345453116361615 23414.0 32.00426287966729 0.0 - - - - - - - 689.125 46 8 EFS embryonal Fyn-associated substrate 71 9 B20140220_SF056_06 B20140220_SF056_06 TB470169.[MT7]-LAASAPLRAQVR.3y4_1.heavy 466.288 / 473.283 23641.0 25.473400115966797 41 13 10 10 8 1.9466793146693409 45.73180357779724 0.0 4 0.9122169883153234 4.1345453116361615 23641.0 18.27800976580449 0.0 - - - - - - - 671.4444444444445 47 9 EFS embryonal Fyn-associated substrate 73 10 B20140220_SF056_06 B20140220_SF056_06 TB317724.[MT7]-SFFWNVAPGAESAVASFVTQLAAAEALQK[MT7].3b6_1.heavy 1100.25 / 925.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCSTN nicastrin 75 10 B20140220_SF056_06 B20140220_SF056_06 TB317724.[MT7]-SFFWNVAPGAESAVASFVTQLAAAEALQK[MT7].3b5_1.heavy 1100.25 / 826.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCSTN nicastrin 77 10 B20140220_SF056_06 B20140220_SF056_06 TB317724.[MT7]-SFFWNVAPGAESAVASFVTQLAAAEALQK[MT7].3b3_1.heavy 1100.25 / 526.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCSTN nicastrin 79 10 B20140220_SF056_06 B20140220_SF056_06 TB317724.[MT7]-SFFWNVAPGAESAVASFVTQLAAAEALQK[MT7].3b7_1.heavy 1100.25 / 996.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCSTN nicastrin 81 11 B20140220_SF056_06 B20140220_SF056_06 TB470166.[MT7]-TRTVIYEIPR.3b4_1.heavy 464.609 / 602.374 47680.0 28.512100219726562 42 18 6 10 8 5.006893576051933 19.97246366056229 0.0 4 0.9865137548539351 10.615184577133379 47680.0 30.034974884483994 1.0 - - - - - - - 884.0 470 2 PDGFA platelet-derived growth factor alpha polypeptide 83 11 B20140220_SF056_06 B20140220_SF056_06 TB470166.[MT7]-TRTVIYEIPR.3b5_1.heavy 464.609 / 715.458 41555.0 28.512100219726562 42 18 6 10 8 5.006893576051933 19.97246366056229 0.0 4 0.9865137548539351 10.615184577133379 41555.0 83.84633484871493 0.0 - - - - - - - 688.9090909090909 83 11 PDGFA platelet-derived growth factor alpha polypeptide 85 11 B20140220_SF056_06 B20140220_SF056_06 TB470166.[MT7]-TRTVIYEIPR.3y4_1.heavy 464.609 / 514.298 117780.0 28.512100219726562 42 18 6 10 8 5.006893576051933 19.97246366056229 0.0 4 0.9865137548539351 10.615184577133379 117780.0 90.44337086325186 0.0 - - - - - - - 1154.4285714285713 235 7 PDGFA platelet-derived growth factor alpha polypeptide 87 11 B20140220_SF056_06 B20140220_SF056_06 TB470166.[MT7]-TRTVIYEIPR.3y5_1.heavy 464.609 / 677.362 152830.0 28.512100219726562 42 18 6 10 8 5.006893576051933 19.97246366056229 0.0 4 0.9865137548539351 10.615184577133379 152830.0 295.7544420368364 0.0 - - - - - - - 701.6666666666666 305 9 PDGFA platelet-derived growth factor alpha polypeptide 89 12 B20140220_SF056_06 B20140220_SF056_06 TB317725.[MT7]-SFFWNVAPGAESAVASFVTQLAAAEALQK[MT7].4b7_1.heavy 825.439 / 996.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCSTN nicastrin 91 12 B20140220_SF056_06 B20140220_SF056_06 TB317725.[MT7]-SFFWNVAPGAESAVASFVTQLAAAEALQK[MT7].4b4_1.heavy 825.439 / 712.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCSTN nicastrin 93 12 B20140220_SF056_06 B20140220_SF056_06 TB317725.[MT7]-SFFWNVAPGAESAVASFVTQLAAAEALQK[MT7].4b6_1.heavy 825.439 / 925.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCSTN nicastrin 95 12 B20140220_SF056_06 B20140220_SF056_06 TB317725.[MT7]-SFFWNVAPGAESAVASFVTQLAAAEALQK[MT7].4b3_1.heavy 825.439 / 526.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCSTN nicastrin 97 13 B20140220_SF056_06 B20140220_SF056_06 TB470233.[MT7]-RAEVDEEHRK[MT7].3b6_1.heavy 519.618 / 844.428 1532.0 13.589799880981445 42 20 2 10 10 6.148589394863626 16.263892996910386 0.0 3 0.9971058686559583 22.93498464191188 1532.0 132.36712121212122 0.0 - - - - - - - 90.27272727272727 3 11 MUTED muted homolog (mouse) 99 13 B20140220_SF056_06 B20140220_SF056_06 TB470233.[MT7]-RAEVDEEHRK[MT7].3b5_1.heavy 519.618 / 715.385 11181.0 13.589799880981445 42 20 2 10 10 6.148589394863626 16.263892996910386 0.0 3 0.9971058686559583 22.93498464191188 11181.0 444.9581632653061 0.0 - - - - - - - 67.88888888888889 22 18 MUTED muted homolog (mouse) 101 13 B20140220_SF056_06 B20140220_SF056_06 TB470233.[MT7]-RAEVDEEHRK[MT7].3b3_1.heavy 519.618 / 501.29 N/A 13.589799880981445 42 20 2 10 10 6.148589394863626 16.263892996910386 0.0 3 0.9971058686559583 22.93498464191188 6161.0 5.449216057023928 2.0 - - - - - - - 1265.125 53 8 MUTED muted homolog (mouse) 103 13 B20140220_SF056_06 B20140220_SF056_06 TB470233.[MT7]-RAEVDEEHRK[MT7].3b7_1.heavy 519.618 / 973.471 3488.0 13.589799880981445 42 20 2 10 10 6.148589394863626 16.263892996910386 0.0 3 0.9971058686559583 22.93498464191188 3488.0 158.54545454545456 0.0 - - - - - - - 100.28571428571429 6 7 MUTED muted homolog (mouse) 105 14 B20140220_SF056_06 B20140220_SF056_06 TB317723.[MT7]-LAGVGWRVDYTLSSSLLQSVEEPMVHLR.4y8_1.heavy 822.44 / 1010.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - COMMD4 COMM domain containing 4 107 14 B20140220_SF056_06 B20140220_SF056_06 TB317723.[MT7]-LAGVGWRVDYTLSSSLLQSVEEPMVHLR.4y16_2.heavy 822.44 / 906.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - COMMD4 COMM domain containing 4 109 14 B20140220_SF056_06 B20140220_SF056_06 TB317723.[MT7]-LAGVGWRVDYTLSSSLLQSVEEPMVHLR.4y10_1.heavy 822.44 / 1196.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - COMMD4 COMM domain containing 4 111 14 B20140220_SF056_06 B20140220_SF056_06 TB317723.[MT7]-LAGVGWRVDYTLSSSLLQSVEEPMVHLR.4y6_1.heavy 822.44 / 752.424 N/A N/A - - - - - - - - - 0.0 - - - - - - - COMMD4 COMM domain containing 4 113 15 B20140220_SF056_06 B20140220_SF056_06 TB317115.[MT7]-GFPVLSK[MT7].2y4_1.heavy 518.326 / 590.399 5261.0 32.04652500152588 40 14 10 6 10 2.97833432312801 33.57581424739937 0.038898468017578125 3 0.9481443133265915 5.395967856659526 5261.0 5.649756411060785 0.0 - - - - - - - 1255.4285714285713 10 7 PRMT5 protein arginine methyltransferase 5 115 15 B20140220_SF056_06 B20140220_SF056_06 TB317115.[MT7]-GFPVLSK[MT7].2y5_1.heavy 518.326 / 687.452 24906.0 32.04652500152588 40 14 10 6 10 2.97833432312801 33.57581424739937 0.038898468017578125 3 0.9481443133265915 5.395967856659526 24906.0 14.150588235294117 1.0 - - - - - - - 761.1428571428571 49 7 PRMT5 protein arginine methyltransferase 5 117 15 B20140220_SF056_06 B20140220_SF056_06 TB317115.[MT7]-GFPVLSK[MT7].2b4_1.heavy 518.326 / 545.32 5860.0 32.04652500152588 40 14 10 6 10 2.97833432312801 33.57581424739937 0.038898468017578125 3 0.9481443133265915 5.395967856659526 5860.0 4.243783125869258 1.0 - - - - - - - 310.6666666666667 11 3 PRMT5 protein arginine methyltransferase 5 119 15 B20140220_SF056_06 B20140220_SF056_06 TB317115.[MT7]-GFPVLSK[MT7].2y3_1.heavy 518.326 / 491.331 9856.0 32.04652500152588 40 14 10 6 10 2.97833432312801 33.57581424739937 0.038898468017578125 3 0.9481443133265915 5.395967856659526 9856.0 2.3489655172413793 1.0 - - - - - - - 400.0 19 1 PRMT5 protein arginine methyltransferase 5 121 16 B20140220_SF056_06 B20140220_SF056_06 TB469936.[MT7]-SLEEEK[MT7].2y4_1.heavy 511.784 / 678.343 11276.0 19.331775188446045 40 14 10 6 10 1.2430001039645249 51.368614718014726 0.030900955200195312 3 0.948287235896339 5.40348494371785 11276.0 68.33939393939394 0.0 - - - - - - - 260.1923076923077 22 26 DNAH12;CASP14;SARS2;DST dynein, axonemal, heavy chain 12;caspase 14, apoptosis-related cysteine peptidase;seryl-tRNA synthetase 2, mitochondrial;dystonin 123 16 B20140220_SF056_06 B20140220_SF056_06 TB469936.[MT7]-SLEEEK[MT7].2y5_1.heavy 511.784 / 791.427 14244.0 19.331775188446045 40 14 10 6 10 1.2430001039645249 51.368614718014726 0.030900955200195312 3 0.948287235896339 5.40348494371785 14244.0 50.4632464548045 0.0 - - - - - - - 213.6315789473684 28 19 DNAH12;CASP14;SARS2;DST dynein, axonemal, heavy chain 12;caspase 14, apoptosis-related cysteine peptidase;seryl-tRNA synthetase 2, mitochondrial;dystonin 125 16 B20140220_SF056_06 B20140220_SF056_06 TB469936.[MT7]-SLEEEK[MT7].2b4_1.heavy 511.784 / 603.311 11639.0 19.331775188446045 40 14 10 6 10 1.2430001039645249 51.368614718014726 0.030900955200195312 3 0.948287235896339 5.40348494371785 11639.0 62.30979797979798 0.0 - - - - - - - 220.84615384615384 23 26 DNAH12;CASP14;SARS2;DST dynein, axonemal, heavy chain 12;caspase 14, apoptosis-related cysteine peptidase;seryl-tRNA synthetase 2, mitochondrial;dystonin 127 16 B20140220_SF056_06 B20140220_SF056_06 TB469936.[MT7]-SLEEEK[MT7].2y3_1.heavy 511.784 / 549.3 10320.0 19.331775188446045 40 14 10 6 10 1.2430001039645249 51.368614718014726 0.030900955200195312 3 0.948287235896339 5.40348494371785 10320.0 27.382003900083575 0.0 - - - - - - - 229.73076923076923 20 26 DNAH12;CASP14;SARS2;DST dynein, axonemal, heavy chain 12;caspase 14, apoptosis-related cysteine peptidase;seryl-tRNA synthetase 2, mitochondrial;dystonin 129 17 B20140220_SF056_06 B20140220_SF056_06 TB470022.[MT7]-EWVAPEK[MT7].2b3_1.heavy 573.823 / 559.3 37363.0 26.354999542236328 44 14 10 10 10 2.6804942835870746 37.30655223266457 0.0 3 0.949399141055721 5.463046403766737 37363.0 38.64074780117244 0.0 - - - - - - - 1292.25 74 8 PRMT5 protein arginine methyltransferase 5 131 17 B20140220_SF056_06 B20140220_SF056_06 TB470022.[MT7]-EWVAPEK[MT7].2y4_1.heavy 573.823 / 588.347 44747.0 26.354999542236328 44 14 10 10 10 2.6804942835870746 37.30655223266457 0.0 3 0.949399141055721 5.463046403766737 44747.0 77.26213868428292 0.0 - - - - - - - 731.0 89 10 PRMT5 protein arginine methyltransferase 5 133 17 B20140220_SF056_06 B20140220_SF056_06 TB470022.[MT7]-EWVAPEK[MT7].2b4_1.heavy 573.823 / 630.337 35738.0 26.354999542236328 44 14 10 10 10 2.6804942835870746 37.30655223266457 0.0 3 0.949399141055721 5.463046403766737 35738.0 51.444092436119305 0.0 - - - - - - - 738.5 71 10 PRMT5 protein arginine methyltransferase 5 135 17 B20140220_SF056_06 B20140220_SF056_06 TB470022.[MT7]-EWVAPEK[MT7].2y3_1.heavy 573.823 / 517.31 70960.0 26.354999542236328 44 14 10 10 10 2.6804942835870746 37.30655223266457 0.0 3 0.949399141055721 5.463046403766737 70960.0 86.67475540742149 0.0 - - - - - - - 1203.5 141 10 PRMT5 protein arginine methyltransferase 5 137 18 B20140220_SF056_06 B20140220_SF056_06 TB469934.[MT7]-IDPTLC[CAM]R.2y4_1.heavy 509.777 / 549.281 1503.0 25.876200199127197 44 18 10 6 10 3.994035278409913 25.037335183431715 0.03999900817871094 3 0.9883452692244927 11.420590087599829 1503.0 1.8518523301362197 12.0 - - - - - - - 763.9166666666666 5 12 EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa 139 18 B20140220_SF056_06 B20140220_SF056_06 TB469934.[MT7]-IDPTLC[CAM]R.2y5_1.heavy 509.777 / 646.334 89879.0 25.876200199127197 44 18 10 6 10 3.994035278409913 25.037335183431715 0.03999900817871094 3 0.9883452692244927 11.420590087599829 89879.0 115.66796027648445 0.0 - - - - - - - 784.7777777777778 179 9 EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa 141 18 B20140220_SF056_06 B20140220_SF056_06 TB469934.[MT7]-IDPTLC[CAM]R.2b4_1.heavy 509.777 / 571.321 2555.0 25.876200199127197 44 18 10 6 10 3.994035278409913 25.037335183431715 0.03999900817871094 3 0.9883452692244927 11.420590087599829 2555.0 1.1330376940133038 0.0 - - - - - - - 801.5 5 12 EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa 143 18 B20140220_SF056_06 B20140220_SF056_06 TB469934.[MT7]-IDPTLC[CAM]R.2y6_1.heavy 509.777 / 761.361 26302.0 25.876200199127197 44 18 10 6 10 3.994035278409913 25.037335183431715 0.03999900817871094 3 0.9883452692244927 11.420590087599829 26302.0 64.02030740744192 0.0 - - - - - - - 300.57142857142856 52 14 EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa 145 19 B20140220_SF056_06 B20140220_SF056_06 TB469921.[MT7]-IYNIGK[MT7].2b3_1.heavy 498.31 / 535.3 5441.0 26.588899612426758 41 18 9 10 4 6.545547043153906 15.27756188149188 0.0 7 0.9878793732763163 11.198508741571251 5441.0 4.997563852005057 3.0 - - - - - - - 329.4 41 5 CPXM2 carboxypeptidase X (M14 family), member 2 147 19 B20140220_SF056_06 B20140220_SF056_06 TB469921.[MT7]-IYNIGK[MT7].2y4_1.heavy 498.31 / 575.363 8233.0 26.588899612426758 41 18 9 10 4 6.545547043153906 15.27756188149188 0.0 7 0.9878793732763163 11.198508741571251 8233.0 13.508578827098027 0.0 - - - - - - - 709.4545454545455 16 11 CPXM2 carboxypeptidase X (M14 family), member 2 149 19 B20140220_SF056_06 B20140220_SF056_06 TB469921.[MT7]-IYNIGK[MT7].2y5_1.heavy 498.31 / 738.427 20689.0 26.588899612426758 41 18 9 10 4 6.545547043153906 15.27756188149188 0.0 7 0.9878793732763163 11.198508741571251 20689.0 12.348269771659998 1.0 - - - - - - - 272.2 47 5 CPXM2 carboxypeptidase X (M14 family), member 2 151 19 B20140220_SF056_06 B20140220_SF056_06 TB469921.[MT7]-IYNIGK[MT7].2b4_1.heavy 498.31 / 648.384 4868.0 26.588899612426758 41 18 9 10 4 6.545547043153906 15.27756188149188 0.0 7 0.9878793732763163 11.198508741571251 4868.0 9.178491620111732 2.0 - - - - - - - 1278.4285714285713 17 7 CPXM2 carboxypeptidase X (M14 family), member 2 153 20 B20140220_SF056_06 B20140220_SF056_06 TB470447.[MT7]-FVPSSLSWYGAYLVNAYPLDMSQYFR.3b6_1.heavy 1073.53 / 775.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPT2 carnitine palmitoyltransferase 2 155 20 B20140220_SF056_06 B20140220_SF056_06 TB470447.[MT7]-FVPSSLSWYGAYLVNAYPLDMSQYFR.3y6_1.heavy 1073.53 / 831.382 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPT2 carnitine palmitoyltransferase 2 157 20 B20140220_SF056_06 B20140220_SF056_06 TB470447.[MT7]-FVPSSLSWYGAYLVNAYPLDMSQYFR.3b7_1.heavy 1073.53 / 862.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPT2 carnitine palmitoyltransferase 2 159 20 B20140220_SF056_06 B20140220_SF056_06 TB470447.[MT7]-FVPSSLSWYGAYLVNAYPLDMSQYFR.3y9_1.heavy 1073.53 / 1156.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPT2 carnitine palmitoyltransferase 2 161 21 B20140220_SF056_06 B20140220_SF056_06 TB317716.[MT7]-TEFTQGMILPTMNGESVDPVGQPALK[MT7].4y4_1.heavy 762.896 / 572.389 9380.0 40.14012432098389 39 13 10 6 10 1.4173950595785207 59.38502984688922 0.030101776123046875 3 0.9131425903084266 4.15684823530942 9380.0 20.89491525423729 1.0 - - - - - - - 687.6666666666666 18 9 AHSA1 AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) 163 21 B20140220_SF056_06 B20140220_SF056_06 TB317716.[MT7]-TEFTQGMILPTMNGESVDPVGQPALK[MT7].4b7_1.heavy 762.896 / 939.436 3452.0 40.14012432098389 39 13 10 6 10 1.4173950595785207 59.38502984688922 0.030101776123046875 3 0.9131425903084266 4.15684823530942 3452.0 15.71370460048426 0.0 - - - - - - - 262.85 6 20 AHSA1 AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) 165 21 B20140220_SF056_06 B20140220_SF056_06 TB317716.[MT7]-TEFTQGMILPTMNGESVDPVGQPALK[MT7].4b3_1.heavy 762.896 / 522.268 1126.0 40.14012432098389 39 13 10 6 10 1.4173950595785207 59.38502984688922 0.030101776123046875 3 0.9131425903084266 4.15684823530942 1126.0 4.003555555555556 2.0 - - - - - - - 289.3333333333333 2 24 AHSA1 AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) 167 21 B20140220_SF056_06 B20140220_SF056_06 TB317716.[MT7]-TEFTQGMILPTMNGESVDPVGQPALK[MT7].4b6_1.heavy 762.896 / 808.396 4014.0 40.14012432098389 39 13 10 6 10 1.4173950595785207 59.38502984688922 0.030101776123046875 3 0.9131425903084266 4.15684823530942 4014.0 12.699545008880996 0.0 - - - - - - - 704.6428571428571 8 14 AHSA1 AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) 169 22 B20140220_SF056_06 B20140220_SF056_06 TB470443.[MT7]-LAVLFSGALLGLLAESTGTTSHRTTK[MT7].4b8_1.heavy 733.923 / 903.542 35697.0 50.06740188598633 44 14 10 10 10 2.793702047797374 35.79479783065719 0.0 3 0.947875840418696 5.381930810376352 35697.0 164.3195238095238 0.0 - - - - - - - 171.0 71 7 CD68 CD68 molecule 171 22 B20140220_SF056_06 B20140220_SF056_06 TB470443.[MT7]-LAVLFSGALLGLLAESTGTTSHRTTK[MT7].4b7_1.heavy 733.923 / 832.505 8262.0 50.06740188598633 44 14 10 10 10 2.793702047797374 35.79479783065719 0.0 3 0.947875840418696 5.381930810376352 8262.0 83.05714285714285 0.0 - - - - - - - 149.625 16 8 CD68 CD68 molecule 173 22 B20140220_SF056_06 B20140220_SF056_06 TB470443.[MT7]-LAVLFSGALLGLLAESTGTTSHRTTK[MT7].4b4_1.heavy 733.923 / 541.383 18732.0 50.06740188598633 44 14 10 10 10 2.793702047797374 35.79479783065719 0.0 3 0.947875840418696 5.381930810376352 18732.0 198.2222222222222 0.0 - - - - - - - 157.5 37 14 CD68 CD68 molecule 175 22 B20140220_SF056_06 B20140220_SF056_06 TB470443.[MT7]-LAVLFSGALLGLLAESTGTTSHRTTK[MT7].4b5_1.heavy 733.923 / 688.451 5676.0 50.06740188598633 44 14 10 10 10 2.793702047797374 35.79479783065719 0.0 3 0.947875840418696 5.381930810376352 5676.0 18.019047619047615 0.0 - - - - - - - 105.0 11 6 CD68 CD68 molecule 177 23 B20140220_SF056_06 B20140220_SF056_06 TB470441.[MT7]-GYLPNVLGIIPYAGIDLAVYETLK[MT7].3b9_1.heavy 960.884 / 1071.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 179 23 B20140220_SF056_06 B20140220_SF056_06 TB470441.[MT7]-GYLPNVLGIIPYAGIDLAVYETLK[MT7].3b6_1.heavy 960.884 / 788.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 181 23 B20140220_SF056_06 B20140220_SF056_06 TB470441.[MT7]-GYLPNVLGIIPYAGIDLAVYETLK[MT7].3b5_1.heavy 960.884 / 689.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 183 23 B20140220_SF056_06 B20140220_SF056_06 TB470441.[MT7]-GYLPNVLGIIPYAGIDLAVYETLK[MT7].3b8_1.heavy 960.884 / 958.548 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 185 24 B20140220_SF056_06 B20140220_SF056_06 TB317719.[MT7]-NMITGTSQADC[CAM]AVLIVAAGVGEFEAGISK[MT7].4y4_1.heavy 800.166 / 548.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - EEF1A1;EEF1A2 eukaryotic translation elongation factor 1 alpha 1;eukaryotic translation elongation factor 1 alpha 2 187 24 B20140220_SF056_06 B20140220_SF056_06 TB317719.[MT7]-NMITGTSQADC[CAM]AVLIVAAGVGEFEAGISK[MT7].4y9_1.heavy 800.166 / 1081.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - EEF1A1;EEF1A2 eukaryotic translation elongation factor 1 alpha 1;eukaryotic translation elongation factor 1 alpha 2 189 24 B20140220_SF056_06 B20140220_SF056_06 TB317719.[MT7]-NMITGTSQADC[CAM]AVLIVAAGVGEFEAGISK[MT7].4b5_1.heavy 800.166 / 661.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - EEF1A1;EEF1A2 eukaryotic translation elongation factor 1 alpha 1;eukaryotic translation elongation factor 1 alpha 2 191 24 B20140220_SF056_06 B20140220_SF056_06 TB317719.[MT7]-NMITGTSQADC[CAM]AVLIVAAGVGEFEAGISK[MT7].4b3_1.heavy 800.166 / 503.277 N/A N/A - - - - - - - - - 0.0 - - - - - - - EEF1A1;EEF1A2 eukaryotic translation elongation factor 1 alpha 1;eukaryotic translation elongation factor 1 alpha 2 193 25 B20140220_SF056_06 B20140220_SF056_06 TB470442.[MT7]-TDVLVLSC[CAM]DLITDVALHEVVDLFR.4y8_1.heavy 722.391 / 1014.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF2B3 eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa 195 25 B20140220_SF056_06 B20140220_SF056_06 TB470442.[MT7]-TDVLVLSC[CAM]DLITDVALHEVVDLFR.4b4_1.heavy 722.391 / 573.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF2B3 eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa 197 25 B20140220_SF056_06 B20140220_SF056_06 TB470442.[MT7]-TDVLVLSC[CAM]DLITDVALHEVVDLFR.4b5_1.heavy 722.391 / 672.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF2B3 eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa 199 25 B20140220_SF056_06 B20140220_SF056_06 TB470442.[MT7]-TDVLVLSC[CAM]DLITDVALHEVVDLFR.4y7_1.heavy 722.391 / 877.478 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF2B3 eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa 201 26 B20140220_SF056_06 B20140220_SF056_06 TB317321.[MT7]-RLISVLEQIR.2b8_1.heavy 685.934 / 1083.66 1853.0 37.18400001525879 43 17 10 6 10 2.8164425384677676 35.505783851142624 0.035396575927734375 3 0.9724737818493385 7.4214338909916036 1853.0 7.909146341463414 1.0 - - - - - - - 163.8181818181818 3 22 IDI1 isopentenyl-diphosphate delta isomerase 1 203 26 B20140220_SF056_06 B20140220_SF056_06 TB317321.[MT7]-RLISVLEQIR.2y9_1.heavy 685.934 / 1070.66 5342.0 37.18400001525879 43 17 10 6 10 2.8164425384677676 35.505783851142624 0.035396575927734375 3 0.9724737818493385 7.4214338909916036 5342.0 45.97399231744611 0.0 - - - - - - - 149.3684210526316 10 19 IDI1 isopentenyl-diphosphate delta isomerase 1 205 26 B20140220_SF056_06 B20140220_SF056_06 TB317321.[MT7]-RLISVLEQIR.2b7_1.heavy 685.934 / 955.606 3979.0 37.18400001525879 43 17 10 6 10 2.8164425384677676 35.505783851142624 0.035396575927734375 3 0.9724737818493385 7.4214338909916036 3979.0 19.54132002554021 0.0 - - - - - - - 591.8571428571429 7 7 IDI1 isopentenyl-diphosphate delta isomerase 1 207 26 B20140220_SF056_06 B20140220_SF056_06 TB317321.[MT7]-RLISVLEQIR.2y7_1.heavy 685.934 / 844.489 2071.0 37.18400001525879 43 17 10 6 10 2.8164425384677676 35.505783851142624 0.035396575927734375 3 0.9724737818493385 7.4214338909916036 2071.0 10.77919413919414 0.0 - - - - - - - 194.2 4 25 IDI1 isopentenyl-diphosphate delta isomerase 1 209 27 B20140220_SF056_06 B20140220_SF056_06 TB470157.[MT7]-DLEIMQILTR.2y8_1.heavy 688.39 / 1003.56 8550.0 44.86289978027344 46 16 10 10 10 2.3888313184554795 33.52703369482461 0.0 3 0.9684756927169853 6.932534495904611 8550.0 83.125 0.0 - - - - - - - 127.85 17 20 CASP7 caspase 7, apoptosis-related cysteine peptidase 211 27 B20140220_SF056_06 B20140220_SF056_06 TB470157.[MT7]-DLEIMQILTR.2b4_1.heavy 688.39 / 615.347 11076.0 44.86289978027344 46 16 10 10 10 2.3888313184554795 33.52703369482461 0.0 3 0.9684756927169853 6.932534495904611 11076.0 26.6382943968516 0.0 - - - - - - - 733.5555555555555 22 9 CASP7 caspase 7, apoptosis-related cysteine peptidase 213 27 B20140220_SF056_06 B20140220_SF056_06 TB470157.[MT7]-DLEIMQILTR.2y9_1.heavy 688.39 / 1116.64 10499.0 44.86289978027344 46 16 10 10 10 2.3888313184554795 33.52703369482461 0.0 3 0.9684756927169853 6.932534495904611 10499.0 319.34458333333333 0.0 - - - - - - - 115.26666666666667 20 15 CASP7 caspase 7, apoptosis-related cysteine peptidase 215 27 B20140220_SF056_06 B20140220_SF056_06 TB470157.[MT7]-DLEIMQILTR.2y6_1.heavy 688.39 / 761.434 18472.0 44.86289978027344 46 16 10 10 10 2.3888313184554795 33.52703369482461 0.0 3 0.9684756927169853 6.932534495904611 18472.0 50.84372277227723 0.0 - - - - - - - 336.9166666666667 36 12 CASP7 caspase 7, apoptosis-related cysteine peptidase 217 28 B20140220_SF056_06 B20140220_SF056_06 TB470159.[MT7]-QDQVEQFLAR.2b3_1.heavy 689.366 / 516.253 4267.0 33.36090087890625 46 16 10 10 10 25.34169074453785 3.9460666223130363 0.0 3 0.9637134061630984 6.45902830043918 4267.0 10.866684283815431 3.0 - - - - - - - 289.75 17 20 HPDL 4-hydroxyphenylpyruvate dioxygenase-like 219 28 B20140220_SF056_06 B20140220_SF056_06 TB470159.[MT7]-QDQVEQFLAR.2y8_1.heavy 689.366 / 990.537 6035.0 33.36090087890625 46 16 10 10 10 25.34169074453785 3.9460666223130363 0.0 3 0.9637134061630984 6.45902830043918 6035.0 61.339344262295086 0.0 - - - - - - - 114.82352941176471 12 17 HPDL 4-hydroxyphenylpyruvate dioxygenase-like 221 28 B20140220_SF056_06 B20140220_SF056_06 TB470159.[MT7]-QDQVEQFLAR.2b4_1.heavy 689.366 / 615.322 4572.0 33.36090087890625 46 16 10 10 10 25.34169074453785 3.9460666223130363 0.0 3 0.9637134061630984 6.45902830043918 4572.0 19.38727868852459 0.0 - - - - - - - 250.1 9 20 HPDL 4-hydroxyphenylpyruvate dioxygenase-like 223 28 B20140220_SF056_06 B20140220_SF056_06 TB470159.[MT7]-QDQVEQFLAR.2y9_1.heavy 689.366 / 1105.56 8108.0 33.36090087890625 46 16 10 10 10 25.34169074453785 3.9460666223130363 0.0 3 0.9637134061630984 6.45902830043918 8108.0 71.77573770491803 0.0 - - - - - - - 186.05 16 20 HPDL 4-hydroxyphenylpyruvate dioxygenase-like 225 29 B20140220_SF056_06 B20140220_SF056_06 TB317712.[MT7]-DSLSFEDFLDLLSVFSDTATPDIK[MT7].4y4_1.heavy 741.631 / 616.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - CIB1 calcium and integrin binding 1 (calmyrin) 227 29 B20140220_SF056_06 B20140220_SF056_06 TB317712.[MT7]-DSLSFEDFLDLLSVFSDTATPDIK[MT7].4b7_1.heavy 741.631 / 938.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - CIB1 calcium and integrin binding 1 (calmyrin) 229 29 B20140220_SF056_06 B20140220_SF056_06 TB317712.[MT7]-DSLSFEDFLDLLSVFSDTATPDIK[MT7].4b4_1.heavy 741.631 / 547.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CIB1 calcium and integrin binding 1 (calmyrin) 231 29 B20140220_SF056_06 B20140220_SF056_06 TB317712.[MT7]-DSLSFEDFLDLLSVFSDTATPDIK[MT7].4b6_1.heavy 741.631 / 823.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - CIB1 calcium and integrin binding 1 (calmyrin) 233 30 B20140220_SF056_06 B20140220_SF056_06 TB470343.[MT7]-MRVDIEVDPLQLLGQR.3b6_1.heavy 676.046 / 888.473 9726.0 43.4705753326416 39 13 10 6 10 1.8999720561364626 41.84725912887133 0.03150177001953125 3 0.921993903023078 4.389688427888107 9726.0 93.04095890410959 0.0 - - - - - - - 155.91304347826087 19 23 FAM78B family with sequence similarity 78, member B 235 30 B20140220_SF056_06 B20140220_SF056_06 TB470343.[MT7]-MRVDIEVDPLQLLGQR.3y6_1.heavy 676.046 / 714.426 20440.0 43.4705753326416 39 13 10 6 10 1.8999720561364626 41.84725912887133 0.03150177001953125 3 0.921993903023078 4.389688427888107 20440.0 87.8810311337423 0.0 - - - - - - - 215.9047619047619 40 21 FAM78B family with sequence similarity 78, member B 237 30 B20140220_SF056_06 B20140220_SF056_06 TB470343.[MT7]-MRVDIEVDPLQLLGQR.3b4_1.heavy 676.046 / 646.346 5558.0 43.4705753326416 39 13 10 6 10 1.8999720561364626 41.84725912887133 0.03150177001953125 3 0.921993903023078 4.389688427888107 5558.0 27.780956719817766 0.0 - - - - - - - 305.3478260869565 11 23 FAM78B family with sequence similarity 78, member B 239 30 B20140220_SF056_06 B20140220_SF056_06 TB470343.[MT7]-MRVDIEVDPLQLLGQR.3b8_1.heavy 676.046 / 1102.57 12469.0 43.4705753326416 39 13 10 6 10 1.8999720561364626 41.84725912887133 0.03150177001953125 3 0.921993903023078 4.389688427888107 12469.0 127.41546448087433 0.0 - - - - - - - 103.94736842105263 24 19 FAM78B family with sequence similarity 78, member B 241 31 B20140220_SF056_06 B20140220_SF056_06 TB469922.[MT7]-ADLDHQR.2y5_1.heavy 499.76 / 668.347 7140.0 15.118649959564209 46 20 10 6 10 78.54907761076247 1.2730894243664348 0.03609943389892578 3 0.9989307838645649 37.739045690250315 7140.0 29.60645020701678 0.0 - - - - - - - 694.5555555555555 14 9 RRAS2 related RAS viral (r-ras) oncogene homolog 2 243 31 B20140220_SF056_06 B20140220_SF056_06 TB469922.[MT7]-ADLDHQR.2b6_1.heavy 499.76 / 824.402 1059.0 15.118649959564209 46 20 10 6 10 78.54907761076247 1.2730894243664348 0.03609943389892578 3 0.9989307838645649 37.739045690250315 1059.0 6.40142918271288 0.0 - - - - - - - 100.6 2 20 RRAS2 related RAS viral (r-ras) oncogene homolog 2 245 31 B20140220_SF056_06 B20140220_SF056_06 TB469922.[MT7]-ADLDHQR.2y6_1.heavy 499.76 / 783.374 4749.0 15.118649959564209 46 20 10 6 10 78.54907761076247 1.2730894243664348 0.03609943389892578 3 0.9989307838645649 37.739045690250315 4749.0 107.08529411764707 0.0 - - - - - - - 119.375 9 16 RRAS2 related RAS viral (r-ras) oncogene homolog 2 247 31 B20140220_SF056_06 B20140220_SF056_06 TB469922.[MT7]-ADLDHQR.2b5_1.heavy 499.76 / 696.343 1811.0 15.118649959564209 46 20 10 6 10 78.54907761076247 1.2730894243664348 0.03609943389892578 3 0.9989307838645649 37.739045690250315 1811.0 15.957125276888998 0.0 - - - - - - - 183.26315789473685 3 19 RRAS2 related RAS viral (r-ras) oncogene homolog 2 249 32 B20140220_SF056_06 B20140220_SF056_06 TB470342.[MT7]-LSPDAVAQLAFQMAFLR.2y8_1.heavy 1011.55 / 983.513 1249.0 50.1077995300293 40 10 10 10 10 1.832663738082815 54.56538366640676 0.0 3 0.8301368793052433 2.950966857241569 1249.0 21.721739130434784 0.0 - - - - - - - 125.9090909090909 2 11 CPT2 carnitine palmitoyltransferase 2 251 32 B20140220_SF056_06 B20140220_SF056_06 TB470342.[MT7]-LSPDAVAQLAFQMAFLR.2b4_1.heavy 1011.55 / 557.305 6104.0 50.1077995300293 40 10 10 10 10 1.832663738082815 54.56538366640676 0.0 3 0.8301368793052433 2.950966857241569 6104.0 111.62596432552954 0.0 - - - - - - - 156.0 12 4 CPT2 carnitine palmitoyltransferase 2 253 32 B20140220_SF056_06 B20140220_SF056_06 TB470342.[MT7]-LSPDAVAQLAFQMAFLR.2y10_1.heavy 1011.55 / 1224.66 624.0 50.1077995300293 40 10 10 10 10 1.832663738082815 54.56538366640676 0.0 3 0.8301368793052433 2.950966857241569 624.0 5.817 0.0 - - - - - - - 0.0 1 0 CPT2 carnitine palmitoyltransferase 2 255 32 B20140220_SF056_06 B20140220_SF056_06 TB470342.[MT7]-LSPDAVAQLAFQMAFLR.2b5_1.heavy 1011.55 / 628.342 1249.0 50.1077995300293 40 10 10 10 10 1.832663738082815 54.56538366640676 0.0 3 0.8301368793052433 2.950966857241569 1249.0 20.503372352285396 0.0 - - - - - - - 150.33333333333334 2 6 CPT2 carnitine palmitoyltransferase 2 257 33 B20140220_SF056_06 B20140220_SF056_06 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1274730.0 29.430400848388672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1274730.0 3198.04346848357 0.0 - - - - - - - 759.0 2549 1 259 33 B20140220_SF056_06 B20140220_SF056_06 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 365123.0 29.430400848388672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 365123.0 628.503315559438 0.0 - - - - - - - 1833.142857142857 730 7 261 33 B20140220_SF056_06 B20140220_SF056_06 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 275549.0 29.430400848388672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 275549.0 273.35345613942326 0.0 - - - - - - - 1824.142857142857 551 7 263 34 B20140220_SF056_06 B20140220_SF056_06 TB470341.[MT7]-LSPDAVAQLAFQMAFLR.3y8_1.heavy 674.704 / 983.513 480.0 50.1077995300293 44 14 10 10 10 2.508305889022235 33.56418127402706 0.0 3 0.9474611383718826 5.360459397884942 480.0 6.898686131386862 0.0 - - - - - - - 0.0 0 0 CPT2 carnitine palmitoyltransferase 2 265 34 B20140220_SF056_06 B20140220_SF056_06 TB470341.[MT7]-LSPDAVAQLAFQMAFLR.3b6_1.heavy 674.704 / 727.411 1371.0 50.1077995300293 44 14 10 10 10 2.508305889022235 33.56418127402706 0.0 3 0.9474611383718826 5.360459397884942 1371.0 17.955125357029516 0.0 - - - - - - - 117.71428571428571 2 7 CPT2 carnitine palmitoyltransferase 2 267 34 B20140220_SF056_06 B20140220_SF056_06 TB470341.[MT7]-LSPDAVAQLAFQMAFLR.3b4_1.heavy 674.704 / 557.305 1029.0 50.1077995300293 44 14 10 10 10 2.508305889022235 33.56418127402706 0.0 3 0.9474611383718826 5.360459397884942 1029.0 4.595533980582525 0.0 - - - - - - - 151.0 2 10 CPT2 carnitine palmitoyltransferase 2 269 34 B20140220_SF056_06 B20140220_SF056_06 TB470341.[MT7]-LSPDAVAQLAFQMAFLR.3b5_1.heavy 674.704 / 628.342 3017.0 50.1077995300293 44 14 10 10 10 2.508305889022235 33.56418127402706 0.0 3 0.9474611383718826 5.360459397884942 3017.0 14.656321309616608 0.0 - - - - - - - 131.1818181818182 6 11 CPT2 carnitine palmitoyltransferase 2 271 35 B20140220_SF056_06 B20140220_SF056_06 TB470014.[MT7]-AK[MT7]PAPSK[MT7].2y4_1.heavy 565.867 / 546.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHSA1 AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) 273 35 B20140220_SF056_06 B20140220_SF056_06 TB470014.[MT7]-AK[MT7]PAPSK[MT7].2y5_1.heavy 565.867 / 643.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHSA1 AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) 275 35 B20140220_SF056_06 B20140220_SF056_06 TB470014.[MT7]-AK[MT7]PAPSK[MT7].2b4_1.heavy 565.867 / 656.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHSA1 AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) 277 35 B20140220_SF056_06 B20140220_SF056_06 TB470014.[MT7]-AK[MT7]PAPSK[MT7].2y6_1.heavy 565.867 / 915.587 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHSA1 AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) 279 36 B20140220_SF056_06 B20140220_SF056_06 TB469928.[MT7]-DIPSFER.2y4_1.heavy 504.268 / 538.262 10382.0 28.631399154663086 48 18 10 10 10 8.936545423052841 11.19000634652833 0.0 3 0.98078845972105 8.889626741547517 10382.0 24.668246451658646 0.0 - - - - - - - 723.5 20 14 PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 281 36 B20140220_SF056_06 B20140220_SF056_06 TB469928.[MT7]-DIPSFER.2y5_1.heavy 504.268 / 635.315 144031.0 28.631399154663086 48 18 10 10 10 8.936545423052841 11.19000634652833 0.0 3 0.98078845972105 8.889626741547517 144031.0 104.99720817010848 0.0 - - - - - - - 747.125 288 8 PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 283 36 B20140220_SF056_06 B20140220_SF056_06 TB469928.