Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18544.[MT7]-DILTIK[MT7].2b3_1.heavy 495.826 / 486.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDR kinase insert domain receptor (a type III receptor tyrosine kinase) 3 1 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18544.[MT7]-DILTIK[MT7].2y4_1.heavy 495.826 / 618.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDR kinase insert domain receptor (a type III receptor tyrosine kinase) 5 1 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18544.[MT7]-DILTIK[MT7].2y5_1.heavy 495.826 / 731.515 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDR kinase insert domain receptor (a type III receptor tyrosine kinase) 7 1 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18544.[MT7]-DILTIK[MT7].2y3_1.heavy 495.826 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDR kinase insert domain receptor (a type III receptor tyrosine kinase) 9 2 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB37002.[MT7]-TVLGTPEVLLGALPGAGGTQRLPK[MT7].3b8_1.heavy 878.525 / 941.542 3923.0 41.16184997558594 40 14 10 6 10 3.118668940122098 32.06496166152375 0.03710174560546875 3 0.9350353583985723 4.815530996252757 3923.0 3.7781701444622793 0.0 - - - - - - - 186.875 7 16 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 11 2 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB37002.[MT7]-TVLGTPEVLLGALPGAGGTQRLPK[MT7].3y11_1.heavy 878.525 / 1225.71 7971.0 41.16184997558594 40 14 10 6 10 3.118668940122098 32.06496166152375 0.03710174560546875 3 0.9350353583985723 4.815530996252757 7971.0 123.39107999999999 0.0 - - - - - - - 181.75 15 12 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 13 2 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB37002.[MT7]-TVLGTPEVLLGALPGAGGTQRLPK[MT7].3b7_1.heavy 878.525 / 842.474 2366.0 41.16184997558594 40 14 10 6 10 3.118668940122098 32.06496166152375 0.03710174560546875 3 0.9350353583985723 4.815530996252757 2366.0 1.717135207496653 1.0 - - - - - - - 233.5625 4 16 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 15 2 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB37002.[MT7]-TVLGTPEVLLGALPGAGGTQRLPK[MT7].3b5_1.heavy 878.525 / 616.379 5604.0 41.16184997558594 40 14 10 6 10 3.118668940122098 32.06496166152375 0.03710174560546875 3 0.9350353583985723 4.815530996252757 5604.0 42.25475935828877 0.0 - - - - - - - 258.14285714285717 11 14 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 17 3 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18411.[MT7]-QLPAAR.2y4_1.heavy 400.249 / 414.246 13180.0 18.61199951171875 44 18 8 10 8 5.758086533892132 17.366880371005088 0.0 4 0.9866022296560041 10.650255540959959 13180.0 29.5509628563809 0.0 - - - - - - - 634.3333333333334 26 9 ACADL acyl-CoA dehydrogenase, long chain 19 3 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18411.[MT7]-QLPAAR.2y5_1.heavy 400.249 / 527.33 15576.0 18.61199951171875 44 18 8 10 8 5.758086533892132 17.366880371005088 0.0 4 0.9866022296560041 10.650255540959959 15576.0 21.60863819161795 1.0 - - - - - - - 1214.2857142857142 39 7 ACADL acyl-CoA dehydrogenase, long chain 21 3 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18411.[MT7]-QLPAAR.2b4_1.heavy 400.249 / 554.342 3709.0 18.61199951171875 44 18 8 10 8 5.758086533892132 17.366880371005088 0.0 4 0.9866022296560041 10.650255540959959 3709.0 14.958163271576488 0.0 - - - - - - - 184.41176470588235 7 17 ACADL acyl-CoA dehydrogenase, long chain 23 3 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18411.[MT7]-QLPAAR.2b5_1.heavy 400.249 / 625.379 1883.0 18.61199951171875 44 18 8 10 8 5.758086533892132 17.366880371005088 0.0 4 0.9866022296560041 10.650255540959959 1883.0 3.854093567251462 1.0 - - - - - - - 595.4285714285714 5 7 ACADL acyl-CoA dehydrogenase, long chain 25 4 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18927.[MT7]-VYTLTPFLANNR.2b3_1.heavy 776.934 / 508.289 1596.0 39.2060489654541 46 20 10 6 10 9.590735596263833 10.426728898558729 0.036899566650390625 3 0.9921096094290436 13.884400816622806 1596.0 5.085559322033898 0.0 - - - - - - - 253.14285714285714 3 21 ARRB1 arrestin, beta 1 27 4 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18927.[MT7]-VYTLTPFLANNR.2y8_1.heavy 776.934 / 932.495 2541.0 39.2060489654541 46 20 10 6 10 9.590735596263833 10.426728898558729 0.036899566650390625 3 0.9921096094290436 13.884400816622806 2541.0 6.029491525423729 0.0 - - - - - - - 192.68421052631578 5 19 ARRB1 arrestin, beta 1 29 4 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18927.[MT7]-VYTLTPFLANNR.2y9_1.heavy 776.934 / 1045.58 946.0 39.2060489654541 46 20 10 6 10 9.590735596263833 10.426728898558729 0.036899566650390625 3 0.9921096094290436 13.884400816622806 946.0 15.152033898305085 1.0 - - - - - - - 0.0 1 0 ARRB1 arrestin, beta 1 31 4 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18927.[MT7]-VYTLTPFLANNR.2y7_1.heavy 776.934 / 831.447 5201.0 39.2060489654541 46 20 10 6 10 9.590735596263833 10.426728898558729 0.036899566650390625 3 0.9921096094290436 13.884400816622806 5201.0 27.54332394366197 0.0 - - - - - - - 312.88235294117646 10 17 ARRB1 arrestin, beta 1 33 5 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41759.[MT7]-GQVTTGQYR.2y8_1.heavy 577.308 / 952.485 711.0 17.74090003967285 47 17 10 10 10 2.4192449509388685 33.199489235101126 0.0 3 0.9733583394239768 7.544192928633479 711.0 30.50805288461538 0.0 - - - - - - - 0.0 1 0 HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) 35 5 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41759.[MT7]-GQVTTGQYR.2y5_1.heavy 577.308 / 624.31 614.0 17.74090003967285 47 17 10 10 10 2.4192449509388685 33.199489235101126 0.0 3 0.9733583394239768 7.544192928633479 614.0 13.068644007155635 0.0 - - - - - - - 0.0 1 0 HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) 37 5 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41759.[MT7]-GQVTTGQYR.2y6_1.heavy 577.308 / 725.358 2133.0 17.74090003967285 47 17 10 10 10 2.4192449509388685 33.199489235101126 0.0 3 0.9733583394239768 7.544192928633479 2133.0 33.57656621728786 0.0 - - - - - - - 78.875 4 16 HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) 39 5 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41759.[MT7]-GQVTTGQYR.2y7_1.heavy 577.308 / 824.426 970.0 17.74090003967285 47 17 10 10 10 2.4192449509388685 33.199489235101126 0.0 3 0.9733583394239768 7.544192928633479 970.0 35.097211538461536 0.0 - - - - - - - 0.0 1 0 HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) 41 6 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42217.[MT7]-TVLGTPEVLLGALPGAGGTQR.3b5_1.heavy 717.747 / 616.379 3352.0 43.00044822692871 41 15 10 6 10 2.8913141033643566 34.586349467752115 0.033100128173828125 3 0.950718395038085 5.536305545501658 3352.0 61.228023137779346 0.0 - - - - - - - 189.5 6 16 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 43 6 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42217.[MT7]-TVLGTPEVLLGALPGAGGTQR.3b8_1.heavy 717.747 / 941.542 3033.0 43.00044822692871 41 15 10 6 10 2.8913141033643566 34.586349467752115 0.033100128173828125 3 0.950718395038085 5.536305545501658 3033.0 19.159427486187845 0.0 - - - - - - - 172.91666666666666 6 12 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 45 6 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42217.[MT7]-TVLGTPEVLLGALPGAGGTQR.3y8_1.heavy 717.747 / 743.38 12824.0 43.00044822692871 41 15 10 6 10 2.8913141033643566 34.586349467752115 0.033100128173828125 3 0.950718395038085 5.536305545501658 12824.0 70.38736842105263 0.0 - - - - - - - 191.46666666666667 25 15 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 47 6 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42217.[MT7]-TVLGTPEVLLGALPGAGGTQR.3b7_1.heavy 717.747 / 842.474 4363.0 43.00044822692871 41 15 10 6 10 2.8913141033643566 34.586349467752115 0.033100128173828125 3 0.950718395038085 5.536305545501658 4363.0 51.547243745194294 0.0 - - - - - - - 192.52380952380952 8 21 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 49 7 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533778.[MT7]-DLVVPEK[MT7]WEESGPQFITNSEEVR.4y8_1.heavy 744.885 / 947.479 3006.0 37.87369918823242 46 18 10 10 8 6.275826692091688 15.934155754494027 0.0 4 0.9888818282575467 11.693445014921751 3006.0 18.05055690072639 0.0 - - - - - - - 235.93333333333334 6 15 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 51 7 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533778.