[MT7]-DIPSFER.2b4_1.heavy 504.268 / 557.305 10571.0 28.631399154663086 48 18 10 10 10 8.936545423052841 11.19000634652833 0.0 3 0.98078845972105 8.889626741547517 10571.0 20.544691290621216 0.0 - - - - - - - 1258.625 21 8 PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 285 36 B20140220_SF056_06 B20140220_SF056_06 TB469928.[MT7]-DIPSFER.2y6_1.heavy 504.268 / 748.399 55939.0 28.631399154663086 48 18 10 10 10 8.936545423052841 11.19000634652833 0.0 3 0.98078845972105 8.889626741547517 55939.0 171.56608476937365 0.0 - - - - - - - 645.8 111 15 PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 287 37 B20140220_SF056_06 B20140220_SF056_06 TB317402.[MT7]-C[CAM]VSSPHFQVAER.3y7_1.heavy 520.928 / 886.453 4385.0 24.964599609375 47 17 10 10 10 2.6472470306592317 31.40268952119725 0.0 3 0.9710719314280388 7.23852555184474 4385.0 40.93277411397503 1.0 - - - - - - - 163.8181818181818 9 11 PPP2R5B;PPP2R5C;PPP2R5D;PPP2R5E protein phosphatase 2, regulatory subunit B', beta;protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta;protein phosphatase 2, regulatory subunit B', epsilon isoform 289 37 B20140220_SF056_06 B20140220_SF056_06 TB317402.[MT7]-C[CAM]VSSPHFQVAER.3y6_1.heavy 520.928 / 749.394 33148.0 24.964599609375 47 17 10 10 10 2.6472470306592317 31.40268952119725 0.0 3 0.9710719314280388 7.23852555184474 33148.0 68.93941572601054 0.0 - - - - - - - 764.4285714285714 66 7 PPP2R5B;PPP2R5C;PPP2R5D;PPP2R5E protein phosphatase 2, regulatory subunit B', beta;protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta;protein phosphatase 2, regulatory subunit B', epsilon isoform 291 37 B20140220_SF056_06 B20140220_SF056_06 TB317402.[MT7]-C[CAM]VSSPHFQVAER.3b4_1.heavy 520.928 / 578.273 23346.0 24.964599609375 47 17 10 10 10 2.6472470306592317 31.40268952119725 0.0 3 0.9710719314280388 7.23852555184474 23346.0 40.825030742444966 0.0 - - - - - - - 736.8571428571429 46 7 PPP2R5B;PPP2R5C;PPP2R5D;PPP2R5E protein phosphatase 2, regulatory subunit B', beta;protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta;protein phosphatase 2, regulatory subunit B', epsilon isoform 293 37 B20140220_SF056_06 B20140220_SF056_06 TB317402.[MT7]-C[CAM]VSSPHFQVAER.3y5_1.heavy 520.928 / 602.326 28634.0 24.964599609375 47 17 10 10 10 2.6472470306592317 31.40268952119725 0.0 3 0.9710719314280388 7.23852555184474 28634.0 35.39455587762535 0.0 - - - - - - - 720.0 57 12 PPP2R5B;PPP2R5C;PPP2R5D;PPP2R5E protein phosphatase 2, regulatory subunit B', beta;protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta;protein phosphatase 2, regulatory subunit B', epsilon isoform 295 38 B20140220_SF056_06 B20140220_SF056_06 TB469910.[MT7]-QQLILAR.2b3_1.heavy 493.317 / 514.311 15168.0 27.893199920654297 29 15 0 10 4 10.183883344924226 9.819436909579412 0.0 8 0.9544602517388511 5.761094286487672 15168.0 14.770232176709309 0.0 - - - - - - - 767.9 30 10 PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 297 38 B20140220_SF056_06 B20140220_SF056_06 TB469910.[MT7]-QQLILAR.2y5_1.heavy 493.317 / 585.408 15612.0 27.893199920654297 29 15 0 10 4 10.183883344924226 9.819436909579412 0.0 8 0.9544602517388511 5.761094286487672 15612.0 17.65336864710093 1.0 - - - - - - - 1729.25 34 8 PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 299 38 B20140220_SF056_06 B20140220_SF056_06 TB469910.[MT7]-QQLILAR.2b4_1.heavy 493.317 / 627.395 20054.0 27.893199920654297 29 15 0 10 4 10.183883344924226 9.819436909579412 0.0 8 0.9544602517388511 5.761094286487672 20054.0 11.790387205081883 4.0 - - - - - - - 1223.7142857142858 600 7 PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 301 38 B20140220_SF056_06 B20140220_SF056_06 TB469910.[MT7]-QQLILAR.2y6_1.heavy 493.317 / 713.467 51024.0 27.893199920654297 29 15 0 10 4 10.183883344924226 9.819436909579412 0.0 8 0.9544602517388511 5.761094286487672 51024.0 93.43951258084792 0.0 - - - - - - - 734.4285714285714 102 14 PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 303 39 B20140220_SF056_06 B20140220_SF056_06 TB470041.[MT7]-VREIIQK[MT7].2b3_1.heavy 587.382 / 529.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLS3 plastin 3 305 39 B20140220_SF056_06 B20140220_SF056_06 TB470041.[MT7]-VREIIQK[MT7].2y3_1.heavy 587.382 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLS3 plastin 3 307 39 B20140220_SF056_06 B20140220_SF056_06 TB470041.[MT7]-VREIIQK[MT7].2b6_1.heavy 587.382 / 883.548 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLS3 plastin 3 309 39 B20140220_SF056_06 B20140220_SF056_06 TB470041.[MT7]-VREIIQK[MT7].2b5_1.heavy 587.382 / 755.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLS3 plastin 3 311 40 B20140220_SF056_06 B20140220_SF056_06 TB470415.[MT7]-YFILPDSLPLDTLLVDVEPK[MT7].4y5_1.heavy 644.618 / 731.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNRPD1 small nuclear ribonucleoprotein D1 polypeptide 16kDa 313 40 B20140220_SF056_06 B20140220_SF056_06 TB470415.[MT7]-YFILPDSLPLDTLLVDVEPK[MT7].4b4_1.heavy 644.618 / 681.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNRPD1 small nuclear ribonucleoprotein D1 polypeptide 16kDa 315 40 B20140220_SF056_06 B20140220_SF056_06 TB470415.[MT7]-YFILPDSLPLDTLLVDVEPK[MT7].4y6_1.heavy 644.618 / 830.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNRPD1 small nuclear ribonucleoprotein D1 polypeptide 16kDa 317 40 B20140220_SF056_06 B20140220_SF056_06 TB470415.[MT7]-YFILPDSLPLDTLLVDVEPK[MT7].4b3_1.heavy 644.618 / 568.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNRPD1 small nuclear ribonucleoprotein D1 polypeptide 16kDa 319 41 B20140220_SF056_06 B20140220_SF056_06 TB470350.[MT7]-LSHAVGC[CAM]AFAAC[CAM]LERK[MT7].4y11_2.heavy 520.277 / 713.856 47797.0 31.95639991760254 35 5 10 10 10 0.41951285657772375 114.61657651056548 0.0 3 0.6478963396548256 2.0154456512688514 47797.0 253.61894334437537 0.0 - - - - - - - 735.4285714285714 95 7 NUMB;NUMBL numb homolog (Drosophila);numb homolog (Drosophila)-like 321 41 B20140220_SF056_06 B20140220_SF056_06 TB470350.[MT7]-LSHAVGC[CAM]AFAAC[CAM]LERK[MT7].4b4_1.heavy 520.277 / 553.321 20121.0 31.95639991760254 35 5 10 10 10 0.41951285657772375 114.61657651056548 0.0 3 0.6478963396548256 2.0154456512688514 20121.0 9.263244952650915 1.0 - - - - - - - 690.6666666666666 40 6 NUMB;NUMBL numb homolog (Drosophila);numb homolog (Drosophila)-like 323 41 B20140220_SF056_06 B20140220_SF056_06 TB470350.[MT7]-LSHAVGC[CAM]AFAAC[CAM]LERK[MT7].4y7_1.heavy 520.277 / 991.547 5214.0 31.95639991760254 35 5 10 10 10 0.41951285657772375 114.61657651056548 0.0 3 0.6478963396548256 2.0154456512688514 5214.0 100.12955223880596 0.0 - - - - - - - 142.86666666666667 10 15 NUMB;NUMBL numb homolog (Drosophila);numb homolog (Drosophila)-like 325 41 B20140220_SF056_06 B20140220_SF056_06 TB470350.[MT7]-LSHAVGC[CAM]AFAAC[CAM]LERK[MT7].4y6_1.heavy 520.277 / 920.51 4078.0 31.95639991760254 35 5 10 10 10 0.41951285657772375 114.61657651056548 0.0 3 0.6478963396548256 2.0154456512688514 4078.0 15.557278385233497 0.0 - - - - - - - 214.0 8 20 NUMB;NUMBL numb homolog (Drosophila);numb homolog (Drosophila)-like 327 42 B20140220_SF056_06 B20140220_SF056_06 TB317404.[MT7]-VEEEEDESALK[MT7].2y4_1.heavy 783.393 / 562.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 329 42 B20140220_SF056_06 B20140220_SF056_06 TB317404.[MT7]-VEEEEDESALK[MT7].2b3_1.heavy 783.393 / 502.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 331 42 B20140220_SF056_06 B20140220_SF056_06 TB317404.[MT7]-VEEEEDESALK[MT7].2b4_1.heavy 783.393 / 631.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 333 42 B20140220_SF056_06 B20140220_SF056_06 TB317404.[MT7]-VEEEEDESALK[MT7].2b6_1.heavy 783.393 / 875.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 335 43 B20140220_SF056_06 B20140220_SF056_06 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 205831.0 15.562999725341797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 205831.0 785.598103224699 1.0 - - - - - - - 288.375 560 8 337 43 B20140220_SF056_06 B20140220_SF056_06 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 703322.0 15.562999725341797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 703322.0 10142.442873248081 0.0 - - - - - - - 120.75 1406 4 339 43 B20140220_SF056_06 B20140220_SF056_06 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 244598.0 15.562999725341797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 244598.0 2345.1150564111153 0.0 - - - - - - - 310.1666666666667 489 12 341 44 B20140220_SF056_06 B20140220_SF056_06 TB317708.[MT7]-DSLSFEDFLDLLSVFSDTATPDIK[MT7].3b5_1.heavy 988.505 / 694.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - CIB1 calcium and integrin binding 1 (calmyrin) 343 44 B20140220_SF056_06 B20140220_SF056_06 TB317708.[MT7]-DSLSFEDFLDLLSVFSDTATPDIK[MT7].3y4_1.heavy 988.505 / 616.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - CIB1 calcium and integrin binding 1 (calmyrin) 345 44 B20140220_SF056_06 B20140220_SF056_06 TB317708.[MT7]-DSLSFEDFLDLLSVFSDTATPDIK[MT7].3b8_1.heavy 988.505 / 1085.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - CIB1 calcium and integrin binding 1 (calmyrin) 347 44 B20140220_SF056_06 B20140220_SF056_06 TB317708.[MT7]-DSLSFEDFLDLLSVFSDTATPDIK[MT7].3b7_1.heavy 988.505 / 938.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - CIB1 calcium and integrin binding 1 (calmyrin) 349 45 B20140220_SF056_06 B20140220_SF056_06 TB317501.[MT7]-RPAEDMEEEQAFK[MT7].3b6_1.heavy 623.308 / 844.41 4298.0 25.169700622558594 38 8 10 10 10 1.0026608007498692 61.314004279181106 0.0 3 0.7851342244698345 2.6132240801120443 4298.0 35.52551999476405 0.0 - - - - - - - 142.57894736842104 8 19 HNRNPK heterogeneous nuclear ribonucleoprotein K 351 45 B20140220_SF056_06 B20140220_SF056_06 TB317501.[MT7]-RPAEDMEEEQAFK[MT7].3y3_1.heavy 623.308 / 509.32 24666.0 25.169700622558594 38 8 10 10 10 1.0026608007498692 61.314004279181106 0.0 3 0.7851342244698345 2.6132240801120443 24666.0 64.53783845554351 0.0 - - - - - - - 275.5833333333333 49 12 HNRNPK heterogeneous nuclear ribonucleoprotein K 353 45 B20140220_SF056_06 B20140220_SF056_06 TB317501.[MT7]-RPAEDMEEEQAFK[MT7].3b4_1.heavy 623.308 / 598.343 1852.0 25.169700622558594 38 8 10 10 10 1.0026608007498692 61.314004279181106 0.0 3 0.7851342244698345 2.6132240801120443 1852.0 4.668612099644128 0.0 - - - - - - - 184.14285714285714 3 14 HNRNPK heterogeneous nuclear ribonucleoprotein K 355 45 B20140220_SF056_06 B20140220_SF056_06 TB317501.[MT7]-RPAEDMEEEQAFK[MT7].3b5_1.heavy 623.308 / 713.37 8464.0 25.169700622558594 38 8 10 10 10 1.0026608007498692 61.314004279181106 0.0 3 0.7851342244698345 2.6132240801120443 8464.0 99.38787878787879 0.0 - - - - - - - 165.21428571428572 16 14 HNRNPK heterogeneous nuclear ribonucleoprotein K 357 46 B20140220_SF056_06 B20140220_SF056_06 TB317500.[MT7]-TLFLAVQVQNEEGK[MT7].3b4_1.heavy 622.019 / 619.394 44331.0 37.47610092163086 43 13 10 10 10 1.2839205886081104 50.09427599922542 0.0 3 0.9180355903747777 4.280925905964917 44331.0 55.233635801210625 0.0 - - - - - - - 1082.857142857143 88 7 AHSA1 AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) 359 46 B20140220_SF056_06 B20140220_SF056_06 TB317500.[MT7]-TLFLAVQVQNEEGK[MT7].3b5_1.heavy 622.019 / 690.431 98244.0 37.47610092163086 43 13 10 10 10 1.2839205886081104 50.09427599922542 0.0 3 0.9180355903747777 4.280925905964917 98244.0 123.51124709038733 0.0 - - - - - - - 395.0 196 2 AHSA1 AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) 361 46 B20140220_SF056_06 B20140220_SF056_06 TB317500.[MT7]-TLFLAVQVQNEEGK[MT7].3b3_1.heavy 622.019 / 506.31 32590.0 37.47610092163086 43 13 10 10 10 1.2839205886081104 50.09427599922542 0.0 3 0.9180355903747777 4.280925905964917 32590.0 29.78255931370896 0.0 - - - - - - - 737.0 65 7 AHSA1 AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) 363 46 B20140220_SF056_06 B20140220_SF056_06 TB317500.[MT7]-TLFLAVQVQNEEGK[MT7].3y5_1.heavy 622.019 / 720.364 48227.0 37.47610092163086 43 13 10 10 10 1.2839205886081104 50.09427599922542 0.0 3 0.9180355903747777 4.280925905964917 48227.0 65.1213488194378 0.0 - - - - - - - 1189.8 96 10 AHSA1 AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) 365 47 B20140220_SF056_06 B20140220_SF056_06 TB317705.[MT7]-TLAC[CAM]LLLLGC[CAM]GYLAHVLAEEAEIPR.4y9_1.heavy 732.397 / 1027.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFA platelet-derived growth factor alpha polypeptide 367 47 B20140220_SF056_06 B20140220_SF056_06 TB317705.[MT7]-TLAC[CAM]LLLLGC[CAM]GYLAHVLAEEAEIPR.4b4_1.heavy 732.397 / 590.309 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFA platelet-derived growth factor alpha polypeptide 369 47 B20140220_SF056_06 B20140220_SF056_06 TB317705.[MT7]-TLAC[CAM]LLLLGC[CAM]GYLAHVLAEEAEIPR.4b5_1.heavy 732.397 / 703.393 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFA platelet-derived growth factor alpha polypeptide 371 47 B20140220_SF056_06 B20140220_SF056_06 TB317705.[MT7]-TLAC[CAM]LLLLGC[CAM]GYLAHVLAEEAEIPR.4b6_1.heavy 732.397 / 816.477 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFA platelet-derived growth factor alpha polypeptide 373 48 B20140220_SF056_06 B20140220_SF056_06 TB317704.[MT7]-RFSFC[CAM]C[CAM]SPEPEAEAEAAAGPGPC[CAM]ER.4y5_1.heavy 732.322 / 618.266 9044.0 30.39069938659668 46 16 10 10 10 3.078405119614122 28.441906337811048 0.0 3 0.9626465156031996 6.365544930776 9044.0 23.610040480689516 0.0 - - - - - - - 705.8333333333334 18 12 SQSTM1 sequestosome 1 375 48 B20140220_SF056_06 B20140220_SF056_06 TB317704.[MT7]-RFSFC[CAM]C[CAM]SPEPEAEAEAAAGPGPC[CAM]ER.4b7_1.heavy 732.322 / 1089.47 2611.0 30.39069938659668 46 16 10 10 10 3.078405119614122 28.441906337811048 0.0 3 0.9626465156031996 6.365544930776 2611.0 26.01635404213217 0.0 - - - - - - - 127.23076923076923 5 13 SQSTM1 sequestosome 1 377 48 B20140220_SF056_06 B20140220_SF056_06 TB317704.[MT7]-RFSFC[CAM]C[CAM]SPEPEAEAEAAAGPGPC[CAM]ER.4y7_1.heavy 732.322 / 772.341 23884.0 30.39069938659668 46 16 10 10 10 3.078405119614122 28.441906337811048 0.0 3 0.9626465156031996 6.365544930776 23884.0 36.203012590732115 0.0 - - - - - - - 621.125 47 8 SQSTM1 sequestosome 1 379 48 B20140220_SF056_06 B20140220_SF056_06 TB317704.[MT7]-RFSFC[CAM]C[CAM]SPEPEAEAEAAAGPGPC[CAM]ER.4y6_1.heavy 732.322 / 715.319 22865.0 30.39069938659668 46 16 10 10 10 3.078405119614122 28.441906337811048 0.0 3 0.9626465156031996 6.365544930776 22865.0 16.856100332266 0.0 - - - - - - - 1238.4444444444443 45 9 SQSTM1 sequestosome 1 381 49 B20140220_SF056_06 B20140220_SF056_06 TB470143.[MT7]-FRVLPQGLK[MT7].3y3_1.heavy 449.29 / 461.32 157824.0 31.124900817871094 43 17 10 6 10 4.871595989358835 20.527153774334497 0.03639984130859375 3 0.97642932409989 8.02268221875157 157824.0 145.3839145241613 0.0 - - - - - - - 895.5 315 2 FGFRL1 fibroblast growth factor receptor-like 1 383 49 B20140220_SF056_06 B20140220_SF056_06 TB470143.[MT7]-FRVLPQGLK[MT7].3b4_1.heavy 449.29 / 660.431 43254.0 31.124900817871094 43 17 10 6 10 4.871595989358835 20.527153774334497 0.03639984130859375 3 0.97642932409989 8.02268221875157 43254.0 76.42014129024581 0.0 - - - - - - - 322.14285714285717 86 7 FGFRL1 fibroblast growth factor receptor-like 1 385 49 B20140220_SF056_06 B20140220_SF056_06 TB470143.[MT7]-FRVLPQGLK[MT7].3b3_1.heavy 449.29 / 547.347 14064.0 31.124900817871094 43 17 10 6 10 4.871595989358835 20.527153774334497 0.03639984130859375 3 0.97642932409989 8.02268221875157 14064.0 35.5839260890026 0.0 - - - - - - - 683.3 28 10 FGFRL1 fibroblast growth factor receptor-like 1 387 49 B20140220_SF056_06 B20140220_SF056_06 TB470143.[MT7]-FRVLPQGLK[MT7].3y5_1.heavy 449.29 / 686.432 38411.0 31.124900817871094 43 17 10 6 10 4.871595989358835 20.527153774334497 0.03639984130859375 3 0.97642932409989 8.02268221875157 38411.0 95.57115157234135 0.0 - - - - - - - 671.5 76 8 FGFRL1 fibroblast growth factor receptor-like 1 389 50 B20140220_SF056_06 B20140220_SF056_06 TB317509.[MT7]-VYTAQNPSAQALGLGK[MT7].2b3_1.heavy 953.535 / 508.289 4765.0 30.624300003051758 44 14 10 10 10 1.8526480252172752 42.628354111195854 0.0 3 0.9304485196968618 4.652209917608962 4765.0 86.66016483516482 0.0 - - - - - - - 146.83333333333334 9 12 PLAT plasminogen activator, tissue 391 50 B20140220_SF056_06 B20140220_SF056_06 TB317509.[MT7]-VYTAQNPSAQALGLGK[MT7].2y4_1.heavy 953.535 / 518.342 10313.0 30.624300003051758 44 14 10 10 10 1.8526480252172752 42.628354111195854 0.0 3 0.9304485196968618 4.652209917608962 10313.0 57.7065474931246 0.0 - - - - - - - 157.75 20 12 PLAT plasminogen activator, tissue 393 50 B20140220_SF056_06 B20140220_SF056_06 TB317509.[MT7]-VYTAQNPSAQALGLGK[MT7].2b4_1.heavy 953.535 / 579.326 6658.0 30.624300003051758 44 14 10 10 10 1.8526480252172752 42.628354111195854 0.0 3 0.9304485196968618 4.652209917608962 6658.0 70.99646749144512 0.0 - - - - - - - 134.2941176470588 13 17 PLAT plasminogen activator, tissue 395 50 B20140220_SF056_06 B20140220_SF056_06 TB317509.[MT7]-VYTAQNPSAQALGLGK[MT7].2y10_1.heavy 953.535 / 1085.64 15600.0 30.624300003051758 44 14 10 10 10 1.8526480252172752 42.628354111195854 0.0 3 0.9304485196968618 4.652209917608962 15600.0 64.21903317179257 0.0 - - - - - - - 201.25 31 12 PLAT plasminogen activator, tissue 397 51 B20140220_SF056_06 B20140220_SF056_06 TB469919.[MT7]-IDEELVTNSGK[MT7].3b4_1.heavy 498.275 / 631.305 53689.0 28.095924854278564 40 13 10 7 10 3.130504396702741 31.94373408493748 0.029500961303710938 3 0.9267804998825602 4.532760590481551 53689.0 57.792184658691056 0.0 - - - - - - - 1136.0 107 8 HELLS helicase, lymphoid-specific 399 51 B20140220_SF056_06 B20140220_SF056_06 TB469919.[MT7]-IDEELVTNSGK[MT7].3b5_1.heavy 498.275 / 744.39 45439.0 28.095924854278564 40 13 10 7 10 3.130504396702741 31.94373408493748 0.029500961303710938 3 0.9267804998825602 4.532760590481551 45439.0 72.75833454392537 0.0 - - - - - - - 659.0 90 9 HELLS helicase, lymphoid-specific 401 51 B20140220_SF056_06 B20140220_SF056_06 TB469919.[MT7]-IDEELVTNSGK[MT7].3y4_1.heavy 498.275 / 549.311 25330.0 28.095924854278564 40 13 10 7 10 3.130504396702741 31.94373408493748 0.029500961303710938 3 0.9267804998825602 4.532760590481551 25330.0 28.06337270915764 0.0 - - - - - - - 1252.2857142857142 50 7 HELLS helicase, lymphoid-specific 403 51 B20140220_SF056_06 B20140220_SF056_06 TB469919.[MT7]-IDEELVTNSGK[MT7].3b3_1.heavy 498.275 / 502.263 10506.0 28.095924854278564 40 13 10 7 10 3.130504396702741 31.94373408493748 0.029500961303710938 3 0.9267804998825602 4.532760590481551 10506.0 15.370321075024467 0.0 - - - - - - - 726.9444444444445 21 18 HELLS helicase, lymphoid-specific 405 52 B20140220_SF056_06 B20140220_SF056_06 TB469915.[MT7]-RFSGLLHGSPK[MT7].3b6_1.heavy 496.296 / 818.5 26132.0 25.55970001220703 42 12 10 10 10 0.9548366065739746 60.18482314043091 0.0 3 0.8801527292985657 3.528680193168409 26132.0 29.612930721264792 0.0 - - - - - - - 298.0833333333333 52 12 PSTPIP1 proline-serine-threonine phosphatase interacting protein 1 407 52 B20140220_SF056_06 B20140220_SF056_06 TB469915.[MT7]-RFSGLLHGSPK[MT7].3b4_1.heavy 496.296 / 592.332 3358.0 25.55970001220703 42 12 10 10 10 0.9548366065739746 60.18482314043091 0.0 3 0.8801527292985657 3.528680193168409 3358.0 4.65974025974026 3.0 - - - - - - - 740.4285714285714 14 7 PSTPIP1 proline-serine-threonine phosphatase interacting protein 1 409 52 B20140220_SF056_06 B20140220_SF056_06 TB469915.[MT7]-RFSGLLHGSPK[MT7].3b5_1.heavy 496.296 / 705.416 12628.0 25.55970001220703 42 12 10 10 10 0.9548366065739746 60.18482314043091 0.0 3 0.8801527292985657 3.528680193168409 12628.0 25.742297154899894 0.0 - - - - - - - 700.8 25 10 PSTPIP1 proline-serine-threonine phosphatase interacting protein 1 411 52 B20140220_SF056_06 B20140220_SF056_06 TB469915.[MT7]-RFSGLLHGSPK[MT7].3y4_1.heavy 496.296 / 532.321 35256.0 25.55970001220703 42 12 10 10 10 0.9548366065739746 60.18482314043091 0.0 3 0.8801527292985657 3.528680193168409 35256.0 19.92087799407194 0.0 - - - - - - - 894.25 70 4 PSTPIP1 proline-serine-threonine phosphatase interacting protein 1 413 53 B20140220_SF056_06 B20140220_SF056_06 TB470358.[MT7]-LTFVDFLTYDILDQNR.2b3_1.heavy 1059.06 / 506.31 48990.0 50.1077995300293 42 12 10 10 10 1.474252152295349 56.91826589452755 0.0 3 0.8871327022721504 3.638364853947876 48990.0 710.0 0.0 - - - - - - - 83.0 97 5 GSTM3 glutathione S-transferase mu 3 (brain) 415 53 B20140220_SF056_06 B20140220_SF056_06 TB470358.[MT7]-LTFVDFLTYDILDQNR.2y9_1.heavy 1059.06 / 1137.55 14711.0 50.1077995300293 42 12 10 10 10 1.474252152295349 56.91826589452755 0.0 3 0.8871327022721504 3.638364853947876 14711.0 303.1008977166093 0.0 - - - - - - - 86.5 29 4 GSTM3 glutathione S-transferase mu 3 (brain) 417 53 B20140220_SF056_06 B20140220_SF056_06 TB470358.[MT7]-LTFVDFLTYDILDQNR.2y6_1.heavy 1059.06 / 758.416 26299.0 50.1077995300293 42 12 10 10 10 1.474252152295349 56.91826589452755 0.0 3 0.8871327022721504 3.638364853947876 26299.0 359.4827338129497 0.0 - - - - - - - 123.22222222222223 52 9 GSTM3 glutathione S-transferase mu 3 (brain) 419 53 B20140220_SF056_06 B20140220_SF056_06 TB470358.[MT7]-LTFVDFLTYDILDQNR.2b5_1.heavy 1059.06 / 720.405 139893.0 50.1077995300293 42 12 10 10 10 1.474252152295349 56.91826589452755 0.0 3 0.8871327022721504 3.638364853947876 139893.0 1199.6579568345323 0.0 - - - - - - - 173.375 279 8 GSTM3 glutathione S-transferase mu 3 (brain) 421 54 B20140220_SF056_06 B20140220_SF056_06 TB469913.[MT7]-LLDGRK[MT7].2y4_1.heavy 495.321 / 619.364 2444.0 21.733400344848633 42 17 10 7 8 4.461282455814669 22.41507929399622 0.02880096435546875 4 0.9739300720276884 7.626836034848413 2444.0 6.357702702702703 2.0 - - - - - - - 246.66666666666666 8 30 PSTPIP1 proline-serine-threonine phosphatase interacting protein 1 423 54 B20140220_SF056_06 B20140220_SF056_06 TB469913.[MT7]-LLDGRK[MT7].2y5_1.heavy 495.321 / 732.448 7664.0 21.733400344848633 42 17 10 7 8 4.461282455814669 22.41507929399622 0.02880096435546875 4 0.9739300720276884 7.626836034848413 7664.0 29.422604422604422 0.0 - - - - - - - 620.0 15 8 PSTPIP1 proline-serine-threonine phosphatase interacting protein 1 425 54 B20140220_SF056_06 B20140220_SF056_06 TB469913.[MT7]-LLDGRK[MT7].2y3_1.heavy 495.321 / 504.337 10108.0 21.733400344848633 42 17 10 7 8 4.461282455814669 22.41507929399622 0.02880096435546875 4 0.9739300720276884 7.626836034848413 10108.0 28.186186186186184 0.0 - - - - - - - 695.6428571428571 20 14 PSTPIP1 proline-serine-threonine phosphatase interacting protein 1 427 54 B20140220_SF056_06 B20140220_SF056_06 TB469913.[MT7]-LLDGRK[MT7].2b5_1.heavy 495.321 / 699.427 1740.0 21.733400344848633 42 17 10 7 8 4.461282455814669 22.41507929399622 0.02880096435546875 4 0.9739300720276884 7.626836034848413 1740.0 0.3227344992050878 3.0 - - - - - - - 267.35483870967744 5 31 PSTPIP1 proline-serine-threonine phosphatase interacting protein 1 429 55 B20140220_SF056_06 B20140220_SF056_06 TB317603.[MT7]-SLEVILRAEAVESAQAGDK[MT7].4y4_1.heavy 569.319 / 534.3 30973.0 36.732300758361816 37 13 10 6 8 1.8529709978132591 53.967385414025735 0.032398223876953125 4 0.9221082280958561 4.392951800987091 30973.0 17.48402647695744 1.0 - - - - - - - 751.5 67 4 MCM6 minichromosome maintenance complex component 6 431 55 B20140220_SF056_06 B20140220_SF056_06 TB317603.[MT7]-SLEVILRAEAVESAQAGDK[MT7].4b4_1.heavy 569.319 / 573.336 4097.0 36.732300758361816 37 13 10 6 8 1.8529709978132591 53.967385414025735 0.032398223876953125 4 0.9221082280958561 4.392951800987091 4097.0 1.4998169615619281 3.0 - - - - - - - 886.5384615384615 9 13 MCM6 minichromosome maintenance complex component 6 433 55 B20140220_SF056_06 B20140220_SF056_06 TB317603.[MT7]-SLEVILRAEAVESAQAGDK[MT7].4b9_2.heavy 569.319 / 578.346 9396.0 36.732300758361816 37 13 10 6 8 1.8529709978132591 53.967385414025735 0.032398223876953125 4 0.9221082280958561 4.392951800987091 9396.0 19.9904254753011 0.0 - - - - - - - 685.8888888888889 18 9 MCM6 minichromosome maintenance complex component 6 435 55 B20140220_SF056_06 B20140220_SF056_06 TB317603.[MT7]-SLEVILRAEAVESAQAGDK[MT7].4b10_2.heavy 569.319 / 613.865 25784.0 36.732300758361816 37 13 10 6 8 1.8529709978132591 53.967385414025735 0.032398223876953125 4 0.9221082280958561 4.392951800987091 25784.0 47.01731867998514 0.0 - - - - - - - 715.0909090909091 51 11 MCM6 minichromosome maintenance complex component 6 437 56 B20140220_SF056_06 B20140220_SF056_06 TB470354.[MT7]-TTMAGLTMEELIQLVAAR.2y9_1.heavy 1046.57 / 1012.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF214 ring finger protein 214 439 56 B20140220_SF056_06 B20140220_SF056_06 TB470354.[MT7]-TTMAGLTMEELIQLVAAR.2b4_1.heavy 1046.57 / 549.282 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF214 ring finger protein 214 441 56 B20140220_SF056_06 B20140220_SF056_06 TB470354.[MT7]-TTMAGLTMEELIQLVAAR.2y10_1.heavy 1046.57 / 1141.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF214 ring finger protein 214 443 56 B20140220_SF056_06 B20140220_SF056_06 TB470354.[MT7]-TTMAGLTMEELIQLVAAR.2b5_1.heavy 1046.57 / 606.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF214 ring finger protein 214 445 57 B20140220_SF056_06 B20140220_SF056_06 TB470353.[MT7]-SRGFGFVTFENIDDAK[MT7].3y6_1.heavy 697.696 / 819.433 10430.0 37.390350341796875 29 11 2 6 10 0.8358384127520431 72.88273912894635 0.0343017578125 3 0.8531636384320859 3.180403600950924 10430.0 28.621860465116278 0.0 - - - - - - - 599.1428571428571 20 7 CIRBP cold inducible RNA binding protein 447 57 B20140220_SF056_06 B20140220_SF056_06 TB470353.[MT7]-SRGFGFVTFENIDDAK[MT7].3b6_1.heavy 697.696 / 796.422 7850.0 37.390350341796875 29 11 2 6 10 0.8358384127520431 72.88273912894635 0.0343017578125 3 0.8531636384320859 3.180403600950924 7850.0 15.993587841380062 0.0 - - - - - - - 253.11764705882354 15 17 CIRBP cold inducible RNA binding protein 449 57 B20140220_SF056_06 B20140220_SF056_06 TB470353.[MT7]-SRGFGFVTFENIDDAK[MT7].3b5_1.heavy 697.696 / 649.354 2850.0 37.390350341796875 29 11 2 6 10 0.8358384127520431 72.88273912894635 0.0343017578125 3 0.8531636384320859 3.180403600950924 2850.0 4.10002314028724 5.0 - - - - - - - 722.0 43 7 CIRBP cold inducible RNA binding protein 451 57 B20140220_SF056_06 B20140220_SF056_06 TB470353.[MT7]-SRGFGFVTFENIDDAK[MT7].3b7_1.heavy 697.696 / 895.491 6344.0 37.390350341796875 29 11 2 6 10 0.8358384127520431 72.88273912894635 0.0343017578125 3 0.8531636384320859 3.180403600950924 6344.0 20.910935998462428 0.0 - - - - - - - 287.65 12 20 CIRBP cold inducible RNA binding protein 453 58 B20140220_SF056_06 B20140220_SF056_06 TB317304.[MT7]-DWNTLIVGK[MT7].2y8_1.heavy 667.39 / 1074.64 1114.0 35.37620162963867 50 20 10 10 10 25.989239523891126 3.8477462916170753 0.0 2 0.9977458940098088 25.989240656873385 1114.0 9.032432432432433 0.0 - - - - - - - 150.95833333333334 2 24 PRMT5 protein arginine methyltransferase 5 455 58 B20140220_SF056_06 B20140220_SF056_06 TB317304.[MT7]-DWNTLIVGK[MT7].2b4_1.heavy 667.39 / 661.306 N/A 35.37620162963867 50 20 10 10 10 25.989239523891126 3.8477462916170753 0.0 2 0.9977458940098088 25.989240656873385 2841.0 3.268007324573131 11.0 - - - - - - - 1174.3333333333333 8 12 PRMT5 protein arginine methyltransferase 5 457 58 B20140220_SF056_06 B20140220_SF056_06 TB317304.[MT7]-DWNTLIVGK[MT7].2y3_1.heavy 667.39 / 447.305 4067.0 35.37620162963867 50 20 10 10 10 25.989239523891126 3.8477462916170753 0.0 2 0.9977458940098088 25.989240656873385 4067.0 15.877920483540386 0.0 - - - - - - - 562.6 8 10 PRMT5 protein arginine methyltransferase 5 459 59 B20140220_SF056_06 B20140220_SF056_06 TB470425.[MT7]-VNLMTVEALEEGDYFEAIPLK[MT7].4y5_1.heavy 668.105 / 685.473 2733.0 47.497050285339355 41 14 10 7 10 3.770366850956321 26.522618077505072 0.023799896240234375 3 0.9443247380850669 5.205894852584813 2733.0 13.564890109890111 0.0 - - - - - - - 193.92307692307693 5 26 CLMN calmin (calponin-like, transmembrane) 461 59 B20140220_SF056_06 B20140220_SF056_06 TB470425.[MT7]-VNLMTVEALEEGDYFEAIPLK[MT7].4b4_1.heavy 668.105 / 602.345 1262.0 47.497050285339355 41 14 10 7 10 3.770366850956321 26.522618077505072 0.023799896240234375 3 0.9443247380850669 5.205894852584813 1262.0 4.807619047619046 4.0 - - - - - - - 187.19230769230768 2 26 CLMN calmin (calponin-like, transmembrane) 463 59 B20140220_SF056_06 B20140220_SF056_06 TB470425.[MT7]-VNLMTVEALEEGDYFEAIPLK[MT7].4b5_1.heavy 668.105 / 703.393 1612.0 47.497050285339355 41 14 10 7 10 3.770366850956321 26.522618077505072 0.023799896240234375 3 0.9443247380850669 5.205894852584813 1612.0 18.422857142857143 0.0 - - - - - - - 115.0 3 28 CLMN calmin (calponin-like, transmembrane) 465 59 B20140220_SF056_06 B20140220_SF056_06 TB470425.[MT7]-VNLMTVEALEEGDYFEAIPLK[MT7].4y3_1.heavy 668.105 / 501.352 10233.0 47.497050285339355 41 14 10 7 10 3.770366850956321 26.522618077505072 0.023799896240234375 3 0.9443247380850669 5.205894852584813 10233.0 48.68227349847302 0.0 - - - - - - - 245.13793103448276 20 29 CLMN calmin (calponin-like, transmembrane) 467 60 B20140220_SF056_06 B20140220_SF056_06 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 554075.0 18.17770004272461 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 554075.0 2486.1176959193135 0.0 - - - - - - - 390.0 1108 1 469 60 B20140220_SF056_06 B20140220_SF056_06 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 412531.0 18.17770004272461 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 412531.0 4531.6960496524325 0.0 - - - - - - - 746.7142857142857 825 7 471 60 B20140220_SF056_06 B20140220_SF056_06 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 430976.0 18.17770004272461 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 430976.0 1607.642004737872 0.0 - - - - - - - 272.8 861 5 473 61 B20140220_SF056_06 B20140220_SF056_06 TB470367.[MT7]-LSQDPEPDQQDPTLGGPAR.3y7_1.heavy 722.358 / 671.383 9580.0 26.1884503364563 42 16 10 6 10 2.453164350640198 40.76367731901174 0.03980064392089844 3 0.9653401267991178 6.6097716280439425 9580.0 30.889936500281326 0.0 - - - - - - - 204.64285714285714 19 14 SIT1 signaling threshold regulating transmembrane adaptor 1 475 61 B20140220_SF056_06 B20140220_SF056_06 TB470367.[MT7]-LSQDPEPDQQDPTLGGPAR.3b6_1.heavy 722.358 / 814.406 62685.0 26.1884503364563 42 16 10 6 10 2.453164350640198 40.76367731901174 0.03980064392089844 3 0.9653401267991178 6.6097716280439425 62685.0 273.12264136725344 0.0 - - - - - - - 167.33333333333334 125 9 SIT1 signaling threshold regulating transmembrane adaptor 1 477 61 B20140220_SF056_06 B20140220_SF056_06 TB470367.[MT7]-LSQDPEPDQQDPTLGGPAR.3b4_1.heavy 722.358 / 588.311 83279.0 26.1884503364563 42 16 10 6 10 2.453164350640198 40.76367731901174 0.03980064392089844 3 0.9653401267991178 6.6097716280439425 83279.0 249.24375175829917 0.0 - - - - - - - 301.6666666666667 166 9 SIT1 signaling threshold regulating transmembrane adaptor 1 479 61 B20140220_SF056_06 B20140220_SF056_06 TB470367.[MT7]-LSQDPEPDQQDPTLGGPAR.3y8_1.heavy 722.358 / 768.436 87428.0 26.1884503364563 42 16 10 6 10 2.453164350640198 40.76367731901174 0.03980064392089844 3 0.9653401267991178 6.6097716280439425 87428.0 113.06195998844399 0.0 - - - - - - - 264.0 174 4 SIT1 signaling threshold regulating transmembrane adaptor 1 481 62 B20140220_SF056_06 B20140220_SF056_06 TB317109.[MT7]-C[CAM]SFPVK[MT7].2y4_1.heavy 513.288 / 634.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - NUMB numb homolog (Drosophila) 483 62 B20140220_SF056_06 B20140220_SF056_06 TB317109.[MT7]-C[CAM]SFPVK[MT7].2b3_1.heavy 513.288 / 539.24 N/A N/A - - - - - - - - - 0.0 - - - - - - - NUMB numb homolog (Drosophila) 485 62 B20140220_SF056_06 B20140220_SF056_06 TB317109.[MT7]-C[CAM]SFPVK[MT7].2y5_1.heavy 513.288 / 721.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - NUMB numb homolog (Drosophila) 487 62 B20140220_SF056_06 B20140220_SF056_06 TB317109.[MT7]-C[CAM]SFPVK[MT7].2b5_1.heavy 513.288 / 735.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - NUMB numb homolog (Drosophila) 489 63 B20140220_SF056_06 B20140220_SF056_06 TB317308.[MT7]-GGFSFENC[CAM]QR.2y4_1.heavy 673.307 / 577.251 4518.0 28.316974639892578 43 17 10 6 10 3.46855892935 22.938272608166894 0.0308990478515625 3 0.9759318669961369 7.939008087470973 4518.0 28.84583969465649 0.0 - - - - - - - 182.47368421052633 9 19 PSMB10 proteasome (prosome, macropain) subunit, beta type, 10 491 63 B20140220_SF056_06 B20140220_SF056_06 TB317308.[MT7]-GGFSFENC[CAM]QR.2y9_1.heavy 673.307 / 1144.48 3340.0 28.316974639892578 43 17 10 6 10 3.46855892935 22.938272608166894 0.0308990478515625 3 0.9759318669961369 7.939008087470973 3340.0 57.181491413785 0.0 - - - - - - - 169.2941176470588 6 17 PSMB10 proteasome (prosome, macropain) subunit, beta type, 10 493 63 B20140220_SF056_06 B20140220_SF056_06 TB317308.[MT7]-GGFSFENC[CAM]QR.2y6_1.heavy 673.307 / 853.362 2685.0 28.316974639892578 43 17 10 6 10 3.46855892935 22.938272608166894 0.0308990478515625 3 0.9759318669961369 7.939008087470973 2685.0 76.41923076923077 0.0 - - - - - - - 179.8125 5 16 PSMB10 proteasome (prosome, macropain) subunit, beta type, 10 495 63 B20140220_SF056_06 B20140220_SF056_06 TB317308.[MT7]-GGFSFENC[CAM]QR.2y7_1.heavy 673.307 / 940.394 5370.0 28.316974639892578 43 17 10 6 10 3.46855892935 22.938272608166894 0.0308990478515625 3 0.9759318669961369 7.939008087470973 5370.0 58.824045801526715 0.0 - - - - - - - 163.5 10 18 PSMB10 proteasome (prosome, macropain) subunit, beta type, 10 497 64 B20140220_SF056_06 B20140220_SF056_06 TB470033.[MT7]-EK[MT7]EPPK[MT7].2b3_1.heavy 580.356 / 675.392 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCF1;PPP2R5D ATP-binding cassette, sub-family F (GCN20), member 1;protein phosphatase 2, regulatory subunit B', delta 499 64 B20140220_SF056_06 B20140220_SF056_06 TB470033.[MT7]-EK[MT7]EPPK[MT7].2y5_1.heavy 580.356 / 886.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCF1;PPP2R5D ATP-binding cassette, sub-family F (GCN20), member 1;protein phosphatase 2, regulatory subunit B', delta 501 64 B20140220_SF056_06 B20140220_SF056_06 TB470033.[MT7]-EK[MT7]EPPK[MT7].2b4_1.heavy 580.356 / 772.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCF1;PPP2R5D ATP-binding cassette, sub-family F (GCN20), member 1;protein phosphatase 2, regulatory subunit B', delta 503 64 B20140220_SF056_06 B20140220_SF056_06 TB470033.[MT7]-EK[MT7]EPPK[MT7].2y3_1.heavy 580.356 / 485.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCF1;PPP2R5D ATP-binding cassette, sub-family F (GCN20), member 1;protein phosphatase 2, regulatory subunit B', delta 505 65 B20140220_SF056_06 B20140220_SF056_06 TB470035.[MT7]-SLRDPSAK[MT7].2b3_1.heavy 581.345 / 501.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - WARS2 tryptophanyl tRNA synthetase 2, mitochondrial 507 65 B20140220_SF056_06 B20140220_SF056_06 TB470035.[MT7]-SLRDPSAK[MT7].2y4_1.heavy 581.345 / 546.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - WARS2 tryptophanyl tRNA synthetase 2, mitochondrial 509 65 B20140220_SF056_06 B20140220_SF056_06 TB470035.[MT7]-SLRDPSAK[MT7].2b4_1.heavy 581.345 / 616.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - WARS2 tryptophanyl tRNA synthetase 2, mitochondrial 511 65 B20140220_SF056_06 B20140220_SF056_06 TB470035.[MT7]-SLRDPSAK[MT7].2y7_1.heavy 581.345 / 930.549 N/A N/A - - - - - - - - - 0.0 - - - - - - - WARS2 tryptophanyl tRNA synthetase 2, mitochondrial 513 66 B20140220_SF056_06 B20140220_SF056_06 TB469902.[MT7]-VNDRVAR.2b4_1.heavy 487.287 / 629.349 8605.0 14.70045018196106 46 20 10 6 10 5.608714725235792 17.829396733276706 0.036200523376464844 3 0.9948459133791098 17.183032205041894 8605.0 11.19162242255334 0.0 - - - - - - - 198.47619047619048 17 21 CASP7 caspase 7, apoptosis-related cysteine peptidase 515 66 B20140220_SF056_06 B20140220_SF056_06 TB469902.[MT7]-VNDRVAR.2y3_1.heavy 487.287 / 345.224 11417.0 14.70045018196106 46 20 10 6 10 5.608714725235792 17.829396733276706 0.036200523376464844 3 0.9948459133791098 17.183032205041894 11417.0 24.08493724031728 0.0 - - - - - - - 666.3333333333334 22 9 CASP7 caspase 7, apoptosis-related cysteine peptidase 517 66 B20140220_SF056_06 B20140220_SF056_06 TB469902.[MT7]-VNDRVAR.2b6_1.heavy 487.287 / 799.454 1084.0 14.70045018196106 46 20 10 6 10 5.608714725235792 17.829396733276706 0.036200523376464844 3 0.9948459133791098 17.183032205041894 1084.0 12.052574734811957 1.0 - - - - - - - 150.43478260869566 2 23 CASP7 caspase 7, apoptosis-related cysteine peptidase 519 66 B20140220_SF056_06 B20140220_SF056_06 TB469902.[MT7]-VNDRVAR.2b5_1.heavy 487.287 / 728.417 1253.0 14.70045018196106 46 20 10 6 10 5.608714725235792 17.829396733276706 0.036200523376464844 3 0.9948459133791098 17.183032205041894 1253.0 11.716787497286738 0.0 - - - - - - - 152.65 2 20 CASP7 caspase 7, apoptosis-related cysteine peptidase 521 67 B20140220_SF056_06 B20140220_SF056_06 TB317104.[MT7]-DSATEAER.2y5_1.heavy 511.747 / 605.289 1930.0 13.955300331115723 50 20 10 10 10 27.65158152519498 3.616429675419618 0.0 3 0.9998087312333043 89.23462820453399 1930.0 29.84654884165273 0.0 - - - - - - - 79.23529411764706 3 17 PSTPIP1 proline-serine-threonine phosphatase interacting protein 1 523 67 B20140220_SF056_06 B20140220_SF056_06 TB317104.[MT7]-DSATEAER.2y6_1.heavy 511.747 / 676.326 2247.0 13.955300331115723 50 20 10 10 10 27.65158152519498 3.616429675419618 0.0 3 0.9998087312333043 89.23462820453399 2247.0 39.852452830188675 0.0 - - - - - - - 95.27777777777777 4 18 PSTPIP1 proline-serine-threonine phosphatase interacting protein 1 525 67 B20140220_SF056_06 B20140220_SF056_06 TB317104.[MT7]-DSATEAER.2b5_1.heavy 511.747 / 648.296 1850.0 13.955300331115723 50 20 10 10 10 27.65158152519498 3.616429675419618 0.0 3 0.9998087312333043 89.23462820453399 1850.0 18.920454545454547 0.0 - - - - - - - 94.70588235294117 3 17 PSTPIP1 proline-serine-threonine phosphatase interacting protein 1 527 67 B20140220_SF056_06 B20140220_SF056_06 TB317104.[MT7]-DSATEAER.2y7_1.heavy 511.747 / 763.358 9305.0 13.955300331115723 50 20 10 10 10 27.65158152519498 3.616429675419618 0.0 3 0.9998087312333043 89.23462820453399 9305.0 120.34253859348199 0.0 - - - - - - - 120.25 18 20 PSTPIP1 proline-serine-threonine phosphatase interacting protein 1 529 68 B20140220_SF056_06 B20140220_SF056_06 TB469903.[MT7]-TLQAIQR.2y5_1.heavy 487.299 / 615.357 31774.0 23.66010093688965 43 18 9 10 6 4.867752500850332 16.15492670126256 0.0 5 0.9847962788545523 9.996216205817767 31774.0 39.55338807977038 3.0 - - - - - - - 828.1428571428571 132 7 CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 531 68 B20140220_SF056_06 B20140220_SF056_06 TB469903.[MT7]-TLQAIQR.2b4_1.heavy 487.299 / 558.337 29330.0 23.66010093688965 43 18 9 10 6 4.867752500850332 16.15492670126256 0.0 5 0.9847962788545523 9.996216205817767 29330.0 60.47680878423178 0.0 - - - - - - - 746.0 58 8 CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 533 68 B20140220_SF056_06 B20140220_SF056_06 TB469903.[MT7]-TLQAIQR.2y6_1.heavy 487.299 / 728.441 57182.0 23.66010093688965 43 18 9 10 6 4.867752500850332 16.15492670126256 0.0 5 0.9847962788545523 9.996216205817767 57182.0 143.97883073726405 0.0 - - - - - - - 330.8181818181818 114 11 CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 535 68 B20140220_SF056_06 B20140220_SF056_06 TB469903.[MT7]-TLQAIQR.2b5_1.heavy 487.299 / 671.421 17962.0 23.66010093688965 43 18 9 10 6 4.867752500850332 16.15492670126256 0.0 5 0.9847962788545523 9.996216205817767 17962.0 51.67598723609251 0.0 - - - - - - - 703.375 35 8 CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 537 69 B20140220_SF056_06 B20140220_SF056_06 TB317353.[MT7]-EC[CAM]GVTATFDASR.2y8_1.heavy 729.344 / 868.416 2534.0 26.781266530354817 45 20 10 5 10 5.8296002562709095 17.15383484355207 0.04120063781738281 3 0.9916744441574323 13.51618034269573 2534.0 47.40790872483221 0.0 - - - - - - - 182.55555555555554 5 9 NUMB numb homolog (Drosophila) 539 69 B20140220_SF056_06 B20140220_SF056_06 TB317353.[MT7]-EC[CAM]GVTATFDASR.2y10_1.heavy 729.344 / 1024.51 N/A 26.781266530354817 45 20 10 5 10 5.8296002562709095 17.15383484355207 0.04120063781738281 3 0.9916744441574323 13.51618034269573 1863.0 30.463155 0.0 - - - - - - - 149.42857142857142 3 7 NUMB numb homolog (Drosophila) 541 69 B20140220_SF056_06 B20140220_SF056_06 TB317353.[MT7]-EC[CAM]GVTATFDASR.2y11_1.heavy 729.344 / 1184.54 2832.0 26.781266530354817 45 20 10 5 10 5.8296002562709095 17.15383484355207 0.04120063781738281 3 0.9916744441574323 13.51618034269573 2832.0 26.58394055608821 0.0 - - - - - - - 174.11111111111111 5 9 NUMB numb homolog (Drosophila) 543 69 B20140220_SF056_06 B20140220_SF056_06 TB317353.[MT7]-EC[CAM]GVTATFDASR.2b4_1.heavy 729.344 / 590.273 1938.0 26.781266530354817 45 20 10 5 10 5.8296002562709095 17.15383484355207 0.04120063781738281 3 0.9916744441574323 13.51618034269573 1938.0 9.923806970509382 0.0 - - - - - - - 175.85714285714286 3 14 NUMB numb homolog (Drosophila) 545 70 B20140220_SF056_06 B20140220_SF056_06 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 1408540.0 36.78900146484375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1408540.0 2005.0018977435784 0.0 - - - - - - - 244.28571428571428 2817 7 547 70 B20140220_SF056_06 B20140220_SF056_06 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 631754.0 36.78900146484375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 631754.0 1605.3233287897617 0.0 - - - - - - - 718.1428571428571 1263 7 549 70 B20140220_SF056_06 B20140220_SF056_06 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 874014.0 36.78900146484375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 874014.0 99.38735093601818 0.0 - - - - - - - 395.6 1748 5 551 71 B20140220_SF056_06 B20140220_SF056_06 TB317351.[MT7]-LNFELTDALK[MT7].2b3_1.heavy 726.421 / 519.305 3740.0 39.606401443481445 46 20 10 6 10 4.980955031881451 20.076471150599225 0.031200408935546875 3 0.9933630930514563 15.140458073592503 3740.0 8.280317151203228 0.0 - - - - - - - 666.5555555555555 7 9 CPT2 carnitine palmitoyltransferase 2 553 71 B20140220_SF056_06 B20140220_SF056_06 TB317351.[MT7]-LNFELTDALK[MT7].2y9_1.heavy 726.421 / 1194.65 3493.0 39.606401443481445 46 20 10 6 10 4.980955031881451 20.076471150599225 0.031200408935546875 3 0.9933630930514563 15.140458073592503 3493.0 28.914603535104177 0.0 - - - - - - - 148.79166666666666 6 24 CPT2 carnitine palmitoyltransferase 2 555 71 B20140220_SF056_06 B20140220_SF056_06 TB317351.[MT7]-LNFELTDALK[MT7].2b4_1.heavy 726.421 / 648.347 6658.0 39.606401443481445 46 20 10 6 10 4.980955031881451 20.076471150599225 0.031200408935546875 3 0.9933630930514563 15.140458073592503 6658.0 11.98849563700696 0.0 - - - - - - - 763.1428571428571 13 7 CPT2 carnitine palmitoyltransferase 2 557 71 B20140220_SF056_06 B20140220_SF056_06 TB317351.[MT7]-LNFELTDALK[MT7].2y6_1.heavy 726.421 / 804.495 4603.0 39.606401443481445 46 20 10 6 10 4.980955031881451 20.076471150599225 0.031200408935546875 3 0.9933630930514563 15.140458073592503 4603.0 12.801219831670476 0.0 - - - - - - - 622.1428571428571 9 7 CPT2 carnitine palmitoyltransferase 2 559 72 B20140220_SF056_06 B20140220_SF056_06 TB317497.[MT7]-YTLNVLEDLGDGQK[MT7].3b4_1.heavy 618.335 / 636.347 15304.0 40.28160095214844 34 14 2 10 8 1.6120411444166869 41.453386499198444 0.0 4 0.9391814474215892 4.978726514024949 15304.0 54.47246198740593 0.0 - - - - - - - 344.36842105263156 30 19 PLS3 plastin 3 561 72 B20140220_SF056_06 B20140220_SF056_06 TB317497.[MT7]-YTLNVLEDLGDGQK[MT7].3b5_1.heavy 618.335 / 735.416 14768.0 40.28160095214844 34 14 2 10 8 1.6120411444166869 41.453386499198444 0.0 4 0.9391814474215892 4.978726514024949 14768.0 33.60449127326857 0.0 - - - - - - - 699.5714285714286 29 7 PLS3 plastin 3 563 72 B20140220_SF056_06 B20140220_SF056_06 TB317497.[MT7]-YTLNVLEDLGDGQK[MT7].3b3_1.heavy 618.335 / 522.304 3023.0 40.28160095214844 34 14 2 10 8 1.6120411444166869 41.453386499198444 0.0 4 0.9391814474215892 4.978726514024949 3023.0 5.768721359400693 2.0 - - - - - - - 647.25 7 12 PLS3 plastin 3 565 72 B20140220_SF056_06 B20140220_SF056_06 TB317497.[MT7]-YTLNVLEDLGDGQK[MT7].3y5_1.heavy 618.335 / 648.343 16146.0 40.28160095214844 34 14 2 10 8 1.6120411444166869 41.453386499198444 0.0 4 0.9391814474215892 4.978726514024949 16146.0 36.192434547892695 1.0 - - - - - - - 692.4 89 10 PLS3 plastin 3 567 73 B20140220_SF056_06 B20140220_SF056_06 TB317210.[MT7]-AIQDVTIK[MT7].2y4_1.heavy 588.366 / 604.415 8168.0 27.710725784301758 42 16 10 6 10 1.8056996747312197 44.16002544564384 0.03170013427734375 3 0.961202518758794 6.245200425586671 8168.0 46.87774010020097 0.0 - - - - - - - 250.65 16 20 RNF214 ring finger protein 214 569 73 B20140220_SF056_06 B20140220_SF056_06 TB317210.[MT7]-AIQDVTIK[MT7].2y5_1.heavy 588.366 / 719.442 3775.0 27.710725784301758 42 16 10 6 10 1.8056996747312197 44.16002544564384 0.03170013427734375 3 0.961202518758794 6.245200425586671 3775.0 10.539518011565601 0.0 - - - - - - - 264.25 7 20 RNF214 ring finger protein 214 571 73 B20140220_SF056_06 B20140220_SF056_06 TB317210.[MT7]-AIQDVTIK[MT7].2b4_1.heavy 588.366 / 572.316 8992.0 27.710725784301758 42 16 10 6 10 1.8056996747312197 44.16002544564384 0.03170013427734375 3 0.961202518758794 6.245200425586671 8992.0 13.024196559005082 0.0 - - - - - - - 716.8888888888889 17 9 RNF214 ring finger protein 214 573 73 B20140220_SF056_06 B20140220_SF056_06 TB317210.[MT7]-AIQDVTIK[MT7].2y3_1.heavy 588.366 / 505.347 5011.0 27.710725784301758 42 16 10 6 10 1.8056996747312197 44.16002544564384 0.03170013427734375 3 0.961202518758794 6.245200425586671 5011.0 3.9884848009124387 0.0 - - - - - - - 289.8333333333333 10 18 RNF214 ring finger protein 214 575 74 B20140220_SF056_06 B20140220_SF056_06 TB317356.[MT7]-ILMALLEVLSGR.2y8_1.heavy 729.945 / 886.536 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLMN calmin (calponin-like, transmembrane) 577 74 B20140220_SF056_06 B20140220_SF056_06 TB317356.[MT7]-ILMALLEVLSGR.2y9_1.heavy 729.945 / 957.573 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLMN calmin (calponin-like, transmembrane) 579 74 B20140220_SF056_06 B20140220_SF056_06 TB317356.[MT7]-ILMALLEVLSGR.2y10_1.heavy 729.945 / 1088.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLMN calmin (calponin-like, transmembrane) 581 74 B20140220_SF056_06 B20140220_SF056_06 TB317356.[MT7]-ILMALLEVLSGR.2y11_1.heavy 729.945 / 1201.7 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLMN calmin (calponin-like, transmembrane) 583 75 B20140220_SF056_06 B20140220_SF056_06 TB470064.[MT7]-NLLHEYK[MT7].3y3_1.heavy 402.236 / 583.321 29882.0 25.25589942932129 34 18 4 10 2 4.134599024727149 24.186142211601577 0.0 13 0.9865370370093182 10.624380004849082 29882.0 93.81612672246503 2.0 - - - - - - - 350.8333333333333 162 6 CLMN calmin (calponin-like, transmembrane) 585 75 B20140220_SF056_06 B20140220_SF056_06 TB470064.[MT7]-NLLHEYK[MT7].3y4_1.heavy 402.236 / 720.38 3297.0 25.25589942932129 34 18 4 10 2 4.134599024727149 24.186142211601577 0.0 13 0.9865370370093182 10.624380004849082 3297.0 69.9435 0.0 - - - - - - - 186.88888888888889 6 9 CLMN calmin (calponin-like, transmembrane) 587 75 B20140220_SF056_06 B20140220_SF056_06 TB470064.[MT7]-NLLHEYK[MT7].3b3_1.heavy 402.236 / 485.32 43139.0 25.25589942932129 34 18 4 10 2 4.134599024727149 24.186142211601577 0.0 13 0.9865370370093182 10.624380004849082 43139.0 63.85394527520321 0.0 - - - - - - - 827.8 86 5 CLMN calmin (calponin-like, transmembrane) 589 75 B20140220_SF056_06 B20140220_SF056_06 TB470064.[MT7]-NLLHEYK[MT7].3y5_2.heavy 402.236 / 417.236 3998.0 25.25589942932129 34 18 4 10 2 4.134599024727149 24.186142211601577 0.0 13 0.9865370370093182 10.624380004849082 3998.0 2.7123026869067273 9.0 - - - - - - - 631.0 114 1 CLMN calmin (calponin-like, transmembrane) 591 76 B20140220_SF056_06 B20140220_SF056_06 TB317627.[MT7]-ITINPGC[CAM]VVVDGMPPGVSFK[MT7].3y7_1.heavy 792.428 / 875.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - GTF2I general transcription factor IIi 593 76 B20140220_SF056_06 B20140220_SF056_06 TB317627.[MT7]-ITINPGC[CAM]VVVDGMPPGVSFK[MT7].3y6_1.heavy 792.428 / 778.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - GTF2I general transcription factor IIi 595 76 B20140220_SF056_06 B20140220_SF056_06 TB317627.[MT7]-ITINPGC[CAM]VVVDGMPPGVSFK[MT7].3y3_1.heavy 792.428 / 525.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - GTF2I general transcription factor IIi 597 76 B20140220_SF056_06 B20140220_SF056_06 TB317627.[MT7]-ITINPGC[CAM]VVVDGMPPGVSFK[MT7].3b4_1.heavy 792.428 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - GTF2I general transcription factor IIi 599 77 B20140220_SF056_06 B20140220_SF056_06 TB317628.[MT7]-ITINPGC[CAM]VVVDGMPPGVSFK[MT7].2b4_1.heavy 1188.14 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - GTF2I general transcription factor IIi 601 77 B20140220_SF056_06 B20140220_SF056_06 TB317628.[MT7]-ITINPGC[CAM]VVVDGMPPGVSFK[MT7].2y3_1.heavy 1188.14 / 525.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - GTF2I general transcription factor IIi 603 77 B20140220_SF056_06 B20140220_SF056_06 TB317628.[MT7]-ITINPGC[CAM]VVVDGMPPGVSFK[MT7].2y6_1.heavy 1188.14 / 778.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - GTF2I general transcription factor IIi 605 77 B20140220_SF056_06 B20140220_SF056_06 TB317628.[MT7]-ITINPGC[CAM]VVVDGMPPGVSFK[MT7].2y7_1.heavy 1188.14 / 875.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - GTF2I general transcription factor IIi 607 78 B20140220_SF056_06 B20140220_SF056_06 TB470066.[MT7]-EDFRDLIR.3y6_2.heavy 403.223 / 410.245 375256.0 32.36650085449219 43 13 10 10 10 3.0698813312930704 32.57454904873434 0.0 3 0.9296456686163292 4.625271685334422 375256.0 1003.1300393184797 0.0 - - - - - - - 196.1 750 10 NAE1 NEDD8 activating enzyme E1 subunit 1 609 78 B20140220_SF056_06 B20140220_SF056_06 TB470066.[MT7]-EDFRDLIR.3y3_1.heavy 403.223 / 401.287 33484.0 32.36650085449219 43 13 10 10 10 3.0698813312930704 32.57454904873434 0.0 3 0.9296456686163292 4.625271685334422 33484.0 66.48713974488032 0.0 - - - - - - - 654.0 66 8 NAE1 NEDD8 activating enzyme E1 subunit 1 611 78 B20140220_SF056_06 B20140220_SF056_06 TB470066.[MT7]-EDFRDLIR.3b3_1.heavy 403.223 / 536.247 5755.0 32.36650085449219 43 13 10 10 10 3.0698813312930704 32.57454904873434 0.0 3 0.9296456686163292 4.625271685334422 5755.0 20.505003160402584 0.0 - - - - - - - 207.16666666666666 11 18 NAE1 NEDD8 activating enzyme E1 subunit 1 613 78 B20140220_SF056_06 B20140220_SF056_06 TB470066.[MT7]-EDFRDLIR.3y4_1.heavy 403.223 / 516.314 35577.0 32.36650085449219 43 13 10 10 10 3.0698813312930704 32.57454904873434 0.0 3 0.9296456686163292 4.625271685334422 35577.0 51.09081537114869 0.0 - - - - - - - 761.1818181818181 71 11 NAE1 NEDD8 activating enzyme E1 subunit 1 615 79 B20140220_SF056_06 B20140220_SF056_06 TB317361.[MT7]-ERYQEVLDK[MT7].3y3_1.heavy 489.94 / 519.326 42739.0 24.751800537109375 37 13 10 10 4 2.8601536604867173 34.96315648404108 0.0 7 0.9164125517922082 4.238568920277586 42739.0 62.58544152855853 1.0 - - - - - - - 339.8333333333333 85 6 RNF214 ring finger protein 214 617 79 B20140220_SF056_06 B20140220_SF056_06 TB317361.[MT7]-ERYQEVLDK[MT7].3b4_1.heavy 489.94 / 721.375 5744.0 24.751800537109375 37 13 10 10 4 2.8601536604867173 34.96315648404108 0.0 7 0.9164125517922082 4.238568920277586 5744.0 1.504621761439046 9.0 - - - - - - - 2285.0 21 3 RNF214 ring finger protein 214 619 79 B20140220_SF056_06 B20140220_SF056_06 TB317361.[MT7]-ERYQEVLDK[MT7].3b5_1.heavy 489.94 / 850.417 10376.0 24.751800537109375 37 13 10 10 4 2.8601536604867173 34.96315648404108 0.0 7 0.9164125517922082 4.238568920277586 10376.0 64.96999535162693 0.0 - - - - - - - 166.0625 20 16 RNF214 ring finger protein 214 621 79 B20140220_SF056_06 B20140220_SF056_06 TB317361.[MT7]-ERYQEVLDK[MT7].3b3_1.heavy 489.94 / 593.316 3397.0 24.751800537109375 37 13 10 10 4 2.8601536604867173 34.96315648404108 0.0 7 0.9164125517922082 4.238568920277586 3397.0 5.855558758177043 4.0 - - - - - - - 727.9285714285714 27 14 RNF214 ring finger protein 214 623 80 B20140220_SF056_06 B20140220_SF056_06 TB317366.[MT7]-ASDC[CAM]GLAPHRPR.3b6_1.heavy 494.257 / 748.342 3952.0 17.369149684906006 33 12 10 3 8 1.3770488411153998 62.92780779403962 0.06739997863769531 4 0.8970792312847614 3.813411622965775 3952.0 13.736023675006724 0.0 - - - - - - - 143.33333333333334 7 21 SH2D5 SH2 domain containing 5 625 80 B20140220_SF056_06 B20140220_SF056_06 TB317366.[MT7]-ASDC[CAM]GLAPHRPR.3b5_1.heavy 494.257 / 635.258 7268.0 17.369149684906006 33 12 10 3 8 1.3770488411153998 62.92780779403962 0.06739997863769531 4 0.8970792312847614 3.813411622965775 7268.0 37.87208420051139 0.0 - - - - - - - 156.5 14 22 SH2D5 SH2 domain containing 5 627 80 B20140220_SF056_06 B20140220_SF056_06 TB317366.[MT7]-ASDC[CAM]GLAPHRPR.3y9_2.heavy 494.257 / 532.282 5359.0 17.369149684906006 33 12 10 3 8 1.3770488411153998 62.92780779403962 0.06739997863769531 4 0.8970792312847614 3.813411622965775 5359.0 27.99477611940298 1.0 - - - - - - - 277.5882352941176 14 17 SH2D5 SH2 domain containing 5 629 80 B20140220_SF056_06 B20140220_SF056_06 TB317366.[MT7]-ASDC[CAM]GLAPHRPR.3y5_1.heavy 494.257 / 662.385 4120.0 17.369149684906006 33 12 10 3 8 1.3770488411153998 62.92780779403962 0.06739997863769531 4 0.8970792312847614 3.813411622965775 4120.0 0.8199004975124377 1.0 - - - - - - - 203.65217391304347 8 23 SH2D5 SH2 domain containing 5 631 81 B20140220_SF056_06 B20140220_SF056_06 TB317618.[MT7]-SWFVQSVIAQC[CAM]LVQLSSAR.3y7_1.heavy 775.083 / 760.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2CBP ubiquitin-conjugating enzyme E2C binding protein 633 81 B20140220_SF056_06 B20140220_SF056_06 TB317618.[MT7]-SWFVQSVIAQC[CAM]LVQLSSAR.3b4_1.heavy 775.083 / 664.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2CBP ubiquitin-conjugating enzyme E2C binding protein 635 81 B20140220_SF056_06 B20140220_SF056_06 TB317618.[MT7]-SWFVQSVIAQC[CAM]LVQLSSAR.3b3_1.heavy 775.083 / 565.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2CBP ubiquitin-conjugating enzyme E2C binding protein 637 81 B20140220_SF056_06 B20140220_SF056_06 TB317618.[MT7]-SWFVQSVIAQC[CAM]LVQLSSAR.3y9_1.heavy 775.083 / 1033.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2CBP ubiquitin-conjugating enzyme E2C binding protein 639 82 B20140220_SF056_06 B20140220_SF056_06 TB317613.[MT7]-HSVDGESLSSELQQLGLPK[MT7].4y4_1.heavy 578.814 / 558.373 74005.0 38.567501068115234 37 7 10 10 10 0.6472002920696756 80.61542307955816 0.0 3 0.744874857350166 2.3893921263761975 74005.0 29.753708750346888 0.0 - - - - - - - 1226.0 148 3 COMMD4 COMM domain containing 4 641 82 B20140220_SF056_06 B20140220_SF056_06 TB317613.[MT7]-HSVDGESLSSELQQLGLPK[MT7].4b7_1.heavy 578.814 / 856.392 17473.0 38.567501068115234 37 7 10 10 10 0.6472002920696756 80.61542307955816 0.0 3 0.744874857350166 2.3893921263761975 17473.0 77.26184143988289 0.0 - - - - - - - 624.3 34 10 COMMD4 COMM domain containing 4 643 82 B20140220_SF056_06 B20140220_SF056_06 TB317613.[MT7]-HSVDGESLSSELQQLGLPK[MT7].4b4_1.heavy 578.814 / 583.296 24152.0 38.567501068115234 37 7 10 10 10 0.6472002920696756 80.61542307955816 0.0 3 0.744874857350166 2.3893921263761975 24152.0 40.75234159779614 0.0 - - - - - - - 754.3333333333334 48 12 COMMD4 COMM domain containing 4 645 82 B20140220_SF056_06 B20140220_SF056_06 TB317613.[MT7]-HSVDGESLSSELQQLGLPK[MT7].4b6_1.heavy 578.814 / 769.36 21200.0 38.567501068115234 37 7 10 10 10 0.6472002920696756 80.61542307955816 0.0 3 0.744874857350166 2.3893921263761975 21200.0 65.70247933884298 0.0 - - - - - - - 774.4285714285714 42 7 COMMD4 COMM domain containing 4 647 83 B20140220_SF056_06 B20140220_SF056_06 TB317612.[MT7]-LFLDFLEEFQSSDGEIK[MT7].2y4_1.heavy 1153.1 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 649 83 B20140220_SF056_06 B20140220_SF056_06 TB317612.[MT7]-LFLDFLEEFQSSDGEIK[MT7].2b4_1.heavy 1153.1 / 633.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 651 83 B20140220_SF056_06 B20140220_SF056_06 TB317612.[MT7]-LFLDFLEEFQSSDGEIK[MT7].2b5_1.heavy 1153.1 / 780.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 653 84 B20140220_SF056_06 B20140220_SF056_06 TB470207.[MT7]-TWMWWHNFR.3y6_1.heavy 503.244 / 945.448 9666.0 39.18119812011719 50 20 10 10 10 8.39415934180681 11.913045241106346 0.0 3 0.9941993693252741 16.196255038605457 9666.0 79.41445520581115 0.0 - - - - - - - 138.83333333333334 19 18 PRMT5 protein arginine methyltransferase 5 655 84 B20140220_SF056_06 B20140220_SF056_06 TB470207.[MT7]-TWMWWHNFR.3b3_1.heavy 503.244 / 563.277 64034.0 39.18119812011719 50 20 10 10 10 8.39415934180681 11.913045241106346 0.0 3 0.9941993693252741 16.196255038605457 64034.0 75.62501678113038 0.0 - - - - - - - 1226.125 128 8 PRMT5 protein arginine methyltransferase 5 657 84 B20140220_SF056_06 B20140220_SF056_06 TB470207.[MT7]-TWMWWHNFR.3y4_1.heavy 503.244 / 573.289 109396.0 39.18119812011719 50 20 10 10 10 8.39415934180681 11.913045241106346 0.0 3 0.9941993693252741 16.196255038605457 109396.0 93.93031082564212 0.0 - - - - - - - 697.9 218 10 PRMT5 protein arginine methyltransferase 5 659 84 B20140220_SF056_06 B20140220_SF056_06 TB470207.[MT7]-TWMWWHNFR.3y5_1.heavy 503.244 / 759.369 38336.0 39.18119812011719 50 20 10 10 10 8.39415934180681 11.913045241106346 0.0 3 0.9941993693252741 16.196255038605457 38336.0 89.67460934811277 0.0 - - - - - - - 639.1111111111111 76 9 PRMT5 protein arginine methyltransferase 5 661 85 B20140220_SF056_06 B20140220_SF056_06 TB470306.[MT7]-IHVLPSLNPDGYEK[MT7].3y6_1.heavy 624.015 / 852.422 6864.0 33.21950149536133 45 15 10 10 10 1.8528688594614313 37.798637032968074 0.0 3 0.9539182974563337 5.7268536893928115 6864.0 41.10277559981182 0.0 - - - - - - - 207.2941176470588 13 17 CPXM2 carboxypeptidase X (M14 family), member 2 663 85 B20140220_SF056_06 B20140220_SF056_06 TB470306.[MT7]-IHVLPSLNPDGYEK[MT7].3b4_1.heavy 624.015 / 607.405 9416.0 33.21950149536133 45 15 10 10 10 1.8528688594614313 37.798637032968074 0.0 3 0.9539182974563337 5.7268536893928115 9416.0 14.316229526067485 0.0 - - - - - - - 809.9166666666666 18 12 CPXM2 carboxypeptidase X (M14 family), member 2 665 85 B20140220_SF056_06 B20140220_SF056_06 TB470306.[MT7]-IHVLPSLNPDGYEK[MT7].3y4_1.heavy 624.015 / 640.342 6135.0 33.21950149536133 45 15 10 10 10 1.8528688594614313 37.798637032968074 0.0 3 0.9539182974563337 5.7268536893928115 6135.0 14.24755858705306 0.0 - - - - - - - 713.75 12 8 CPXM2 carboxypeptidase X (M14 family), member 2 667 85 B20140220_SF056_06 B20140220_SF056_06 TB470306.[MT7]-IHVLPSLNPDGYEK[MT7].3y5_1.heavy 624.015 / 755.369 3220.0 33.21950149536133 45 15 10 10 10 1.8528688594614313 37.798637032968074 0.0 3 0.9539182974563337 5.7268536893928115 3220.0 8.507628842194487 0.0 - - - - - - - 703.6666666666666 6 12 CPXM2 carboxypeptidase X (M14 family), member 2 669 86 B20140220_SF056_06 B20140220_SF056_06 TB470201.[MT7]-ASGPPVSELITK[MT7].3b6_1.heavy 496.295 / 653.374 22182.0 31.95639991760254 46 18 10 10 8 6.142050289741014 16.281208274544525 0.0 4 0.9849997695115232 10.063962920910374 22182.0 17.33825196616312 1.0 - - - - - - - 447.0 52 1 HIST1H1C;HIST1H1D;HIST1H1E histone cluster 1, H1c;histone cluster 1, H1d;histone cluster 1, H1e 671 86 B20140220_SF056_06 B20140220_SF056_06 TB470201.[MT7]-ASGPPVSELITK[MT7].3y3_1.heavy 496.295 / 505.347 67441.0 31.95639991760254 46 18 10 10 8 6.142050289741014 16.281208274544525 0.0 4 0.9849997695115232 10.063962920910374 67441.0 21.20802661707258 1.0 - - - - - - - 895.0 134 1 HIST1H1C;HIST1H1D;HIST1H1E histone cluster 1, H1c;histone cluster 1, H1d;histone cluster 1, H1e 673 86 B20140220_SF056_06 B20140220_SF056_06 TB470201.[MT7]-ASGPPVSELITK[MT7].3y4_1.heavy 496.295 / 618.431 N/A 31.95639991760254 46 18 10 10 8 6.142050289741014 16.281208274544525 0.0 4 0.9849997695115232 10.063962920910374 21607.0 0.5812981734971584 2.0 - - - - - - - 703.0 113 1 HIST1H1C;HIST1H1D;HIST1H1E histone cluster 1, H1c;histone cluster 1, H1d;histone cluster 1, H1e 675 86 B20140220_SF056_06 B20140220_SF056_06 TB470201.[MT7]-ASGPPVSELITK[MT7].3b8_1.heavy 496.295 / 869.448 21031.0 31.95639991760254 46 18 10 10 8 6.142050289741014 16.281208274544525 0.0 4 0.9849997695115232 10.063962920910374 21031.0 9.778869680220707 1.0 - - - - - - - 693.8571428571429 42 7 HIST1H1C;HIST1H1D;HIST1H1E histone cluster 1, H1c;histone cluster 1, H1d;histone cluster 1, H1e 677 87 B20140220_SF056_06 B20140220_SF056_06 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 587548.0 33.948299407958984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 587548.0 185.5394511323554 0.0 - - - - - - - 904.5 1175 2 679 87 B20140220_SF056_06 B20140220_SF056_06 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 146277.0 33.948299407958984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 146277.0 194.88761073702398 0.0 - - - - - - - 1297.2222222222222 292 9 681 87 B20140220_SF056_06 B20140220_SF056_06 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 213521.0 33.948299407958984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 213521.0 303.3732075812274 0.0 - - - - - - - 1317.5714285714287 427 7 683 88 B20140220_SF056_06 B20140220_SF056_06 TB470305.[MT7]-K[MT7]FC[CAM]AQPWEEIK[MT7].3y6_1.heavy 623.342 / 945.516 11022.0 32.07569885253906 50 20 10 10 10 17.29197059294826 5.78303088491143 0.0 3 0.9945337591998302 16.684759910297913 11022.0 127.19717014925372 0.0 - - - - - - - 169.26666666666668 22 15 ENTPD1 ectonucleoside triphosphate diphosphohydrolase 1 685 88 B20140220_SF056_06 B20140220_SF056_06 TB470305.[MT7]-K[MT7]FC[CAM]AQPWEEIK[MT7].3b5_1.heavy 623.342 / 923.501 13426.0 32.07569885253906 50 20 10 10 10 17.29197059294826 5.78303088491143 0.0 3 0.9945337591998302 16.684759910297913 13426.0 90.21744482714632 0.0 - - - - - - - 236.13333333333333 26 15 ENTPD1 ectonucleoside triphosphate diphosphohydrolase 1 687 88 B20140220_SF056_06 B20140220_SF056_06 TB470305.[MT7]-K[MT7]FC[CAM]AQPWEEIK[MT7].3y4_1.heavy 623.342 / 662.384 13760.0 32.07569885253906 50 20 10 10 10 17.29197059294826 5.78303088491143 0.0 3 0.9945337591998302 16.684759910297913 13760.0 20.110208453238094 0.0 - - - - - - - 262.0769230769231 27 13 ENTPD1 ectonucleoside triphosphate diphosphohydrolase 1 689 88 B20140220_SF056_06 B20140220_SF056_06 TB470305.[MT7]-K[MT7]FC[CAM]AQPWEEIK[MT7].3y5_1.heavy 623.342 / 848.463 6546.0 32.07569885253906 50 20 10 10 10 17.29197059294826 5.78303088491143 0.0 3 0.9945337591998302 16.684759910297913 6546.0 11.434102020557813 0.0 - - - - - - - 228.0 13 17 ENTPD1 ectonucleoside triphosphate diphosphohydrolase 1 691 89 B20140220_SF056_06 B20140220_SF056_06 TB470199.[MT7]-EIDLVNRDPK[MT7].2b8_1.heavy 743.927 / 1099.59 21117.0 25.758999347686768 38 12 10 6 10 1.185326983550391 58.106465780822795 0.03999900817871094 3 0.8923174477121217 3.72660389832585 21117.0 280.72190728637975 0.0 - - - - - - - 208.125 42 8 CAV1;CAV3 caveolin 1, caveolae protein, 22kDa;caveolin 3 693 89 B20140220_SF056_06 B20140220_SF056_06 TB470199.[MT7]-EIDLVNRDPK[MT7].2b3_1.heavy 743.927 / 502.263 2346.0 25.758999347686768 38 12 10 6 10 1.185326983550391 58.106465780822795 0.03999900817871094 3 0.8923174477121217 3.72660389832585 2346.0 20.176840862894238 0.0 - - - - - - - 186.30769230769232 4 13 CAV1;CAV3 caveolin 1, caveolae protein, 22kDa;caveolin 3 695 89 B20140220_SF056_06 B20140220_SF056_06 TB470199.[MT7]-EIDLVNRDPK[MT7].2y9_1.heavy 743.927 / 1213.7 681.0 25.758999347686768 38 12 10 6 10 1.185326983550391 58.106465780822795 0.03999900817871094 3 0.8923174477121217 3.72660389832585 681.0 9.625024752475248 1.0 - - - - - - - 0.0 1 0 CAV1;CAV3 caveolin 1, caveolae protein, 22kDa;caveolin 3 697 89 B20140220_SF056_06 B20140220_SF056_06 TB470199.