[MT7]-DLVVPEK[MT7]WEESGPQFITNSEEVR.4b4_1.heavy 744.885 / 571.357 7014.0 37.87369918823242 46 18 10 10 8 6.275826692091688 15.934155754494027 0.0 4 0.9888818282575467 11.693445014921751 7014.0 7.144991511035653 1.0 - - - - - - - 640.625 18 8 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 53 7 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533778.[MT7]-DLVVPEK[MT7]WEESGPQFITNSEEVR.4y7_1.heavy 744.885 / 834.395 14675.0 37.87369918823242 46 18 10 10 8 6.275826692091688 15.934155754494027 0.0 4 0.9888818282575467 11.693445014921751 14675.0 28.976114649681527 1.0 - - - - - - - 271.2 29 15 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 55 7 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533778.[MT7]-DLVVPEK[MT7]WEESGPQFITNSEEVR.4y6_1.heavy 744.885 / 733.347 5010.0 37.87369918823242 46 18 10 10 8 6.275826692091688 15.934155754494027 0.0 4 0.9888818282575467 11.693445014921751 5010.0 4.533936651583711 1.0 - - - - - - - 693.8888888888889 10 9 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 57 8 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18920.[MT7]-LTAYAMTIPFVR.2y4_1.heavy 763.93 / 518.308 1974.0 43.41360092163086 44 18 10 6 10 3.535813447847517 22.624224300145677 0.033599853515625 3 0.9860158519077422 10.424061303067745 1974.0 6.697670886075949 0.0 - - - - - - - 197.3181818181818 3 22 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 59 8 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18920.[MT7]-LTAYAMTIPFVR.2y8_1.heavy 763.93 / 934.518 1974.0 43.41360092163086 44 18 10 6 10 3.535813447847517 22.624224300145677 0.033599853515625 3 0.9860158519077422 10.424061303067745 1974.0 9.534707393662575 0.0 - - - - - - - 161.6 3 15 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 61 8 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18920.[MT7]-LTAYAMTIPFVR.2y9_1.heavy 763.93 / 1097.58 1410.0 43.41360092163086 44 18 10 6 10 3.535813447847517 22.624224300145677 0.033599853515625 3 0.9860158519077422 10.424061303067745 1410.0 24.678571428571427 1.0 - - - - - - - 169.08333333333334 2 12 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 63 8 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18920.[MT7]-LTAYAMTIPFVR.2y10_1.heavy 763.93 / 1168.62 789.0 43.41360092163086 44 18 10 6 10 3.535813447847517 22.624224300145677 0.033599853515625 3 0.9860158519077422 10.424061303067745 789.0 13.056902654867256 0.0 - - - - - - - 0.0 1 0 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 65 9 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36913.[MT7]-INLNSEEEALFK[MT7]K[MT7].3y3_1.heavy 656.377 / 710.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 67 9 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36913.[MT7]-INLNSEEEALFK[MT7]K[MT7].3y4_1.heavy 656.377 / 823.564 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 69 9 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36913.[MT7]-INLNSEEEALFK[MT7]K[MT7].3y5_1.heavy 656.377 / 894.602 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 71 9 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36913.[MT7]-INLNSEEEALFK[MT7]K[MT7].3b7_1.heavy 656.377 / 944.481 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 73 10 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18922.[MT7]-LWDIEC[CAM]GAC[CAM]LR.2b3_1.heavy 768.875 / 559.3 5121.0 37.9202995300293 37 11 10 6 10 1.341978466052895 58.26940359144015 0.031402587890625 3 0.8618140585715635 3.280934569195331 5121.0 28.302320610687023 0.0 - - - - - - - 229.78947368421052 10 19 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 75 10 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18922.[MT7]-LWDIEC[CAM]GAC[CAM]LR.2y8_1.heavy 768.875 / 978.45 2851.0 37.9202995300293 37 11 10 6 10 1.341978466052895 58.26940359144015 0.031402587890625 3 0.8618140585715635 3.280934569195331 2851.0 17.00811158798283 0.0 - - - - - - - 198.36363636363637 5 22 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 77 10 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18922.[MT7]-LWDIEC[CAM]GAC[CAM]LR.2y9_1.heavy 768.875 / 1093.48 1397.0 37.9202995300293 37 11 10 6 10 1.341978466052895 58.26940359144015 0.031402587890625 3 0.8618140585715635 3.280934569195331 1397.0 8.936489683347343 0.0 - - - - - - - 145.44444444444446 2 18 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 79 10 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18922.[MT7]-LWDIEC[CAM]GAC[CAM]LR.2y6_1.heavy 768.875 / 736.323 1862.0 37.9202995300293 37 11 10 6 10 1.341978466052895 58.26940359144015 0.031402587890625 3 0.8618140585715635 3.280934569195331 1862.0 3.376272446903913 0.0 - - - - - - - 283.39130434782606 3 23 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 81 11 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19216.[MT7]-SYESSLPQTQQVDLDLSRPLFTSAALLSAC[CAM]K[MT7].4b8_1.heavy 929.238 / 1036.51 767.0 43.774898529052734 39 13 10 6 10 1.6454189061675017 53.040647680313946 0.0316009521484375 3 0.9283821882740712 4.583795050968714 767.0 7.519607843137255 0.0 - - - - - - - 0.0 1 0 ORC6 origin recognition complex, subunit 6 83 11 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19216.[MT7]-SYESSLPQTQQVDLDLSRPLFTSAALLSAC[CAM]K[MT7].4y4_1.heavy 929.238 / 609.315 8486.0 43.774898529052734 39 13 10 6 10 1.6454189061675017 53.040647680313946 0.0316009521484375 3 0.9283821882740712 4.583795050968714 8486.0 16.303360925974243 0.0 - - - - - - - 233.64285714285714 16 14 ORC6 origin recognition complex, subunit 6 85 11 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19216.[MT7]-SYESSLPQTQQVDLDLSRPLFTSAALLSAC[CAM]K[MT7].4b5_1.heavy 929.238 / 698.311 2965.0 43.774898529052734 39 13 10 6 10 1.6454189061675017 53.040647680313946 0.0316009521484375 3 0.9283821882740712 4.583795050968714 2965.0 17.46925008389664 0.0 - - - - - - - 188.1578947368421 5 19 ORC6 origin recognition complex, subunit 6 87 11 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19216.[MT7]-SYESSLPQTQQVDLDLSRPLFTSAALLSAC[CAM]K[MT7].4y3_1.heavy 929.238 / 522.283 4907.0 43.774898529052734 39 13 10 6 10 1.6454189061675017 53.040647680313946 0.0316009521484375 3 0.9283821882740712 4.583795050968714 4907.0 13.417578124999999 1.0 - - - - - - - 164.14285714285714 9 14 ORC6 origin recognition complex, subunit 6 89 12 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533780.[MT7]-RDFVDHIDLVDPVDGVVLVDPEYLK[MT7].4y5_1.heavy 789.677 / 793.458 11236.0 43.05059814453125 38 8 10 10 10 0.6270022882103259 79.84059736193649 0.0 3 0.791767621750781 2.6561135148558668 11236.0 37.591222533894346 0.0 - - - - - - - 253.14285714285714 22 21 ARRB1 arrestin, beta 1 91 12 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533780.[MT7]-RDFVDHIDLVDPVDGVVLVDPEYLK[MT7].4b8_2.heavy 789.677 / 571.789 1644.0 43.05059814453125 38 8 10 10 10 0.6270022882103259 79.84059736193649 0.0 3 0.791767621750781 2.6561135148558668 1644.0 6.560354458709492 0.0 - - - - - - - 169.76190476190476 3 21 ARRB1 arrestin, beta 1 93 12 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533780.[MT7]-RDFVDHIDLVDPVDGVVLVDPEYLK[MT7].4b11_2.heavy 789.677 / 735.379 7564.0 43.05059814453125 38 8 10 10 10 0.6270022882103259 79.84059736193649 0.0 3 0.791767621750781 2.6561135148558668 7564.0 18.124981439845005 0.0 - - - - - - - 246.625 15 16 ARRB1 arrestin, beta 1 95 12 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533780.[MT7]-RDFVDHIDLVDPVDGVVLVDPEYLK[MT7].4b5_1.heavy 789.677 / 777.401 2741.0 43.05059814453125 38 8 10 10 10 0.6270022882103259 79.84059736193649 0.0 3 0.791767621750781 2.6561135148558668 2741.0 7.083435316042864 0.0 - - - - - - - 250.52380952380952 5 21 ARRB1 arrestin, beta 1 97 13 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533286.[MT7]-LAEQAER.2y4_1.heavy 480.765 / 503.257 14594.0 18.298699378967285 46 20 10 6 10 30.25520686103771 3.3052162049098 0.03660011291503906 3 0.994517385713705 16.659804505909058 14594.0 30.798859304168428 0.0 - - - - - - - 302.3076923076923 29 13 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 99 13 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533286.[MT7]-LAEQAER.2y5_1.heavy 480.765 / 632.3 9663.0 18.298699378967285 46 20 10 6 10 30.25520686103771 3.3052162049098 0.03660011291503906 3 0.994517385713705 16.659804505909058 9663.0 78.16485549872122 0.0 - - - - - - - 195.94444444444446 19 18 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 101 13 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533286.[MT7]-LAEQAER.2b4_1.heavy 480.765 / 586.332 9262.0 18.298699378967285 46 20 10 6 10 30.25520686103771 3.3052162049098 0.03660011291503906 3 0.994517385713705 16.659804505909058 9262.0 40.82782928631812 0.0 - - - - - - - 698.7142857142857 18 7 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 103 13 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533286.[MT7]-LAEQAER.2y6_1.heavy 480.765 / 703.337 57495.0 18.298699378967285 46 20 10 6 10 30.25520686103771 3.3052162049098 0.03660011291503906 3 0.994517385713705 16.659804505909058 57495.0 556.2974331550802 0.0 - - - - - - - 247.16666666666666 114 12 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 105 14 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533508.[MT7]-VLEGHEELVR.3y3_1.heavy 442.25 / 387.271 18313.0 26.10610008239746 47 17 10 10 10 3.9871839642739193 25.080357690044625 0.0 3 0.9785223729499477 8.405989461757022 18313.0 25.957370224896685 0.0 - - - - - - - 237.33333333333334 36 3 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 107 14 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533508.[MT7]-VLEGHEELVR.3b4_1.heavy 442.25 / 543.326 26147.0 26.10610008239746 47 17 10 10 10 3.9871839642739193 25.080357690044625 0.0 3 0.9785223729499477 8.405989461757022 26147.0 27.16895032026246 0.0 - - - - - - - 356.0 52 2 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 109 14 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533508.[MT7]-VLEGHEELVR.3y4_1.heavy 442.25 / 516.314 37745.0 26.10610008239746 47 17 10 10 10 3.9871839642739193 25.080357690044625 0.0 3 0.9785223729499477 8.405989461757022 37745.0 124.5696773440769 0.0 - - - - - - - 757.4444444444445 75 9 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 111 14 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533508.[MT7]-VLEGHEELVR.3y5_1.heavy 442.25 / 645.357 42933.0 26.10610008239746 47 17 10 10 10 3.9871839642739193 25.080357690044625 0.0 3 0.9785223729499477 8.405989461757022 42933.0 109.98181247762903 0.0 - - - - - - - 237.33333333333334 85 9 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 113 15 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36627.[MT7]-RFLLDTNK[MT7].3y3_1.heavy 432.262 / 506.306 9240.0 28.014150619506836 38 14 10 6 8 1.751938760029617 48.26884875465022 0.036899566650390625 4 0.9428289898378462 5.13668949263681 9240.0 29.919999999999995 0.0 - - - - - - - 711.6666666666666 18 9 MCM6 minichromosome maintenance complex component 6 115 15 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36627.[MT7]-RFLLDTNK[MT7].3b5_1.heavy 432.262 / 789.474 1470.0 28.014150619506836 38 14 10 6 8 1.751938760029617 48.26884875465022 0.036899566650390625 4 0.9428289898378462 5.13668949263681 1470.0 26.04 0.0 - - - - - - - 166.25 2 12 MCM6 minichromosome maintenance complex component 6 117 15 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36627.[MT7]-RFLLDTNK[MT7].3y4_1.heavy 432.262 / 621.332 4515.0 28.014150619506836 38 14 10 6 8 1.751938760029617 48.26884875465022 0.036899566650390625 4 0.9428289898378462 5.13668949263681 4515.0 7.214444444444444 0.0 - - - - - - - 247.5 9 14 MCM6 minichromosome maintenance complex component 6 119 15 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36627.[MT7]-RFLLDTNK[MT7].3b3_1.heavy 432.262 / 561.363 2415.0 28.014150619506836 38 14 10 6 8 1.751938760029617 48.26884875465022 0.036899566650390625 4 0.9428289898378462 5.13668949263681 2415.0 4.176507936507936 1.0 - - - - - - - 766.5 7 10 MCM6 minichromosome maintenance complex component 6 121 16 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533281.[MT7]-VFYLK[MT7].2b3_1.heavy 479.304 / 554.31 14203.0 33.39862537384033 46 20 10 6 10 6.261977240401918 15.969396911059615 0.039501190185546875 3 0.9939559830944069 15.866478643592279 14203.0 21.99235603003919 0.0 - - - - - - - 614.4 28 10 YWHAQ;SFN;YWHAB;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 123 16 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533281.[MT7]-VFYLK[MT7].2y4_1.heavy 479.304 / 714.431 77965.0 33.39862537384033 46 20 10 6 10 6.261977240401918 15.969396911059615 0.039501190185546875 3 0.9939559830944069 15.866478643592279 77965.0 122.06410372118856 0.0 - - - - - - - 184.66666666666666 155 6 YWHAQ;SFN;YWHAB;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 125 16 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533281.[MT7]-VFYLK[MT7].2b4_1.heavy 479.304 / 667.394 6044.0 33.39862537384033 46 20 10 6 10 6.261977240401918 15.969396911059615 0.039501190185546875 3 0.9939559830944069 15.866478643592279 6044.0 6.230125407852181 0.0 - - - - - - - 251.625 12 8 YWHAQ;SFN;YWHAB;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 127 16 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533281.[MT7]-VFYLK[MT7].2y3_1.heavy 479.304 / 567.362 30924.0 33.39862537384033 46 20 10 6 10 6.261977240401918 15.969396911059615 0.039501190185546875 3 0.9939559830944069 15.866478643592279 30924.0 24.1737414864714 0.0 - - - - - - - 201.5 61 2 YWHAQ;SFN;YWHAB;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 129 17 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533284.[MT7]-VIIVVK[MT7].2y4_1.heavy 479.849 / 602.436 11324.0 31.638099670410156 38 18 2 10 8 10.869948867524478 9.199675289988186 0.0 4 0.9891333840667138 11.828267811166251 11324.0 10.656511972017546 1.0 - - - - - - - 683.6666666666666 24 12 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 131 17 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533284.[MT7]-VIIVVK[MT7].2y5_1.heavy 479.849 / 715.52 11531.0 31.638099670410156 38 18 2 10 8 10.869948867524478 9.199675289988186 0.0 4 0.9891333840667138 11.828267811166251 11531.0 44.223895450568676 1.0 - - - - - - - 682.4285714285714 75 7 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 133 17 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533284.[MT7]-VIIVVK[MT7].2b4_1.heavy 479.849 / 569.414 6856.0 31.638099670410156 38 18 2 10 8 10.869948867524478 9.199675289988186 0.0 4 0.9891333840667138 11.828267811166251 6856.0 12.258562544588397 0.0 - - - - - - - 221.0 13 8 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 135 17 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533284.[MT7]-VIIVVK[MT7].2y3_1.heavy 479.849 / 489.352 17037.0 31.638099670410156 38 18 2 10 8 10.869948867524478 9.199675289988186 0.0 4 0.9891333840667138 11.828267811166251 17037.0 41.92265185706561 0.0 - - - - - - - 761.6666666666666 34 9 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 137 18 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533605.[MT7]-LSSGSQSSHILVR.3y7_1.heavy 505.618 / 811.479 9656.0 24.57587480545044 40 14 10 6 10 2.262510960510603 37.544890691485094 0.03750038146972656 3 0.9443003110848631 5.204742393275144 9656.0 10.36293878887836 0.0 - - - - - - - 265.75 19 12 IL3RA interleukin 3 receptor, alpha (low affinity) 139 18 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533605.[MT7]-LSSGSQSSHILVR.3b5_1.heavy 505.618 / 576.311 5793.0 24.57587480545044 40 14 10 6 10 2.262510960510603 37.544890691485094 0.03750038146972656 3 0.9443003110848631 5.204742393275144 5793.0 9.627453919011856 0.0 - - - - - - - 772.3636363636364 11 11 IL3RA interleukin 3 receptor, alpha (low affinity) 141 18 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533605.[MT7]-LSSGSQSSHILVR.3y4_1.heavy 505.618 / 500.355 35822.0 24.57587480545044 40 14 10 6 10 2.262510960510603 37.544890691485094 0.03750038146972656 3 0.9443003110848631 5.204742393275144 35822.0 15.608541847644503 0.0 - - - - - - - 193.0 71 1 IL3RA interleukin 3 receptor, alpha (low affinity) 143 18 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533605.[MT7]-LSSGSQSSHILVR.3y5_1.heavy 505.618 / 637.414 13035.0 24.57587480545044 40 14 10 6 10 2.262510960510603 37.544890691485094 0.03750038146972656 3 0.9443003110848631 5.204742393275144 13035.0 17.09963755609251 0.0 - - - - - - - 675.7142857142857 26 7 IL3RA interleukin 3 receptor, alpha (low affinity) 145 19 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18939.[MT7]-AIAC[CAM]LLFGGSRK[MT7].3y7_1.heavy 527.644 / 908.543 5166.0 37.863399505615234 42 16 10 6 10 1.7033171929802646 37.800940596471925 0.0308990478515625 3 0.9660539358877861 6.679306749189942 5166.0 83.45076923076923 0.0 - - - - - - - 142.57142857142858 10 14 MCM5 minichromosome maintenance complex component 5 147 19 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18939.