[MT7]-EIDLVNRDPK[MT7].2y7_1.heavy 743.927 / 985.591 2498.0 25.758999347686768 38 12 10 6 10 1.185326983550391 58.106465780822795 0.03999900817871094 3 0.8923174477121217 3.72660389832585 2498.0 29.028692924363888 0.0 - - - - - - - 109.44444444444444 4 9 CAV1;CAV3 caveolin 1, caveolae protein, 22kDa;caveolin 3 699 90 B20140220_SF056_06 B20140220_SF056_06 TB470450.[MT7]-LQDEYDSVLYSIVDLHSITVPQDPAVLR.4y5_1.heavy 833.19 / 555.361 15585.0 48.232601165771484 45 15 10 10 10 2.293169380086047 43.60776873631885 0.0 3 0.9567820588250386 5.9149854500613 15585.0 129.875 0.0 - - - - - - - 180.22222222222223 31 18 WARS2 tryptophanyl tRNA synthetase 2, mitochondrial 701 90 B20140220_SF056_06 B20140220_SF056_06 TB470450.[MT7]-LQDEYDSVLYSIVDLHSITVPQDPAVLR.4y8_1.heavy 833.19 / 895.5 10823.0 48.232601165771484 45 15 10 10 10 2.293169380086047 43.60776873631885 0.0 3 0.9567820588250386 5.9149854500613 10823.0 139.67745194156095 0.0 - - - - - - - 189.0 21 25 WARS2 tryptophanyl tRNA synthetase 2, mitochondrial 703 90 B20140220_SF056_06 B20140220_SF056_06 TB470450.[MT7]-LQDEYDSVLYSIVDLHSITVPQDPAVLR.4b4_1.heavy 833.19 / 630.321 3680.0 48.232601165771484 45 15 10 10 10 2.293169380086047 43.60776873631885 0.0 3 0.9567820588250386 5.9149854500613 3680.0 25.750564102564105 0.0 - - - - - - - 178.83333333333334 7 24 WARS2 tryptophanyl tRNA synthetase 2, mitochondrial 705 90 B20140220_SF056_06 B20140220_SF056_06 TB470450.[MT7]-LQDEYDSVLYSIVDLHSITVPQDPAVLR.4b3_1.heavy 833.19 / 501.279 2670.0 48.232601165771484 45 15 10 10 10 2.293169380086047 43.60776873631885 0.0 3 0.9567820588250386 5.9149854500613 2670.0 29.666666666666664 0.0 - - - - - - - 150.20833333333334 5 24 WARS2 tryptophanyl tRNA synthetase 2, mitochondrial 707 91 B20140220_SF056_06 B20140220_SF056_06 TB470185.[MT7]-LNFELTDALK[MT7].3b4_1.heavy 484.616 / 648.347 208623.0 39.59080123901367 48 18 10 10 10 2.6493744864380333 29.51774138717826 0.0 3 0.9865337915531132 10.623096763143474 208623.0 308.5126293062727 0.0 - - - - - - - 717.0 417 8 CPT2 carnitine palmitoyltransferase 2 709 91 B20140220_SF056_06 B20140220_SF056_06 TB470185.[MT7]-LNFELTDALK[MT7].3b5_1.heavy 484.616 / 761.431 48404.0 39.59080123901367 48 18 10 10 10 2.6493744864380333 29.51774138717826 0.0 3 0.9865337915531132 10.623096763143474 48404.0 207.48525788355755 0.0 - - - - - - - 139.10526315789474 96 19 CPT2 carnitine palmitoyltransferase 2 711 91 B20140220_SF056_06 B20140220_SF056_06 TB470185.[MT7]-LNFELTDALK[MT7].3y4_1.heavy 484.616 / 590.363 110393.0 39.59080123901367 48 18 10 10 10 2.6493744864380333 29.51774138717826 0.0 3 0.9865337915531132 10.623096763143474 110393.0 193.38920957929645 0.0 - - - - - - - 696.625 220 8 CPT2 carnitine palmitoyltransferase 2 713 91 B20140220_SF056_06 B20140220_SF056_06 TB470185.[MT7]-LNFELTDALK[MT7].3b3_1.heavy 484.616 / 519.305 98515.0 39.59080123901367 48 18 10 10 10 2.6493744864380333 29.51774138717826 0.0 3 0.9865337915531132 10.623096763143474 98515.0 87.9684477356405 0.0 - - - - - - - 1224.888888888889 197 9 CPT2 carnitine palmitoyltransferase 2 715 92 B20140220_SF056_06 B20140220_SF056_06 TB470184.[MT7]-K[MT7]LAETLGRK[MT7].3y7_1.heavy 483.316 / 918.549 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMS1 LIM and senescent cell antigen-like domains 1 717 92 B20140220_SF056_06 B20140220_SF056_06 TB470184.[MT7]-K[MT7]LAETLGRK[MT7].3b4_1.heavy 483.316 / 730.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMS1 LIM and senescent cell antigen-like domains 1 719 92 B20140220_SF056_06 B20140220_SF056_06 TB470184.[MT7]-K[MT7]LAETLGRK[MT7].3b3_1.heavy 483.316 / 601.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMS1 LIM and senescent cell antigen-like domains 1 721 92 B20140220_SF056_06 B20140220_SF056_06 TB470184.[MT7]-K[MT7]LAETLGRK[MT7].3y8_1.heavy 483.316 / 1031.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMS1 LIM and senescent cell antigen-like domains 1 723 93 B20140220_SF056_06 B20140220_SF056_06 TB317748.[MT7]-THWLGAALSLIPLIFLISGAEAASFQRNQLLQK[MT7].4b7_1.heavy 974.56 / 881.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCG2 secretogranin II 725 93 B20140220_SF056_06 B20140220_SF056_06 TB317748.[MT7]-THWLGAALSLIPLIFLISGAEAASFQRNQLLQK[MT7].4b4_1.heavy 974.56 / 682.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCG2 secretogranin II 727 93 B20140220_SF056_06 B20140220_SF056_06 TB317748.[MT7]-THWLGAALSLIPLIFLISGAEAASFQRNQLLQK[MT7].4y17_2.heavy 974.56 / 1003.05 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCG2 secretogranin II 729 93 B20140220_SF056_06 B20140220_SF056_06 TB317748.[MT7]-THWLGAALSLIPLIFLISGAEAASFQRNQLLQK[MT7].4y3_1.heavy 974.56 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCG2 secretogranin II 731 94 B20140220_SF056_06 B20140220_SF056_06 TB317644.[MT7]-ILMALLEVLSGRNLLHEYK[MT7].4y4_1.heavy 625.87 / 720.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLMN calmin (calponin-like, transmembrane) 733 94 B20140220_SF056_06 B20140220_SF056_06 TB317644.[MT7]-ILMALLEVLSGRNLLHEYK[MT7].4b4_1.heavy 625.87 / 573.355 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLMN calmin (calponin-like, transmembrane) 735 94 B20140220_SF056_06 B20140220_SF056_06 TB317644.[MT7]-ILMALLEVLSGRNLLHEYK[MT7].4b5_1.heavy 625.87 / 686.439 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLMN calmin (calponin-like, transmembrane) 737 94 B20140220_SF056_06 B20140220_SF056_06 TB317644.[MT7]-ILMALLEVLSGRNLLHEYK[MT7].4b3_1.heavy 625.87 / 502.318 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLMN calmin (calponin-like, transmembrane) 739 95 B20140220_SF056_06 B20140220_SF056_06 TB470314.[MT7]-VYTAQNPSAQALGLGK[MT7].3b6_1.heavy 636.026 / 821.427 112102.0 30.624300003051758 44 14 10 10 10 2.9409682619408444 34.002407062362046 0.0 3 0.9326237130110752 4.727588977824302 112102.0 64.71602563227646 0.0 - - - - - - - 254.6153846153846 224 13 PLAT plasminogen activator, tissue 741 95 B20140220_SF056_06 B20140220_SF056_06 TB470314.[MT7]-VYTAQNPSAQALGLGK[MT7].3b5_1.heavy 636.026 / 707.385 71205.0 30.624300003051758 44 14 10 10 10 2.9409682619408444 34.002407062362046 0.0 3 0.9326237130110752 4.727588977824302 71205.0 335.9741647260111 0.0 - - - - - - - 236.5 142 14 PLAT plasminogen activator, tissue 743 95 B20140220_SF056_06 B20140220_SF056_06 TB470314.[MT7]-VYTAQNPSAQALGLGK[MT7].3y4_1.heavy 636.026 / 518.342 246438.0 30.624300003051758 44 14 10 10 10 2.9409682619408444 34.002407062362046 0.0 3 0.9326237130110752 4.727588977824302 246438.0 1201.4798674857393 0.0 - - - - - - - 323.6666666666667 492 9 PLAT plasminogen activator, tissue 745 95 B20140220_SF056_06 B20140220_SF056_06 TB470314.[MT7]-VYTAQNPSAQALGLGK[MT7].3y5_1.heavy 636.026 / 631.426 97874.0 30.624300003051758 44 14 10 10 10 2.9409682619408444 34.002407062362046 0.0 3 0.9326237130110752 4.727588977824302 97874.0 85.10495547760388 0.0 - - - - - - - 744.375 195 8 PLAT plasminogen activator, tissue 747 96 B20140220_SF056_06 B20140220_SF056_06 TB317647.[MT7]-SVEQTLLPLVSQITTLINHK[MT7].4b4_1.heavy 631.375 / 588.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 749 96 B20140220_SF056_06 B20140220_SF056_06 TB317647.[MT7]-SVEQTLLPLVSQITTLINHK[MT7].4b5_1.heavy 631.375 / 689.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 751 96 B20140220_SF056_06 B20140220_SF056_06 TB317647.[MT7]-SVEQTLLPLVSQITTLINHK[MT7].4y7_1.heavy 631.375 / 970.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 753 96 B20140220_SF056_06 B20140220_SF056_06 TB317647.[MT7]-SVEQTLLPLVSQITTLINHK[MT7].4b6_1.heavy 631.375 / 802.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 755 97 B20140220_SF056_06 B20140220_SF056_06 TB470186.[MT7]-FVLALLDLFDSEDPRER.3b7_1.heavy 727.055 / 916.562 693.0 50.06740188598633 47 17 10 10 10 3.5972373003619373 27.79911127629486 0.0 3 0.9761862211739449 7.981464289851027 693.0 4.985611510791367 0.0 - - - - - - - 0.0 1 0 PPP2R5D protein phosphatase 2, regulatory subunit B', delta 757 97 B20140220_SF056_06 B20140220_SF056_06 TB470186.[MT7]-FVLALLDLFDSEDPRER.3b4_1.heavy 727.055 / 575.367 901.0 50.06740188598633 47 17 10 10 10 3.5972373003619373 27.79911127629486 0.0 3 0.9761862211739449 7.981464289851027 901.0 9.723021582733812 0.0 - - - - - - - 0.0 1 0 PPP2R5D protein phosphatase 2, regulatory subunit B', delta 759 97 B20140220_SF056_06 B20140220_SF056_06 TB470186.[MT7]-FVLALLDLFDSEDPRER.3y4_1.heavy 727.055 / 557.315 2356.0 50.06740188598633 47 17 10 10 10 3.5972373003619373 27.79911127629486 0.0 3 0.9761862211739449 7.981464289851027 2356.0 13.60884162235429 0.0 - - - - - - - 119.54545454545455 4 11 PPP2R5D protein phosphatase 2, regulatory subunit B', delta 761 97 B20140220_SF056_06 B20140220_SF056_06 TB470186.[MT7]-FVLALLDLFDSEDPRER.3b3_1.heavy 727.055 / 504.33 1039.0 50.06740188598633 47 17 10 10 10 3.5972373003619373 27.79911127629486 0.0 3 0.9761862211739449 7.981464289851027 1039.0 2.2505415162454874 0.0 - - - - - - - 126.0 2 11 PPP2R5D protein phosphatase 2, regulatory subunit B', delta 763 98 B20140220_SF056_06 B20140220_SF056_06 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 293409.0 22.40130043029785 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 293409.0 254.68594912302126 0.0 - - - - - - - 734.1176470588235 586 17 765 98 B20140220_SF056_06 B20140220_SF056_06 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 493398.0 22.40130043029785 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 493398.0 815.7846568335733 0.0 - - - - - - - 318.8 986 20 767 98 B20140220_SF056_06 B20140220_SF056_06 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 1853360.0 22.40130043029785 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1853360.0 3754.529991640799 0.0 - - - - - - - 1114.2857142857142 3706 7 769 99 B20140220_SF056_06 B20140220_SF056_06 TB317741.[MT7]-TLAC[CAM]LLLLGC[CAM]GYLAHVLAEEAEIPREVIER.4b5_1.heavy 888.981 / 703.393 1508.0 50.06740188598633 41 11 10 10 10 0.8278619730768758 73.88275077828479 0.0 3 0.8619541218260547 3.2826389607497646 1508.0 13.796210330530476 0.0 - - - - - - - 131.25 3 8 PDGFA platelet-derived growth factor alpha polypeptide 771 99 B20140220_SF056_06 B20140220_SF056_06 TB317741.[MT7]-TLAC[CAM]LLLLGC[CAM]GYLAHVLAEEAEIPREVIER.4b7_1.heavy 888.981 / 929.561 2295.0 50.06740188598633 41 11 10 10 10 0.8278619730768758 73.88275077828479 0.0 3 0.8619541218260547 3.2826389607497646 2295.0 11.614443931702814 0.0 - - - - - - - 131.5 4 6 PDGFA platelet-derived growth factor alpha polypeptide 773 99 B20140220_SF056_06 B20140220_SF056_06 TB317741.[MT7]-TLAC[CAM]LLLLGC[CAM]GYLAHVLAEEAEIPREVIER.4b6_1.heavy 888.981 / 816.477 1574.0 50.06740188598633 41 11 10 10 10 0.8278619730768758 73.88275077828479 0.0 3 0.8619541218260547 3.2826389607497646 1574.0 5.59899252140892 0.0 - - - - - - - 161.0909090909091 3 11 PDGFA platelet-derived growth factor alpha polypeptide 775 99 B20140220_SF056_06 B20140220_SF056_06 TB317741.[MT7]-TLAC[CAM]LLLLGC[CAM]GYLAHVLAEEAEIPREVIER.4b4_1.heavy 888.981 / 590.309 2623.0 50.06740188598633 41 11 10 10 10 0.8278619730768758 73.88275077828479 0.0 3 0.8619541218260547 3.2826389607497646 2623.0 27.431374045801522 0.0 - - - - - - - 153.08333333333334 5 12 PDGFA platelet-derived growth factor alpha polypeptide 777 100 B20140220_SF056_06 B20140220_SF056_06 TB317341.[MT7]-QDLTTLDVTK[MT7].2y4_1.heavy 711.408 / 606.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa 779 100 B20140220_SF056_06 B20140220_SF056_06 TB317341.[MT7]-QDLTTLDVTK[MT7].2b3_1.heavy 711.408 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa 781 100 B20140220_SF056_06 B20140220_SF056_06 TB317341.[MT7]-QDLTTLDVTK[MT7].2b7_1.heavy 711.408 / 931.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa 783 100 B20140220_SF056_06 B20140220_SF056_06 TB317341.[MT7]-QDLTTLDVTK[MT7].2y7_1.heavy 711.408 / 921.537 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa 785 101 B20140220_SF056_06 B20140220_SF056_06 TB470170.[MT7]-EAHFHSLQHR.3y6_1.heavy 469.245 / 777.411 3381.0 16.66119956970215 50 20 10 10 10 39.20911298670485 2.5504274996965197 0.0 3 0.9962840850294604 20.239273106288405 3381.0 14.55353192365077 0.0 - - - - - - - 174.33333333333334 6 30 FAM104A family with sequence similarity 104, member A 787 101 B20140220_SF056_06 B20140220_SF056_06 TB470170.[MT7]-EAHFHSLQHR.3y4_1.heavy 469.245 / 553.32 5332.0 16.66119956970215 50 20 10 10 10 39.20911298670485 2.5504274996965197 0.0 3 0.9962840850294604 20.239273106288405 5332.0 41.16402372062377 0.0 - - - - - - - 208.06896551724137 10 29 FAM104A family with sequence similarity 104, member A 789 101 B20140220_SF056_06 B20140220_SF056_06 TB470170.[MT7]-EAHFHSLQHR.3b3_1.heavy 469.245 / 482.248 12512.0 16.66119956970215 50 20 10 10 10 39.20911298670485 2.5504274996965197 0.0 3 0.9962840850294604 20.239273106288405 12512.0 27.691963214714114 0.0 - - - - - - - 172.7391304347826 25 23 FAM104A family with sequence similarity 104, member A 791 101 B20140220_SF056_06 B20140220_SF056_06 TB470170.[MT7]-EAHFHSLQHR.3y5_1.heavy 469.245 / 640.352 21468.0 16.66119956970215 50 20 10 10 10 39.20911298670485 2.5504274996965197 0.0 3 0.9962840850294604 20.239273106288405 21468.0 154.2001099757137 0.0 - - - - - - - 167.32 42 25 FAM104A family with sequence similarity 104, member A 793 102 B20140220_SF056_06 B20140220_SF056_06 TB317739.[MT7]-QAGETIAALTDITNLNHLESDGQITIFTDK[MT7].4b8_1.heavy 880.212 / 886.475 14075.0 44.97420120239258 38 8 10 10 10 0.9735557417088521 65.03318273732323 0.0 3 0.7589873083536391 2.4615386060683515 14075.0 21.65965446617336 0.0 - - - - - - - 757.8333333333334 28 12 CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 795 102 B20140220_SF056_06 B20140220_SF056_06 TB317739.[MT7]-QAGETIAALTDITNLNHLESDGQITIFTDK[MT7].4y4_1.heavy 880.212 / 654.358 37061.0 44.97420120239258 38 8 10 10 10 0.9735557417088521 65.03318273732323 0.0 3 0.7589873083536391 2.4615386060683515 37061.0 61.29074312714776 0.0 - - - - - - - 774.2857142857143 74 7 CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 797 102 B20140220_SF056_06 B20140220_SF056_06 TB317739.[MT7]-QAGETIAALTDITNLNHLESDGQITIFTDK[MT7].4b7_1.heavy 880.212 / 815.438 11275.0 44.97420120239258 38 8 10 10 10 0.9735557417088521 65.03318273732323 0.0 3 0.7589873083536391 2.4615386060683515 11275.0 17.304649154126245 0.0 - - - - - - - 780.1818181818181 22 11 CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 799 102 B20140220_SF056_06 B20140220_SF056_06 TB317739.[MT7]-QAGETIAALTDITNLNHLESDGQITIFTDK[MT7].4b5_1.heavy 880.212 / 631.317 8874.0 44.97420120239258 38 8 10 10 10 0.9735557417088521 65.03318273732323 0.0 3 0.7589873083536391 2.4615386060683515 8874.0 19.41507916093535 0.0 - - - - - - - 699.1111111111111 17 9 CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 801 103 B20140220_SF056_06 B20140220_SF056_06 TB470075.[MT7]-SYQGC[CAM]SEPR.2y6_1.heavy 614.281 / 705.299 1791.0 16.232174396514893 46 20 10 6 10 15.217928710069081 6.57119650809207 0.030500411987304688 3 0.9951025922020045 17.627950937396882 1791.0 27.716698369565215 0.0 - - - - - - - 160.61111111111111 3 18 PLAT plasminogen activator, tissue 803 103 B20140220_SF056_06 B20140220_SF056_06 TB470075.[MT7]-SYQGC[CAM]SEPR.2b3_1.heavy 614.281 / 523.263 1309.0 16.232174396514893 46 20 10 6 10 15.217928710069081 6.57119650809207 0.030500411987304688 3 0.9951025922020045 17.627950937396882 1309.0 9.959782608695653 0.0 - - - - - - - 183.05263157894737 2 19 PLAT plasminogen activator, tissue 805 103 B20140220_SF056_06 B20140220_SF056_06 TB470075.[MT7]-SYQGC[CAM]SEPR.2y8_1.heavy 614.281 / 996.42 2239.0 16.232174396514893 46 20 10 6 10 15.217928710069081 6.57119650809207 0.030500411987304688 3 0.9951025922020045 17.627950937396882 2239.0 35.505930652421235 0.0 - - - - - - - 114.66666666666667 4 15 PLAT plasminogen activator, tissue 807 103 B20140220_SF056_06 B20140220_SF056_06 TB470075.[MT7]-SYQGC[CAM]SEPR.2y7_1.heavy 614.281 / 833.357 1068.0 16.232174396514893 46 20 10 6 10 15.217928710069081 6.57119650809207 0.030500411987304688 3 0.9951025922020045 17.627950937396882 1068.0 21.740151670424265 1.0 - - - - - - - 105.46666666666667 2 15 PLAT plasminogen activator, tissue 809 104 B20140220_SF056_06 B20140220_SF056_06 TB317344.[MT7]-LC[CAM]YSSDHEK[MT7].3y3_1.heavy 476.234 / 557.316 11298.0 20.112549304962158 44 18 10 6 10 3.496630125185002 28.598964265546712 0.030599594116210938 3 0.9810159342917426 8.94289837333595 11298.0 20.047255756677195 0.0 - - - - - - - 678.5 22 10 GSTM3 glutathione S-transferase mu 3 (brain) 811 104 B20140220_SF056_06 B20140220_SF056_06 TB317344.[MT7]-LC[CAM]YSSDHEK[MT7].3b6_1.heavy 476.234 / 870.378 13246.0 20.112549304962158 44 18 10 6 10 3.496630125185002 28.598964265546712 0.030599594116210938 3 0.9810159342917426 8.94289837333595 13246.0 198.20784141741956 0.0 - - - - - - - 171.85 26 20 GSTM3 glutathione S-transferase mu 3 (brain) 813 104 B20140220_SF056_06 B20140220_SF056_06 TB317344.[MT7]-LC[CAM]YSSDHEK[MT7].3b3_1.heavy 476.234 / 581.287 7175.0 20.112549304962158 44 18 10 6 10 3.496630125185002 28.598964265546712 0.030599594116210938 3 0.9810159342917426 8.94289837333595 7175.0 25.954422819483064 0.0 - - - - - - - 695.3333333333334 14 12 GSTM3 glutathione S-transferase mu 3 (brain) 815 104 B20140220_SF056_06 B20140220_SF056_06 TB317344.[MT7]-LC[CAM]YSSDHEK[MT7].3y5_1.heavy 476.234 / 759.375 3376.0 20.112549304962158 44 18 10 6 10 3.496630125185002 28.598964265546712 0.030599594116210938 3 0.9810159342917426 8.94289837333595 3376.0 30.64369230769231 0.0 - - - - - - - 155.25 6 28 GSTM3 glutathione S-transferase mu 3 (brain) 817 105 B20140220_SF056_06 B20140220_SF056_06 TB470323.[MT7]-GTGRIPDQLVILDMK[MT7].4b8_1.heavy 486.785 / 969.523 12183.0 37.51029968261719 38 8 10 10 10 1.2021719003186309 83.182779412408 0.0 3 0.7974848112669273 2.694734034037962 12183.0 287.48815094339625 0.0 - - - - - - - 176.66666666666666 24 12 TMED10 transmembrane emp24-like trafficking protein 10 (yeast) 819 105 B20140220_SF056_06 B20140220_SF056_06 TB470323.[MT7]-GTGRIPDQLVILDMK[MT7].4b7_1.heavy 486.785 / 841.465 13508.0 37.51029968261719 38 8 10 10 10 1.2021719003186309 83.182779412408 0.0 3 0.7974848112669273 2.694734034037962 13508.0 170.76150943396226 0.0 - - - - - - - 203.6315789473684 27 19 TMED10 transmembrane emp24-like trafficking protein 10 (yeast) 821 105 B20140220_SF056_06 B20140220_SF056_06 TB470323.[MT7]-GTGRIPDQLVILDMK[MT7].4y3_1.heavy 486.785 / 537.282 176871.0 37.51029968261719 38 8 10 10 10 1.2021719003186309 83.182779412408 0.0 3 0.7974848112669273 2.694734034037962 176871.0 250.48828849372524 0.0 - - - - - - - 834.625 353 8 TMED10 transmembrane emp24-like trafficking protein 10 (yeast) 823 105 B20140220_SF056_06 B20140220_SF056_06 TB470323.[MT7]-GTGRIPDQLVILDMK[MT7].4b9_2.heavy 486.785 / 541.807 278100.0 37.51029968261719 38 8 10 10 10 1.2021719003186309 83.182779412408 0.0 3 0.7974848112669273 2.694734034037962 278100.0 603.9265233996466 0.0 - - - - - - - 753.5555555555555 556 9 TMED10 transmembrane emp24-like trafficking protein 10 (yeast) 825 106 B20140220_SF056_06 B20140220_SF056_06 TB317632.[MT7]-NVMFVFFQGETFDYIGSSR.3y6_1.heavy 796.72 / 682.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCSTN nicastrin 827 106 B20140220_SF056_06 B20140220_SF056_06 TB317632.[MT7]-NVMFVFFQGETFDYIGSSR.3y11_1.heavy 796.72 / 1231.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCSTN nicastrin 829 106 B20140220_SF056_06 B20140220_SF056_06 TB317632.[MT7]-NVMFVFFQGETFDYIGSSR.3b4_1.heavy 796.72 / 636.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCSTN nicastrin 831 106 B20140220_SF056_06 B20140220_SF056_06 TB317632.[MT7]-NVMFVFFQGETFDYIGSSR.3b5_1.heavy 796.72 / 735.398 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCSTN nicastrin 833 107 B20140220_SF056_06 B20140220_SF056_06 TB317634.[MT7]-LLRMESEELADRVLDVVER.4y5_1.heavy 604.83 / 617.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENTPD1 ectonucleoside triphosphate diphosphohydrolase 1 835 107 B20140220_SF056_06 B20140220_SF056_06 TB317634.[MT7]-LLRMESEELADRVLDVVER.4b15_2.heavy 604.83 / 958.007 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENTPD1 ectonucleoside triphosphate diphosphohydrolase 1 837 107 B20140220_SF056_06 B20140220_SF056_06 TB317634.[MT7]-LLRMESEELADRVLDVVER.4y7_1.heavy 604.83 / 829.478 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENTPD1 ectonucleoside triphosphate diphosphohydrolase 1 839 107 B20140220_SF056_06 B20140220_SF056_06 TB317634.[MT7]-LLRMESEELADRVLDVVER.4y6_1.heavy 604.83 / 730.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENTPD1 ectonucleoside triphosphate diphosphohydrolase 1 841 108 B20140220_SF056_06 B20140220_SF056_06 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 489849.0 31.431999842325848 23 -3 10 6 10 null 0.0 0.03750038146972656 3 0.0 0.0 489849.0 1239.9806674395713 0.0 - - - - - - - 256.7894736842105 979 19 843 108 B20140220_SF056_06 B20140220_SF056_06 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 492322.0 31.431999842325848 23 -3 10 6 10 null 0.0 0.03750038146972656 3 0.0 0.0 492322.0 1180.723797813807 0.0 - - - - - - - 250.75 984 16 845 108 B20140220_SF056_06 B20140220_SF056_06 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 847783.0 31.431999842325848 23 -3 10 6 10 null 0.0 0.03750038146972656 3 0.0 0.0 847783.0 1017.7418164821494 0.0 - - - - - - - 662.3636363636364 1695 11 847 109 B20140220_SF056_06 B20140220_SF056_06 TB317733.[MT7]-AFYRGYLPNVLGIIPYAGIDLAVYETLK[MT7].4b7_1.heavy 855.232 / 1015.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 849 109 B20140220_SF056_06 B20140220_SF056_06 TB317733.[MT7]-AFYRGYLPNVLGIIPYAGIDLAVYETLK[MT7].4b9_1.heavy 855.232 / 1226.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 851 109 B20140220_SF056_06 B20140220_SF056_06 TB317733.[MT7]-AFYRGYLPNVLGIIPYAGIDLAVYETLK[MT7].4b10_2.heavy 855.232 / 663.36 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 853 109 B20140220_SF056_06 B20140220_SF056_06 TB317733.[MT7]-AFYRGYLPNVLGIIPYAGIDLAVYETLK[MT7].4b9_2.heavy 855.232 / 613.826 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 855 110 B20140220_SF056_06 B20140220_SF056_06 TB317730.[MT7]-SALTIQFIQSYFVTDYDPTIEDSYTK[MT7].4y4_1.heavy 834.172 / 642.358 13449.0 48.0458984375 48 18 10 10 10 5.095012116198544 15.323819966227804 0.0 3 0.9884468216755727 11.470771258001898 13449.0 -4.590102389078499 0.0 - - - - - - - 260.1818181818182 26 11 RRAS2 related RAS viral (r-ras) oncogene homolog 2 857 110 B20140220_SF056_06 B20140220_SF056_06 TB317730.[MT7]-SALTIQFIQSYFVTDYDPTIEDSYTK[MT7].4b7_1.heavy 834.172 / 905.521 14138.0 48.0458984375 48 18 10 10 10 5.095012116198544 15.323819966227804 0.0 3 0.9884468216755727 11.470771258001898 14138.0 -7.935266604303087 0.0 - - - - - - - 261.4166666666667 28 12 RRAS2 related RAS viral (r-ras) oncogene homolog 2 859 110 B20140220_SF056_06 B20140220_SF056_06 TB317730.[MT7]-SALTIQFIQSYFVTDYDPTIEDSYTK[MT7].4b4_1.heavy 834.172 / 517.31 9655.0 48.0458984375 48 18 10 10 10 5.095012116198544 15.323819966227804 0.0 3 0.9884468216755727 11.470771258001898 9655.0 -1.1660628019323696 0.0 - - - - - - - 256.4375 19 16 RRAS2 related RAS viral (r-ras) oncogene homolog 2 861 110 B20140220_SF056_06 B20140220_SF056_06 TB317730.[MT7]-SALTIQFIQSYFVTDYDPTIEDSYTK[MT7].4b6_1.heavy 834.172 / 758.453 26897.0 48.0458984375 48 18 10 10 10 5.095012116198544 15.323819966227804 0.0 3 0.9884468216755727 11.470771258001898 26897.0 -1.5592463768115934 0.0 - - - - - - - 219.45454545454547 53 11 RRAS2 related RAS viral (r-ras) oncogene homolog 2 863 111 B20140220_SF056_06 B20140220_SF056_06 TB317731.[MT7]-NTLVVSFVDLEQFNQQLSTTIQEEFYR.4b5_1.heavy 848.934 / 671.421 1065.0 50.06740188598633 38 8 10 10 10 1.8946886848033595 42.73723280442575 0.0 3 0.7599549859098457 2.4667135328294982 1065.0 8.619702127659576 0.0 - - - - - - - 116.35714285714286 2 14 MCM6 minichromosome maintenance complex component 6 865 111 B20140220_SF056_06 B20140220_SF056_06 TB317731.[MT7]-NTLVVSFVDLEQFNQQLSTTIQEEFYR.4y7_1.heavy 848.934 / 984.479 564.0 50.06740188598633 38 8 10 10 10 1.8946886848033595 42.73723280442575 0.0 3 0.7599549859098457 2.4667135328294982 564.0 5.196670773162939 0.0 - - - - - - - 0.0 1 0 MCM6 minichromosome maintenance complex component 6 867 111 B20140220_SF056_06 B20140220_SF056_06 TB317731.[MT7]-NTLVVSFVDLEQFNQQLSTTIQEEFYR.4y6_1.heavy 848.934 / 871.394 1316.0 50.06740188598633 38 8 10 10 10 1.8946886848033595 42.73723280442575 0.0 3 0.7599549859098457 2.4667135328294982 1316.0 4.2 0.0 - - - - - - - 106.6 2 10 MCM6 minichromosome maintenance complex component 6 869 111 B20140220_SF056_06 B20140220_SF056_06 TB317731.[MT7]-NTLVVSFVDLEQFNQQLSTTIQEEFYR.4b4_1.heavy 848.934 / 572.352 564.0 50.06740188598633 38 8 10 10 10 1.8946886848033595 42.73723280442575 0.0 3 0.7599549859098457 2.4667135328294982 564.0 5.35104 1.0 - - - - - - - 0.0 1 0 MCM6 minichromosome maintenance complex component 6 871 112 B20140220_SF056_06 B20140220_SF056_06 TB317660.[MT7]-YFILPDSLPLDTLLVDVEPK[MT7].3b4_1.heavy 859.155 / 681.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNRPD1 small nuclear ribonucleoprotein D1 polypeptide 16kDa 873 112 B20140220_SF056_06 B20140220_SF056_06 TB317660.[MT7]-YFILPDSLPLDTLLVDVEPK[MT7].3b3_1.heavy 859.155 / 568.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNRPD1 small nuclear ribonucleoprotein D1 polypeptide 16kDa 875 112 B20140220_SF056_06 B20140220_SF056_06 TB317660.[MT7]-YFILPDSLPLDTLLVDVEPK[MT7].3b8_1.heavy 859.155 / 1093.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNRPD1 small nuclear ribonucleoprotein D1 polypeptide 16kDa 877 112 B20140220_SF056_06 B20140220_SF056_06 TB317660.[MT7]-YFILPDSLPLDTLLVDVEPK[MT7].3y5_1.heavy 859.155 / 731.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNRPD1 small nuclear ribonucleoprotein D1 polypeptide 16kDa 879 113 B20140220_SF056_06 B20140220_SF056_06 TB469833.[MT7]-VAELK[MT7].2b3_1.heavy 424.278 / 444.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMACHC;CDNF;BDP1;MKL1;TNIP3;ZNF830;CDC20 methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria;cerebral dopamine neurotrophic factor;B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB;megakaryoblastic leukemia (translocation) 1;TNFAIP3 interacting protein 3;zinc finger protein 830;cell division cycle 20 homolog (S. cerevisiae) 881 113 B20140220_SF056_06 B20140220_SF056_06 TB469833.[MT7]-VAELK[MT7].2y4_1.heavy 424.278 / 604.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMACHC;CDNF;BDP1;MKL1;TNIP3;ZNF830;CDC20 methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria;cerebral dopamine neurotrophic factor;B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB;megakaryoblastic leukemia (translocation) 1;TNFAIP3 interacting protein 3;zinc finger protein 830;cell division cycle 20 homolog (S. cerevisiae) 883 113 B20140220_SF056_06 B20140220_SF056_06 TB469833.[MT7]-VAELK[MT7].2b4_1.heavy 424.278 / 557.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMACHC;CDNF;BDP1;MKL1;TNIP3;ZNF830;CDC20 methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria;cerebral dopamine neurotrophic factor;B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB;megakaryoblastic leukemia (translocation) 1;TNFAIP3 interacting protein 3;zinc finger protein 830;cell division cycle 20 homolog (S. cerevisiae) 885 113 B20140220_SF056_06 B20140220_SF056_06 TB469833.[MT7]-VAELK[MT7].2y3_1.heavy 424.278 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMACHC;CDNF;BDP1;MKL1;TNIP3;ZNF830;CDC20 methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria;cerebral dopamine neurotrophic factor;B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB;megakaryoblastic leukemia (translocation) 1;TNFAIP3 interacting protein 3;zinc finger protein 830;cell division cycle 20 homolog (S. cerevisiae) 887 114 B20140220_SF056_06 B20140220_SF056_06 TB317667.[MT7]-DAFWC[CAM]RDFTAHTGYEVLLQR.4y5_1.heavy 658.074 / 628.414 32115.0 38.1953010559082 45 15 10 10 10 2.0607563097754773 34.23474015091874 0.0 3 0.9528243515882725 5.659539892172449 32115.0 51.68575551082766 0.0 - - - - - - - 733.8 64 15 PSTPIP1 proline-serine-threonine phosphatase interacting protein 1 889 114 B20140220_SF056_06 B20140220_SF056_06 TB317667.[MT7]-DAFWC[CAM]RDFTAHTGYEVLLQR.4y8_1.heavy 658.074 / 977.542 18835.0 38.1953010559082 45 15 10 10 10 2.0607563097754773 34.23474015091874 0.0 3 0.9528243515882725 5.659539892172449 18835.0 44.890344796888854 0.0 - - - - - - - 248.30769230769232 37 13 PSTPIP1 proline-serine-threonine phosphatase interacting protein 1 891 114 B20140220_SF056_06 B20140220_SF056_06 TB317667.[MT7]-DAFWC[CAM]RDFTAHTGYEVLLQR.4b7_2.heavy 658.074 / 548.244 8786.0 38.1953010559082 45 15 10 10 10 2.0607563097754773 34.23474015091874 0.0 3 0.9528243515882725 5.659539892172449 8786.0 20.31385517645841 0.0 - - - - - - - 702.5833333333334 17 12 PSTPIP1 proline-serine-threonine phosphatase interacting protein 1 893 114 B20140220_SF056_06 B20140220_SF056_06 TB317667.[MT7]-DAFWC[CAM]RDFTAHTGYEVLLQR.4y6_1.heavy 658.074 / 757.457 27419.0 38.1953010559082 45 15 10 10 10 2.0607563097754773 34.23474015091874 0.0 3 0.9528243515882725 5.659539892172449 27419.0 66.71632262282833 0.0 - - - - - - - 681.5 54 8 PSTPIP1 proline-serine-threonine phosphatase interacting protein 1 895 115 B20140220_SF056_06 B20140220_SF056_06 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 306823.0 26.081499099731445 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 306823.0 665.4103718350914 0.0 - - - - - - - 2225.0 613 8 897 115 B20140220_SF056_06 B20140220_SF056_06 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 310892.0 26.081499099731445 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 310892.0 783.9502981542389 0.0 - - - - - - - 1380.0 621 1 899 115 B20140220_SF056_06 B20140220_SF056_06 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 443996.0 26.081499099731445 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 443996.0 1250.5419235607255 0.0 - - - - - - - 1816.0 887 1 901 116 B20140220_SF056_06 B20140220_SF056_06 TB317067.[MT7]-VLATMER.2y4_1.heavy 482.274 / 536.25 6176.0 27.1628999710083 44 18 10 6 10 3.583573602712502 27.905105653280668 0.03899955749511719 3 0.9817121914680634 9.112078416402111 6176.0 8.55686733653706 0.0 - - - - - - - 733.2727272727273 12 11 CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 903 116 B20140220_SF056_06 B20140220_SF056_06 TB317067.[MT7]-VLATMER.2y5_1.heavy 482.274 / 607.287 18745.0 27.1628999710083 44 18 10 6 10 3.583573602712502 27.905105653280668 0.03899955749511719 3 0.9817121914680634 9.112078416402111 18745.0 51.40841620080006 0.0 - - - - - - - 744.8333333333334 37 12 CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 905 116 B20140220_SF056_06 B20140220_SF056_06 TB317067.[MT7]-VLATMER.2b4_1.heavy 482.274 / 529.347 5885.0 27.1628999710083 44 18 10 6 10 3.583573602712502 27.905105653280668 0.03899955749511719 3 0.9817121914680634 9.112078416402111 5885.0 7.363767496067332 2.0 - - - - - - - 752.7142857142857 12 14 CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 907 116 B20140220_SF056_06 B20140220_SF056_06 TB317067.[MT7]-VLATMER.2y6_1.heavy 482.274 / 720.371 37199.0 27.1628999710083 44 18 10 6 10 3.583573602712502 27.905105653280668 0.03899955749511719 3 0.9817121914680634 9.112078416402111 37199.0 51.770036866359455 0.0 - - - - - - - 718.6666666666666 74 9 CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 909 117 B20140220_SF056_06 B20140220_SF056_06 TB470099.[MT7]-ALEYIENLR.2y8_1.heavy 632.854 / 1049.56 18088.0 37.76789855957031 44 18 6 10 10 7.176140450446496 13.935067281713813 0.0 3 0.9881716554963773 11.336301134089368 18088.0 146.04905660377358 0.0 - - - - - - - 143.66666666666666 36 21 SCG2 secretogranin II 911 117 B20140220_SF056_06 B20140220_SF056_06 TB470099.[MT7]-ALEYIENLR.2b4_1.heavy 632.854 / 621.336 9414.0 37.76789855957031 44 18 6 10 10 7.176140450446496 13.935067281713813 0.0 3 0.9881716554963773 11.336301134089368 9414.0 17.000606156363737 0.0 - - - - - - - 1150.25 18 8 SCG2 secretogranin II 913 117 B20140220_SF056_06 B20140220_SF056_06 TB470099.