[MT7]-AIAC[CAM]LLFGGSRK[MT7].3y6_1.heavy 527.644 / 795.459 8219.0 37.863399505615234 42 16 10 6 10 1.7033171929802646 37.800940596471925 0.0308990478515625 3 0.9660539358877861 6.679306749189942 8219.0 42.495965909090906 0.0 - - - - - - - 237.5 16 22 MCM5 minichromosome maintenance complex component 5 149 19 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18939.[MT7]-AIAC[CAM]LLFGGSRK[MT7].3b4_1.heavy 527.644 / 560.298 5401.0 37.863399505615234 42 16 10 6 10 1.7033171929802646 37.800940596471925 0.0308990478515625 3 0.9660539358877861 6.679306749189942 5401.0 4.087795648060549 1.0 - - - - - - - 653.125 10 8 MCM5 minichromosome maintenance complex component 5 151 19 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18939.[MT7]-AIAC[CAM]LLFGGSRK[MT7].3y5_1.heavy 527.644 / 648.391 N/A 37.863399505615234 42 16 10 6 10 1.7033171929802646 37.800940596471925 0.0308990478515625 3 0.9660539358877861 6.679306749189942 9099.0 6.1152463148237155 0.0 - - - - - - - 381.75 18 4 MCM5 minichromosome maintenance complex component 5 153 20 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19125.[MT7]-FFQEEVIPHHSEWEK[MT7].4y5_1.heavy 558.285 / 822.411 6489.0 32.311500549316406 43 13 10 10 10 1.238204453756451 48.90434443523126 0.0 3 0.9205331137922305 4.348609663804861 6489.0 25.515 0.0 - - - - - - - 220.71428571428572 12 14 ACADL acyl-CoA dehydrogenase, long chain 155 20 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19125.[MT7]-FFQEEVIPHHSEWEK[MT7].4b4_1.heavy 558.285 / 696.347 9682.0 32.311500549316406 43 13 10 10 10 1.238204453756451 48.90434443523126 0.0 3 0.9205331137922305 4.348609663804861 9682.0 22.291428571428572 0.0 - - - - - - - 702.2727272727273 19 11 ACADL acyl-CoA dehydrogenase, long chain 157 20 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19125.[MT7]-FFQEEVIPHHSEWEK[MT7].4b5_1.heavy 558.285 / 825.39 15656.0 32.311500549316406 43 13 10 10 10 1.238204453756451 48.90434443523126 0.0 3 0.9205331137922305 4.348609663804861 15656.0 56.324444444444445 0.0 - - - - - - - 197.41666666666666 31 12 ACADL acyl-CoA dehydrogenase, long chain 159 20 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19125.[MT7]-FFQEEVIPHHSEWEK[MT7].4y6_1.heavy 558.285 / 959.47 6798.0 32.311500549316406 43 13 10 10 10 1.238204453756451 48.90434443523126 0.0 3 0.9205331137922305 4.348609663804861 6798.0 25.409999999999997 0.0 - - - - - - - 187.27272727272728 13 11 ACADL acyl-CoA dehydrogenase, long chain 161 21 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18420.[MT7]-IGLLTR.2y4_1.heavy 408.775 / 502.335 845.0 31.50332546234131 36 17 10 5 4 2.988893846288173 33.45719357821534 0.041500091552734375 10 0.9758195290875009 7.920470240959795 845.0 2.005892289110521 10.0 - - - - - - - 271.57142857142856 5 14 MCM6 minichromosome maintenance complex component 6 163 21 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18420.[MT7]-IGLLTR.2b3_1.heavy 408.775 / 428.299 1901.0 31.50332546234131 36 17 10 5 4 2.988893846288173 33.45719357821534 0.041500091552734375 10 0.9758195290875009 7.920470240959795 1901.0 8.829446276646593 2.0 - - - - - - - 237.58333333333334 4 12 MCM6 minichromosome maintenance complex component 6 165 21 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18420.[MT7]-IGLLTR.2y5_1.heavy 408.775 / 559.356 8554.0 31.50332546234131 36 17 10 5 4 2.988893846288173 33.45719357821534 0.041500091552734375 10 0.9758195290875009 7.920470240959795 8554.0 69.8794371515685 0.0 - - - - - - - 200.8 17 10 MCM6 minichromosome maintenance complex component 6 167 21 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18420.[MT7]-IGLLTR.2b4_1.heavy 408.775 / 541.383 739.0 31.50332546234131 36 17 10 5 4 2.988893846288173 33.45719357821534 0.041500091552734375 10 0.9758195290875009 7.920470240959795 739.0 -0.04442105263157892 13.0 - - - - - - - 220.16666666666666 5 12 MCM6 minichromosome maintenance complex component 6 169 22 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18882.[MT7]-FLSTLTIDGVTR.2y8_1.heavy 733.92 / 874.499 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDR kinase insert domain receptor (a type III receptor tyrosine kinase) 171 22 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18882.[MT7]-FLSTLTIDGVTR.2y9_1.heavy 733.92 / 975.547 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDR kinase insert domain receptor (a type III receptor tyrosine kinase) 173 22 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18882.[MT7]-FLSTLTIDGVTR.2y10_1.heavy 733.92 / 1062.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDR kinase insert domain receptor (a type III receptor tyrosine kinase) 175 22 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18882.[MT7]-FLSTLTIDGVTR.2y11_1.heavy 733.92 / 1175.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDR kinase insert domain receptor (a type III receptor tyrosine kinase) 177 23 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18560.[MT7]-YLIGEK[MT7].2b3_1.heavy 505.81 / 534.341 4010.0 28.810400009155273 46 16 10 10 10 3.7561470781024613 26.62302564853723 0.0 3 0.9622855157071746 6.3348132053853945 4010.0 4.868636673438046 1.0 - - - - - - - 751.6 8 10 LDHC lactate dehydrogenase C 179 23 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18560.[MT7]-YLIGEK[MT7].2y4_1.heavy 505.81 / 590.363 8320.0 28.810400009155273 46 16 10 10 10 3.7561470781024613 26.62302564853723 0.0 3 0.9622855157071746 6.3348132053853945 8320.0 18.20597290522447 0.0 - - - - - - - 270.6 16 10 LDHC lactate dehydrogenase C 181 23 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18560.[MT7]-YLIGEK[MT7].2y5_1.heavy 505.81 / 703.447 5213.0 28.810400009155273 46 16 10 10 10 3.7561470781024613 26.62302564853723 0.0 3 0.9622855157071746 6.3348132053853945 5213.0 17.604853686968823 0.0 - - - - - - - 567.7777777777778 10 9 LDHC lactate dehydrogenase C 183 23 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18560.[MT7]-YLIGEK[MT7].2y3_1.heavy 505.81 / 477.279 15237.0 28.810400009155273 46 16 10 10 10 3.7561470781024613 26.62302564853723 0.0 3 0.9622855157071746 6.3348132053853945 15237.0 16.28890125164434 0.0 - - - - - - - 1647.0 30 7 LDHC lactate dehydrogenase C 185 24 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1316250.0 29.50589942932129 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1316250.0 3196.977535862521 0.0 - - - - - - - 302.0 2632 3 187 24 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 364895.0 29.50589942932129 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 364895.0 514.594088022807 0.0 - - - - - - - 631.3636363636364 729 11 189 24 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 266522.0 29.50589942932129 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 266522.0 149.25434625226202 1.0 - - - - - - - 1087.6 540 10 191 25 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18564.[MT7]-SSIPITVR.2y5_1.heavy 508.815 / 585.372 22226.0 27.607850074768066 44 20 10 6 8 21.23120902861382 4.710047358359459 0.034999847412109375 4 0.9995835552352288 60.47398579225513 22226.0 73.18089690647903 0.0 - - - - - - - 687.3333333333334 44 9 MCM5 minichromosome maintenance complex component 5 193 25 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18564.[MT7]-SSIPITVR.2y6_1.heavy 508.815 / 698.456 2516.0 27.607850074768066 44 20 10 6 8 21.23120902861382 4.710047358359459 0.034999847412109375 4 0.9995835552352288 60.47398579225513 2516.0 24.76063492063492 0.0 - - - - - - - 279.8333333333333 5 12 MCM5 minichromosome maintenance complex component 5 195 25 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18564.[MT7]-SSIPITVR.2b5_1.heavy 508.815 / 642.394 3040.0 27.607850074768066 44 20 10 6 8 21.23120902861382 4.710047358359459 0.034999847412109375 4 0.9995835552352288 60.47398579225513 3040.0 1.1867343884487531 4.0 - - - - - - - 655.25 8 8 MCM5 minichromosome maintenance complex component 5 197 25 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18564.[MT7]-SSIPITVR.2y7_1.heavy 508.815 / 785.488 9645.0 27.607850074768066 44 20 10 6 8 21.23120902861382 4.710047358359459 0.034999847412109375 4 0.9995835552352288 60.47398579225513 9645.0 36.34325262308313 0.0 - - - - - - - 747.125 19 8 MCM5 minichromosome maintenance complex component 5 199 26 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18565.[MT7]-VLQLMLR.2y4_1.heavy 508.824 / 532.328 1303.0 39.54319953918457 40 16 10 6 8 1.7009772689789975 44.673207963997015 0.03800201416015625 4 0.9684013731129207 6.924333688702353 1303.0 0.3826725403817915 4.0 - - - - - - - 668.1428571428571 5 7 MCM5 minichromosome maintenance complex component 5 201 26 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18565.[MT7]-VLQLMLR.2y5_1.heavy 508.824 / 660.386 2960.0 39.54319953918457 40 16 10 6 8 1.7009772689789975 44.673207963997015 0.03800201416015625 4 0.9684013731129207 6.924333688702353 2960.0 9.830605574374516 0.0 - - - - - - - 288.94117647058823 5 17 MCM5 minichromosome maintenance complex component 5 203 26 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18565.[MT7]-VLQLMLR.2b4_1.heavy 508.824 / 598.404 1717.0 39.54319953918457 40 16 10 6 8 1.7009772689789975 44.673207963997015 0.03800201416015625 4 0.9684013731129207 6.924333688702353 1717.0 2.634739134739135 2.0 - - - - - - - 213.06666666666666 9 15 MCM5 minichromosome maintenance complex component 5 205 26 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18565.[MT7]-VLQLMLR.2y6_1.heavy 508.824 / 773.47 6217.0 39.54319953918457 40 16 10 6 8 1.7009772689789975 44.673207963997015 0.03800201416015625 4 0.9684013731129207 6.924333688702353 6217.0 40.3627828770375 0.0 - - - - - - - 186.07142857142858 12 14 MCM5 minichromosome maintenance complex component 5 207 27 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18528.[MT7]-ALTSFER.2y4_1.heavy 484.27 / 538.262 2691.0 28.095425605773926 37 11 10 6 10 1.2334002113102656 53.36234619628347 0.035900115966796875 3 0.8754192835852525 3.459565569704776 2691.0 5.609999999999999 2.0 - - - - - - - 734.1818181818181 5 11 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 209 27 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18528.[MT7]-ALTSFER.2y5_1.heavy 484.27 / 639.31 9833.0 28.095425605773926 37 11 10 6 10 1.2334002113102656 53.36234619628347 0.035900115966796875 3 0.8754192835852525 3.459565569704776 9833.0 30.445077046150026 0.0 - - - - - - - 621.25 19 8 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 211 27 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18528.[MT7]-ALTSFER.2b4_1.heavy 484.27 / 517.31 4037.0 28.095425605773926 37 11 10 6 10 1.2334002113102656 53.36234619628347 0.035900115966796875 3 0.8754192835852525 3.459565569704776 4037.0 2.479592822636301 1.0 - - - - - - - 1332.625 8 8 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 213 27 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18528.[MT7]-ALTSFER.2y6_1.heavy 484.27 / 752.394 8901.0 28.095425605773926 37 11 10 6 10 1.2334002113102656 53.36234619628347 0.035900115966796875 3 0.8754192835852525 3.459565569704776 8901.0 49.879999999999995 0.0 - - - - - - - 207.25 17 16 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 215 28 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18524.[MT7]-NVAIMK[MT7].2y4_1.heavy 482.299 / 606.377 2647.0 24.89586639404297 27 5 10 6 6 0.6766924635356152 78.84406857788524 0.03759956359863281 6 0.6979739680340719 2.1864939558179737 2647.0 5.987261904761905 3.0 - - - - - - - 686.0 7 7 LDHC lactate dehydrogenase C 217 28 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18524.[MT7]-NVAIMK[MT7].2y5_1.heavy 482.299 / 705.445 7058.0 24.89586639404297 27 5 10 6 6 0.6766924635356152 78.84406857788524 0.03759956359863281 6 0.6979739680340719 2.1864939558179737 7058.0 24.576964285714283 0.0 - - - - - - - 285.8333333333333 14 12 LDHC lactate dehydrogenase C 219 28 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18524.[MT7]-NVAIMK[MT7].2b4_1.heavy 482.299 / 542.342 2254.0 24.89586639404297 27 5 10 6 6 0.6766924635356152 78.84406857788524 0.03759956359863281 6 0.6979739680340719 2.1864939558179737 2254.0 2.951666666666666 0.0 - - - - - - - 820.75 4 8 LDHC lactate dehydrogenase C 221 28 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18524.[MT7]-NVAIMK[MT7].2y3_1.heavy 482.299 / 535.339 N/A 24.89586639404297 27 5 10 6 6 0.6766924635356152 78.84406857788524 0.03759956359863281 6 0.6979739680340719 2.1864939558179737 2353.0 0.8745774570393592 3.0 - - - - - - - 310.3333333333333 6 6 LDHC lactate dehydrogenase C 223 29 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 328104.0 15.409266789754232 25 -3 10 8 10 null 0.0 0.01640033721923828 3 0.0 0.0 328104.0 1112.6826898116747 1.0 - - - - - - - 701.4444444444445 656 9 225 29 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 625117.0 15.409266789754232 25 -3 10 8 10 null 0.0 0.01640033721923828 3 0.0 0.0 625117.0 4546.431357105042 0.0 - - - - - - - 734.0909090909091 1250 11 227 29 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 245315.0 15.409266789754232 25 -3 10 8 10 null 0.0 0.01640033721923828 3 0.0 0.0 245315.0 1189.2729280718536 0.0 - - - - - - - 671.0 490 7 229 30 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533612.[MT7]-SSGSHLVFVPSLR.3y7_1.heavy 510.623 / 817.493 22167.0 33.84830093383789 50 20 10 10 10 8.964271684998327 11.155395944474732 0.0 3 0.9925069537686724 14.248252668355626 22167.0 50.68521910112359 0.0 - - - - - - - 667.5 44 10 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 231 30 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533612.[MT7]-SSGSHLVFVPSLR.3y6_1.heavy 510.623 / 718.425 37479.0 33.84830093383789 50 20 10 10 10 8.964271684998327 11.155395944474732 0.0 3 0.9925069537686724 14.248252668355626 37479.0 67.85924879614768 0.0 - - - - - - - 762.8571428571429 74 7 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 233 30 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533612.[MT7]-SSGSHLVFVPSLR.3b5_1.heavy 510.623 / 600.286 26707.0 33.84830093383789 50 20 10 10 10 8.964271684998327 11.155395944474732 0.0 3 0.9925069537686724 14.248252668355626 26707.0 47.78175453759724 0.0 - - - - - - - 741.6666666666666 53 9 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 235 30 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533612.[MT7]-SSGSHLVFVPSLR.3y5_1.heavy 510.623 / 571.356 13799.0 33.84830093383789 50 20 10 10 10 8.964271684998327 11.155395944474732 0.0 3 0.9925069537686724 14.248252668355626 13799.0 18.58777451481103 0.0 - - - - - - - 791.1111111111111 27 9 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 237 31 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18425.[MT7]-AYVDAR.2b3_1.heavy 419.731 / 478.278 7099.0 18.670449256896973 44 18 10 6 10 4.502048601372024 22.212110275647504 0.03890037536621094 3 0.9825725252780797 9.334958525778857 7099.0 18.58902500321675 1.0 - - - - - - - 240.41666666666666 14 12 ACADL acyl-CoA dehydrogenase, long chain 239 31 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18425.[MT7]-AYVDAR.2y5_1.heavy 419.731 / 623.315 11716.0 18.670449256896973 44 18 10 6 10 4.502048601372024 22.212110275647504 0.03890037536621094 3 0.9825725252780797 9.334958525778857 11716.0 162.1395466197537 0.0 - - - - - - - 158.6875 23 16 ACADL acyl-CoA dehydrogenase, long chain 241 31 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18425.[MT7]-AYVDAR.2b4_1.heavy 419.731 / 593.305 95117.0 18.670449256896973 44 18 10 6 10 4.502048601372024 22.212110275647504 0.03890037536621094 3 0.9825725252780797 9.334958525778857 95117.0 270.8275580965825 0.0 - - - - - - - 230.88888888888889 190 9 ACADL acyl-CoA dehydrogenase, long chain 243 31 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18425.[MT7]-AYVDAR.2y3_1.heavy 419.731 / 361.183 1962.0 18.670449256896973 44 18 10 6 10 4.502048601372024 22.212110275647504 0.03890037536621094 3 0.9825725252780797 9.334958525778857 1962.0 3.3368526739442483 1.0 - - - - - - - 758.6428571428571 3 14 ACADL acyl-CoA dehydrogenase, long chain 245 32 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533295.[MT7]-QLEAIVR.2b3_1.heavy 486.802 / 515.295 8663.0 28.653400421142578 50 20 10 10 10 6.7973946471329585 14.71151892617836 0.0 3 0.9970666806042383 22.78119362614899 8663.0 15.095650895769307 0.0 - - - - - - - 675.0 17 10 MCM5 minichromosome maintenance complex component 5 247 32 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533295.[MT7]-QLEAIVR.2y5_1.heavy 486.802 / 587.351 7757.0 28.653400421142578 50 20 10 10 10 6.7973946471329585 14.71151892617836 0.0 3 0.9970666806042383 22.78119362614899 7757.0 27.32548298475718 0.0 - - - - - - - 570.6666666666666 15 9 MCM5 minichromosome maintenance complex component 5 249 32 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533295.