[MT7]-ALEYIENLR.2y6_1.heavy 632.854 / 807.436 18935.0 37.76789855957031 44 18 6 10 10 7.176140450446496 13.935067281713813 0.0 3 0.9881716554963773 11.336301134089368 18935.0 90.18291291291291 1.0 - - - - - - - 297.0952380952381 55 21 SCG2 secretogranin II 915 117 B20140220_SF056_06 B20140220_SF056_06 TB470099.[MT7]-ALEYIENLR.2y7_1.heavy 632.854 / 936.479 14598.0 37.76789855957031 44 18 6 10 10 7.176140450446496 13.935067281713813 0.0 3 0.9881716554963773 11.336301134089368 14598.0 148.73433962264153 0.0 - - - - - - - 172.0 29 16 SCG2 secretogranin II 917 118 B20140220_SF056_06 B20140220_SF056_06 TB317665.[MT7]-LIESLSQMLSMGFSDEGGWLTR.3y11_1.heavy 867.765 / 1224.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - SQSTM1 sequestosome 1 919 118 B20140220_SF056_06 B20140220_SF056_06 TB317665.[MT7]-LIESLSQMLSMGFSDEGGWLTR.3b4_1.heavy 867.765 / 587.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - SQSTM1 sequestosome 1 921 118 B20140220_SF056_06 B20140220_SF056_06 TB317665.[MT7]-LIESLSQMLSMGFSDEGGWLTR.3b3_1.heavy 867.765 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - SQSTM1 sequestosome 1 923 118 B20140220_SF056_06 B20140220_SF056_06 TB317665.[MT7]-LIESLSQMLSMGFSDEGGWLTR.3y9_1.heavy 867.765 / 1020.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - SQSTM1 sequestosome 1 925 119 B20140220_SF056_06 B20140220_SF056_06 TB317469.[MT7]-NSPLLSVSSQTITK[MT7].3b6_1.heavy 588.343 / 756.437 9438.0 32.36650085449219 43 13 10 10 10 1.5374243128519904 53.40011810486442 0.0 3 0.9285926610373967 4.590628128370697 9438.0 11.973684210526315 0.0 - - - - - - - 300.6666666666667 18 9 RNF214 ring finger protein 214 927 119 B20140220_SF056_06 B20140220_SF056_06 TB317469.[MT7]-NSPLLSVSSQTITK[MT7].3y3_1.heavy 588.343 / 505.347 18019.0 32.36650085449219 43 13 10 10 10 1.5374243128519904 53.40011810486442 0.0 3 0.9285926610373967 4.590628128370697 18019.0 34.002796143250684 0.0 - - - - - - - 742.5 36 8 RNF214 ring finger protein 214 929 119 B20140220_SF056_06 B20140220_SF056_06 TB317469.[MT7]-NSPLLSVSSQTITK[MT7].3b4_1.heavy 588.343 / 556.321 19603.0 32.36650085449219 43 13 10 10 10 1.5374243128519904 53.40011810486442 0.0 3 0.9285926610373967 4.590628128370697 19603.0 27.597657828282827 0.0 - - - - - - - 1303.5 39 8 RNF214 ring finger protein 214 931 119 B20140220_SF056_06 B20140220_SF056_06 TB317469.[MT7]-NSPLLSVSSQTITK[MT7].3b5_1.heavy 588.343 / 669.405 13729.0 32.36650085449219 43 13 10 10 10 1.5374243128519904 53.40011810486442 0.0 3 0.9285926610373967 4.590628128370697 13729.0 49.14357954545454 0.0 - - - - - - - 313.5 27 8 RNF214 ring finger protein 214 933 120 B20140220_SF056_06 B20140220_SF056_06 TB317468.[MT7]-TVQC[CAM]IATIALMIQR.2b4_1.heavy 881.495 / 633.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - HELLS helicase, lymphoid-specific 935 120 B20140220_SF056_06 B20140220_SF056_06 TB317468.[MT7]-TVQC[CAM]IATIALMIQR.2y9_1.heavy 881.495 / 1016.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - HELLS helicase, lymphoid-specific 937 120 B20140220_SF056_06 B20140220_SF056_06 TB317468.[MT7]-TVQC[CAM]IATIALMIQR.2y6_1.heavy 881.495 / 731.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - HELLS helicase, lymphoid-specific 939 120 B20140220_SF056_06 B20140220_SF056_06 TB317468.[MT7]-TVQC[CAM]IATIALMIQR.2y10_1.heavy 881.495 / 1129.68 N/A N/A - - - - - - - - - 0.0 - - - - - - - HELLS helicase, lymphoid-specific 941 121 B20140220_SF056_06 B20140220_SF056_06 TB469839.[MT7]-SINNK[MT7].2b3_1.heavy 432.263 / 459.268 990.0 15.100600242614746 38 10 10 10 8 0.581681110626209 94.45389971806993 0.0 4 0.8236920115811097 2.894867492362152 990.0 3.7730706815723045 3.0 - - - - - - - 0.0 1 0 PABPC3 poly(A) binding protein, cytoplasmic 3 943 121 B20140220_SF056_06 B20140220_SF056_06 TB469839.[MT7]-SINNK[MT7].2y4_1.heavy 432.263 / 632.385 3005.0 15.100600242614746 38 10 10 10 8 0.581681110626209 94.45389971806993 0.0 4 0.8236920115811097 2.894867492362152 3005.0 10.993128300714508 1.0 - - - - - - - 237.1578947368421 7 19 PABPC3 poly(A) binding protein, cytoplasmic 3 945 121 B20140220_SF056_06 B20140220_SF056_06 TB469839.[MT7]-SINNK[MT7].2b4_1.heavy 432.263 / 573.311 8536.0 15.100600242614746 38 10 10 10 8 0.581681110626209 94.45389971806993 0.0 4 0.8236920115811097 2.894867492362152 8536.0 17.302702702702703 1.0 - - - - - - - 290.07142857142856 17 14 PABPC3 poly(A) binding protein, cytoplasmic 3 947 121 B20140220_SF056_06 B20140220_SF056_06 TB469839.[MT7]-SINNK[MT7].2y3_1.heavy 432.263 / 519.301 9082.0 15.100600242614746 38 10 10 10 8 0.581681110626209 94.45389971806993 0.0 4 0.8236920115811097 2.894867492362152 9082.0 10.12974993003741 0.0 - - - - - - - 691.375 18 8 PABPC3 poly(A) binding protein, cytoplasmic 3 949 122 B20140220_SF056_06 B20140220_SF056_06 TB317463.[MT7]-NLGFSPGDREENIR.3b5_1.heavy 583.3 / 663.358 3698.0 26.753799438476562 40 10 10 10 10 2.0532098167229296 42.45708055656932 0.0 3 0.8310370638456797 2.9590541507230945 3698.0 6.383560606060605 1.0 - - - - - - - 212.8235294117647 7 17 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 951 122 B20140220_SF056_06 B20140220_SF056_06 TB317463.[MT7]-NLGFSPGDREENIR.3y4_1.heavy 583.3 / 531.289 3094.0 26.753799438476562 40 10 10 10 10 2.0532098167229296 42.45708055656932 0.0 3 0.8310370638456797 2.9590541507230945 3094.0 7.746391752577319 1.0 - - - - - - - 722.2857142857143 9 7 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 953 122 B20140220_SF056_06 B20140220_SF056_06 TB317463.[MT7]-NLGFSPGDREENIR.3y12_2.heavy 583.3 / 688.831 13885.0 26.753799438476562 40 10 10 10 10 2.0532098167229296 42.45708055656932 0.0 3 0.8310370638456797 2.9590541507230945 13885.0 72.14681221978657 0.0 - - - - - - - 221.26666666666668 27 15 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 955 122 B20140220_SF056_06 B20140220_SF056_06 TB317463.[MT7]-NLGFSPGDREENIR.3y13_2.heavy 583.3 / 745.373 16376.0 26.753799438476562 40 10 10 10 10 2.0532098167229296 42.45708055656932 0.0 3 0.8310370638456797 2.9590541507230945 16376.0 51.685424062552876 0.0 - - - - - - - 664.0 32 10 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 957 123 B20140220_SF056_06 B20140220_SF056_06 TB317650.[MT7]-FVVLPTGDVWSRPDGSYLNK[MT7].4y11_2.heavy 635.345 / 733.879 66768.0 39.000099182128906 46 16 10 10 10 4.195391738622767 18.25332317649496 0.0 3 0.9694072312858506 7.037842217507672 66768.0 366.44062554459987 0.0 - - - - - - - 311.8181818181818 133 11 FGFRL1 fibroblast growth factor receptor-like 1 959 123 B20140220_SF056_06 B20140220_SF056_06 TB317650.[MT7]-FVVLPTGDVWSRPDGSYLNK[MT7].4b4_1.heavy 635.345 / 603.399 56568.0 39.000099182128906 46 16 10 10 10 4.195391738622767 18.25332317649496 0.0 3 0.9694072312858506 7.037842217507672 56568.0 106.06085022118171 0.0 - - - - - - - 719.1428571428571 113 7 FGFRL1 fibroblast growth factor receptor-like 1 961 123 B20140220_SF056_06 B20140220_SF056_06 TB317650.[MT7]-FVVLPTGDVWSRPDGSYLNK[MT7].4y3_1.heavy 635.345 / 518.342 19910.0 39.000099182128906 46 16 10 10 10 4.195391738622767 18.25332317649496 0.0 3 0.9694072312858506 7.037842217507672 19910.0 45.04587401600576 0.0 - - - - - - - 732.0 39 7 FGFRL1 fibroblast growth factor receptor-like 1 963 123 B20140220_SF056_06 B20140220_SF056_06 TB317650.[MT7]-FVVLPTGDVWSRPDGSYLNK[MT7].4y6_1.heavy 635.345 / 825.459 8285.0 39.000099182128906 46 16 10 10 10 4.195391738622767 18.25332317649496 0.0 3 0.9694072312858506 7.037842217507672 8285.0 22.52788762417724 0.0 - - - - - - - 214.375 16 16 FGFRL1 fibroblast growth factor receptor-like 1 965 124 B20140220_SF056_06 B20140220_SF056_06 TB317198.[MT7]-GHIAALRK[MT7].2y4_1.heavy 577.374 / 631.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - GALE UDP-galactose-4-epimerase 967 124 B20140220_SF056_06 B20140220_SF056_06 TB317198.[MT7]-GHIAALRK[MT7].2y5_1.heavy 577.374 / 702.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - GALE UDP-galactose-4-epimerase 969 124 B20140220_SF056_06 B20140220_SF056_06 TB317198.[MT7]-GHIAALRK[MT7].2y6_1.heavy 577.374 / 815.558 N/A N/A - - - - - - - - - 0.0 - - - - - - - GALE UDP-galactose-4-epimerase 971 124 B20140220_SF056_06 B20140220_SF056_06 TB317198.[MT7]-GHIAALRK[MT7].2y7_1.heavy 577.374 / 952.617 N/A N/A - - - - - - - - - 0.0 - - - - - - - GALE UDP-galactose-4-epimerase 973 125 B20140220_SF056_06 B20140220_SF056_06 TB317651.[MT7]-QQVQLLAEMC[CAM]ILIDENDNK[MT7].3y7_1.heavy 854.776 / 991.481 5313.0 46.22342586517334 41 16 10 7 8 2.123085172709492 47.101266254136895 0.025501251220703125 4 0.9644726624801824 6.528100081250021 5313.0 26.009327817531307 0.0 - - - - - - - 287.125 10 24 IDI1 isopentenyl-diphosphate delta isomerase 1 975 125 B20140220_SF056_06 B20140220_SF056_06 TB317651.[MT7]-QQVQLLAEMC[CAM]ILIDENDNK[MT7].3b4_1.heavy 854.776 / 628.354 6432.0 46.22342586517334 41 16 10 7 8 2.123085172709492 47.101266254136895 0.025501251220703125 4 0.9644726624801824 6.528100081250021 6432.0 10.649821215733017 1.0 - - - - - - - 706.5 12 14 IDI1 isopentenyl-diphosphate delta isomerase 1 977 125 B20140220_SF056_06 B20140220_SF056_06 TB317651.[MT7]-QQVQLLAEMC[CAM]ILIDENDNK[MT7].3b5_1.heavy 854.776 / 741.438 10591.0 46.22342586517334 41 16 10 7 8 2.123085172709492 47.101266254136895 0.025501251220703125 4 0.9644726624801824 6.528100081250021 10591.0 6.021438920906168 1.0 - - - - - - - 1266.3076923076924 21 13 IDI1 isopentenyl-diphosphate delta isomerase 1 979 125 B20140220_SF056_06 B20140220_SF056_06 TB317651.[MT7]-QQVQLLAEMC[CAM]ILIDENDNK[MT7].3b3_1.heavy 854.776 / 500.295 4439.0 46.22342586517334 41 16 10 7 8 2.123085172709492 47.101266254136895 0.025501251220703125 4 0.9644726624801824 6.528100081250021 4439.0 8.997237532542576 0.0 - - - - - - - 635.3636363636364 8 11 IDI1 isopentenyl-diphosphate delta isomerase 1 981 126 B20140220_SF056_06 B20140220_SF056_06 TB317194.[MT7]-GFQTVPNSR.2y8_1.heavy 575.31 / 948.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - PCDH10 protocadherin 10 983 126 B20140220_SF056_06 B20140220_SF056_06 TB317194.[MT7]-GFQTVPNSR.2y5_1.heavy 575.31 / 572.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - PCDH10 protocadherin 10 985 126 B20140220_SF056_06 B20140220_SF056_06 TB317194.[MT7]-GFQTVPNSR.2y7_1.heavy 575.31 / 801.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - PCDH10 protocadherin 10 987 127 B20140220_SF056_06 B20140220_SF056_06 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 147116.0 35.97650146484375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 147116.0 213.07271170530768 0.0 - - - - - - - 330.5 294 14 989 127 B20140220_SF056_06 B20140220_SF056_06 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 383003.0 35.97650146484375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 383003.0 217.66198591741923 0.0 - - - - - - - 306.125 766 16 991 127 B20140220_SF056_06 B20140220_SF056_06 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 333584.0 35.97650146484375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 333584.0 184.0077816169175 0.0 - - - - - - - 728.125 667 8 993 128 B20140220_SF056_06 B20140220_SF056_06 TB317052.[MT7]-LAASAPLR.2y5_1.heavy 471.796 / 543.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - EFS embryonal Fyn-associated substrate 995 128 B20140220_SF056_06 B20140220_SF056_06 TB317052.[MT7]-LAASAPLR.2y6_1.heavy 471.796 / 614.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - EFS embryonal Fyn-associated substrate 997 128 B20140220_SF056_06 B20140220_SF056_06 TB317052.[MT7]-LAASAPLR.2b5_1.heavy 471.796 / 558.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - EFS embryonal Fyn-associated substrate 999 128 B20140220_SF056_06 B20140220_SF056_06 TB317052.[MT7]-LAASAPLR.2y7_1.heavy 471.796 / 685.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - EFS embryonal Fyn-associated substrate 1001 129 B20140220_SF056_06 B20140220_SF056_06 TB317656.[MT7]-YGAAEPHTIAAFLGGAAAQEVIK[MT7].4b11_2.heavy 644.105 / 613.818 30647.0 40.31010055541992 31 8 10 3 10 0.5183473116945757 90.38303115586392 0.05699920654296875 3 0.7872583939714034 2.626742784139511 30647.0 73.95957767722473 0.0 - - - - - - - 676.9285714285714 61 14 NAE1 NEDD8 activating enzyme E1 subunit 1 1003 129 B20140220_SF056_06 B20140220_SF056_06 TB317656.[MT7]-YGAAEPHTIAAFLGGAAAQEVIK[MT7].4b5_1.heavy 644.105 / 636.311 5771.0 40.31010055541992 31 8 10 3 10 0.5183473116945757 90.38303115586392 0.05699920654296875 3 0.7872583939714034 2.626742784139511 5771.0 10.825829725829726 0.0 - - - - - - - 732.3333333333334 11 9 NAE1 NEDD8 activating enzyme E1 subunit 1 1005 129 B20140220_SF056_06 B20140220_SF056_06 TB317656.[MT7]-YGAAEPHTIAAFLGGAAAQEVIK[MT7].4b6_1.heavy 644.105 / 733.364 1170.0 40.31010055541992 31 8 10 3 10 0.5183473116945757 90.38303115586392 0.05699920654296875 3 0.7872583939714034 2.626742784139511 1170.0 1.722488038277512 2.0 - - - - - - - 198.3913043478261 2 23 NAE1 NEDD8 activating enzyme E1 subunit 1 1007 129 B20140220_SF056_06 B20140220_SF056_06 TB317656.[MT7]-YGAAEPHTIAAFLGGAAAQEVIK[MT7].4b10_2.heavy 644.105 / 578.299 15285.0 40.31010055541992 31 8 10 3 10 0.5183473116945757 90.38303115586392 0.05699920654296875 3 0.7872583939714034 2.626742784139511 15285.0 19.448721967687483 0.0 - - - - - - - 705.9 30 10 NAE1 NEDD8 activating enzyme E1 subunit 1 1009 130 B20140220_SF056_06 B20140220_SF056_06 TB317657.[MT7]-YGAAEPHTIAAFLGGAAAQEVIK[MT7].3b4_1.heavy 858.47 / 507.268 1404.0 40.30297565460205 37 10 10 7 10 0.9850936202838204 66.61670624428668 0.028499603271484375 3 0.823770914401132 2.8955358438972936 1404.0 4.254545454545455 0.0 - - - - - - - 256.86206896551727 2 29 NAE1 NEDD8 activating enzyme E1 subunit 1 1011 130 B20140220_SF056_06 B20140220_SF056_06 TB317657.[MT7]-YGAAEPHTIAAFLGGAAAQEVIK[MT7].3b5_1.heavy 858.47 / 636.311 3899.0 40.30297565460205 37 10 10 7 10 0.9850936202838204 66.61670624428668 0.028499603271484375 3 0.823770914401132 2.8955358438972936 3899.0 11.242214680744093 0.0 - - - - - - - 244.5 7 26 NAE1 NEDD8 activating enzyme E1 subunit 1 1013 130 B20140220_SF056_06 B20140220_SF056_06 TB317657.[MT7]-YGAAEPHTIAAFLGGAAAQEVIK[MT7].3b10_2.heavy 858.47 / 578.299 6005.0 40.30297565460205 37 10 10 7 10 0.9850936202838204 66.61670624428668 0.028499603271484375 3 0.823770914401132 2.8955358438972936 6005.0 13.248210470085471 0.0 - - - - - - - 638.625 12 8 NAE1 NEDD8 activating enzyme E1 subunit 1 1015 130 B20140220_SF056_06 B20140220_SF056_06 TB317657.[MT7]-YGAAEPHTIAAFLGGAAAQEVIK[MT7].3y9_1.heavy 858.47 / 1030.6 936.0 40.30297565460205 37 10 10 7 10 0.9850936202838204 66.61670624428668 0.028499603271484375 3 0.823770914401132 2.8955358438972936 936.0 2.4000000000000004 1.0 - - - - - - - 0.0 1 0 NAE1 NEDD8 activating enzyme E1 subunit 1 1017 131 B20140220_SF056_06 B20140220_SF056_06 TB317054.[MT7]-TGITAAK[MT7].2b3_1.heavy 475.3 / 416.263 N/A 18.88960075378418 50 20 10 10 10 6.832164483858593 14.636649957163081 0.0 3 0.9931713452277041 14.926134265532777 4817.0 4.130150340615456 1.0 - - - - - - - 1229.25 9 8 CPT2 carnitine palmitoyltransferase 2 1019 131 B20140220_SF056_06 B20140220_SF056_06 TB317054.[MT7]-TGITAAK[MT7].2y4_1.heavy 475.3 / 534.337 5543.0 18.88960075378418 50 20 10 10 10 6.832164483858593 14.636649957163081 0.0 3 0.9931713452277041 14.926134265532777 5543.0 13.857499999999998 0.0 - - - - - - - 251.625 11 16 CPT2 carnitine palmitoyltransferase 2 1021 131 B20140220_SF056_06 B20140220_SF056_06 TB317054.[MT7]-TGITAAK[MT7].2y6_1.heavy 475.3 / 704.442 3530.0 18.88960075378418 50 20 10 10 10 6.832164483858593 14.636649957163081 0.0 3 0.9931713452277041 14.926134265532777 3530.0 15.070022059677232 0.0 - - - - - - - 191.71428571428572 7 21 CPT2 carnitine palmitoyltransferase 2 1023 131 B20140220_SF056_06 B20140220_SF056_06 TB317054.[MT7]-TGITAAK[MT7].2b5_1.heavy 475.3 / 588.347 1518.0 18.88960075378418 50 20 10 10 10 6.832164483858593 14.636649957163081 0.0 3 0.9931713452277041 14.926134265532777 1518.0 3.216783216783216 1.0 - - - - - - - 281.7692307692308 3 26 CPT2 carnitine palmitoyltransferase 2 1025 132 B20140220_SF056_06 B20140220_SF056_06 TB317057.[MT7]-EQC[CAM]GC[CAM]R.2b3_1.heavy 477.206 / 562.241 N/A N/A - - - - - - - - - 0.0 - - - - - - - GALE UDP-galactose-4-epimerase 1027 132 B20140220_SF056_06 B20140220_SF056_06 TB317057.[MT7]-EQC[CAM]GC[CAM]R.2y4_1.heavy 477.206 / 552.202 N/A N/A - - - - - - - - - 0.0 - - - - - - - GALE UDP-galactose-4-epimerase 1029 132 B20140220_SF056_06 B20140220_SF056_06 TB317057.[MT7]-EQC[CAM]GC[CAM]R.2y5_1.heavy 477.206 / 680.26 N/A N/A - - - - - - - - - 0.0 - - - - - - - GALE UDP-galactose-4-epimerase 1031 132 B20140220_SF056_06 B20140220_SF056_06 TB317057.[MT7]-EQC[CAM]GC[CAM]R.2b4_1.heavy 477.206 / 619.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - GALE UDP-galactose-4-epimerase 1033 133 B20140220_SF056_06 B20140220_SF056_06 TB317592.[MT7]-FFIEEMIRDLC[CAM]QADK[MT7].4b4_1.heavy 551.534 / 681.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - GALE UDP-galactose-4-epimerase 1035 133 B20140220_SF056_06 B20140220_SF056_06 TB317592.[MT7]-FFIEEMIRDLC[CAM]QADK[MT7].4b5_1.heavy 551.534 / 810.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - GALE UDP-galactose-4-epimerase 1037 133 B20140220_SF056_06 B20140220_SF056_06 TB317592.[MT7]-FFIEEMIRDLC[CAM]QADK[MT7].4b10_2.heavy 551.534 / 719.88 N/A N/A - - - - - - - - - 0.0 - - - - - - - GALE UDP-galactose-4-epimerase 1039 133 B20140220_SF056_06 B20140220_SF056_06 TB317592.[MT7]-FFIEEMIRDLC[CAM]QADK[MT7].4b9_2.heavy 551.534 / 663.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - GALE UDP-galactose-4-epimerase 1041 134 B20140220_SF056_06 B20140220_SF056_06 TB317253.[MT7]-STPPTLETVR.2y8_1.heavy 622.852 / 912.515 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF214 ring finger protein 214 1043 134 B20140220_SF056_06 B20140220_SF056_06 TB317253.[MT7]-STPPTLETVR.2y5_1.heavy 622.852 / 617.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF214 ring finger protein 214 1045 134 B20140220_SF056_06 B20140220_SF056_06 TB317253.[MT7]-STPPTLETVR.2y9_1.heavy 622.852 / 1013.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF214 ring finger protein 214 1047 134 B20140220_SF056_06 B20140220_SF056_06 TB317253.[MT7]-STPPTLETVR.2y7_1.heavy 622.852 / 815.462 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF214 ring finger protein 214 1049 135 B20140220_SF056_06 B20140220_SF056_06 TB317596.[MT7]-SANALILTYDITC[CAM]EESFR.3b6_1.heavy 749.708 / 714.427 58007.0 43.08570098876953 48 18 10 10 10 4.004899781248532 24.969413833577853 0.0 3 0.9836750046167607 9.645910736526787 58007.0 103.9748470354821 0.0 - - - - - - - 339.5 116 2 RAB30 RAB30, member RAS oncogene family 1051 135 B20140220_SF056_06 B20140220_SF056_06 TB317596.[MT7]-SANALILTYDITC[CAM]EESFR.3b5_1.heavy 749.708 / 601.343 90741.0 43.08570098876953 48 18 10 10 10 4.004899781248532 24.969413833577853 0.0 3 0.9836750046167607 9.645910736526787 90741.0 107.17259843350558 0.0 - - - - - - - 321.5 181 2 RAB30 RAB30, member RAS oncogene family 1053 135 B20140220_SF056_06 B20140220_SF056_06 TB317596.[MT7]-SANALILTYDITC[CAM]EESFR.3y8_1.heavy 749.708 / 1041.47 13743.0 43.08570098876953 48 18 10 10 10 4.004899781248532 24.969413833577853 0.0 3 0.9836750046167607 9.645910736526787 13743.0 50.29588305343512 0.0 - - - - - - - 740.75 27 8 RAB30 RAB30, member RAS oncogene family 1055 135 B20140220_SF056_06 B20140220_SF056_06 TB317596.[MT7]-SANALILTYDITC[CAM]EESFR.3y9_1.heavy 749.708 / 1156.49 19133.0 43.08570098876953 48 18 10 10 10 4.004899781248532 24.969413833577853 0.0 3 0.9836750046167607 9.645910736526787 19133.0 116.636213645986 0.0 - - - - - - - 201.28571428571428 38 14 RAB30 RAB30, member RAS oncogene family 1057 136 B20140220_SF056_06 B20140220_SF056_06 TB317255.[MT7]-LLC[CAM]SQVLK[MT7].2y5_1.heavy 624.883 / 718.458 3072.0 32.085174560546875 29 17 0 6 6 5.277656085802346 18.947805308688906 0.03790283203125 5 0.9727188573275676 7.454847748166971 3072.0 1.8395209580838323 1.0 - - - - - - - 270.8888888888889 6 18 LOC440292;COMMD4 hypothetical protein LOC440292;COMM domain containing 4 1059 136 B20140220_SF056_06 B20140220_SF056_06 TB317255.[MT7]-LLC[CAM]SQVLK[MT7].2y3_1.heavy 624.883 / 503.367 4741.0 32.085174560546875 29 17 0 6 6 5.277656085802346 18.947805308688906 0.03790283203125 5 0.9727188573275676 7.454847748166971 4741.0 9.50123140815144 1.0 - - - - - - - 623.2222222222222 13 9 LOC440292;COMMD4 hypothetical protein LOC440292;COMM domain containing 4 1061 136 B20140220_SF056_06 B20140220_SF056_06 TB317255.[MT7]-LLC[CAM]SQVLK[MT7].2y6_1.heavy 624.883 / 878.489 6611.0 32.085174560546875 29 17 0 6 6 5.277656085802346 18.947805308688906 0.03790283203125 5 0.9727188573275676 7.454847748166971 6611.0 5.3039885002016325 1.0 - - - - - - - 200.33333333333334 45 15 LOC440292;COMMD4 hypothetical protein LOC440292;COMM domain containing 4 1063 136 B20140220_SF056_06 B20140220_SF056_06 TB317255.[MT7]-LLC[CAM]SQVLK[MT7].2y7_1.heavy 624.883 / 991.573 5342.0 32.085174560546875 29 17 0 6 6 5.277656085802346 18.947805308688906 0.03790283203125 5 0.9727188573275676 7.454847748166971 5342.0 29.89280838323353 0.0 - - - - - - - 173.05882352941177 10 17 LOC440292;COMMD4 hypothetical protein LOC440292;COMM domain containing 4 1065 137 B20140220_SF056_06 B20140220_SF056_06 TB469826.[MT7]-NASLER.2y4_1.heavy 417.234 / 504.278 7996.0 16.361374855041504 39 14 10 7 8 2.4165073544702835 41.38203834348385 0.025501251220703125 4 0.9486885274797249 5.424758214374425 7996.0 19.885546383945478 0.0 - - - - - - - 593.5384615384615 15 13 MYH15;PSMB10 myosin, heavy chain 15;proteasome (prosome, macropain) subunit, beta type, 10 1067 137 B20140220_SF056_06 B20140220_SF056_06 TB469826.[MT7]-NASLER.2y5_1.heavy 417.234 / 575.315 21553.0 16.361374855041504 39 14 10 7 8 2.4165073544702835 41.38203834348385 0.025501251220703125 4 0.9486885274797249 5.424758214374425 21553.0 41.133046006281305 1.0 - - - - - - - 750.4166666666666 43 12 MYH15;PSMB10 myosin, heavy chain 15;proteasome (prosome, macropain) subunit, beta type, 10 1069 137 B20140220_SF056_06 B20140220_SF056_06 TB469826.[MT7]-NASLER.2b4_1.heavy 417.234 / 530.305 8343.0 16.361374855041504 39 14 10 7 8 2.4165073544702835 41.38203834348385 0.025501251220703125 4 0.9486885274797249 5.424758214374425 8343.0 7.392097997153962 1.0 - - - - - - - 643.0833333333334 41 12 MYH15;PSMB10 myosin, heavy chain 15;proteasome (prosome, macropain) subunit, beta type, 10 1071 137 B20140220_SF056_06 B20140220_SF056_06 TB469826.[MT7]-NASLER.2b5_1.heavy 417.234 / 659.348 15643.0 16.361374855041504 39 14 10 7 8 2.4165073544702835 41.38203834348385 0.025501251220703125 4 0.9486885274797249 5.424758214374425 15643.0 22.232396630594682 0.0 - - - - - - - 720.0 31 7 MYH15;PSMB10 myosin, heavy chain 15;proteasome (prosome, macropain) subunit, beta type, 10 1073 138 B20140220_SF056_06 B20140220_SF056_06 TB317391.[MT7]-EEFTSGGPLGQK[MT7].3b6_1.heavy 513.275 / 795.364 5111.0 28.110650062561035 47 20 10 7 10 7.133766902999479 14.017839573361135 0.029399871826171875 3 0.9942875568879954 16.320913709520184 5111.0 9.681277672359267 1.0 - - - - - - - 293.36842105263156 10 19 PAFAH1B1 platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) 1075 138 B20140220_SF056_06 B20140220_SF056_06 TB317391.[MT7]-EEFTSGGPLGQK[MT7].3b3_1.heavy 513.275 / 550.263 13274.0 28.110650062561035 47 20 10 7 10 7.133766902999479 14.017839573361135 0.029399871826171875 3 0.9942875568879954 16.320913709520184 13274.0 17.658129336953266 0.0 - - - - - - - 746.5 26 8 PAFAH1B1 platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) 1077 138 B20140220_SF056_06 B20140220_SF056_06 TB317391.[MT7]-EEFTSGGPLGQK[MT7].3y4_1.heavy 513.275 / 589.379 20907.0 28.110650062561035 47 20 10 7 10 7.133766902999479 14.017839573361135 0.029399871826171875 3 0.9942875568879954 16.320913709520184 20907.0 34.39958826863844 0.0 - - - - - - - 658.9285714285714 41 14 PAFAH1B1 platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) 1079 138 B20140220_SF056_06 B20140220_SF056_06 TB317391.[MT7]-EEFTSGGPLGQK[MT7].3b7_1.heavy 513.275 / 852.386 37898.0 28.110650062561035 47 20 10 7 10 7.133766902999479 14.017839573361135 0.029399871826171875 3 0.9942875568879954 16.320913709520184 37898.0 146.37440517656776 0.0 - - - - - - - 729.8571428571429 75 7 PAFAH1B1 platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) 1081 139 B20140220_SF056_06 B20140220_SF056_06 TB469823.[MT7]-SLVSK[MT7].2b3_1.heavy 411.27 / 444.294 4355.0 20.819400787353516 48 20 10 10 8 6.868688819855915 14.558819393727855 0.0 4 0.9961613473884328 19.912873771753326 4355.0 3.484036741753142 3.0 - - - - - - - 1184.6363636363637 10 11 HIST1H1C;HIST1H1D;HIST1H1E;HIST1H1B;HIST1H1A;RP1 histone cluster 1, H1c;histone cluster 1, H1d;histone cluster 1, H1e;histone cluster 1, H1b;histone cluster 1, H1a;retinitis pigmentosa 1 (autosomal dominant) 1083 139 B20140220_SF056_06 B20140220_SF056_06 TB469823.[MT7]-SLVSK[MT7].2y4_1.heavy 411.27 / 590.399 10129.0 20.819400787353516 48 20 10 10 8 6.868688819855915 14.558819393727855 0.0 4 0.9961613473884328 19.912873771753326 10129.0 16.3982986156183 0.0 - - - - - - - 617.7 20 10 HIST1H1C;HIST1H1D;HIST1H1E;HIST1H1B;HIST1H1A;RP1 histone cluster 1, H1c;histone cluster 1, H1d;histone cluster 1, H1e;histone cluster 1, H1b;histone cluster 1, H1a;retinitis pigmentosa 1 (autosomal dominant) 1085 139 B20140220_SF056_06 B20140220_SF056_06 TB469823.[MT7]-SLVSK[MT7].2y3_1.heavy 411.27 / 477.315 6685.0 20.819400787353516 48 20 10 10 8 6.868688819855915 14.558819393727855 0.0 4 0.9961613473884328 19.912873771753326 6685.0 8.262996795565591 0.0 - - - - - - - 724.7333333333333 13 15 HIST1H1C;HIST1H1D;HIST1H1E;HIST1H1B;HIST1H1A;RP1 histone cluster 1, H1c;histone cluster 1, H1d;histone cluster 1, H1e;histone cluster 1, H1b;histone cluster 1, H1a;retinitis pigmentosa 1 (autosomal dominant) 1087 140 B20140220_SF056_06 B20140220_SF056_06 TB470404.[MT7]-LAVLFSGALLGLLAESTGTTSHR.4y8_1.heavy 615.35 / 846.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - CD68 CD68 molecule 1089 140 B20140220_SF056_06 B20140220_SF056_06 TB470404.[MT7]-LAVLFSGALLGLLAESTGTTSHR.4y9_1.heavy 615.35 / 975.449 N/A N/A - - - - - - - - - 0.0 - - - - - - - CD68 CD68 molecule 1091 140 B20140220_SF056_06 B20140220_SF056_06 TB470404.[MT7]-LAVLFSGALLGLLAESTGTTSHR.4y10_1.heavy 615.35 / 1046.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - CD68 CD68 molecule 1093 140 B20140220_SF056_06 B20140220_SF056_06 TB470404.[MT7]-LAVLFSGALLGLLAESTGTTSHR.4b4_1.heavy 615.35 / 541.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - CD68 CD68 molecule 1095 141 B20140220_SF056_06 B20140220_SF056_06 TB317185.[MT7]-FLLDTNK[MT7].2y4_1.heavy 569.839 / 621.332 10296.0 32.38475036621094 43 17 10 6 10 2.336053128996699 33.85094346062001 0.0364990234375 3 0.9770462502165898 8.13020144053382 10296.0 18.773333333333333 0.0 - - - - - - - 742.5 20 12 MCM6 minichromosome maintenance complex component 6 1097 141 B20140220_SF056_06 B20140220_SF056_06 TB317185.[MT7]-FLLDTNK[MT7].2b4_1.heavy 569.839 / 633.373 13002.0 32.38475036621094 43 17 10 6 10 2.336053128996699 33.85094346062001 0.0364990234375 3 0.9770462502165898 8.13020144053382 13002.0 24.296666666666667 0.0 - - - - - - - 792.0 26 12 MCM6 minichromosome maintenance complex component 6 1099 141 B20140220_SF056_06 B20140220_SF056_06 TB317185.[MT7]-FLLDTNK[MT7].2y3_1.heavy 569.839 / 506.306 17029.0 32.38475036621094 43 17 10 6 10 2.336053128996699 33.85094346062001 0.0364990234375 3 0.9770462502165898 8.13020144053382 17029.0 35.671045772409414 0.0 - - - - - - - 766.6153846153846 34 13 MCM6 minichromosome maintenance complex component 6 1101 141 B20140220_SF056_06 B20140220_SF056_06 TB317185.[MT7]-FLLDTNK[MT7].2y6_1.heavy 569.839 / 847.5 10428.0 32.38475036621094 43 17 10 6 10 2.336053128996699 33.85094346062001 0.0364990234375 3 0.9770462502165898 8.13020144053382 10428.0 23.943076923076923 0.0 - - - - - - - 651.75 20 8 MCM6 minichromosome maintenance complex component 6 1103 142 B20140220_SF056_06 B20140220_SF056_06 TB470403.[MT7]-LAVLFSGALLGLLAESTGTTSHR.3b4_1.heavy 820.131 / 541.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - CD68 CD68 molecule 1105 142 B20140220_SF056_06 B20140220_SF056_06 TB470403.[MT7]-LAVLFSGALLGLLAESTGTTSHR.3b8_1.heavy 820.131 / 903.542 N/A N/A - - - - - - - - - 0.0 - - - - - - - CD68 CD68 molecule 1107 142 B20140220_SF056_06 B20140220_SF056_06 TB470403.[MT7]-LAVLFSGALLGLLAESTGTTSHR.3b7_1.heavy 820.131 / 832.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - CD68 CD68 molecule 1109 142 B20140220_SF056_06 B20140220_SF056_06 TB470403.[MT7]-LAVLFSGALLGLLAESTGTTSHR.3y10_1.heavy 820.131 / 1046.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - CD68 CD68 molecule 1111 143 B20140220_SF056_06 B20140220_SF056_06 TB470407.[MT7]-ESVRAPPNRTIFDSDLMDSAR.4y5_1.heavy 631.07 / 579.255 5576.0 32.41217613220215 35 16 10 3 6 2.8265548418602817 27.934609878665537 0.07310104370117188 5 0.9672994289099565 6.806033278506035 5576.0 9.01801951723464 1.0 - - - - - - - 744.5 11 14 PMEPA1 prostate transmembrane protein, androgen induced 1 1113 143 B20140220_SF056_06 B20140220_SF056_06 TB470407.[MT7]-ESVRAPPNRTIFDSDLMDSAR.4y8_1.heavy 631.07 / 894.399 1726.0 32.41217613220215 35 16 10 3 6 2.8265548418602817 27.934609878665537 0.07310104370117188 5 0.9672994289099565 6.806033278506035 1726.0 8.178916568529758 1.0 - - - - - - - 203.4375 3 16 PMEPA1 prostate transmembrane protein, androgen induced 1 1115 143 B20140220_SF056_06 B20140220_SF056_06 TB470407.[MT7]-ESVRAPPNRTIFDSDLMDSAR.4b15_2.heavy 631.07 / 915.467 3253.0 32.41217613220215 35 16 10 3 6 2.8265548418602817 27.934609878665537 0.07310104370117188 5 0.9672994289099565 6.806033278506035 3253.0 13.352113538901369 0.0 - - - - - - - 203.05882352941177 6 17 PMEPA1 prostate transmembrane protein, androgen induced 1 1117 143 B20140220_SF056_06 B20140220_SF056_06 TB470407.[MT7]-ESVRAPPNRTIFDSDLMDSAR.4y6_1.heavy 631.07 / 692.34 2323.0 32.41217613220215 35 16 10 3 6 2.8265548418602817 27.934609878665537 0.07310104370117188 5 0.9672994289099565 6.806033278506035 2323.0 0.0 1.0 - - - - - - - 269.4117647058824 5 17 PMEPA1 prostate transmembrane protein, androgen induced 1 1119 144 B20140220_SF056_06 B20140220_SF056_06 TB317189.[MT7]-AIRVTISSGPEVSVR.3b9_1.heavy 572.336 / 1029.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL17RE interleukin 17 receptor E 1121 144 B20140220_SF056_06 B20140220_SF056_06 TB317189.[MT7]-AIRVTISSGPEVSVR.3y6_1.heavy 572.336 / 686.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL17RE interleukin 17 receptor E 1123 144 B20140220_SF056_06 B20140220_SF056_06 TB317189.[MT7]-AIRVTISSGPEVSVR.3y8_1.heavy 572.336 / 830.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL17RE interleukin 17 receptor E 1125 144 B20140220_SF056_06 B20140220_SF056_06 TB317189.[MT7]-AIRVTISSGPEVSVR.3y9_1.heavy 572.336 / 917.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL17RE interleukin 17 receptor E 1127 145 B20140220_SF056_06 B20140220_SF056_06 TB470409.[MT7]-SVEQTLLPLVSQITTLINHK[MT7].3b6_1.heavy 841.498 / 802.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 1129 145 B20140220_SF056_06 B20140220_SF056_06 TB470409.[MT7]-SVEQTLLPLVSQITTLINHK[MT7].3b4_1.heavy 841.498 / 588.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 1131 145 B20140220_SF056_06 B20140220_SF056_06 TB470409.[MT7]-SVEQTLLPLVSQITTLINHK[MT7].3b5_1.heavy 841.498 / 689.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 1133 145 B20140220_SF056_06 B20140220_SF056_06 TB470409.[MT7]-SVEQTLLPLVSQITTLINHK[MT7].3b7_1.heavy 841.498 / 915.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 1135 146 B20140220_SF056_06 B20140220_SF056_06 TB469855.