[MT7]-QLEAIVR.2b4_1.heavy 486.802 / 586.332 7555.0 28.653400421142578 50 20 10 10 10 6.7973946471329585 14.71151892617836 0.0 3 0.9970666806042383 22.78119362614899 7555.0 14.289657005085969 2.0 - - - - - - - 659.5454545454545 18 11 MCM5 minichromosome maintenance complex component 5 251 32 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533295.[MT7]-QLEAIVR.2y6_1.heavy 486.802 / 700.435 18434.0 28.653400421142578 50 20 10 10 10 6.7973946471329585 14.71151892617836 0.0 3 0.9970666806042383 22.78119362614899 18434.0 97.05802476976817 0.0 - - - - - - - 604.375 36 8 MCM5 minichromosome maintenance complex component 5 253 33 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18848.[MT7]-SPNVLSVALSQR.2y8_1.heavy 707.91 / 873.515 1032.0 35.939499855041504 38 18 10 6 4 3.4137421055871466 22.896688352629543 0.034000396728515625 7 0.9887083821212891 11.603119833113139 1032.0 1.4992736077481839 0.0 - - - - - - - 226.23809523809524 2 21 HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) 255 33 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18848.[MT7]-SPNVLSVALSQR.2b4_1.heavy 707.91 / 542.305 619.0 35.939499855041504 38 18 10 6 4 3.4137421055871466 22.896688352629543 0.034000396728515625 7 0.9887083821212891 11.603119833113139 619.0 0.772141372141372 14.0 - - - - - - - 0.0 1 0 HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) 257 33 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18848.[MT7]-SPNVLSVALSQR.2y11_1.heavy 707.91 / 1183.68 1857.0 35.939499855041504 38 18 10 6 4 3.4137421055871466 22.896688352629543 0.034000396728515625 7 0.9887083821212891 11.603119833113139 1857.0 9.965217391304348 1.0 - - - - - - - 190.69230769230768 3 13 HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) 259 33 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18848.[MT7]-SPNVLSVALSQR.2y7_1.heavy 707.91 / 760.431 757.0 35.939499855041504 38 18 10 6 4 3.4137421055871466 22.896688352629543 0.034000396728515625 7 0.9887083821212891 11.603119833113139 757.0 4.163749944970284 7.0 - - - - - - - 183.5185185185185 2 27 HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) 261 34 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36656.[MT7]-IQETQAELPR.2b3_1.heavy 664.868 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 263 34 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36656.[MT7]-IQETQAELPR.2y9_1.heavy 664.868 / 1071.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 265 34 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36656.[MT7]-IQETQAELPR.2b7_1.heavy 664.868 / 944.481 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 267 34 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36656.[MT7]-IQETQAELPR.2y7_1.heavy 664.868 / 814.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 269 35 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18427.[MT7]-LALVQR.2y4_1.heavy 422.28 / 515.33 15317.0 27.785574913024902 44 18 10 6 10 3.440083466518731 29.06906212400632 0.036701202392578125 3 0.9809228782523404 8.920990821189669 15317.0 11.135791498986576 0.0 - - - - - - - 780.7777777777778 30 9 LDHC lactate dehydrogenase C 271 35 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18427.[MT7]-LALVQR.2b3_1.heavy 422.28 / 442.315 24234.0 27.785574913024902 44 18 10 6 10 3.440083466518731 29.06906212400632 0.036701202392578125 3 0.9809228782523404 8.920990821189669 24234.0 23.631313559322034 1.0 - - - - - - - 839.0 48 7 LDHC lactate dehydrogenase C 273 35 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18427.[MT7]-LALVQR.2y5_1.heavy 422.28 / 586.367 90433.0 27.785574913024902 44 18 10 6 10 3.440083466518731 29.06906212400632 0.036701202392578125 3 0.9809228782523404 8.920990821189669 90433.0 279.1951883304448 0.0 - - - - - - - 1304.0 180 7 LDHC lactate dehydrogenase C 275 35 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18427.[MT7]-LALVQR.2b4_1.heavy 422.28 / 541.383 18989.0 27.785574913024902 44 18 10 6 10 3.440083466518731 29.06906212400632 0.036701202392578125 3 0.9809228782523404 8.920990821189669 18989.0 43.05988948694457 0.0 - - - - - - - 664.4444444444445 37 9 LDHC lactate dehydrogenase C 277 36 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18948.[MT7]-LTWLTVSTVFQR.3y6_1.heavy 532.307 / 737.394 21484.0 46.16859817504883 50 20 10 10 10 5.367118843209659 14.944994419383224 0.0 3 0.9941375019758596 16.110485033776634 21484.0 545.031606788627 0.0 - - - - - - - 122.88888888888889 42 18 HTR2B 5-hydroxytryptamine (serotonin) receptor 2B 279 36 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18948.[MT7]-LTWLTVSTVFQR.3b4_1.heavy 532.307 / 658.404 10936.0 46.16859817504883 50 20 10 10 10 5.367118843209659 14.944994419383224 0.0 3 0.9941375019758596 16.110485033776634 10936.0 123.99537091232983 0.0 - - - - - - - 121.16 21 25 HTR2B 5-hydroxytryptamine (serotonin) receptor 2B 281 36 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18948.[MT7]-LTWLTVSTVFQR.3b3_1.heavy 532.307 / 545.32 15977.0 46.16859817504883 50 20 10 10 10 5.367118843209659 14.944994419383224 0.0 3 0.9941375019758596 16.110485033776634 15977.0 230.73483870967743 0.0 - - - - - - - 161.54166666666666 31 24 HTR2B 5-hydroxytryptamine (serotonin) receptor 2B 283 36 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18948.[MT7]-LTWLTVSTVFQR.3y5_1.heavy 532.307 / 650.362 12758.0 46.16859817504883 50 20 10 10 10 5.367118843209659 14.944994419383224 0.0 3 0.9941375019758596 16.110485033776634 12758.0 87.95469321213318 0.0 - - - - - - - 134.04545454545453 25 22 HTR2B 5-hydroxytryptamine (serotonin) receptor 2B 285 37 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19113.[MT7]-VQYAPERPGPQPTAETTR.3y7_1.heavy 714.707 / 775.394 4192.0 22.37310028076172 38 8 10 10 10 0.6457594112758634 91.43761108181477 0.0 3 0.7675793107461363 2.5085924270223656 4192.0 65.98788722589627 0.0 - - - - - - - 160.625 8 8 ARRB1 arrestin, beta 1 287 37 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19113.[MT7]-VQYAPERPGPQPTAETTR.3y15_2.heavy 714.707 / 804.41 11967.0 22.37310028076172 38 8 10 10 10 0.6457594112758634 91.43761108181477 0.0 3 0.7675793107461363 2.5085924270223656 11967.0 195.02291509707334 0.0 - - - - - - - 124.16666666666667 23 6 ARRB1 arrestin, beta 1 289 37 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19113.[MT7]-VQYAPERPGPQPTAETTR.3y11_1.heavy 714.707 / 1154.58 5544.0 22.37310028076172 38 8 10 10 10 0.6457594112758634 91.43761108181477 0.0 3 0.7675793107461363 2.5085924270223656 5544.0 85.35663069961713 0.0 - - - - - - - 321.0 11 4 ARRB1 arrestin, beta 1 291 37 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19113.[MT7]-VQYAPERPGPQPTAETTR.3y14_2.heavy 714.707 / 768.892 16632.0 22.37310028076172 38 8 10 10 10 0.6457594112758634 91.43761108181477 0.0 3 0.7675793107461363 2.5085924270223656 16632.0 106.54498797113071 0.0 - - - - - - - 232.88888888888889 33 9 ARRB1 arrestin, beta 1 293 38 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18949.[MT7]-LTWLTVSTVFQR.2y8_1.heavy 797.957 / 937.51 5435.0 46.16859817504883 46 16 10 10 10 3.5673687691062557 21.84725542889137 0.0 3 0.969769733647475 7.080129454749229 5435.0 32.69836027427011 0.0 - - - - - - - 168.5185185185185 10 27 HTR2B 5-hydroxytryptamine (serotonin) receptor 2B 295 38 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18949.[MT7]-LTWLTVSTVFQR.2y9_1.heavy 797.957 / 1050.59 2236.0 46.16859817504883 46 16 10 10 10 3.5673687691062557 21.84725542889137 0.0 3 0.969769733647475 7.080129454749229 2236.0 27.85031962855797 0.0 - - - - - - - 126.1923076923077 4 26 HTR2B 5-hydroxytryptamine (serotonin) receptor 2B 297 38 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18949.[MT7]-LTWLTVSTVFQR.2y6_1.heavy 797.957 / 737.394 2698.0 46.16859817504883 46 16 10 10 10 3.5673687691062557 21.84725542889137 0.0 3 0.969769733647475 7.080129454749229 2698.0 6.148810057459555 0.0 - - - - - - - 198.35714285714286 5 28 HTR2B 5-hydroxytryptamine (serotonin) receptor 2B 299 38 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18949.[MT7]-LTWLTVSTVFQR.2y10_1.heavy 797.957 / 1236.67 1465.0 46.16859817504883 46 16 10 10 10 3.5673687691062557 21.84725542889137 0.0 3 0.969769733647475 7.080129454749229 1465.0 28.246253746253743 0.0 - - - - - - - 81.2 2 20 HTR2B 5-hydroxytryptamine (serotonin) receptor 2B 301 39 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533611.[MT7]-LTAYAMTIPFVR.3y6_1.heavy 509.622 / 732.44 7676.0 43.41360092163086 44 18 10 6 10 3.998709045790273 25.00807106865581 0.033599853515625 3 0.9876218609813995 11.081171896304504 7676.0 81.4595918367347 0.0 - - - - - - - 144.0 15 14 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 303 39 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533611.[MT7]-LTAYAMTIPFVR.3b4_1.heavy 509.622 / 593.341 11598.0 43.41360092163086 44 18 10 6 10 3.998709045790273 25.00807106865581 0.033599853515625 3 0.9876218609813995 11.081171896304504 11598.0 103.41550000000001 0.0 - - - - - - - 184.47058823529412 23 17 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 305 39 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533611.[MT7]-LTAYAMTIPFVR.3b5_1.heavy 509.622 / 664.379 23195.0 43.41360092163086 44 18 10 6 10 3.998709045790273 25.00807106865581 0.033599853515625 3 0.9876218609813995 11.081171896304504 23195.0 126.3299107142857 0.0 - - - - - - - 200.94117647058823 46 17 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 307 39 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533611.[MT7]-LTAYAMTIPFVR.3y4_1.heavy 509.622 / 518.308 46503.0 43.41360092163086 44 18 10 6 10 3.998709045790273 25.00807106865581 0.033599853515625 3 0.9876218609813995 11.081171896304504 46503.0 262.6652967032967 0.0 - - - - - - - 253.86666666666667 93 15 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 309 40 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533198.[MT7]-LQALK[MT7].2b3_1.heavy 430.794 / 457.289 2626.0 25.885700225830078 37 17 4 10 6 3.1696920474091708 24.513896177306112 0.0 5 0.9705235204074671 7.17054162340141 2626.0 4.766666666666667 3.0 - - - - - - - 650.8888888888889 26 9 ZMPSTE24;JUN;TKT zinc metallopeptidase (STE24 homolog, S. cerevisiae);jun proto-oncogene;transketolase 311 40 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533198.[MT7]-LQALK[MT7].2y4_1.heavy 430.794 / 603.395 7677.0 25.885700225830078 37 17 4 10 6 3.1696920474091708 24.513896177306112 0.0 5 0.9705235204074671 7.17054162340141 7677.0 8.29574123023162 0.0 - - - - - - - 336.6666666666667 15 6 ZMPSTE24;JUN;TKT zinc metallopeptidase (STE24 homolog, S. cerevisiae);jun proto-oncogene;transketolase 313 40 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533198.[MT7]-LQALK[MT7].2b4_1.heavy 430.794 / 570.373 1212.0 25.885700225830078 37 17 4 10 6 3.1696920474091708 24.513896177306112 0.0 5 0.9705235204074671 7.17054162340141 1212.0 1.6666666666666665 9.0 - - - - - - - 744.875 13 8 ZMPSTE24;JUN;TKT zinc metallopeptidase (STE24 homolog, S. cerevisiae);jun proto-oncogene;transketolase 315 40 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533198.[MT7]-LQALK[MT7].2y3_1.heavy 430.794 / 475.336 5657.0 25.885700225830078 37 17 4 10 6 3.1696920474091708 24.513896177306112 0.0 5 0.9705235204074671 7.17054162340141 5657.0 4.9220822082208215 2.0 - - - - - - - 649.2857142857143 11 7 ZMPSTE24;JUN;TKT zinc metallopeptidase (STE24 homolog, S. cerevisiae);jun proto-oncogene;transketolase 317 41 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36938.[MT7]-DATLTALDRGQQQVFK[MT7].3y7_1.heavy 693.719 / 978.549 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 319 41 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36938.[MT7]-DATLTALDRGQQQVFK[MT7].3y3_1.heavy 693.719 / 537.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 321 41 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36938.[MT7]-DATLTALDRGQQQVFK[MT7].3b4_1.heavy 693.719 / 545.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 323 41 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36938.[MT7]-DATLTALDRGQQQVFK[MT7].3y8_2.heavy 693.719 / 567.829 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 325 42 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533196.[MT7]-GDVAVVR.2y5_1.heavy 430.26 / 543.361 12767.0 20.18274974822998 37 11 10 6 10 0.8410452587414908 72.06708553733705 0.030200958251953125 3 0.8593139406124974 3.250937164539832 12767.0 32.668770608126835 0.0 - - - - - - - 744.1111111111111 25 9 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 327 42 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533196.[MT7]-GDVAVVR.2b4_1.heavy 430.26 / 487.263 14713.0 20.18274974822998 37 11 10 6 10 0.8410452587414908 72.06708553733705 0.030200958251953125 3 0.8593139406124974 3.250937164539832 14713.0 41.61697539335967 0.0 - - - - - - - 729.75 29 8 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 329 42 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533196.[MT7]-GDVAVVR.2y6_1.heavy 430.26 / 658.388 6755.0 20.18274974822998 37 11 10 6 10 0.8410452587414908 72.06708553733705 0.030200958251953125 3 0.8593139406124974 3.250937164539832 6755.0 25.20424551188743 0.0 - - - - - - - 213.73684210526315 13 19 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 331 42 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533196.[MT7]-GDVAVVR.2b5_1.heavy 430.26 / 586.332 20438.0 20.18274974822998 37 11 10 6 10 0.8410452587414908 72.06708553733705 0.030200958251953125 3 0.8593139406124974 3.250937164539832 20438.0 55.797897570695724 0.0 - - - - - - - 744.1428571428571 40 7 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 333 43 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18751.[MT7]-ILQEGVDPK[MT7].2b4_1.heavy 643.882 / 628.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 335 43 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18751.[MT7]-ILQEGVDPK[MT7].2b6_1.heavy 643.882 / 784.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 337 43 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18751.[MT7]-ILQEGVDPK[MT7].2b7_1.heavy 643.882 / 899.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 339 43 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18751.[MT7]-ILQEGVDPK[MT7].2b5_1.heavy 643.882 / 685.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 341 44 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36933.[MT7]-WEESGPQFITNSEEVR.2b3_1.heavy 1026.49 / 589.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 343 44 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36933.[MT7]-WEESGPQFITNSEEVR.2b4_1.heavy 1026.49 / 676.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 345 44 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36933.[MT7]-WEESGPQFITNSEEVR.2y9_1.heavy 1026.49 / 1094.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 347 44 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36933.[MT7]-WEESGPQFITNSEEVR.2y7_1.heavy 1026.49 / 834.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 349 45 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18941.[MT7]-VRIQETQAELPR.3y6_1.heavy 528.638 / 713.394 8552.0 26.018299102783203 44 14 10 10 10 2.4994141922709376 31.082434994205496 0.0 3 0.9482068245472978 5.399251849891561 8552.0 14.18962431688129 0.0 - - - - - - - 254.58333333333334 17 12 MCM6 minichromosome maintenance complex component 6 351 45 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18941.[MT7]-VRIQETQAELPR.3b5_1.heavy 528.638 / 770.464 3360.0 26.018299102783203 44 14 10 10 10 2.4994141922709376 31.082434994205496 0.0 3 0.9482068245472978 5.399251849891561 3360.0 14.282063882063884 0.0 - - - - - - - 246.0 6 12 MCM6 minichromosome maintenance complex component 6 353 45 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18941.[MT7]-VRIQETQAELPR.3y4_1.heavy 528.638 / 514.298 15067.0 26.018299102783203 44 14 10 10 10 2.4994141922709376 31.082434994205496 0.0 3 0.9482068245472978 5.399251849891561 15067.0 19.945190627326518 0.0 - - - - - - - 1149.0 30 7 MCM6 minichromosome maintenance complex component 6 355 45 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18941.[MT7]-VRIQETQAELPR.3y5_1.heavy 528.638 / 585.336 27996.0 26.018299102783203 44 14 10 10 10 2.4994141922709376 31.082434994205496 0.0 3 0.9482068245472978 5.399251849891561 27996.0 59.513236024844716 0.0 - - - - - - - 295.1 55 10 MCM6 minichromosome maintenance complex component 6 357 46 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41883.[MT7]-IPGIIIAASAVR.3y6_1.heavy 442.286 / 574.331 115306.0 40.76599979400635 43 17 10 6 10 3.365219199856937 29.715746303911267 0.032398223876953125 3 0.9789867555583247 8.498697511405961 115306.0 499.4075862909368 0.0 - - - - - - - 200.2 230 10 MCM5 minichromosome maintenance complex component 5 359 46 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41883.[MT7]-IPGIIIAASAVR.3b4_1.heavy 442.286 / 525.352 107677.0 40.76599979400635 43 17 10 6 10 3.365219199856937 29.715746303911267 0.032398223876953125 3 0.9789867555583247 8.498697511405961 107677.0 472.29815157894734 0.0 - - - - - - - 219.0 215 8 MCM5 minichromosome maintenance complex component 5 361 46 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41883.