[MT7]-FFFDPVRK[MT7].3b4_1.heavy 448.595 / 701.341 140475.0 35.54880142211914 44 14 10 10 10 0.907842687509011 67.5643952141284 0.0 3 0.9475875456096967 5.366977272842977 140475.0 783.6100612272977 0.0 - - - - - - - 181.91666666666666 280 12 HELLS helicase, lymphoid-specific 1137 146 B20140220_SF056_06 B20140220_SF056_06 TB469855.[MT7]-FFFDPVRK[MT7].3y7_2.heavy 448.595 / 526.804 46423.0 35.54880142211914 44 14 10 10 10 0.907842687509011 67.5643952141284 0.0 3 0.9475875456096967 5.366977272842977 46423.0 280.6422802960222 0.0 - - - - - - - 220.16666666666666 92 12 HELLS helicase, lymphoid-specific 1139 146 B20140220_SF056_06 B20140220_SF056_06 TB469855.[MT7]-FFFDPVRK[MT7].3b3_1.heavy 448.595 / 586.315 23039.0 35.54880142211914 44 14 10 10 10 0.907842687509011 67.5643952141284 0.0 3 0.9475875456096967 5.366977272842977 23039.0 89.04127471338957 0.0 - - - - - - - 229.9 46 10 HELLS helicase, lymphoid-specific 1141 146 B20140220_SF056_06 B20140220_SF056_06 TB469855.[MT7]-FFFDPVRK[MT7].3y4_1.heavy 448.595 / 643.437 23843.0 35.54880142211914 44 14 10 10 10 0.907842687509011 67.5643952141284 0.0 3 0.9475875456096967 5.366977272842977 23843.0 83.65939838957821 0.0 - - - - - - - 201.0 47 16 HELLS helicase, lymphoid-specific 1143 147 B20140220_SF056_06 B20140220_SF056_06 TB317689.[MT7]-IVSLFAEHNDLQYAAPGGLIGVGTK[MT7].4y5_1.heavy 715.397 / 605.374 58492.0 41.31489944458008 41 11 10 10 10 0.8923025545093588 73.29723297913806 0.0 3 0.8749262886176145 3.4525919724817027 58492.0 55.08115923764876 0.0 - - - - - - - 1302.888888888889 116 9 EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa 1145 147 B20140220_SF056_06 B20140220_SF056_06 TB317689.[MT7]-IVSLFAEHNDLQYAAPGGLIGVGTK[MT7].4b7_1.heavy 715.397 / 904.526 3315.0 41.31489944458008 41 11 10 10 10 0.8923025545093588 73.29723297913806 0.0 3 0.8749262886176145 3.4525919724817027 3315.0 17.826753566158388 0.0 - - - - - - - 207.82758620689654 6 29 EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa 1147 147 B20140220_SF056_06 B20140220_SF056_06 TB317689.[MT7]-IVSLFAEHNDLQYAAPGGLIGVGTK[MT7].4b12_2.heavy 715.397 / 756.402 42809.0 41.31489944458008 41 11 10 10 10 0.8923025545093588 73.29723297913806 0.0 3 0.8749262886176145 3.4525919724817027 42809.0 58.03491140955657 0.0 - - - - - - - 754.5 85 12 EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa 1149 147 B20140220_SF056_06 B20140220_SF056_06 TB317689.[MT7]-IVSLFAEHNDLQYAAPGGLIGVGTK[MT7].4b10_2.heavy 715.397 / 635.831 14614.0 41.31489944458008 41 11 10 10 10 0.8923025545093588 73.29723297913806 0.0 3 0.8749262886176145 3.4525919724817027 14614.0 24.18999511217557 0.0 - - - - - - - 316.0 29 22 EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa 1151 148 B20140220_SF056_06 B20140220_SF056_06 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 243878.0 38.81379954020182 23 -3 10 6 10 null 0.0 0.036602020263671875 3 0.0 0.0 243878.0 184.07897131546292 0.0 - - - - - - - 609.0 487 7 1153 148 B20140220_SF056_06 B20140220_SF056_06 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 477409.0 38.81379954020182 23 -3 10 6 10 null 0.0 0.036602020263671875 3 0.0 0.0 477409.0 215.450806902353 0.0 - - - - - - - 328.44444444444446 954 9 1155 148 B20140220_SF056_06 B20140220_SF056_06 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 541782.0 38.81379954020182 23 -3 10 6 10 null 0.0 0.036602020263671875 3 0.0 0.0 541782.0 208.24953433981196 0.0 - - - - - - - 291.2 1083 10 1157 149 B20140220_SF056_06 B20140220_SF056_06 TB317084.[MT7]-VSNEEK[MT7].2y4_1.heavy 497.276 / 663.343 1298.0 14.965025186538696 42 20 8 6 8 22.659870032182592 4.413087977026143 0.03609943389892578 4 0.9979638511365017 27.34537531463201 1298.0 7.760400250156347 0.0 - - - - - - - 145.47368421052633 2 19 PSENEN;ARID5B presenilin enhancer 2 homolog (C. elegans);AT rich interactive domain 5B (MRF1-like) 1159 149 B20140220_SF056_06 B20140220_SF056_06 TB317084.[MT7]-VSNEEK[MT7].2y5_1.heavy 497.276 / 750.375 13216.0 14.965025186538696 42 20 8 6 8 22.659870032182592 4.413087977026143 0.03609943389892578 4 0.9979638511365017 27.34537531463201 13216.0 89.7566551765533 1.0 - - - - - - - 169.04761904761904 36 21 PSENEN;ARID5B presenilin enhancer 2 homolog (C. elegans);AT rich interactive domain 5B (MRF1-like) 1161 149 B20140220_SF056_06 B20140220_SF056_06 TB317084.[MT7]-VSNEEK[MT7].2b4_1.heavy 497.276 / 574.295 3176.0 14.965025186538696 42 20 8 6 8 22.659870032182592 4.413087977026143 0.03609943389892578 4 0.9979638511365017 27.34537531463201 3176.0 15.785810841877788 0.0 - - - - - - - 214.52380952380952 6 21 PSENEN;ARID5B presenilin enhancer 2 homolog (C. elegans);AT rich interactive domain 5B (MRF1-like) 1163 149 B20140220_SF056_06 B20140220_SF056_06 TB317084.[MT7]-VSNEEK[MT7].2b5_1.heavy 497.276 / 703.338 2698.0 14.965025186538696 42 20 8 6 8 22.659870032182592 4.413087977026143 0.03609943389892578 4 0.9979638511365017 27.34537531463201 2698.0 30.1231506456241 0.0 - - - - - - - 143.91304347826087 5 23 PSENEN;ARID5B presenilin enhancer 2 homolog (C. elegans);AT rich interactive domain 5B (MRF1-like) 1165 150 B20140220_SF056_06 B20140220_SF056_06 TB317093.[MT7]-ELLVLK[MT7].2y4_1.heavy 501.844 / 616.451 9003.0 34.640734354654946 47 20 10 7 10 7.206986082550906 13.875425712575415 0.02809906005859375 3 0.9956098367300534 18.619285893739132 9003.0 7.613515514852938 0.0 - - - - - - - 1205.5 18 8 RNF214 ring finger protein 214 1167 150 B20140220_SF056_06 B20140220_SF056_06 TB317093.[MT7]-ELLVLK[MT7].2b3_1.heavy 501.844 / 500.32 12605.0 34.640734354654946 47 20 10 7 10 7.206986082550906 13.875425712575415 0.02809906005859375 3 0.9956098367300534 18.619285893739132 12605.0 9.765577333053882 1.0 - - - - - - - 1233.3846153846155 25 13 RNF214 ring finger protein 214 1169 150 B20140220_SF056_06 B20140220_SF056_06 TB317093.[MT7]-ELLVLK[MT7].2y5_1.heavy 501.844 / 729.536 9003.0 34.640734354654946 47 20 10 7 10 7.206986082550906 13.875425712575415 0.02809906005859375 3 0.9956098367300534 18.619285893739132 9003.0 26.361816016071334 0.0 - - - - - - - 697.0 18 12 RNF214 ring finger protein 214 1171 150 B20140220_SF056_06 B20140220_SF056_06 TB317093.[MT7]-ELLVLK[MT7].2b4_1.heavy 501.844 / 599.388 N/A 34.640734354654946 47 20 10 7 10 7.206986082550906 13.875425712575415 0.02809906005859375 3 0.9956098367300534 18.619285893739132 14928.0 19.655213547232222 0.0 - - - - - - - 772.4 29 10 RNF214 ring finger protein 214 1173 151 B20140220_SF056_06 B20140220_SF056_06 TB469994.[MT7]-SMVLEGGIR.2y8_1.heavy 553.311 / 874.482 15865.0 29.93910026550293 47 17 10 10 10 2.0543185421397356 34.30991988962283 0.0 3 0.9701137588080019 7.12096951353077 15865.0 64.39674427102867 0.0 - - - - - - - 196.9090909090909 31 11 SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 1175 151 B20140220_SF056_06 B20140220_SF056_06 TB469994.[MT7]-SMVLEGGIR.2y5_1.heavy 553.311 / 531.289 17140.0 29.93910026550293 47 17 10 10 10 2.0543185421397356 34.30991988962283 0.0 3 0.9701137588080019 7.12096951353077 17140.0 15.653758602570187 0.0 - - - - - - - 1765.857142857143 34 7 SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 1177 151 B20140220_SF056_06 B20140220_SF056_06 TB469994.[MT7]-SMVLEGGIR.2y6_1.heavy 553.311 / 644.373 21281.0 29.93910026550293 47 17 10 10 10 2.0543185421397356 34.30991988962283 0.0 3 0.9701137588080019 7.12096951353077 21281.0 32.555962844697504 0.0 - - - - - - - 1130.75 42 8 SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 1179 151 B20140220_SF056_06 B20140220_SF056_06 TB469994.[MT7]-SMVLEGGIR.2y7_1.heavy 553.311 / 743.441 11787.0 29.93910026550293 47 17 10 10 10 2.0543185421397356 34.30991988962283 0.0 3 0.9701137588080019 7.12096951353077 11787.0 28.719805914777087 0.0 - - - - - - - 254.91666666666666 23 12 SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 1181 152 B20140220_SF056_06 B20140220_SF056_06 TB317383.[MT7]-IHSDHLVASEK[MT7].3y3_1.heavy 508.619 / 507.289 16917.0 19.8164005279541 41 11 10 10 10 3.1214251098843806 32.036648799722144 0.0 3 0.85835723155532 3.239667033610043 16917.0 68.31092636579572 0.0 - - - - - - - 248.375 33 24 MUTED muted homolog (mouse) 1183 152 B20140220_SF056_06 B20140220_SF056_06 TB317383.[MT7]-IHSDHLVASEK[MT7].3b4_1.heavy 508.619 / 597.311 11149.0 19.8164005279541 41 11 10 10 10 3.1214251098843806 32.036648799722144 0.0 3 0.85835723155532 3.239667033610043 11149.0 35.97443861517172 0.0 - - - - - - - 734.6666666666666 22 9 MUTED muted homolog (mouse) 1185 152 B20140220_SF056_06 B20140220_SF056_06 TB317383.[MT7]-IHSDHLVASEK[MT7].3y4_1.heavy 508.619 / 578.327 45956.0 19.8164005279541 41 11 10 10 10 3.1214251098843806 32.036648799722144 0.0 3 0.85835723155532 3.239667033610043 45956.0 137.69118821276376 0.0 - - - - - - - 221.05882352941177 91 17 MUTED muted homolog (mouse) 1187 152 B20140220_SF056_06 B20140220_SF056_06 TB317383.[MT7]-IHSDHLVASEK[MT7].3y5_1.heavy 508.619 / 677.395 28390.0 19.8164005279541 41 11 10 10 10 3.1214251098843806 32.036648799722144 0.0 3 0.85835723155532 3.239667033610043 28390.0 123.20039620491347 0.0 - - - - - - - 204.63636363636363 56 22 MUTED muted homolog (mouse) 1189 153 B20140220_SF056_06 B20140220_SF056_06 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 507643.0 34.046600341796875 24 -3 9 10 8 null 0.0 0.0 4 0.0 0.0 507643.0 577.9317237835947 0.0 - - - - - - - 777.5714285714286 1015 7 1191 153 B20140220_SF056_06 B20140220_SF056_06 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 79369.0 34.046600341796875 24 -3 9 10 8 null 0.0 0.0 4 0.0 0.0 79369.0 139.18984146103008 2.0 - - - - - - - 1287.75 1153 8 1193 153 B20140220_SF056_06 B20140220_SF056_06 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 62512.0 34.046600341796875 24 -3 9 10 8 null 0.0 0.0 4 0.0 0.0 62512.0 85.84508841273143 0.0 - - - - - - - 1186.7272727272727 125 11 1195 154 B20140220_SF056_06 B20140220_SF056_06 TB317587.[MT7]-HPVSLEQYLMEGSYNK[MT7].3y7_1.heavy 728.373 / 972.458 3399.0 36.740400314331055 40 14 10 6 10 3.5143560014445603 22.749543670321966 0.032398223876953125 3 0.9469548512146494 5.334587198577724 3399.0 68.50756097560975 0.0 - - - - - - - 154.0 6 21 PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 1197 154 B20140220_SF056_06 B20140220_SF056_06 TB317587.[MT7]-HPVSLEQYLMEGSYNK[MT7].3y3_1.heavy 728.373 / 568.321 2358.0 36.740400314331055 40 14 10 6 10 3.5143560014445603 22.749543670321966 0.032398223876953125 3 0.9469548512146494 5.334587198577724 2358.0 8.566592221374878 1.0 - - - - - - - 267.125 4 16 PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 1199 154 B20140220_SF056_06 B20140220_SF056_06 TB317587.[MT7]-HPVSLEQYLMEGSYNK[MT7].3b6_1.heavy 728.373 / 807.448 1864.0 36.740400314331055 40 14 10 6 10 3.5143560014445603 22.749543670321966 0.032398223876953125 3 0.9469548512146494 5.334587198577724 1864.0 8.498480243161094 0.0 - - - - - - - 255.04347826086956 3 23 PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 1201 154 B20140220_SF056_06 B20140220_SF056_06 TB317587.[MT7]-HPVSLEQYLMEGSYNK[MT7].3b7_1.heavy 728.373 / 935.507 3454.0 36.740400314331055 40 14 10 6 10 3.5143560014445603 22.749543670321966 0.032398223876953125 3 0.9469548512146494 5.334587198577724 3454.0 18.419920943229062 0.0 - - - - - - - 210.16666666666666 6 18 PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 1203 155 B20140220_SF056_06 B20140220_SF056_06 TB470295.[MT7]-SFESWFDITSLSETAEDIIAK[MT7].3b4_1.heavy 893.121 / 595.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - HELLS helicase, lymphoid-specific 1205 155 B20140220_SF056_06 B20140220_SF056_06 TB470295.[MT7]-SFESWFDITSLSETAEDIIAK[MT7].3b5_1.heavy 893.121 / 781.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - HELLS helicase, lymphoid-specific 1207 155 B20140220_SF056_06 B20140220_SF056_06 TB470295.[MT7]-SFESWFDITSLSETAEDIIAK[MT7].3b3_1.heavy 893.121 / 508.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - HELLS helicase, lymphoid-specific 1209 155 B20140220_SF056_06 B20140220_SF056_06 TB470295.[MT7]-SFESWFDITSLSETAEDIIAK[MT7].3b7_1.heavy 893.121 / 1043.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - HELLS helicase, lymphoid-specific 1211 156 B20140220_SF056_06 B20140220_SF056_06 TB317175.[MT7]-VLEVDEK[MT7].2y4_1.heavy 560.329 / 634.353 19417.0 26.208025455474854 46 20 10 6 10 9.005533715659173 11.104283561352517 0.03849983215332031 3 0.9964406221188535 20.67980402473391 19417.0 38.92250833522682 0.0 - - - - - - - 227.55555555555554 38 9 PIRT phosphoinositide-interacting regulator of transient receptor potential channels 1213 156 B20140220_SF056_06 B20140220_SF056_06 TB317175.[MT7]-VLEVDEK[MT7].2y5_1.heavy 560.329 / 763.395 25258.0 26.208025455474854 46 20 10 6 10 9.005533715659173 11.104283561352517 0.03849983215332031 3 0.9964406221188535 20.67980402473391 25258.0 147.26322777282186 0.0 - - - - - - - 197.33333333333334 50 15 PIRT phosphoinositide-interacting regulator of transient receptor potential channels 1215 156 B20140220_SF056_06 B20140220_SF056_06 TB317175.[MT7]-VLEVDEK[MT7].2y3_1.heavy 560.329 / 535.284 16990.0 26.208025455474854 46 20 10 6 10 9.005533715659173 11.104283561352517 0.03849983215332031 3 0.9964406221188535 20.67980402473391 16990.0 57.36826330506234 0.0 - - - - - - - 780.0 33 7 PIRT phosphoinositide-interacting regulator of transient receptor potential channels 1217 156 B20140220_SF056_06 B20140220_SF056_06 TB317175.[MT7]-VLEVDEK[MT7].2y6_1.heavy 560.329 / 876.479 38304.0 26.208025455474854 46 20 10 6 10 9.005533715659173 11.104283561352517 0.03849983215332031 3 0.9964406221188535 20.67980402473391 38304.0 128.65804931170246 0.0 - - - - - - - 663.75 76 8 PIRT phosphoinositide-interacting regulator of transient receptor potential channels 1219 157 B20140220_SF056_06 B20140220_SF056_06 TB317673.[MT7]-SFESWFDITSLSETAEDIIAK[MT7].4b7_1.heavy 670.093 / 1043.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - HELLS helicase, lymphoid-specific 1221 157 B20140220_SF056_06 B20140220_SF056_06 TB317673.[MT7]-SFESWFDITSLSETAEDIIAK[MT7].4b4_1.heavy 670.093 / 595.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - HELLS helicase, lymphoid-specific 1223 157 B20140220_SF056_06 B20140220_SF056_06 TB317673.[MT7]-SFESWFDITSLSETAEDIIAK[MT7].4b5_1.heavy 670.093 / 781.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - HELLS helicase, lymphoid-specific 1225 157 B20140220_SF056_06 B20140220_SF056_06 TB317673.[MT7]-SFESWFDITSLSETAEDIIAK[MT7].4b3_1.heavy 670.093 / 508.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - HELLS helicase, lymphoid-specific 1227 158 B20140220_SF056_06 B20140220_SF056_06 TB317177.[MT7]-FTGVITQGR.2y8_1.heavy 561.823 / 831.468 84569.0 28.774100303649902 43 17 10 6 10 1.503654479728509 40.78809872750817 0.030399322509765625 3 0.9765254108460981 8.039149699531299 84569.0 443.01705289563597 0.0 - - - - - - - 261.53846153846155 169 13 CPXM2;AEBP1 carboxypeptidase X (M14 family), member 2;AE binding protein 1 1229 158 B20140220_SF056_06 B20140220_SF056_06 TB317177.[MT7]-FTGVITQGR.2y5_1.heavy 561.823 / 574.331 36684.0 28.774100303649902 43 17 10 6 10 1.503654479728509 40.78809872750817 0.030399322509765625 3 0.9765254108460981 8.039149699531299 36684.0 104.64130921871568 0.0 - - - - - - - 746.0 73 7 CPXM2;AEBP1 carboxypeptidase X (M14 family), member 2;AE binding protein 1 1231 158 B20140220_SF056_06 B20140220_SF056_06 TB317177.[MT7]-FTGVITQGR.2b4_1.heavy 561.823 / 549.315 26428.0 28.774100303649902 43 17 10 6 10 1.503654479728509 40.78809872750817 0.030399322509765625 3 0.9765254108460981 8.039149699531299 26428.0 48.33240957717779 0.0 - - - - - - - 651.9090909090909 52 11 CPXM2;AEBP1 carboxypeptidase X (M14 family), member 2;AE binding protein 1 1233 158 B20140220_SF056_06 B20140220_SF056_06 TB317177.[MT7]-FTGVITQGR.2y7_1.heavy 561.823 / 730.421 31273.0 28.774100303649902 43 17 10 6 10 1.503654479728509 40.78809872750817 0.030399322509765625 3 0.9765254108460981 8.039149699531299 31273.0 55.134479768786136 0.0 - - - - - - - 723.5 62 10 CPXM2;AEBP1 carboxypeptidase X (M14 family), member 2;AE binding protein 1 1235 159 B20140220_SF056_06 B20140220_SF056_06 TB317670.[MT7]-SPGRGSWFVQALC[CAM]SILEEHGK[MT7].4y5_1.heavy 662.348 / 743.38 4422.0 46.47460174560547 44 14 10 10 10 1.1972472209149374 55.22236582041628 0.0 3 0.9311254987272642 4.67528832458168 4422.0 16.948563775219423 0.0 - - - - - - - 184.1 8 20 CASP7 caspase 7, apoptosis-related cysteine peptidase 1237 159 B20140220_SF056_06 B20140220_SF056_06 TB317670.[MT7]-SPGRGSWFVQALC[CAM]SILEEHGK[MT7].4b8_2.heavy 662.348 / 510.263 1698.0 46.47460174560547 44 14 10 10 10 1.1972472209149374 55.22236582041628 0.0 3 0.9311254987272642 4.67528832458168 1698.0 -2.7387096774193553 0.0 - - - - - - - 238.3684210526316 3 19 CASP7 caspase 7, apoptosis-related cysteine peptidase 1239 159 B20140220_SF056_06 B20140220_SF056_06 TB317670.[MT7]-SPGRGSWFVQALC[CAM]SILEEHGK[MT7].4b11_2.heavy 662.348 / 659.345 4741.0 46.47460174560547 44 14 10 10 10 1.1972472209149374 55.22236582041628 0.0 3 0.9311254987272642 4.67528832458168 4741.0 22.641168318942544 0.0 - - - - - - - 288.4 9 20 CASP7 caspase 7, apoptosis-related cysteine peptidase 1241 159 B20140220_SF056_06 B20140220_SF056_06 TB317670.[MT7]-SPGRGSWFVQALC[CAM]SILEEHGK[MT7].4b10_2.heavy 662.348 / 623.826 3149.0 46.47460174560547 44 14 10 10 10 1.1972472209149374 55.22236582041628 0.0 3 0.9311254987272642 4.67528832458168 3149.0 20.46274779900581 0.0 - - - - - - - 187.5 6 20 CASP7 caspase 7, apoptosis-related cysteine peptidase 1243 160 B20140220_SF056_06 B20140220_SF056_06 TB469841.[MT7]-ANPFK[MT7].2b3_1.heavy 432.763 / 427.242 N/A N/A - - - - - - - - - 0.0 - - - - - - - CIB1 calcium and integrin binding 1 (calmyrin) 1245 160 B20140220_SF056_06 B20140220_SF056_06 TB469841.[MT7]-ANPFK[MT7].2y4_1.heavy 432.763 / 649.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - CIB1 calcium and integrin binding 1 (calmyrin) 1247 160 B20140220_SF056_06 B20140220_SF056_06 TB469841.[MT7]-ANPFK[MT7].2y4_2.heavy 432.763 / 325.193 N/A N/A - - - - - - - - - 0.0 - - - - - - - CIB1 calcium and integrin binding 1 (calmyrin) 1249 160 B20140220_SF056_06 B20140220_SF056_06 TB469841.[MT7]-ANPFK[MT7].2y3_1.heavy 432.763 / 535.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - CIB1 calcium and integrin binding 1 (calmyrin) 1251 161 B20140220_SF056_06 B20140220_SF056_06 TB317178.[MT7]-TGEGFLLVFSVTDR.3y6_1.heavy 562.306 / 724.362 54845.0 46.365501403808594 43 13 10 10 10 2.19781436326689 45.4997481458613 0.0 3 0.929791786058142 4.630140119678881 54845.0 194.21802717613403 0.0 - - - - - - - 705.3636363636364 109 11 RRAS2 related RAS viral (r-ras) oncogene homolog 2 1253 161 B20140220_SF056_06 B20140220_SF056_06 TB317178.[MT7]-TGEGFLLVFSVTDR.3b6_1.heavy 562.306 / 749.395 47714.0 46.365501403808594 43 13 10 10 10 2.19781436326689 45.4997481458613 0.0 3 0.929791786058142 4.630140119678881 47714.0 252.80562083492913 0.0 - - - - - - - 1173.7142857142858 95 7 RRAS2 related RAS viral (r-ras) oncogene homolog 2 1255 161 B20140220_SF056_06 B20140220_SF056_06 TB317178.[MT7]-TGEGFLLVFSVTDR.3b5_1.heavy 562.306 / 636.311 43834.0 46.365501403808594 43 13 10 10 10 2.19781436326689 45.4997481458613 0.0 3 0.929791786058142 4.630140119678881 43834.0 100.61302865560222 0.0 - - - - - - - 267.35714285714283 87 14 RRAS2 related RAS viral (r-ras) oncogene homolog 2 1257 161 B20140220_SF056_06 B20140220_SF056_06 TB317178.[MT7]-TGEGFLLVFSVTDR.3y5_1.heavy 562.306 / 577.294 45057.0 46.365501403808594 43 13 10 10 10 2.19781436326689 45.4997481458613 0.0 3 0.929791786058142 4.630140119678881 45057.0 63.175446805307395 0.0 - - - - - - - 687.3333333333334 90 9 RRAS2 related RAS viral (r-ras) oncogene homolog 2 1259 162 B20140220_SF056_06 B20140220_SF056_06 TB317077.[MT7]-SQIHSIR.2y6_1.heavy 492.789 / 753.437 2372.0 17.16550064086914 44 16 10 10 8 2.945449427781387 33.95067627262689 0.0 4 0.9697887229496006 7.082365546540449 2372.0 14.96893203883495 0.0 - - - - - - - 112.04347826086956 4 23 PDGFA platelet-derived growth factor alpha polypeptide 1261 162 B20140220_SF056_06 B20140220_SF056_06 TB317077.[MT7]-SQIHSIR.2y4_1.heavy 492.789 / 512.294 2716.0 17.16550064086914 44 16 10 10 8 2.945449427781387 33.95067627262689 0.0 4 0.9697887229496006 7.082365546540449 2716.0 13.184466019417474 0.0 - - - - - - - 165.08 5 25 PDGFA platelet-derived growth factor alpha polypeptide 1263 162 B20140220_SF056_06 B20140220_SF056_06 TB317077.[MT7]-SQIHSIR.2y5_1.heavy 492.789 / 625.378 1238.0 17.16550064086914 44 16 10 10 8 2.945449427781387 33.95067627262689 0.0 4 0.9697887229496006 7.082365546540449 1238.0 13.216988526037072 1.0 - - - - - - - 129.36 2 25 PDGFA platelet-derived growth factor alpha polypeptide 1265 162 B20140220_SF056_06 B20140220_SF056_06 TB317077.[MT7]-SQIHSIR.2b6_1.heavy 492.789 / 810.459 688.0 17.16550064086914 44 16 10 10 8 2.945449427781387 33.95067627262689 0.0 4 0.9697887229496006 7.082365546540449 688.0 3.489855072463768 6.0 - - - - - - - 0.0 1 0 PDGFA platelet-derived growth factor alpha polypeptide 1267 163 B20140220_SF056_06 B20140220_SF056_06 TB317078.[MT7]-YQC[CAM]VK[MT7].2b3_1.heavy 493.273 / 596.262 2899.0 19.094050407409668 38 12 10 6 10 1.4510558781271747 42.29547717257684 0.03149986267089844 3 0.8965477069416521 3.8034274718292034 2899.0 4.033410663944629 0.0 - - - - - - - 234.79166666666666 5 24 LOC100508006;AKR1C1;AKR1C2 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) 1269 163 B20140220_SF056_06 B20140220_SF056_06 TB317078.[MT7]-YQC[CAM]VK[MT7].2y4_1.heavy 493.273 / 678.372 14002.0 19.094050407409668 38 12 10 6 10 1.4510558781271747 42.29547717257684 0.03149986267089844 3 0.8965477069416521 3.8034274718292034 14002.0 128.78939700805523 0.0 - - - - - - - 179.04761904761904 28 21 LOC100508006;AKR1C1;AKR1C2 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) 1271 163 B20140220_SF056_06 B20140220_SF056_06 TB317078.[MT7]-YQC[CAM]VK[MT7].2b4_1.heavy 493.273 / 695.33 2767.0 19.094050407409668 38 12 10 6 10 1.4510558781271747 42.29547717257684 0.03149986267089844 3 0.8965477069416521 3.8034274718292034 2767.0 6.616702902914961 0.0 - - - - - - - 253.31578947368422 5 19 LOC100508006;AKR1C1;AKR1C2 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) 1273 163 B20140220_SF056_06 B20140220_SF056_06 TB317078.[MT7]-YQC[CAM]VK[MT7].2y3_1.heavy 493.273 / 550.314 11135.0 19.094050407409668 38 12 10 6 10 1.4510558781271747 42.29547717257684 0.03149986267089844 3 0.8965477069416521 3.8034274718292034 11135.0 23.411683878777307 0.0 - - - - - - - 280.76190476190476 22 21 LOC100508006;AKR1C1;AKR1C2 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) 1275 164 B20140220_SF056_06 B20140220_SF056_06 TB317072.[MT7]-VLDVVER.2y4_1.heavy 487.294 / 502.298 15002.0 30.014750480651855 34 18 4 6 6 7.548802355714613 13.247134484094389 0.034198760986328125 5 0.986527893146679 10.620765740873468 15002.0 4.146107784431138 2.0 - - - - - - - 0.0 92 0 ENTPD1 ectonucleoside triphosphate diphosphohydrolase 1 1277 164 B20140220_SF056_06 B20140220_SF056_06 TB317072.[MT7]-VLDVVER.2y5_1.heavy 487.294 / 617.325 8555.0 30.014750480651855 34 18 4 6 6 7.548802355714613 13.247134484094389 0.034198760986328125 5 0.986527893146679 10.620765740873468 8555.0 7.5638331705703035 4.0 - - - - - - - 0.0 31 0 ENTPD1 ectonucleoside triphosphate diphosphohydrolase 1 1279 164 B20140220_SF056_06 B20140220_SF056_06 TB317072.[MT7]-VLDVVER.2b4_1.heavy 487.294 / 571.357 8235.0 30.014750480651855 34 18 4 6 6 7.548802355714613 13.247134484094389 0.034198760986328125 5 0.986527893146679 10.620765740873468 8235.0 0.4360077704569967 3.0 - - - - - - - 0.0 28 0 ENTPD1 ectonucleoside triphosphate diphosphohydrolase 1 1281 164 B20140220_SF056_06 B20140220_SF056_06 TB317072.[MT7]-VLDVVER.2y6_1.heavy 487.294 / 730.409 23110.0 30.014750480651855 34 18 4 6 6 7.548802355714613 13.247134484094389 0.034198760986328125 5 0.986527893146679 10.620765740873468 23110.0 24.114782608695652 1.0 - - - - - - - 0.0 46 0 ENTPD1 ectonucleoside triphosphate diphosphohydrolase 1 1283 165 B20140220_SF056_06 B20140220_SF056_06 TB317074.[MT7]-QALGVTSR.2y5_1.heavy 488.289 / 519.289 6512.0 20.37886683146159 41 16 10 7 8 2.2223343332878183 39.32092747653907 0.028900146484375 4 0.9615967736092749 6.277384982235166 6512.0 25.74356997971602 0.0 - - - - - - - 639.0 13 14 SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 1285 165 B20140220_SF056_06 B20140220_SF056_06 TB317074.[MT7]-QALGVTSR.2b4_1.heavy 488.289 / 514.311 3124.0 20.37886683146159 41 16 10 7 8 2.2223343332878183 39.32092747653907 0.028900146484375 4 0.9615967736092749 6.277384982235166 3124.0 6.108116900542063 2.0 - - - - - - - 278.2083333333333 9 24 SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 1287 165 B20140220_SF056_06 B20140220_SF056_06 TB317074.[MT7]-QALGVTSR.2y6_1.heavy 488.289 / 632.373 4933.0 20.37886683146159 41 16 10 7 8 2.2223343332878183 39.32092747653907 0.028900146484375 4 0.9615967736092749 6.277384982235166 4933.0 29.812478260869565 0.0 - - - - - - - 292.0 9 25 SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 1289 165 B20140220_SF056_06 B20140220_SF056_06 TB317074.[MT7]-QALGVTSR.2y7_1.heavy 488.289 / 703.41 N/A 20.37886683146159 41 16 10 7 8 2.2223343332878183 39.32092747653907 0.028900146484375 4 0.9615967736092749 6.277384982235166 17529.0 20.924478142243878 1.0 - - - - - - - 331.14285714285717 35 14 SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 1291 166 B20140220_SF056_06 B20140220_SF056_06 TB317479.[MT7]-YSFMAVIHFAGLK[MT7].3b4_1.heavy 591.332 / 673.314 9129.0 44.38330078125 42 12 10 10 10 1.6214938192534802 41.78143873708576 0.0 3 0.8874068861173084 3.6428790293035895 9129.0 19.939244146675094 2.0 - - - - - - - 273.6923076923077 31 13 GALE UDP-galactose-4-epimerase 1293 166 B20140220_SF056_06 B20140220_SF056_06 TB317479.[MT7]-YSFMAVIHFAGLK[MT7].3b5_1.heavy 591.332 / 744.351 25479.0 44.38330078125 42 12 10 10 10 1.6214938192534802 41.78143873708576 0.0 3 0.8874068861173084 3.6428790293035895 25479.0 135.866018764154 0.0 - - - - - - - 262.57894736842104 50 19 GALE UDP-galactose-4-epimerase 1295 166 B20140220_SF056_06 B20140220_SF056_06 TB317479.[MT7]-YSFMAVIHFAGLK[MT7].3y4_1.heavy 591.332 / 532.357 28852.0 44.38330078125 42 12 10 10 10 1.6214938192534802 41.78143873708576 0.0 3 0.8874068861173084 3.6428790293035895 28852.0 124.49870636186427 0.0 - - - - - - - 650.6666666666666 57 12 GALE UDP-galactose-4-epimerase 1297 166 B20140220_SF056_06 B20140220_SF056_06 TB317479.[MT7]-YSFMAVIHFAGLK[MT7].3y5_1.heavy 591.332 / 679.426 29512.0 44.38330078125 42 12 10 10 10 1.6214938192534802 41.78143873708576 0.0 3 0.8874068861173084 3.6428790293035895 29512.0 138.4600744284955 0.0 - - - - - - - 317.72222222222223 59 18 GALE UDP-galactose-4-epimerase 1299 167 B20140220_SF056_06 B20140220_SF056_06 TB469986.[MT7]-GREHIAK[MT7].2y4_1.heavy 549.835 / 612.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCG2 secretogranin II 1301 167 B20140220_SF056_06 B20140220_SF056_06 TB469986.[MT7]-GREHIAK[MT7].2b4_1.heavy 549.835 / 624.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCG2 secretogranin II 1303 167 B20140220_SF056_06 B20140220_SF056_06 TB469986.[MT7]-GREHIAK[MT7].2b6_1.heavy 549.835 / 808.455 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCG2 secretogranin II 1305 167 B20140220_SF056_06 B20140220_SF056_06 TB469986.[MT7]-GREHIAK[MT7].2b5_1.heavy 549.835 / 737.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCG2 secretogranin II 1307 168 B20140220_SF056_06 B20140220_SF056_06 TB317273.[MT7]-THHDGAITER.2y6_1.heavy 640.827 / 646.352 1312.0 14.211099624633789 46 16 10 10 10 1.8028669849177055 43.98383093116051 0.0 3 0.9608285328318892 6.21511967663787 1312.0 76.7321212121212 0.0 - - - - - - - 82.0 2 6 CFD complement factor D (adipsin) 1309 168 B20140220_SF056_06 B20140220_SF056_06 TB317273.[MT7]-THHDGAITER.2y8_1.heavy 640.827 / 898.438 1115.0 14.211099624633789 46 16 10 10 10 1.8028669849177055 43.98383093116051 0.0 3 0.9608285328318892 6.21511967663787 1115.0 16.049242424242426 0.0 - - - - - - - 121.85714285714286 2 7 CFD complement factor D (adipsin) 1311 168 B20140220_SF056_06 B20140220_SF056_06 TB317273.[MT7]-THHDGAITER.2y9_1.heavy 640.827 / 1035.5 394.0 14.211099624633789 46 16 10 10 10 1.8028669849177055 43.98383093116051 0.0 3 0.9608285328318892 6.21511967663787 394.0 13.133333333333333 0.0 - - - - - - - 0.0 0 0 CFD complement factor D (adipsin) 1313 168 B20140220_SF056_06 B20140220_SF056_06 TB317273.[MT7]-THHDGAITER.2y7_1.heavy 640.827 / 761.379 689.0 14.211099624633789 46 16 10 10 10 1.8028669849177055 43.98383093116051 0.0 3 0.9608285328318892 6.21511967663787 689.0 16.97786332714904 0.0 - - - - - - - 0.0 1 0 CFD complement factor D (adipsin) 1315 169 B20140220_SF056_06 B20140220_SF056_06 TB317374.[MT7]-IDDFPNELEK[MT7].2y3_1.heavy 754.398 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - HELLS helicase, lymphoid-specific 1317 169 B20140220_SF056_06 B20140220_SF056_06 TB317374.[MT7]-IDDFPNELEK[MT7].2y6_1.heavy 754.398 / 873.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - HELLS helicase, lymphoid-specific 1319 169 B20140220_SF056_06 B20140220_SF056_06 TB317374.[MT7]-IDDFPNELEK[MT7].2y7_1.heavy 754.398 / 1020.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - HELLS helicase, lymphoid-specific 1321 170 B20140220_SF056_06 B20140220_SF056_06 TB469977.[MT7]-YAGLLEK[MT7].2y5_1.heavy 541.328 / 703.447 5461.0 30.9242000579834 50 20 10 10 10 8.954079619624327 11.16809367886719 0.0 3 0.991746669952815 13.575274262342214 5461.0 6.381803005008347 0.0 - - - - - - - 665.8888888888889 10 9 PAFAH1B1 platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) 1323 170 B20140220_SF056_06 B20140220_SF056_06 TB469977.[MT7]-YAGLLEK[MT7].2b4_1.heavy 541.328 / 549.315 6061.0 30.9242000579834 50 20 10 10 10 8.954079619624327 11.16809367886719 0.0 3 0.991746669952815 13.575274262342214 6061.0 9.916273403838622 0.0 - - - - - - - 713.5 12 14 PAFAH1B1 platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) 1325 170 B20140220_SF056_06 B20140220_SF056_06 TB469977.[MT7]-YAGLLEK[MT7].2y3_1.heavy 541.328 / 533.341 9724.0 30.9242000579834 50 20 10 10 10 8.954079619624327 11.16809367886719 0.0 3 0.991746669952815 13.575274262342214 9724.0 6.670709701447611 0.0 - - - - - - - 1748.125 19 8 PAFAH1B1 platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) 1327 170 B20140220_SF056_06 B20140220_SF056_06 TB469977.[MT7]-YAGLLEK[MT7].2y6_1.heavy 541.328 / 774.484 11123.0 30.9242000579834 50 20 10 10 10 8.954079619624327 11.16809367886719 0.0 3 0.991746669952815 13.575274262342214 11123.0 20.12251553835244 0.0 - - - - - - - 761.1428571428571 22 7 PAFAH1B1 platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) 1329 171 B20140220_SF056_06 B20140220_SF056_06 TB317167.[MT7]-APDVTTLPR.2y8_1.heavy 557.323 / 898.499 159106.0 26.89560031890869 40 14 10 6 10 3.177016432567905 31.47607263685836 0.03880119323730469 3 0.938831725818868 4.964325504457343 159106.0 327.0100747637184 0.0 - - - - - - - 614.2857142857143 318 7 NCSTN nicastrin 1331 171 B20140220_SF056_06 B20140220_SF056_06 TB317167.[MT7]-APDVTTLPR.2y5_1.heavy 557.323 / 587.351 15792.0 26.89560031890869 40 14 10 6 10 3.177016432567905 31.47607263685836 0.03880119323730469 3 0.938831725818868 4.964325504457343 15792.0 50.68842734702013 0.0 - - - - - - - 667.125 31 8 NCSTN nicastrin 1333 171 B20140220_SF056_06 B20140220_SF056_06 TB317167.[MT7]-APDVTTLPR.2y6_1.heavy 557.323 / 686.42 44485.0 26.89560031890869 40 14 10 6 10 3.177016432567905 31.47607263685836 0.03880119323730469 3 0.938831725818868 4.964325504457343 44485.0 133.54126376946434 0.0 - - - - - - - 267.0 88 10 NCSTN nicastrin 1335 171 B20140220_SF056_06 B20140220_SF056_06 TB317167.[MT7]-APDVTTLPR.2y7_1.heavy 557.323 / 801.446 8971.0 26.89560031890869 40 14 10 6 10 3.177016432567905 31.47607263685836 0.03880119323730469 3 0.938831725818868 4.964325504457343 8971.0 42.91269178678168 0.0 - - - - - - - 217.14285714285714 17 14 NCSTN nicastrin 1337 172 B20140220_SF056_06 B20140220_SF056_06 TB469874.[MT7]-RLISVLEQIR.3b4_1.heavy 457.625 / 614.411 75936.0 37.16630172729492 48 18 10 10 10 8.858412858102179 11.288703924940336 0.0 3 0.9827868219505365 9.39305571261406 75936.0 246.79022539161093 0.0 - - - - - - - 741.4 151 10 IDI1 isopentenyl-diphosphate delta isomerase 1 1339 172 B20140220_SF056_06 B20140220_SF056_06 TB469874.[MT7]-RLISVLEQIR.3b5_1.heavy 457.625 / 713.479 101066.0 37.16630172729492 48 18 10 10 10 8.858412858102179 11.288703924940336 0.0 3 0.9827868219505365 9.39305571261406 101066.0 264.7452491513514 0.0 - - - - - - - 305.5 202 10 IDI1 isopentenyl-diphosphate delta isomerase 1 1341 172 B20140220_SF056_06 B20140220_SF056_06 TB469874.[MT7]-RLISVLEQIR.3y4_1.heavy 457.625 / 545.304 285972.0 37.16630172729492 48 18 10 10 10 8.858412858102179 11.288703924940336 0.0 3 0.9827868219505365 9.39305571261406 285972.0 341.0517708564119 0.0 - - - - - - - 1230.4285714285713 571 7 IDI1 isopentenyl-diphosphate delta isomerase 1 1343 172 B20140220_SF056_06 B20140220_SF056_06 TB469874.[MT7]-RLISVLEQIR.3y5_1.heavy 457.625 / 658.388 207856.0 37.16630172729492 48 18 10 10 10 8.858412858102179 11.288703924940336 0.0 3 0.9827868219505365 9.39305571261406 207856.0 632.0991554526516 0.0 - - - - - - - 792.5384615384615 415 13 IDI1 isopentenyl-diphosphate delta isomerase 1 1345 173 B20140220_SF056_06 B20140220_SF056_06 TB317166.[MT7]-VFVGQFK[MT7].2y4_1.heavy 556.839 / 623.363 33157.0 32.39387512207031 46 20 10 6 10 5.762819173673273 17.35261804792308 0.0364990234375 3 0.9911021506639546 13.073663283853033 33157.0 39.89674913426343 0.0 - - - - - - - 769.3 66 10 PABPC3 poly(A) binding protein, cytoplasmic 3 1347 173 B20140220_SF056_06 B20140220_SF056_06 TB317166.[MT7]-VFVGQFK[MT7].2y5_1.heavy 556.839 / 722.432 17838.0 32.39387512207031 46 20 10 6 10 5.762819173673273 17.35261804792308 0.0364990234375 3 0.9911021506639546 13.073663283853033 17838.0 61.19416413966384 0.0 - - - - - - - 720.0 35 7 PABPC3 poly(A) binding protein, cytoplasmic 3 1349 173 B20140220_SF056_06 B20140220_SF056_06 TB317166.[MT7]-VFVGQFK[MT7].2y6_1.heavy 556.839 / 869.5 31433.0 32.39387512207031 46 20 10 6 10 5.762819173673273 17.35261804792308 0.0364990234375 3 0.9911021506639546 13.073663283853033 31433.0 123.63898554775946 0.0 - - - - - - - 310.9375 62 16 PABPC3 poly(A) binding protein, cytoplasmic 3 1351 173 B20140220_SF056_06 B20140220_SF056_06 TB317166.[MT7]-VFVGQFK[MT7].2b5_1.heavy 556.839 / 675.395 4841.0 32.39387512207031 46 20 10 6 10 5.762819173673273 17.35261804792308 0.0364990234375 3 0.9911021506639546 13.073663283853033 4841.0 9.116187579343778 0.0 - - - - - - - 737.75 9 8 PABPC3 poly(A) binding protein, cytoplasmic 3 1353 174 B20140220_SF056_06 B20140220_SF056_06 TB317165.[MT7]-M[OXI]SGIK[MT7]K[MT7].2y4_1.heavy 556.347 / 733.517 5758.0 25.738999843597412 46 20 10 6 10 16.530408739403562 6.049457189865477 0.03999900817871094 3 0.9959746697443076 19.445352565029896 5758.0 14.357089917231 0.0 - - - - - - - 260.47058823529414 11 17 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 1355 174 B20140220_SF056_06 B20140220_SF056_06 TB317165.[MT7]-M[OXI]SGIK[MT7]K[MT7].2y5_1.heavy 556.347 / 820.549 14322.0 25.738999843597412 46 20 10 6 10 16.530408739403562 6.049457189865477 0.03999900817871094 3 0.9959746697443076 19.445352565029896 14322.0 26.954988994864273 0.0 - - - - - - - 696.0 28 7 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 1357 174 B20140220_SF056_06 B20140220_SF056_06 TB317165.[MT7]-M[OXI]SGIK[MT7]K[MT7].2b4_1.heavy 556.347 / 549.282 6644.0 25.738999843597412 46 20 10 6 10 16.530408739403562 6.049457189865477 0.03999900817871094 3 0.9959746697443076 19.445352565029896 6644.0 11.017123519458545 0.0 - - - - - - - 671.9 13 10 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 1359 174 B20140220_SF056_06 B20140220_SF056_06 TB317165.[MT7]-M[OXI]SGIK[MT7]K[MT7].2y3_1.heavy 556.347 / 676.496 5094.0 25.738999843597412 46 20 10 6 10 16.530408739403562 6.049457189865477 0.03999900817871094 3 0.9959746697443076 19.445352565029896 5094.0 7.4925508326650005 0.0 - - - - - - - 643.4285714285714 22 7 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 1361 175 B20140220_SF056_06 B20140220_SF056_06 TB317026.[MT7]-IFDPK[MT7].2y4_1.heavy 454.278 / 650.363 21040.0 27.946850299835205 44 20 10 6 8 4.364271969799933 22.913329116971646 0.030599594116210938 4 0.9989689010800187 38.430397805407914 21040.0 37.791732629010944 0.0 - - - - - - - 726.6666666666666 42 9 GSTM3 glutathione S-transferase mu 3 (brain) 1363 175 B20140220_SF056_06 B20140220_SF056_06 TB317026.[MT7]-IFDPK[MT7].2b3_1.heavy 454.278 / 520.289 238246.0 27.946850299835205 44 20 10 6 8 4.364271969799933 22.913329116971646 0.030599594116210938 4 0.9989689010800187 38.430397805407914 238246.0 279.68328699413036 0.0 - - - - - - - 303.5 476 2 GSTM3 glutathione S-transferase mu 3 (brain) 1365 175 B20140220_SF056_06 B20140220_SF056_06 TB317026.[MT7]-IFDPK[MT7].2b4_1.heavy 454.278 / 617.341 1821.0 27.946850299835205 44 20 10 6 8 4.364271969799933 22.913329116971646 0.030599594116210938 4 0.9989689010800187 38.430397805407914 1821.0 0.0 14.0 - - - - - - - 1301.6 15 10 GSTM3 glutathione S-transferase mu 3 (brain) 1367 175 B20140220_SF056_06 B20140220_SF056_06 TB317026.[MT7]-IFDPK[MT7].2y3_1.heavy 454.278 / 503.295 7418.0 27.946850299835205 44 20 10 6 8 4.364271969799933 22.913329116971646 0.030599594116210938 4 0.9989689010800187 38.430397805407914 7418.0 5.679425573145132 1.0 - - - - - - - 1734.0 36 7 GSTM3 glutathione S-transferase mu 3 (brain) 1369 176 B20140220_SF056_06 B20140220_SF056_06 TB470127.[MT7]-ILDSAEFIK[MT7].2y8_1.heavy 662.392 / 1066.59 13969.0 36.25510025024414 42 16 10 6 10 2.092764714372398 38.19023741846613 0.03839874267578125 3 0.9645939492097858 6.539338796409217 13969.0 98.16939598340065 0.0 - - - - - - - 232.8125 27 16 GTF2I general transcription factor IIi 1371 176 B20140220_SF056_06 B20140220_SF056_06 TB470127.[MT7]-ILDSAEFIK[MT7].2b6_1.heavy 662.392 / 773.416 5697.0 36.25510025024414 42 16 10 6 10 2.092764714372398 38.19023741846613 0.03839874267578125 3 0.9645939492097858 6.539338796409217 5697.0 8.250646435356465 0.0 - - - - - - - 668.2 11 10 GTF2I general transcription factor IIi 1373 176 B20140220_SF056_06 B20140220_SF056_06 TB470127.[MT7]-ILDSAEFIK[MT7].2y3_1.heavy 662.392 / 551.367 6902.0 36.25510025024414 42 16 10 6 10 2.092764714372398 38.19023741846613 0.03839874267578125 3 0.9645939492097858 6.539338796409217 6902.0 14.892633694821772 0.0 - - - - - - - 634.0 13 7 GTF2I general transcription factor IIi 1375 176 B20140220_SF056_06 B20140220_SF056_06 TB470127.[MT7]-ILDSAEFIK[MT7].2y6_1.heavy 662.392 / 838.479 13530.0 36.25510025024414 42 16 10 6 10 2.092764714372398 38.19023741846613 0.03839874267578125 3 0.9645939492097858 6.539338796409217 13530.0 57.76506849315068 0.0 - - - - - - - 273.8888888888889 27 18 GTF2I general transcription factor IIi 1377 177 B20140220_SF056_06 B20140220_SF056_06 TB470276.[MT7]-NREPVQLETLSIR.3y7_1.heavy 566.992 / 831.493 14839.0 31.726125240325928 41 17 10 6 8 4.859452591240341 20.578449552169765 0.03890037536621094 4 0.9774986342449596 8.211834692059947 14839.0 5.792713077423553 2.0 - - - - - - - 613.9090909090909 48 11 LOC100129492;SNRPD1 small nuclear ribonucleoprotein Sm D1-like;small nuclear ribonucleoprotein D1 polypeptide 16kDa 1379 177 B20140220_SF056_06 B20140220_SF056_06 TB470276.[MT7]-NREPVQLETLSIR.3y6_1.heavy 566.992 / 718.409 27939.0 31.726125240325928 41 17 10 6 8 4.859452591240341 20.578449552169765 0.03890037536621094 4 0.9774986342449596 8.211834692059947 27939.0 48.05746794871795 0.0 - - - - - - - 695.3 55 10 LOC100129492;SNRPD1 small nuclear ribonucleoprotein Sm D1-like;small nuclear ribonucleoprotein D1 polypeptide 16kDa 1381 177 B20140220_SF056_06 B20140220_SF056_06 TB470276.[MT7]-NREPVQLETLSIR.3b5_1.heavy 566.992 / 740.417 9558.0 31.726125240325928 41 17 10 6 8 4.859452591240341 20.578449552169765 0.03890037536621094 4 0.9774986342449596 8.211834692059947 9558.0 31.85683447697705 0.0 - - - - - - - 284.1666666666667 19 12 LOC100129492;SNRPD1 small nuclear ribonucleoprotein Sm D1-like;small nuclear ribonucleoprotein D1 polypeptide 16kDa 1383 177 B20140220_SF056_06 B20140220_SF056_06 TB470276.[MT7]-NREPVQLETLSIR.3y5_1.heavy 566.992 / 589.367 28140.0 31.726125240325928 41 17 10 6 8 4.859452591240341 20.578449552169765 0.03890037536621094 4 0.9774986342449596 8.211834692059947 28140.0 111.36859742054352 0.0 - - - - - - - 744.7142857142857 56 7 LOC100129492;SNRPD1 small nuclear ribonucleoprotein Sm D1-like;small nuclear ribonucleoprotein D1 polypeptide 16kDa 1385 178 B20140220_SF056_06 B20140220_SF056_06 TB470120.[MT7]-K[MT7]WTLSLK[MT7].3y3_1.heavy 436.619 / 491.331 88033.0 31.561100006103516 43 13 10 10 10 9.056760437704689 11.041475667578066 0.0 3 0.9208231965433068 4.356676937595894 88033.0 63.92415119423676 0.0 - - - - - - - 401.0 176 1 FGFRL1 fibroblast growth factor receptor-like 1 1387 178 B20140220_SF056_06 B20140220_SF056_06 TB470120.[MT7]-K[MT7]WTLSLK[MT7].3y4_1.heavy 436.619 / 604.415 36964.0 31.561100006103516 43 13 10 10 10 9.056760437704689 11.041475667578066 0.0 3 0.9208231965433068 4.356676937595894 36964.0 128.63539544695203 0.0 - - - - - - - 649.4285714285714 73 7 FGFRL1 fibroblast growth factor receptor-like 1 1389 178 B20140220_SF056_06 B20140220_SF056_06 TB470120.[MT7]-K[MT7]WTLSLK[MT7].3y3_2.heavy 436.619 / 246.169 5749.0 31.561100006103516 43 13 10 10 10 9.056760437704689 11.041475667578066 0.0 3 0.9208231965433068 4.356676937595894 5749.0 1.8623038443066615 5.0 - - - - - - - 2186.714285714286 47 7 FGFRL1 fibroblast growth factor receptor-like 1 1391 178 B20140220_SF056_06 B20140220_SF056_06 TB470120.[MT7]-K[MT7]WTLSLK[MT7].3y5_1.heavy 436.619 / 705.463 11898.0 31.561100006103516 43 13 10 10 10 9.056760437704689 11.041475667578066 0.0 3 0.9208231965433068 4.356676937595894 11898.0 67.10951058660187 0.0 - - - - - - - 175.6875 23 16 FGFRL1 fibroblast growth factor receptor-like 1 1393 179 B20140220_SF056_06 B20140220_SF056_06 TB470277.[MT7]-VFQSWWDRNLGR.3b4_1.heavy 569.966 / 606.337 28965.0 38.603599548339844 45 15 10 10 10 2.621830466096719 33.475512527694924 0.0 3 0.9585697454678386 6.0421657873197185 28965.0 48.80378520213963 0.0 - - - - - - - 775.5 57 10 BAD BCL2-associated agonist of cell death 1395 179 B20140220_SF056_06 B20140220_SF056_06 TB470277.[MT7]-VFQSWWDRNLGR.3y11_2.heavy 569.966 / 732.86 149600.0 38.603599548339844 45 15 10 10 10 2.621830466096719 33.475512527694924 0.0 3 0.9585697454678386 6.0421657873197185 149600.0 179.00625177428003 0.0 - - - - - - - 373.85714285714283 299 7 BAD BCL2-associated agonist of cell death 1397 179 B20140220_SF056_06 B20140220_SF056_06 TB470277.[MT7]-VFQSWWDRNLGR.3b3_1.heavy 569.966 / 519.305 22802.0 38.603599548339844 45 15 10 10 10 2.621830466096719 33.475512527694924 0.0 3 0.9585697454678386 6.0421657873197185 22802.0 38.747963410509186 0.0 - - - - - - - 1210.4285714285713 45 7 BAD BCL2-associated agonist of cell death 1399 179 B20140220_SF056_06 B20140220_SF056_06 TB470277.[MT7]-VFQSWWDRNLGR.3y5_1.heavy 569.966 / 615.369 13096.0 38.603599548339844 45 15 10 10 10 2.621830466096719 33.475512527694924 0.0 3 0.9585697454678386 6.0421657873197185 13096.0 23.533968049649467 0.0 - - - - - - - 676.9090909090909 26 11 BAD BCL2-associated agonist of cell death 1401 180 B20140220_SF056_06 B20140220_SF056_06 TB470121.[MT7]-SRFVDFQK[MT7].3y3_1.heavy 438.918 / 566.342 83249.0 26.952600479125977 43 13 10 10 10 2.598954672861154 38.47700810030341 0.0 3 0.9290886325125781 4.60684966377507 83249.0 105.29749085278708 0.0 - - - - - - - 1220.0 166 7 MCM6 minichromosome maintenance complex component 6 1403 180 B20140220_SF056_06 B20140220_SF056_06 TB470121.[MT7]-SRFVDFQK[MT7].3b4_1.heavy 438.918 / 634.379 5644.0 26.952600479125977 43 13 10 10 10 2.598954672861154 38.47700810030341 0.0 3 0.9290886325125781 4.60684966377507 5644.0 12.302555863111047 2.0 - - - - - - - 297.0 19 12 MCM6 minichromosome maintenance complex component 6 1405 180 B20140220_SF056_06 B20140220_SF056_06 TB470121.[MT7]-SRFVDFQK[MT7].3b5_1.heavy 438.918 / 749.406 26883.0 26.952600479125977 43 13 10 10 10 2.598954672861154 38.47700810030341 0.0 3 0.9290886325125781 4.60684966377507 26883.0 222.04142775453695 0.0 - - - - - - - 203.13333333333333 53 15 MCM6 minichromosome maintenance complex component 6 1407 180 B20140220_SF056_06 B20140220_SF056_06 TB470121.[MT7]-SRFVDFQK[MT7].3y4_1.heavy 438.918 / 681.369 17081.0 26.952600479125977 43 13 10 10 10 2.598954672861154 38.47700810030341 0.0 3 0.9290886325125781 4.60684966377507 17081.0 23.106834088750755 0.0 - - - - - - - 247.6 34 15 MCM6 minichromosome maintenance complex component 6 1409 181 B20140220_SF056_06 B20140220_SF056_06 TB317567.[MT7]-NISGVVLADHSGAFHNK[MT7].4b4_1.heavy 514.281 / 516.29 65334.0 28.132699966430664 43 13 10 10 10 1.942226181162499 40.73738225748943 0.0 3 0.9175009027118227 4.266834671417255 65334.0 71.35202726345865 0.0 - - - - - - - 1265.142857142857 130 7 NCSTN nicastrin 1411 181 B20140220_SF056_06 B20140220_SF056_06 TB317567.[MT7]-NISGVVLADHSGAFHNK[MT7].4b5_1.heavy 514.281 / 615.358 101850.0 28.132699966430664 43 13 10 10 10 1.942226181162499 40.73738225748943 0.0 3 0.9175009027118227 4.266834671417255 101850.0 132.00359212245036 0.0 - - - - - - - 766.5 203 8 NCSTN nicastrin 1413 181 B20140220_SF056_06 B20140220_SF056_06 TB317567.[MT7]-NISGVVLADHSGAFHNK[MT7].4y7_1.heavy 514.281 / 904.476 12331.0 28.132699966430664 43 13 10 10 10 1.942226181162499 40.73738225748943 0.0 3 0.9175009027118227 4.266834671417255 12331.0 59.881161810518606 0.0 - - - - - - - 188.04761904761904 24 21 NCSTN nicastrin 1415 181 B20140220_SF056_06 B20140220_SF056_06 TB317567.[MT7]-NISGVVLADHSGAFHNK[MT7].4y6_1.heavy 514.281 / 817.444 12808.0 28.132699966430664 43 13 10 10 10 1.942226181162499 40.73738225748943 0.0 3 0.9175009027118227 4.266834671417255 12808.0 31.33218559444051 0.0 - - - - - - - 292.6470588235294 25 17 NCSTN nicastrin 1417 182 B20140220_SF056_06 B20140220_SF056_06 TB469878.[MT7]-ELTADAR.2b3_1.heavy 460.252 / 488.284 12029.0 19.209199905395508 44 14 10 10 10 3.6318861625914187 27.533902639902163 0.0 3 0.9459508812435811 5.2843585975800735 12029.0 25.941983407792893 1.0 - - - - - - - 343.25 41 16 LIMS1 LIM and senescent cell antigen-like domains 1 1419 182 B20140220_SF056_06 B20140220_SF056_06 TB469878.[MT7]-ELTADAR.2y5_1.heavy 460.252 / 533.268 20298.0 19.209199905395508 44 14 10 10 10 3.6318861625914187 27.533902639902163 0.0 3 0.9459508812435811 5.2843585975800735 20298.0 52.590793860954385 0.0 - - - - - - - 686.3333333333334 40 9 LIMS1 LIM and senescent cell antigen-like domains 1 1421 182 B20140220_SF056_06 B20140220_SF056_06 TB469878.[MT7]-ELTADAR.2y6_1.heavy 460.252 / 646.352 41544.0 19.209199905395508 44 14 10 10 10 3.6318861625914187 27.533902639902163 0.0 3 0.9459508812435811 5.2843585975800735 41544.0 45.45597160475526 0.0 - - - - - - - 667.7142857142857 83 14 LIMS1 LIM and senescent cell antigen-like domains 1 1423 182 B20140220_SF056_06 B20140220_SF056_06 TB469878.[MT7]-ELTADAR.2b5_1.heavy 460.252 / 674.348 202851.0 19.209199905395508 44 14 10 10 10 3.6318861625914187 27.533902639902163 0.0 3 0.9459508812435811 5.2843585975800735 202851.0 204.0031833749347 0.0 - - - - - - - 711.6666666666666 405 9 LIMS1 LIM and senescent cell antigen-like domains 1 1425 183 B20140220_SF056_06 B20140220_SF056_06 TB469973.[MT7]-GNSVERK[MT7].2b4_1.heavy 539.316 / 502.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCSTN nicastrin 1427 183 B20140220_SF056_06 B20140220_SF056_06 TB469973.[MT7]-GNSVERK[MT7].2b6_1.heavy 539.316 / 787.418 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCSTN nicastrin 1429 183 B20140220_SF056_06 B20140220_SF056_06 TB469973.[MT7]-GNSVERK[MT7].2y6_1.heavy 539.316 / 876.502 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCSTN nicastrin 1431 183 B20140220_SF056_06 B20140220_SF056_06 TB469973.[MT7]-GNSVERK[MT7].2b5_1.heavy 539.316 / 631.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCSTN nicastrin 1433 184 B20140220_SF056_06 B20140220_SF056_06 TB470371.[MT7]-GDSGGPLVC[CAM]GGVLEGVVTSGSR.3b5_1.heavy 735.375 / 518.233 12429.0 37.10287666320801 39 13 10 6 10 2.749892014440337 28.980848824044696 0.03549957275390625 3 0.9237610529222307 4.440944532371698 12429.0 30.732424413064194 0.0 - - - - - - - 727.25 24 8 CFD complement factor D (adipsin) 1435 184 B20140220_SF056_06 B20140220_SF056_06 TB470371.[MT7]-GDSGGPLVC[CAM]GGVLEGVVTSGSR.3b8_1.heavy 735.375 / 827.438 15550.0 37.10287666320801 39 13 10 6 10 2.749892014440337 28.980848824044696 0.03549957275390625 3 0.9237610529222307 4.440944532371698 15550.0 42.17565856915799 0.0 - - - - - - - 304.125 31 8 CFD complement factor D (adipsin) 1437 184 B20140220_SF056_06 B20140220_SF056_06 TB470371.[MT7]-GDSGGPLVC[CAM]GGVLEGVVTSGSR.3y8_1.heavy 735.375 / 762.41 20839.0 37.10287666320801 39 13 10 6 10 2.749892014440337 28.980848824044696 0.03549957275390625 3 0.9237610529222307 4.440944532371698 20839.0 109.20762432432433 0.0 - - - - - - - 271.92857142857144 41 14 CFD complement factor D (adipsin) 1439 184 B20140220_SF056_06 B20140220_SF056_06 TB470371.[MT7]-GDSGGPLVC[CAM]GGVLEGVVTSGSR.3b7_1.heavy 735.375 / 728.37 20469.0 37.10287666320801 39 13 10 6 10 2.749892014440337 28.980848824044696 0.03549957275390625 3 0.9237610529222307 4.440944532371698 20469.0 34.07715477246457 0.0 - - - - - - - 748.0 40 7 CFD complement factor D (adipsin) 1441 185 B20140220_SF056_06 B20140220_SF056_06 TB470370.[MT7]-SDEPARDDAAVETAEEAK[MT7].4y4_1.heavy 548.769 / 620.337 44958.0 23.736400604248047 43 13 10 10 10 0.9678116424719779 65.01626950814605 0.0 3 0.9233937605205804 4.4301460541625115 44958.0 132.53055025438186 0.0 - - - - - - - 667.0 89 9 BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 1443 185 B20140220_SF056_06 B20140220_SF056_06 TB470370.[MT7]-SDEPARDDAAVETAEEAK[MT7].4b8_2.heavy 548.769 / 515.732 11218.0 23.736400604248047 43 13 10 10 10 0.9678116424719779 65.01626950814605 0.0 3 0.9233937605205804 4.4301460541625115 11218.0 15.798545655375552 0.0 - - - - - - - 1210.8181818181818 22 11 BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 1445 185 B20140220_SF056_06 B20140220_SF056_06 TB470370.[MT7]-SDEPARDDAAVETAEEAK[MT7].4b10_1.heavy 548.769 / 1172.53 N/A 23.736400604248047 43 13 10 10 10 0.9678116424719779 65.01626950814605 0.0 3 0.9233937605205804 4.4301460541625115 88.0 0.0 1.0 - - - - - - - 0.0 0 0 BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 1447 185 B20140220_SF056_06 B20140220_SF056_06 TB470370.[MT7]-SDEPARDDAAVETAEEAK[MT7].4b10_2.heavy 548.769 / 586.769 84220.0 23.736400604248047 43 13 10 10 10 0.9678116424719779 65.01626950814605 0.0 3 0.9233937605205804 4.4301460541625115 84220.0 183.52881319386375 0.0 - - - - - - - 730.3333333333334 168 9 BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 1449 186 B20140220_SF056_06 B20140220_SF056_06 TB317563.[MT7]-GFGFVSFERHEDAQK[MT7].4y4_1.heavy 511.264 / 605.338 18886.0 31.795499801635742 44 14 10 10 10 2.5751704056521705 38.83238164764272 0.0 3 0.939829996314801 5.005763157256304 18886.0 24.371720683457838 0.0 - - - - - - - 1221.2 37 10 PABPC1;PABPC3 poly(A) binding protein, cytoplasmic 1;poly(A) binding protein, cytoplasmic 3 1451 186 B20140220_SF056_06 B20140220_SF056_06 TB317563.[MT7]-GFGFVSFERHEDAQK[MT7].4y10_2.heavy 511.264 / 695.845 133737.0 31.795499801635742 44 14 10 10 10 2.5751704056521705 38.83238164764272 0.0 3 0.939829996314801 5.005763157256304 133737.0 98.09952740472973 0.0 - - - - - - - 253.6 267 5 PABPC1;PABPC3 poly(A) binding protein, cytoplasmic 1;poly(A) binding protein, cytoplasmic 3 1453 186 B20140220_SF056_06 B20140220_SF056_06 TB317563.[MT7]-GFGFVSFERHEDAQK[MT7].4b4_1.heavy 511.264 / 553.289 142546.0 31.795499801635742 44 14 10 10 10 2.5751704056521705 38.83238164764272 0.0 3 0.939829996314801 5.005763157256304 142546.0 134.74009172343114 0.0 - - - - - - - 367.0 285 2 PABPC1;PABPC3 poly(A) binding protein, cytoplasmic 1;poly(A) binding protein, cytoplasmic 3 1455 186 B20140220_SF056_06 B20140220_SF056_06 TB317563.[MT7]-GFGFVSFERHEDAQK[MT7].4y6_1.heavy 511.264 / 871.439 5539.0 31.795499801635742 44 14 10 10 10 2.5751704056521705 38.83238164764272 0.0 3 0.939829996314801 5.005763157256304 5539.0 54.07820956886599 0.0 - - - - - - - 153.45 11 20 PABPC1;PABPC3 poly(A) binding protein, cytoplasmic 1;poly(A) binding protein, cytoplasmic 3 1457 187 B20140220_SF056_06 B20140220_SF056_06 TB470384.[MT7]-LDHVRAEAETLPSLSITK[MT7].4y4_1.heavy 567.826 / 592.379 41863.0 32.81909942626953 45 15 10 10 10 3.271307794735955 23.959447037946163 0.0 3 0.9568728391245571 5.921253053117048 41863.0 39.0976615704733 0.0 - - - - - - - 1230.142857142857 83 7 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 1459 187 B20140220_SF056_06 B20140220_SF056_06 TB470384.[MT7]-LDHVRAEAETLPSLSITK[MT7].4y3_1.heavy 567.826 / 505.347 23271.0 32.81909942626953 45 15 10 10 10 3.271307794735955 23.959447037946163 0.0 3 0.9568728391245571 5.921253053117048 23271.0 29.05198613254383 0.0 - - - - - - - 1310.2222222222222 46 9 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 1461 187 B20140220_SF056_06 B20140220_SF056_06 TB470384.[MT7]-LDHVRAEAETLPSLSITK[MT7].4b10_2.heavy 567.826 / 633.832 50223.0 32.81909942626953 45 15 10 10 10 3.271307794735955 23.959447037946163 0.0 3 0.9568728391245571 5.921253053117048 50223.0 44.03180886498271 0.0 - - - - - - - 1247.875 100 8 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 1463 187 B20140220_SF056_06 B20140220_SF056_06 TB470384.[MT7]-LDHVRAEAETLPSLSITK[MT7].4b9_2.heavy 567.826 / 583.308 21711.0 32.81909942626953 45 15 10 10 10 3.271307794735955 23.959447037946163 0.0 3 0.9568728391245571 5.921253053117048 21711.0 10.030310018669397 0.0 - - - - - - - 998.0 43 1 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 1465 188 B20140220_SF056_06 B20140220_SF056_06 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 249579.0 42.25800069173177 23 -3 10 6 10 null 0.0 0.033000946044921875 3 0.0 0.0 249579.0 461.20876155345917 0.0 - - - - - - - 274.4 499 5 1467 188 B20140220_SF056_06 B20140220_SF056_06 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 496166.0 42.25800069173177 23 -3 10 6 10 null 0.0 0.033000946044921875 3 0.0 0.0 496166.0 741.2566926826586 0.0 - - - - - - - 774.5 992 4 1469 188 B20140220_SF056_06 B20140220_SF056_06 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 387221.0 42.25800069173177 23 -3 10 6 10 null 0.0 0.033000946044921875 3 0.0 0.0 387221.0 587.2733720379819 0.0 - - - - - - - 422.5 774 4 1471 189 B20140220_SF056_06 B20140220_SF056_06 TB317699.[MT7]-EVMFLNELEEILDVIEPSEFSK[MT7].4b7_1.heavy 725.379 / 1007.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5D protein phosphatase 2, regulatory subunit B', delta 1473 189 B20140220_SF056_06 B20140220_SF056_06 TB317699.[MT7]-EVMFLNELEEILDVIEPSEFSK[MT7].4b4_1.heavy 725.379 / 651.329 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5D protein phosphatase 2, regulatory subunit B', delta 1475 189 B20140220_SF056_06 B20140220_SF056_06 TB317699.[MT7]-EVMFLNELEEILDVIEPSEFSK[MT7].4y3_1.heavy 725.379 / 525.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5D protein phosphatase 2, regulatory subunit B', delta 1477 189 B20140220_SF056_06 B20140220_SF056_06 TB317699.[MT7]-EVMFLNELEEILDVIEPSEFSK[MT7].4y6_1.heavy 725.379 / 838.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5D protein phosphatase 2, regulatory subunit B', delta 1479 190 B20140220_SF056_06 B20140220_SF056_06 TB317698.[MT7]-EVMFLNELEEILDVIEPSEFSK[MT7].3y6_1.heavy 966.836 / 838.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5D protein phosphatase 2, regulatory subunit B', delta 1481 190 B20140220_SF056_06 B20140220_SF056_06 TB317698.[MT7]-EVMFLNELEEILDVIEPSEFSK[MT7].3b4_1.heavy 966.836 / 651.329 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5D protein phosphatase 2, regulatory subunit B', delta 1483 190 B20140220_SF056_06 B20140220_SF056_06 TB317698.[MT7]-EVMFLNELEEILDVIEPSEFSK[MT7].3b5_1.heavy 966.836 / 764.413 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5D protein phosphatase 2, regulatory subunit B', delta 1485 190 B20140220_SF056_06 B20140220_SF056_06 TB317698.[MT7]-EVMFLNELEEILDVIEPSEFSK[MT7].3b7_1.heavy 966.836 / 1007.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5D protein phosphatase 2, regulatory subunit B', delta 1487 191 B20140220_SF056_06 B20140220_SF056_06 TB317419.[MT7]-LFDDC[CAM]TQQYK[MT7].2b3_1.heavy 803.395 / 520.289 4267.0 30.132366180419922 46 20 10 6 10 38.11013714273787 2.6239737638691665 0.03549957275390625 3 0.9997261933505726 74.58138849844636 4267.0 13.123976975405547 0.0 - - - - - - - 222.83333333333334 8 18 PPP2R5D protein phosphatase 2, regulatory subunit B', delta 1489 191 B20140220_SF056_06 B20140220_SF056_06 TB317419.[MT7]-LFDDC[CAM]TQQYK[MT7].2b4_1.heavy 803.395 / 635.316 3376.0 30.132366180419922 46 20 10 6 10 38.11013714273787 2.6239737638691665 0.03549957275390625 3 0.9997261933505726 74.58138849844636 3376.0 26.45278472436095 0.0 - - - - - - - 197.4 6 20 PPP2R5D protein phosphatase 2, regulatory subunit B', delta 1491 191 B20140220_SF056_06 B20140220_SF056_06 TB317419.[MT7]-LFDDC[CAM]TQQYK[MT7].2y6_1.heavy 803.395 / 971.474 2229.0 30.132366180419922 46 20 10 6 10 38.11013714273787 2.6239737638691665 0.03549957275390625 3 0.9997261933505726 74.58138849844636 2229.0 11.215094339622642 0.0 - - - - - - - 191.07692307692307 4 13 PPP2R5D protein phosphatase 2, regulatory subunit B', delta 1493 192 B20140220_SF056_06 B20140220_SF056_06 TB317697.[MT7]-TDVLVLSC[CAM]DLITDVALHEVVDLFR.3y7_1.heavy 962.852 / 877.478 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF2B3 eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa 1495 192 B20140220_SF056_06 B20140220_SF056_06 TB317697.[MT7]-TDVLVLSC[CAM]DLITDVALHEVVDLFR.3b4_1.heavy 962.852 / 573.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF2B3 eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa 1497 192 B20140220_SF056_06 B20140220_SF056_06 TB317697.[MT7]-TDVLVLSC[CAM]DLITDVALHEVVDLFR.3b5_1.heavy 962.852 / 672.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF2B3 eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa 1499 192 B20140220_SF056_06 B20140220_SF056_06 TB317697.[MT7]-TDVLVLSC[CAM]DLITDVALHEVVDLFR.3y8_1.heavy 962.852 / 1014.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF2B3 eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa 1501 193 B20140220_SF056_06 B20140220_SF056_06 TB317695.[MT7]-RGLC[CAM]C[CAM]VLLLC[CAM]GAVFVSPSQEIHAR.4b7_1.heavy 722.381 / 1003.53 1454.0 40.582701683044434 36 9 10 7 10 0.6564417360704995 80.21139585219464 0.028400421142578125 3 0.818056148696559 2.848246361572027 1454.0 8.077777777777778 0.0 - - - - - - - 220.7 2 30 PLAT plasminogen activator, tissue 1503 193 B20140220_SF056_06 B20140220_SF056_06 TB317695.[MT7]-RGLC[CAM]C[CAM]VLLLC[CAM]GAVFVSPSQEIHAR.4b7_2.heavy 722.381 / 502.268 5815.0 40.582701683044434 36 9 10 7 10 0.6564417360704995 80.21139585219464 0.028400421142578125 3 0.818056148696559 2.848246361572027 5815.0 10.021510417655284 0.0 - - - - - - - 782.6923076923077 11 13 PLAT plasminogen activator, tissue 1505 193 B20140220_SF056_06 B20140220_SF056_06 TB317695.[MT7]-RGLC[CAM]C[CAM]VLLLC[CAM]GAVFVSPSQEIHAR.4y9_1.heavy 722.381 / 1024.52 4821.0 40.582701683044434 36 9 10 7 10 0.6564417360704995 80.21139585219464 0.028400421142578125 3 0.818056148696559 2.848246361572027 4821.0 43.095986797177325 0.0 - - - - - - - 180.89655172413794 9 29 PLAT plasminogen activator, tissue 1507 193 B20140220_SF056_06 B20140220_SF056_06 TB317695.[MT7]-RGLC[CAM]C[CAM]VLLLC[CAM]GAVFVSPSQEIHAR.4b6_1.heavy 722.381 / 890.446 1186.0 40.582701683044434 36 9 10 7 10 0.6564417360704995 80.21139585219464 0.028400421142578125 3 0.818056148696559 2.848246361572027 1186.0 3.498893140980962 0.0 - - - - - - - 262.6666666666667 2 30 PLAT plasminogen activator, tissue 1509 194 B20140220_SF056_06 B20140220_SF056_06 TB317694.[MT7]-GYLPNVLGIIPYAGIDLAVYETLK[MT7].4y5_1.heavy 720.915 / 797.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 1511 194 B20140220_SF056_06 B20140220_SF056_06 TB317694.[MT7]-GYLPNVLGIIPYAGIDLAVYETLK[MT7].4b8_1.heavy 720.915 / 958.548 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 1513 194 B20140220_SF056_06 B20140220_SF056_06 TB317694.[MT7]-GYLPNVLGIIPYAGIDLAVYETLK[MT7].4b5_1.heavy 720.915 / 689.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 1515 194 B20140220_SF056_06 B20140220_SF056_06 TB317694.[MT7]-GYLPNVLGIIPYAGIDLAVYETLK[MT7].4b6_1.heavy 720.915 / 788.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 1517 195 B20140220_SF056_06 B20140220_SF056_06 TB470113.[MT7]-VTYMEASAK[MT7].3y3_1.heavy 429.9 / 449.284 134240.0 25.085599899291992 48 18 10 10 10 4.238555781347402 18.39360669099885 0.0 3 0.9821479951591398 9.222967136976182 134240.0 185.39172106907898 0.0 - - - - - - - 496.0 268 1 RRAS2 related RAS viral (r-ras) oncogene homolog 2 1519 195 B20140220_SF056_06 B20140220_SF056_06 TB470113.[MT7]-VTYMEASAK[MT7].3b4_1.heavy 429.9 / 639.329 36450.0 25.085599899291992 48 18 10 10 10 4.238555781347402 18.39360669099885 0.0 3 0.9821479951591398 9.222967136976182 36450.0 163.1046277665996 0.0 - - - - - - - 283.7692307692308 72 13 RRAS2 related RAS viral (r-ras) oncogene homolog 2 1521 195 B20140220_SF056_06 B20140220_SF056_06 TB470113.[MT7]-VTYMEASAK[MT7].3y4_1.heavy 429.9 / 520.321 54604.0 25.085599899291992 48 18 10 10 10 4.238555781347402 18.39360669099885 0.0 3 0.9821479951591398 9.222967136976182 54604.0 113.82772167626791 0.0 - - - - - - - 298.0 109 5 RRAS2 related RAS viral (r-ras) oncogene homolog 2 1523 195 B20140220_SF056_06 B20140220_SF056_06 TB470113.[MT7]-VTYMEASAK[MT7].3b3_1.heavy 429.9 / 508.289 102116.0 25.085599899291992 48 18 10 10 10 4.238555781347402 18.39360669099885 0.0 3 0.9821479951591398 9.222967136976182 102116.0 154.74411278515697 0.0 - - - - - - - 354.5 204 4 RRAS2 related RAS viral (r-ras) oncogene homolog 2 1525 196 B20140220_SF056_06 B20140220_SF056_06 TB317692.[MT7]-IITITGTQDQIQNAQYLLQNSVK[MT7].4y4_1.heavy 720.154 / 591.358 N/A 41.64959843953451 47 20 10 7 10 5.569447866043179 17.95510118870098 0.028499603271484375 3 0.9928729342928658 14.60994945998074 23300.0 28.73430142430411 1.0 - - - - - - - 726.4 47 10 HNRNPK heterogeneous nuclear ribonucleoprotein K 1527 196 B20140220_SF056_06 B20140220_SF056_06 TB317692.[MT7]-IITITGTQDQIQNAQYLLQNSVK[MT7].4b4_1.heavy 720.154 / 585.409 13124.0 41.64959843953451 47 20 10 7 10 5.569447866043179 17.95510118870098 0.028499603271484375 3 0.9928729342928658 14.60994945998074 13124.0 26.036822276822278 0.0 - - - - - - - 666.5714285714286 26 7 HNRNPK heterogeneous nuclear ribonucleoprotein K 1529 196 B20140220_SF056_06 B20140220_SF056_06 TB317692.[MT7]-IITITGTQDQIQNAQYLLQNSVK[MT7].4y7_1.heavy 720.154 / 945.585 4141.0 41.64959843953451 47 20 10 7 10 5.569447866043179 17.95510118870098 0.028499603271484375 3 0.9928729342928658 14.60994945998074 4141.0 24.822404558404557 0.0 - - - - - - - 176.8181818181818 8 22 HNRNPK heterogeneous nuclear ribonucleoprotein K 1531 196 B20140220_SF056_06 B20140220_SF056_06 TB317692.[MT7]-IITITGTQDQIQNAQYLLQNSVK[MT7].4y6_1.heavy 720.154 / 832.501 11439.0 41.64959843953451 47 20 10 7 10 5.569447866043179 17.95510118870098 0.028499603271484375 3 0.9928729342928658 14.60994945998074 11439.0 64.4441553067186 0.0 - - - - - - - 274.60869565217394 22 23 HNRNPK heterogeneous nuclear ribonucleoprotein K 1533 197 B20140220_SF056_06 B20140220_SF056_06 TB317690.[MT7]-NVGESVAAALSPLGIEVDIDVEHGGK[MT7].4y4_1.heavy 716.887 / 542.317 6118.0 44.69139862060547 42 16 8 10 8 2.2280226623399795 35.75903759319191 0.0 4 0.9627541806821276 6.374796600887192 6118.0 13.351002695999137 0.0 - - - - - - - 684.6315789473684 12 19 SQSTM1 sequestosome 1 1535 197 B20140220_SF056_06 B20140220_SF056_06 TB317690.[MT7]-NVGESVAAALSPLGIEVDIDVEHGGK[MT7].4b7_1.heavy 716.887 / 801.422 8866.0 44.69139862060547 42 16 8 10 8 2.2280226623399795 35.75903759319191 0.0 4 0.9627541806821276 6.374796600887192 8866.0 38.30726890756303 2.0 - - - - - - - 345.42857142857144 25 7 SQSTM1 sequestosome 1 1537 197 B20140220_SF056_06 B20140220_SF056_06 TB317690.[MT7]-NVGESVAAALSPLGIEVDIDVEHGGK[MT7].4b4_1.heavy 716.887 / 544.285 3041.0 44.69139862060547 42 16 8 10 8 2.2280226623399795 35.75903759319191 0.0 4 0.9627541806821276 6.374796600887192 3041.0 4.719241711229946 1.0 - - - - - - - 686.875 6 8 SQSTM1 sequestosome 1 1539 197 B20140220_SF056_06 B20140220_SF056_06 TB317690.[MT7]-NVGESVAAALSPLGIEVDIDVEHGGK[MT7].4b5_1.heavy 716.887 / 631.317 5202.0 44.69139862060547 42 16 8 10 8 2.2280226623399795 35.75903759319191 0.0 4 0.9627541806821276 6.374796600887192 5202.0 12.453331338248496 3.0 - - - - - - - 748.4285714285714 10 7 SQSTM1 sequestosome 1 1541 198 B20140220_SF056_06 B20140220_SF056_06 TB317559.[MT7]-AVVEVNIPVESEVNLK[MT7].3y6_1.heavy 676.392 / 833.485 3881.0 36.66645050048828 41 15 10 6 10 2.468931655536062 31.791670883941077 0.0337982177734375 3 0.9547533168881878 5.779865177199879 3881.0 7.065526128616865 0.0 - - - - - - - 677.7142857142857 7 7 HELLS helicase, lymphoid-specific 1543 198 B20140220_SF056_06 B20140220_SF056_06 TB317559.[MT7]-AVVEVNIPVESEVNLK[MT7].3b6_1.heavy 676.392 / 756.437 12991.0 36.66645050048828 41 15 10 6 10 2.468931655536062 31.791670883941077 0.0337982177734375 3 0.9547533168881878 5.779865177199879 12991.0 32.390832981492494 0.0 - - - - - - - 316.6875 25 16 HELLS helicase, lymphoid-specific 1545 198 B20140220_SF056_06 B20140220_SF056_06 TB317559.[MT7]-AVVEVNIPVESEVNLK[MT7].3b4_1.heavy 676.392 / 543.326 10565.0 36.66645050048828 41 15 10 6 10 2.468931655536062 31.791670883941077 0.0337982177734375 3 0.9547533168881878 5.779865177199879 10565.0 14.808570611183935 0.0 - - - - - - - 1193.5714285714287 21 7 HELLS helicase, lymphoid-specific 1547 198 B20140220_SF056_06 B20140220_SF056_06 TB317559.[MT7]-AVVEVNIPVESEVNLK[MT7].3b5_1.heavy 676.392 / 642.394 7385.0 36.66645050048828 41 15 10 6 10 2.468931655536062 31.791670883941077 0.0337982177734375 3 0.9547533168881878 5.779865177199879 7385.0 14.248130949169525 0.0 - - - - - - - 709.0769230769231 14 13 HELLS helicase, lymphoid-specific 1549 199 B20140220_SF056_06 B20140220_SF056_06 TB469867.[MT7]-VFLEVR.2y4_1.heavy 453.78 / 516.314 49971.0 33.32630157470703 43 13 10 10 10 2.234184407301363 44.75906271353334 0.0 3 0.9264272110183956 4.521727752428729 49971.0 70.38758263520293 1.0 - - - - - - - 1263.4444444444443 99 9 UBE2CBP ubiquitin-conjugating enzyme E2C binding protein 1551 199 B20140220_SF056_06 B20140220_SF056_06 TB469867.[MT7]-VFLEVR.2b3_1.heavy 453.78 / 504.33 78995.0 33.32630157470703 43 13 10 10 10 2.234184407301363 44.75906271353334 0.0 3 0.9264272110183956 4.521727752428729 78995.0 105.37753582123918 0.0 - - - - - - - 1249.25 157 8 UBE2CBP ubiquitin-conjugating enzyme E2C binding protein 1553 199 B20140220_SF056_06 B20140220_SF056_06 TB469867.[MT7]-VFLEVR.2y5_1.heavy 453.78 / 663.382 296652.0 33.32630157470703 43 13 10 10 10 2.234184407301363 44.75906271353334 0.0 3 0.9264272110183956 4.521727752428729 296652.0 634.2981613197665 0.0 - - - - - - - 282.2857142857143 593 7 UBE2CBP ubiquitin-conjugating enzyme E2C binding protein 1555 199 B20140220_SF056_06 B20140220_SF056_06 TB469867.[MT7]-VFLEVR.2b4_1.heavy 453.78 / 633.373 234532.0 33.32630157470703 43 13 10 10 10 2.234184407301363 44.75906271353334 0.0 3 0.9264272110183956 4.521727752428729 234532.0 360.3059169644328 0.0 - - - - - - - 194.5 469 4 UBE2CBP ubiquitin-conjugating enzyme E2C binding protein 1557 200 B20140220_SF056_06 B20140220_SF056_06 TB470381.[MT7]-LTFVDFLTY[MT7]DILDQNR.3y7_1.heavy 754.407 / 873.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSTM3 glutathione S-transferase mu 3 (brain) 1559 200 B20140220_SF056_06 B20140220_SF056_06 TB470381.[MT7]-LTFVDFLTY[MT7]DILDQNR.3y6_1.heavy 754.407 / 758.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSTM3 glutathione S-transferase mu 3 (brain) 1561 200 B20140220_SF056_06 B20140220_SF056_06 TB470381.[MT7]-LTFVDFLTY[MT7]DILDQNR.3b5_1.heavy 754.407 / 720.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSTM3 glutathione S-transferase mu 3 (brain) 1563 200 B20140220_SF056_06 B20140220_SF056_06 TB470381.[MT7]-LTFVDFLTY[MT7]DILDQNR.3b3_1.heavy 754.407 / 506.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSTM3 glutathione S-transferase mu 3 (brain) 1565 201 B20140220_SF056_06 B20140220_SF056_06 TB317297.[MT7]-Y[MT3]QEVLDK[MT7].2y5_1.heavy 661.882 / 747.437 4385.0 39.21630096435547 43 13 10 10 10 1.1373876371954525 52.860308852641 0.0 3 0.913648569074539 4.1691906144127735 4385.0 18.76372093023256 0.0 - - - - - - - 632.7142857142857 8 7 RNF214 ring finger protein 214 1567 201 B20140220_SF056_06 B20140220_SF056_06 TB317297.[MT7]-Y[MT3]QEVLDK[MT7].2y3_1.heavy 661.882 / 519.326 3912.0 39.21630096435547 43 13 10 10 10 1.1373876371954525 52.860308852641 0.0 3 0.913648569074539 4.1691906144127735 3912.0 10.629047669157108 2.0 - - - - - - - 734.5833333333334 7 12 RNF214 ring finger protein 214 1569 201 B20140220_SF056_06 B20140220_SF056_06 TB317297.[MT7]-Y[MT3]QEVLDK[MT7].2y6_1.heavy 661.882 / 875.495 8554.0 39.21630096435547 43 13 10 10 10 1.1373876371954525 52.860308852641 0.0 3 0.913648569074539 4.1691906144127735 8554.0 34.90321353065539 0.0 - - - - - - - 263.375 17 16 RNF214 ring finger protein 214 1571 202 B20140220_SF056_06 B20140220_SF056_06 TB470382.[MT7]-ALRTDYNASVSVPDSSGPER.3y6_1.heavy 755.712 / 632.3 16520.0 26.38492441177368 40 14 10 6 10 3.0570333468387973 32.71145213492929 0.03989982604980469 3 0.9393508077939206 4.9857450848035345 16520.0 15.365346564069043 0.0 - - - - - - - 274.3636363636364 33 11 HNRNPK heterogeneous nuclear ribonucleoprotein K 1573 202 B20140220_SF056_06 B20140220_SF056_06 TB470382.[MT7]-ALRTDYNASVSVPDSSGPER.3y8_1.heavy 755.712 / 844.38 64420.0 26.38492441177368 40 14 10 6 10 3.0570333468387973 32.71145213492929 0.03989982604980469 3 0.9393508077939206 4.9857450848035345 64420.0 50.98773256240579 0.0 - - - - - - - 251.33333333333334 128 6 HNRNPK heterogeneous nuclear ribonucleoprotein K 1575 202 B20140220_SF056_06 B20140220_SF056_06 TB470382.[MT7]-ALRTDYNASVSVPDSSGPER.3b7_1.heavy 755.712 / 978.513 2338.0 26.38492441177368 40 14 10 6 10 3.0570333468387973 32.71145213492929 0.03989982604980469 3 0.9393508077939206 4.9857450848035345 2338.0 25.238013245033112 0.0 - - - - - - - 135.7 4 10 HNRNPK heterogeneous nuclear ribonucleoprotein K 1577 202 B20140220_SF056_06 B20140220_SF056_06 TB470382.[MT7]-ALRTDYNASVSVPDSSGPER.3y10_1.heavy 755.712 / 1030.48 11692.0 26.38492441177368 40 14 10 6 10 3.0570333468387973 32.71145213492929 0.03989982604980469 3 0.9393508077939206 4.9857450848035345 11692.0 28.342611795421075 0.0 - - - - - - - 253.72727272727272 23 11 HNRNPK heterogeneous nuclear ribonucleoprotein K 1579 203 B20140220_SF056_06 B20140220_SF056_06 TB470107.[MT7]-K[MT7]LEDNPK[MT7].3y3_1.heavy 425.926 / 502.311 31157.0 16.94219970703125 41 14 10 7 10 1.586140163284239 57.831635206655704 0.02790069580078125 3 0.9403729709422896 5.028735861810674 31157.0 68.35502813854093 0.0 - - - - - - - 674.6 62 10 EEF1A2 eukaryotic translation elongation factor 1 alpha 2 1581 203 B20140220_SF056_06 B20140220_SF056_06 TB470107.[MT7]-K[MT7]LEDNPK[MT7].3b4_1.heavy 425.926 / 774.46 4694.0 16.94219970703125 41 14 10 7 10 1.586140163284239 57.831635206655704 0.02790069580078125 3 0.9403729709422896 5.028735861810674 4694.0 91.4196300102775 0.0 - - - - - - - 99.47619047619048 9 21 EEF1A2 eukaryotic translation elongation factor 1 alpha 2 1583 203 B20140220_SF056_06 B20140220_SF056_06 TB470107.[MT7]-K[MT7]LEDNPK[MT7].3b5_1.heavy 425.926 / 888.503 N/A 16.94219970703125 41 14 10 7 10 1.586140163284239 57.831635206655704 0.02790069580078125 3 0.9403729709422896 5.028735861810674 0.0 0.0 3.0 - - - - - - - 0.0 0 0 EEF1A2 eukaryotic translation elongation factor 1 alpha 2 1585 203 B20140220_SF056_06 B20140220_SF056_06 TB470107.[MT7]-K[MT7]LEDNPK[MT7].3b5_2.heavy 425.926 / 444.755 31540.0 16.94219970703125 41 14 10 7 10 1.586140163284239 57.831635206655704 0.02790069580078125 3 0.9403729709422896 5.028735861810674 31540.0 94.882228633337 0.0 - - - - - - - 213.125 63 24 EEF1A2 eukaryotic translation elongation factor 1 alpha 2 1587 204 B20140220_SF056_06 B20140220_SF056_06 TB469958.[MT7]-ELHEQLVALDK[MT7].3y3_1.heavy 528.306 / 519.326 120663.0 29.59429931640625 43 13 10 10 10 1.5527202058319327 50.52520531868894 0.0 3 0.9020192660023875 3.9100337782098338 120663.0 64.87337957225787 0.0 - - - - - - - 2781.9 241 10 CPT2 carnitine palmitoyltransferase 2 1589 204 B20140220_SF056_06 B20140220_SF056_06 TB469958.[MT7]-ELHEQLVALDK[MT7].3b4_1.heavy 528.306 / 653.338 55201.0 29.59429931640625 43 13 10 10 10 1.5527202058319327 50.52520531868894 0.0 3 0.9020192660023875 3.9100337782098338 55201.0 109.55025957640441 0.0 - - - - - - - 694.0769230769231 110 13 CPT2 carnitine palmitoyltransferase 2 1591 204 B20140220_SF056_06 B20140220_SF056_06 TB469958.[MT7]-ELHEQLVALDK[MT7].3b3_1.heavy 528.306 / 524.295 42591.0 29.59429931640625 43 13 10 10 10 1.5527202058319327 50.52520531868894 0.0 3 0.9020192660023875 3.9100337782098338 42591.0 25.788411031662335 0.0 - - - - - - - 1783.7142857142858 85 7 CPT2 carnitine palmitoyltransferase 2 1593 204 B20140220_SF056_06 B20140220_SF056_06 TB469958.[MT7]-ELHEQLVALDK[MT7].3y4_1.heavy 528.306 / 590.363 232178.0 29.59429931640625 43 13 10 10 10 1.5527202058319327 50.52520531868894 0.0 3 0.9020192660023875 3.9100337782098338 232178.0 270.59246191327793 0.0 - - - - - - - 788.125 464 8 CPT2 carnitine palmitoyltransferase 2 1595 205 B20140220_SF056_06 B20140220_SF056_06 TB470258.[MT7]-DIHELFVPENK[MT7].3b4_1.heavy 543.634 / 639.322 46197.0 31.95639991760254 42 12 10 10 10 2.212582631430988 45.196052151654555 0.0 3 0.8941740445756561 3.759756766176313 46197.0 37.80787144362486 0.0 - - - - - - - 756.7 92 10 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 1597 205 B20140220_SF056_06 B20140220_SF056_06 TB470258.[MT7]-DIHELFVPENK[MT7].3b5_1.heavy 543.634 / 752.406 41551.0 31.95639991760254 42 12 10 10 10 2.212582631430988 45.196052151654555 0.0 3 0.8941740445756561 3.759756766176313 41551.0 95.46553169559255 0.0 - - - - - - - 693.2222222222222 83 9 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 1599 205 B20140220_SF056_06 B20140220_SF056_06 TB470258.[MT7]-DIHELFVPENK[MT7].3b3_1.heavy 543.634 / 510.279 24891.0 31.95639991760254 42 12 10 10 10 2.212582631430988 45.196052151654555 0.0 3 0.8941740445756561 3.759756766176313 24891.0 59.422798500219656 0.0 - - - - - - - 749.8 49 10 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 1601 205 B20140220_SF056_06 B20140220_SF056_06 TB470258.[MT7]-DIHELFVPENK[MT7].3y4_1.heavy 543.634 / 631.353 200519.0 31.95639991760254 42 12 10 10 10 2.212582631430988 45.196052151654555 0.0 3 0.8941740445756561 3.759756766176313 200519.0 259.7419546826935 0.0 - - - - - - - 431.5 401 2 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 1603 206 B20140220_SF056_06 B20140220_SF056_06 TB470103.[MT7]-SPDFASSFK[MT7].2y4_1.heavy 637.337 / 612.347 4726.0 30.624300003051758 47 17 10 10 10 2.450333871627251 31.656650043333244 0.0 3 0.9701568275957457 7.12613190742586 4726.0 10.081525096525095 0.0 - - - - - - - 718.7 9 10 CIB1 calcium and integrin binding 1 (calmyrin) 1605 206 B20140220_SF056_06 B20140220_SF056_06 TB470103.[MT7]-SPDFASSFK[MT7].2y8_1.heavy 637.337 / 1042.53 16508.0 30.624300003051758 47 17 10 10 10 2.450333871627251 31.656650043333244 0.0 3 0.9701568275957457 7.12613190742586 16508.0 176.37486935440424 0.0 - - - - - - - 171.0 33 14 CIB1 calcium and integrin binding 1 (calmyrin) 1607 206 B20140220_SF056_06 B20140220_SF056_06 TB470103.[MT7]-SPDFASSFK[MT7].2y3_1.heavy 637.337 / 525.315 2913.0 30.624300003051758 47 17 10 10 10 2.450333871627251 31.656650043333244 0.0 3 0.9701568275957457 7.12613190742586 2913.0 6.713205886389812 0.0 - - - - - - - 669.0 5 9 CIB1 calcium and integrin binding 1 (calmyrin) 1609 206 B20140220_SF056_06 B20140220_SF056_06 TB470103.[MT7]-SPDFASSFK[MT7].2y6_1.heavy 637.337 / 830.453 8804.0 30.624300003051758 47 17 10 10 10 2.450333871627251 31.656650043333244 0.0 3 0.9701568275957457 7.12613190742586 8804.0 48.08444092152702 0.0 - - - - - - - 269.05263157894734 17 19 CIB1 calcium and integrin binding 1 (calmyrin) 1611 207 B20140220_SF056_06 B20140220_SF056_06 TB317049.[MT7]-C[CAM]GGIDK[MT7].2y4_1.heavy 469.254 / 576.347 792.0 17.230499267578125 41 15 10 10 6 2.5973514100466253 30.320248407135786 0.0 5 0.9520892599673745 5.61560494825954 792.0 2.046606401896858 7.0 - - - - - - - 250.92857142857142 3 28 EEF1A1;EEF1A2 eukaryotic translation elongation factor 1 alpha 1;eukaryotic translation elongation factor 1 alpha 2 1613 207 B20140220_SF056_06 B20140220_SF056_06 TB317049.[MT7]-C[CAM]GGIDK[MT7].2y5_1.heavy 469.254 / 633.369 6473.0 17.230499267578125 41 15 10 10 6 2.5973514100466253 30.320248407135786 0.0 5 0.9520892599673745 5.61560494825954 6473.0 36.80832434557915 0.0 - - - - - - - 183.59259259259258 12 27 EEF1A1;EEF1A2 eukaryotic translation elongation factor 1 alpha 1;eukaryotic translation elongation factor 1 alpha 2 1615 207 B20140220_SF056_06 B20140220_SF056_06 TB317049.[MT7]-C[CAM]GGIDK[MT7].2b4_1.heavy 469.254 / 532.267 1205.0 17.230499267578125 41 15 10 10 6 2.5973514100466253 30.320248407135786 0.0 5 0.9520892599673745 5.61560494825954 1205.0 1.5 6.0 - - - - - - - 244.67857142857142 4 28 EEF1A1;EEF1A2 eukaryotic translation elongation factor 1 alpha 1;eukaryotic translation elongation factor 1 alpha 2 1617 207 B20140220_SF056_06 B20140220_SF056_06 TB317049.[MT7]-C[CAM]GGIDK[MT7].2b5_1.heavy 469.254 / 647.294 11294.0 17.230499267578125 41 15 10 10 6 2.5973514100466253 30.320248407135786 0.0 5 0.9520892599673745 5.61560494825954 11294.0 34.2775055188695 0.0 - - - - - - - 252.04 22 25 EEF1A1;EEF1A2 eukaryotic translation elongation factor 1 alpha 1;eukaryotic translation elongation factor 1 alpha 2 1619 208 B20140220_SF056_06 B20140220_SF056_06 TB317442.[MT7]-ENLSVTLEVILER.2b3_1.heavy 829.976 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 1621 208 B20140220_SF056_06 B20140220_SF056_06 TB317442.[MT7]-ENLSVTLEVILER.2y9_1.heavy 829.976 / 1071.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 1623 208 B20140220_SF056_06 B20140220_SF056_06 TB317442.[MT7]-ENLSVTLEVILER.2b4_1.heavy 829.976 / 588.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 1625 208 B20140220_SF056_06 B20140220_SF056_06 TB317442.[MT7]-ENLSVTLEVILER.2y10_1.heavy 829.976 / 1158.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNAL1 catenin (cadherin-associated protein), alpha-like 1 1627 209 B20140220_SF056_06 B20140220_SF056_06 TB469953.[MT7]-AQMTNILQQIK[MT7].3y3_1.heavy 525.976 / 532.357 23411.0 36.69179916381836 47 17 10 10 10 3.1249997123102213 26.019119589112933 0.0 3 0.9755687529708007 7.879549147413826 23411.0 26.666978362877742 0.0 - - - - - - - 1201.6363636363637 46 11 RNF214 ring finger protein 214 1629 209 B20140220_SF056_06 B20140220_SF056_06 TB469953.[MT7]-AQMTNILQQIK[MT7].3b6_1.heavy 525.976 / 803.42 36088.0 36.69179916381836 47 17 10 10 10 3.1249997123102213 26.019119589112933 0.0 3 0.9755687529708007 7.879549147413826 36088.0 114.35869863309419 0.0 - - - - - - - 273.1764705882353 72 17 RNF214 ring finger protein 214 1631 209 B20140220_SF056_06 B20140220_SF056_06 TB469953.[MT7]-AQMTNILQQIK[MT7].3b5_1.heavy 525.976 / 690.336 63599.0 36.69179916381836 47 17 10 10 10 3.1249997123102213 26.019119589112933 0.0 3 0.9755687529708007 7.879549147413826 63599.0 114.01509228673558 0.0 - - - - - - - 715.7272727272727 127 11 RNF214 ring finger protein 214 1633 209 B20140220_SF056_06 B20140220_SF056_06 TB469953.[MT7]-AQMTNILQQIK[MT7].3b10_2.heavy 525.976 / 643.356 28050.0 36.69179916381836 47 17 10 10 10 3.1249997123102213 26.019119589112933 0.0 3 0.9755687529708007 7.879549147413826 28050.0 24.040988792331973 0.0 - - - - - - - 740.2727272727273 56 11 RNF214 ring finger protein 214 1635 210 B20140220_SF056_06 B20140220_SF056_06 TB470391.[MT7]-LFLDFLEEFQSSDGEIK[MT7].4y4_1.heavy 577.052 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1637 210 B20140220_SF056_06 B20140220_SF056_06 TB470391.[MT7]-LFLDFLEEFQSSDGEIK[MT7].4b4_1.heavy 577.052 / 633.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1639 210 B20140220_SF056_06 B20140220_SF056_06 TB470391.[MT7]-LFLDFLEEFQSSDGEIK[MT7].4b5_1.heavy 577.052 / 780.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1641 210 B20140220_SF056_06 B20140220_SF056_06 TB470391.[MT7]-LFLDFLEEFQSSDGEIK[MT7].4b3_1.heavy 577.052 / 518.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1643 211 B20140220_SF056_06 B20140220_SF056_06 TB470390.[MT7]-LFLDFLEEFQSSDGEIK[MT7].3y7_1.heavy 769.066 / 879.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1645 211 B20140220_SF056_06 B20140220_SF056_06 TB470390.[MT7]-LFLDFLEEFQSSDGEIK[MT7].3b4_1.heavy 769.066 / 633.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1647 211 B20140220_SF056_06 B20140220_SF056_06 TB470390.[MT7]-LFLDFLEEFQSSDGEIK[MT7].3b5_1.heavy 769.066 / 780.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1649 211 B20140220_SF056_06 B20140220_SF056_06 TB470390.[MT7]-LFLDFLEEFQSSDGEIK[MT7].3y4_1.heavy 769.066 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1651 212 B20140220_SF056_06 B20140220_SF056_06 TB317449.[MT7]-AFMC[CAM]RFEALEK[MT7].3y10_2.heavy 563.961 / 737.869 14554.0 34.82720184326172 43 15 10 10 8 2.42606465685957 32.03827302320115 0.0 4 0.9524862881083758 5.639208250748703 14554.0 42.11363247863248 0.0 - - - - - - - 678.2 29 10 GSTM3 glutathione S-transferase mu 3 (brain) 1653 212 B20140220_SF056_06 B20140220_SF056_06 TB317449.[MT7]-AFMC[CAM]RFEALEK[MT7].3y3_1.heavy 563.961 / 533.341 N/A 34.82720184326172 43 15 10 10 8 2.42606465685957 32.03827302320115 0.0 4 0.9524862881083758 5.639208250748703 15314.0 3.421998717350488 1.0 - - - - - - - 730.9 41 10 GSTM3 glutathione S-transferase mu 3 (brain) 1655 212 B20140220_SF056_06 B20140220_SF056_06 TB317449.[MT7]-AFMC[CAM]RFEALEK[MT7].3y4_1.heavy 563.961 / 604.379 8417.0 34.82720184326172 43 15 10 10 8 2.42606465685957 32.03827302320115 0.0 4 0.9524862881083758 5.639208250748703 8417.0 11.031882176539188 1.0 - - - - - - - 726.4285714285714 16 14 GSTM3 glutathione S-transferase mu 3 (brain) 1657 212 B20140220_SF056_06 B20140220_SF056_06 TB317449.[MT7]-AFMC[CAM]RFEALEK[MT7].3y9_2.heavy 563.961 / 664.335 4793.0 34.82720184326172 43 15 10 10 8 2.42606465685957 32.03827302320115 0.0 4 0.9524862881083758 5.639208250748703 4793.0 13.042963336549425 1.0 - - - - - - - 709.0 16 8 GSTM3 glutathione S-transferase mu 3 (brain) 1659 213 B20140220_SF056_06 B20140220_SF056_06 TB317034.[MT7]-SFFLTR.2y4_1.heavy 457.764 / 536.319 5503.0 34.47982597351074 36 15 10 3 8 2.4814541344205696 40.29895157556496 0.05889892578125 4 0.9538909271337688 5.72514042507878 5503.0 14.415613364239599 0.0 - - - - - - - 648.3846153846154 11 13 PIRT phosphoinositide-interacting regulator of transient receptor potential channels 1661 213 B20140220_SF056_06 B20140220_SF056_06 TB317034.[MT7]-SFFLTR.2b3_1.heavy 457.764 / 526.278 9367.0 34.47982597351074 36 15 10 3 8 2.4814541344205696 40.29895157556496 0.05889892578125 4 0.9538909271337688 5.72514042507878 9367.0 20.955497533180463 0.0 - - - - - - - 707.1666666666666 18 12 PIRT phosphoinositide-interacting regulator of transient receptor potential channels 1663 213 B20140220_SF056_06 B20140220_SF056_06 TB317034.[MT7]-SFFLTR.2y5_1.heavy 457.764 / 683.388 16099.0 34.47982597351074 36 15 10 3 8 2.4814541344205696 40.29895157556496 0.05889892578125 4 0.9538909271337688 5.72514042507878 16099.0 59.33777760945311 0.0 - - - - - - - 252.68421052631578 32 19 PIRT phosphoinositide-interacting regulator of transient receptor potential channels 1665 213 B20140220_SF056_06 B20140220_SF056_06 TB317034.[MT7]-SFFLTR.2b4_1.heavy 457.764 / 639.362 6791.0 34.47982597351074 36 15 10 3 8 2.4814541344205696 40.29895157556496 0.05889892578125 4 0.9538909271337688 5.72514042507878 6791.0 18.856810506566603 1.0 - - - - - - - 745.0 25 11 PIRT phosphoinositide-interacting regulator of transient receptor potential channels 1667 214 B20140220_SF056_06 B20140220_SF056_06 TB470264.[MT7]-RSIEEAVPAVC[CAM]K[MT7].2y5_1.heavy 823.961 / 718.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFA platelet-derived growth factor alpha polypeptide 1669 214 B20140220_SF056_06 B20140220_SF056_06 TB470264.[MT7]-RSIEEAVPAVC[CAM]K[MT7].2b6_1.heavy 823.961 / 830.449 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFA platelet-derived growth factor alpha polypeptide 1671 214 B20140220_SF056_06 B20140220_SF056_06 TB470264.[MT7]-RSIEEAVPAVC[CAM]K[MT7].2b7_1.heavy 823.961 / 929.517 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFA platelet-derived growth factor alpha polypeptide 1673 214 B20140220_SF056_06 B20140220_SF056_06 TB470264.[MT7]-RSIEEAVPAVC[CAM]K[MT7].2b5_1.heavy 823.961 / 759.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFA platelet-derived growth factor alpha polypeptide 1675 215 B20140220_SF056_06 B20140220_SF056_06 TB317132.[MT7]-ELFGLSPR.2y5_1.heavy 531.807 / 529.309 5584.0 35.410400390625 50 20 10 10 10 9.123779623043935 10.960369948812653 0.0 3 0.993140772398772 14.892794826147453 5584.0 11.570008779631255 0.0 - - - - - - - 1187.8181818181818 11 11 PCDH10 protocadherin 10 1677 215 B20140220_SF056_06 B20140220_SF056_06 TB317132.[MT7]-ELFGLSPR.2b4_1.heavy 531.807 / 591.326 1675.0 35.410400390625 50 20 10 10 10 9.123779623043935 10.960369948812653 0.0 3 0.993140772398772 14.892794826147453 1675.0 1.0 8.0 - - - - - - - 670.1333333333333 4 15 PCDH10 protocadherin 10 1679 215 B20140220_SF056_06 B20140220_SF056_06 TB317132.[MT7]-ELFGLSPR.2y6_1.heavy 531.807 / 676.378 6366.0 35.410400390625 50 20 10 10 10 9.123779623043935 10.960369948812653 0.0 3 0.993140772398772 14.892794826147453 6366.0 8.837264037664424 0.0 - - - - - - - 733.0 12 8 PCDH10 protocadherin 10 1681 215 B20140220_SF056_06 B20140220_SF056_06 TB317132.[MT7]-ELFGLSPR.2y7_1.heavy 531.807 / 789.462 6422.0 35.410400390625 50 20 10 10 10 9.123779623043935 10.960369948812653 0.0 3 0.993140772398772 14.892794826147453 6422.0 23.27138450967668 0.0 - - - - - - - 646.2857142857143 12 7 PCDH10 protocadherin 10 1683 216 B20140220_SF056_06 B20140220_SF056_06 TB470269.[MT7]-VMLGETVSSETTK[MT7].3b6_1.heavy 557.302 / 775.414 35556.0 28.933500289916992 44 14 10 10 10 2.2347491037796674 35.71990103710689 0.0 3 0.9388901593145511 4.966723133624416 35556.0 24.539665226540116 0.0 - - - - - - - 294.5 71 12 UBE2CBP ubiquitin-conjugating enzyme E2C binding protein 1685 216 B20140220_SF056_06 B20140220_SF056_06 TB470269.[MT7]-VMLGETVSSETTK[MT7].3y6_1.heavy 557.302 / 796.417 39155.0 28.933500289916992 44 14 10 10 10 2.2347491037796674 35.71990103710689 0.0 3 0.9388901593145511 4.966723133624416 39155.0 61.06738908152127 0.0 - - - - - - - 682.5 78 8 UBE2CBP ubiquitin-conjugating enzyme E2C binding protein 1687 216 B20140220_SF056_06 B20140220_SF056_06 TB470269.[MT7]-VMLGETVSSETTK[MT7].3b4_1.heavy 557.302 / 545.324 20167.0 28.933500289916992 44 14 10 10 10 2.2347491037796674 35.71990103710689 0.0 3 0.9388901593145511 4.966723133624416 20167.0 19.820350710900474 0.0 - - - - - - - 1318.5 40 12 UBE2CBP ubiquitin-conjugating enzyme E2C binding protein 1689 216 B20140220_SF056_06 B20140220_SF056_06 TB470269.[MT7]-VMLGETVSSETTK[MT7].3b5_1.heavy 557.302 / 674.366 37231.0 28.933500289916992 44 14 10 10 10 2.2347491037796674 35.71990103710689 0.0 3 0.9388901593145511 4.966723133624416 37231.0 38.35760579945391 0.0 - - - - - - - 739.5833333333334 74 12 UBE2CBP ubiquitin-conjugating enzyme E2C binding protein 1691 217 B20140220_SF056_06 B20140220_SF056_06 TB469885.[MT7]-FEVEK[MT7].2y4_1.heavy 470.273 / 648.369 23398.0 25.34469985961914 46 16 10 10 10 4.404989867660686 15.134351875835453 0.0 3 0.9653162715259622 6.607484850489576 23398.0 47.348108396624 2.0 - - - - - - - 783.6153846153846 48 13 PLAT plasminogen activator, tissue 1693 217 B20140220_SF056_06 B20140220_SF056_06 TB469885.[MT7]-FEVEK[MT7].2y3_1.heavy 470.273 / 519.326 15648.0 25.34469985961914 46 16 10 10 10 4.404989867660686 15.134351875835453 0.0 3 0.9653162715259622 6.607484850489576 15648.0 9.47517905115403 0.0 - - - - - - - 332.0 31 2 PLAT plasminogen activator, tissue 1695 218 B20140220_SF056_06 B20140220_SF056_06 TB317133.[MT7]-IRPNFK[MT7].2y4_1.heavy 531.837 / 649.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLRA1;GLRA2;GLRB;GLRA4;GLRA3 glycine receptor, alpha 1;glycine receptor, alpha 2;glycine receptor, beta;glycine receptor, alpha 4;glycine receptor, alpha 3 1697 218 B20140220_SF056_06 B20140220_SF056_06 TB317133.[MT7]-IRPNFK[MT7].2y5_1.heavy 531.837 / 805.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLRA1;GLRA2;GLRB;GLRA4;GLRA3 glycine receptor, alpha 1;glycine receptor, alpha 2;glycine receptor, beta;glycine receptor, alpha 4;glycine receptor, alpha 3 1699 218 B20140220_SF056_06 B20140220_SF056_06 TB317133.[MT7]-IRPNFK[MT7].2b4_1.heavy 531.837 / 625.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLRA1;GLRA2;GLRB;GLRA4;GLRA3 glycine receptor, alpha 1;glycine receptor, alpha 2;glycine receptor, beta;glycine receptor, alpha 4;glycine receptor, alpha 3 1701 218 B20140220_SF056_06 B20140220_SF056_06 TB317133.[MT7]-IRPNFK[MT7].2b5_1.heavy 531.837 / 772.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLRA1;GLRA2;GLRB;GLRA4;GLRA3 glycine receptor, alpha 1;glycine receptor, alpha 2;glycine receptor, beta;glycine receptor, alpha 4;glycine receptor, alpha 3 1703 219 B20140220_SF056_06 B20140220_SF056_06 TB469889.[MT7]-EIPLAK[MT7].2y4_1.heavy 479.812 / 572.389 109550.0 26.63010025024414 44 18 10 10 6 1.5541175826621392 37.11549520902132 0.0 6 0.9870608064697289 10.837755911528268 109550.0 136.24513466630086 0.0 - - - - - - - 69.0 219 1 MCM6 minichromosome maintenance complex component 6 1705 219 B20140220_SF056_06 B20140220_SF056_06 TB469889.[MT7]-EIPLAK[MT7].2y5_1.heavy 479.812 / 685.473 16247.0 26.63010025024414 44 18 10 10 6 1.5541175826621392 37.11549520902132 0.0 6 0.9870608064697289 10.837755911528268 16247.0 21.064222337290342 1.0 - - - - - - - 754.125 48 8 MCM6 minichromosome maintenance complex component 6 1707 219 B20140220_SF056_06 B20140220_SF056_06 TB469889.[MT7]-EIPLAK[MT7].2y3_1.heavy 479.812 / 475.336 11997.0 26.63010025024414 44 18 10 10 6 1.5541175826621392 37.11549520902132 0.0 6 0.9870608064697289 10.837755911528268 11997.0 4.2228316860806405 2.0 - - - - - - - 1805.3333333333333 76 3 MCM6 minichromosome maintenance complex component 6 1709 220 B20140220_SF056_06 B20140220_SF056_06 TB470262.[MT7]-STNVVYQAHHVSR.3y6_1.heavy 547.957 / 706.374 8315.0 18.858200073242188 48 18 10 10 10 4.928030711337458 20.29208133178622 0.0 3 0.9815317904336034 9.06732769111222 8315.0 59.080263157894734 0.0 - - - - - - - 160.48 16 25 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 1711 220 B20140220_SF056_06 B20140220_SF056_06 TB470262.[MT7]-STNVVYQAHHVSR.3b4_1.heavy 547.957 / 546.3 15131.0 18.858200073242188 48 18 10 10 10 4.928030711337458 20.29208133178622 0.0 3 0.9815317904336034 9.06732769111222 15131.0 97.43916312037696 0.0 - - - - - - - 167.2608695652174 30 23 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 1713 220 B20140220_SF056_06 B20140220_SF056_06 TB470262.[MT7]-STNVVYQAHHVSR.3b5_1.heavy 547.957 / 645.369 11283.0 18.858200073242188 48 18 10 10 10 4.928030711337458 20.29208133178622 0.0 3 0.9815317904336034 9.06732769111222 11283.0 105.53453338171262 0.0 - - - - - - - 171.20833333333334 22 24 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 1715 220 B20140220_SF056_06 B20140220_SF056_06 TB470262.[MT7]-STNVVYQAHHVSR.3y8_1.heavy 547.957 / 997.496 3848.0 18.858200073242188 48 18 10 10 10 4.928030711337458 20.29208133178622 0.0 3 0.9815317904336034 9.06732769111222 3848.0 112.47999999999999 0.0 - - - - - - - 62.92857142857143 7 14 PAPSS2 3'-phosphoadenosine 5'-phosphosulfate synthase 2 1717 221 B20140220_SF056_06 B20140220_SF056_06 TB317530.[MT7]-GIPNAIISVEGINHDIR.3b6_1.heavy 654.701 / 710.432 27575.0 37.201698303222656 47 17 10 10 10 1.9502351622844103 40.186859799822955 0.0 3 0.9723411508261316 7.403536036557363 27575.0 72.49656285072952 0.0 - - - - - - - 274.5 55 12 CPXM2 carboxypeptidase X (M14 family), member 2 1719 221 B20140220_SF056_06 B20140220_SF056_06 TB317530.[MT7]-GIPNAIISVEGINHDIR.3b4_1.heavy 654.701 / 526.311 20560.0 37.201698303222656 47 17 10 10 10 1.9502351622844103 40.186859799822955 0.0 3 0.9723411508261316 7.403536036557363 20560.0 30.06557736928861 0.0 - - - - - - - 728.5 41 8 CPXM2 carboxypeptidase X (M14 family), member 2 1721 221 B20140220_SF056_06 B20140220_SF056_06 TB317530.[MT7]-GIPNAIISVEGINHDIR.3b5_1.heavy 654.701 / 597.348 53747.0 37.201698303222656 47 17 10 10 10 1.9502351622844103 40.186859799822955 0.0 3 0.9723411508261316 7.403536036557363 53747.0 79.70205486689697 0.0 - - - - - - - 1181.0 107 9 CPXM2 carboxypeptidase X (M14 family), member 2 1723 221 B20140220_SF056_06 B20140220_SF056_06 TB317530.[MT7]-GIPNAIISVEGINHDIR.3y8_1.heavy 654.701 / 953.48 18131.0 37.201698303222656 47 17 10 10 10 1.9502351622844103 40.186859799822955 0.0 3 0.9723411508261316 7.403536036557363 18131.0 130.38651234567902 0.0 - - - - - - - 199.125 36 16 CPXM2 carboxypeptidase X (M14 family), member 2 1725 222 B20140220_SF056_06 B20140220_SF056_06 TB317433.[MT7]-LMSSGNEESLRK[MT7].3y11_2.heavy 546.962 / 691.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPT2 carnitine palmitoyltransferase 2 1727 222 B20140220_SF056_06 B20140220_SF056_06 TB317433.[MT7]-LMSSGNEESLRK[MT7].3b5_1.heavy 546.962 / 620.319 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPT2 carnitine palmitoyltransferase 2 1729 222 B20140220_SF056_06 B20140220_SF056_06 TB317433.[MT7]-LMSSGNEESLRK[MT7].3y8_1.heavy 546.962 / 1076.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPT2 carnitine palmitoyltransferase 2 1731 222 B20140220_SF056_06 B20140220_SF056_06 TB317433.[MT7]-LMSSGNEESLRK[MT7].3y5_1.heavy 546.962 / 776.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPT2 carnitine palmitoyltransferase 2 1733 223 B20140220_SF056_06 B20140220_SF056_06 TB317437.[MT7]-ALGISISLEQAEK[MT7].2y4_1.heavy 823.982 / 619.353 1925.0 35.92130088806152 43 17 10 6 10 3.1715470381532063 31.530353734948882 0.036800384521484375 3 0.9796301770285625 8.632344528538841 1925.0 8.545833333333333 0.0 - - - - - - - 262.5 3 22 SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 1735 223 B20140220_SF056_06 B20140220_SF056_06 TB317437.[MT7]-ALGISISLEQAEK[MT7].2y8_1.heavy 823.982 / 1061.6 1870.0 35.92130088806152 43 17 10 6 10 3.1715470381532063 31.530353734948882 0.036800384521484375 3 0.9796301770285625 8.632344528538841 1870.0 3.966666666666667 0.0 - - - - - - - 173.25 3 20 SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 1737 223 B20140220_SF056_06 B20140220_SF056_06 TB317437.[MT7]-ALGISISLEQAEK[MT7].2y9_1.heavy 823.982 / 1148.63 4950.0 35.92130088806152 43 17 10 6 10 3.1715470381532063 31.530353734948882 0.036800384521484375 3 0.9796301770285625 8.632344528538841 4950.0 37.349999999999994 0.0 - - - - - - - 145.58823529411765 9 17 SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 1739 223 B20140220_SF056_06 B20140220_SF056_06 TB317437.[MT7]-ALGISISLEQAEK[MT7].2y7_1.heavy 823.982 / 948.512 4510.0 35.92130088806152 43 17 10 6 10 3.1715470381532063 31.530353734948882 0.036800384521484375 3 0.9796301770285625 8.632344528538841 4510.0 15.936161616161616 0.0 - - - - - - - 242.0 9 15 SLC25A23 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23