[MT7]-IPGIIIAASAVR.3b5_1.heavy 442.286 / 638.436 92482.0 40.76599979400635 43 17 10 6 10 3.365219199856937 29.715746303911267 0.032398223876953125 3 0.9789867555583247 8.498697511405961 92482.0 823.9020035424354 0.0 - - - - - - - 203.375 184 8 MCM5 minichromosome maintenance complex component 5 363 46 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41883.[MT7]-IPGIIIAASAVR.3y5_1.heavy 442.286 / 503.294 90669.0 40.76599979400635 43 17 10 6 10 3.365219199856937 29.715746303911267 0.032398223876953125 3 0.9789867555583247 8.498697511405961 90669.0 1503.9213387445886 0.0 - - - - - - - 172.125 181 8 MCM5 minichromosome maintenance complex component 5 365 47 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36790.[MT7]-SEVSSDEDIQFR.2y4_1.heavy 778.371 / 563.33 1464.0 27.75809955596924 40 14 10 6 10 1.0997674941114715 56.122458603558414 0.03660011291503906 3 0.9451297191203903 5.2443017481286285 1464.0 11.624968152866241 1.0 - - - - - - - 171.36363636363637 2 11 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 367 47 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36790.[MT7]-SEVSSDEDIQFR.2y9_1.heavy 778.371 / 1096.49 2301.0 27.75809955596924 40 14 10 6 10 1.0997674941114715 56.122458603558414 0.03660011291503906 3 0.9451297191203903 5.2443017481286285 2301.0 20.69799043062201 0.0 - - - - - - - 174.5 4 12 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 369 47 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36790.[MT7]-SEVSSDEDIQFR.2b6_1.heavy 778.371 / 749.343 1569.0 27.75809955596924 40 14 10 6 10 1.0997674941114715 56.122458603558414 0.03660011291503906 3 0.9451297191203903 5.2443017481286285 1569.0 12.45872611464968 0.0 - - - - - - - 228.27272727272728 3 11 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 371 47 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36790.[MT7]-SEVSSDEDIQFR.2y6_1.heavy 778.371 / 807.399 1151.0 27.75809955596924 40 14 10 6 10 1.0997674941114715 56.122458603558414 0.03660011291503906 3 0.9451297191203903 5.2443017481286285 1151.0 21.26609523809524 0.0 - - - - - - - 254.14285714285714 2 7 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 373 48 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41885.[MT7]-AC[CAM]GVDYEVK[MT7].2y4_1.heavy 664.842 / 682.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB1 arrestin, beta 1 375 48 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41885.[MT7]-AC[CAM]GVDYEVK[MT7].2y3_1.heavy 664.842 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB1 arrestin, beta 1 377 48 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41885.[MT7]-AC[CAM]GVDYEVK[MT7].2b5_1.heavy 664.842 / 647.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB1 arrestin, beta 1 379 48 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41885.[MT7]-AC[CAM]GVDYEVK[MT7].2y7_1.heavy 664.842 / 953.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB1 arrestin, beta 1 381 49 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18757.[MT7]-SREQMINDR.2b8_1.heavy 646.828 / 1118.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC26 cell division cycle 26 homolog (S. cerevisiae) 383 49 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18757.[MT7]-SREQMINDR.2b4_1.heavy 646.828 / 645.344 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC26 cell division cycle 26 homolog (S. cerevisiae) 385 49 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18757.[MT7]-SREQMINDR.2b6_1.heavy 646.828 / 889.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC26 cell division cycle 26 homolog (S. cerevisiae) 387 49 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18757.[MT7]-SREQMINDR.2y7_1.heavy 646.828 / 905.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC26 cell division cycle 26 homolog (S. cerevisiae) 389 50 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41608.[MT7]-SLEVILR.2y4_1.heavy 487.312 / 500.355 4985.0 34.72577476501465 34 10 10 6 8 0.9253062657822018 71.62309358788832 0.03530120849609375 4 0.8302983727551668 2.9524130338561685 4985.0 4.813862253455325 1.0 - - - - - - - 697.1666666666666 9 12 MCM6 minichromosome maintenance complex component 6 391 50 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41608.[MT7]-SLEVILR.2y5_1.heavy 487.312 / 629.398 4540.0 34.72577476501465 34 10 10 6 8 0.9253062657822018 71.62309358788832 0.03530120849609375 4 0.8302983727551668 2.9524130338561685 4540.0 5.8492883895131085 1.0 - - - - - - - 1233.2857142857142 12 7 MCM6 minichromosome maintenance complex component 6 393 50 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41608.[MT7]-SLEVILR.2b4_1.heavy 487.312 / 573.336 5697.0 34.72577476501465 34 10 10 6 8 0.9253062657822018 71.62309358788832 0.03530120849609375 4 0.8302983727551668 2.9524130338561685 5697.0 7.315569823434991 3.0 - - - - - - - 712.0 14 10 MCM6 minichromosome maintenance complex component 6 395 50 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41608.[MT7]-SLEVILR.2y6_1.heavy 487.312 / 742.482 7834.0 34.72577476501465 34 10 10 6 8 0.9253062657822018 71.62309358788832 0.03530120849609375 4 0.8302983727551668 2.9524130338561685 7834.0 16.62646691635456 0.0 - - - - - - - 252.16666666666666 15 18 MCM6 minichromosome maintenance complex component 6 397 51 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18533.[MT7]-IIDVVK[MT7].2y4_1.heavy 487.828 / 604.379 15047.0 30.93400001525879 34 18 2 10 4 3.1870918336542786 25.05389560481583 0.0 7 0.9866776159707927 10.680413337160541 15047.0 24.862755032660694 2.0 - - - - - - - 282.6666666666667 62 3 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 399 51 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18533.[MT7]-IIDVVK[MT7].2y5_1.heavy 487.828 / 717.463 22359.0 30.93400001525879 34 18 2 10 4 3.1870918336542786 25.05389560481583 0.0 7 0.9866776159707927 10.680413337160541 22359.0 14.33304046540046 2.0 - - - - - - - 424.0 118 1 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 401 51 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18533.[MT7]-IIDVVK[MT7].2b4_1.heavy 487.828 / 585.373 6464.0 30.93400001525879 34 18 2 10 4 3.1870918336542786 25.05389560481583 0.0 7 0.9866776159707927 10.680413337160541 6464.0 11.586415094339625 1.0 - - - - - - - 282.6666666666667 33 3 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 403 51 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18533.[MT7]-IIDVVK[MT7].2y3_1.heavy 487.828 / 489.352 20769.0 30.93400001525879 34 18 2 10 4 3.1870918336542786 25.05389560481583 0.0 7 0.9866776159707927 10.680413337160541 20769.0 19.861545584870044 1.0 - - - - - - - 1177.7777777777778 41 9 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 405 52 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18855.[MT7]-EILGIIVSYK[MT7].3y3_1.heavy 474.965 / 541.31 42224.0 42.04210090637207 40 14 10 6 10 1.9340862880825074 41.229543329443 0.039600372314453125 3 0.9499067322309445 5.490891587279799 42224.0 197.48752870051774 0.0 - - - - - - - 251.23076923076923 84 13 ARRB1 arrestin, beta 1 407 52 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18855.[MT7]-EILGIIVSYK[MT7].3b4_1.heavy 474.965 / 557.341 30912.0 42.04210090637207 40 14 10 6 10 1.9340862880825074 41.229543329443 0.039600372314453125 3 0.9499067322309445 5.490891587279799 30912.0 322.7827624309392 0.0 - - - - - - - 176.69230769230768 61 13 ARRB1 arrestin, beta 1 409 52 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18855.[MT7]-EILGIIVSYK[MT7].3b5_1.heavy 474.965 / 670.426 27040.0 42.04210090637207 40 14 10 6 10 1.9340862880825074 41.229543329443 0.039600372314453125 3 0.9499067322309445 5.490891587279799 27040.0 299.5918340539653 0.0 - - - - - - - 186.63636363636363 54 11 ARRB1 arrestin, beta 1 411 52 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18855.[MT7]-EILGIIVSYK[MT7].3y4_1.heavy 474.965 / 640.379 15426.0 42.04210090637207 40 14 10 6 10 1.9340862880825074 41.229543329443 0.039600372314453125 3 0.9499067322309445 5.490891587279799 15426.0 73.62032354492703 0.0 - - - - - - - 171.05555555555554 30 18 ARRB1 arrestin, beta 1 413 53 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533626.[MT7]-QVIQSAYEIIK[MT7].3b6_1.heavy 527.315 / 771.448 42674.0 35.41550064086914 46 16 10 10 10 2.565693243245385 31.707395154934805 0.0 3 0.9696847203196611 7.07014440824883 42674.0 181.29477124183006 0.0 - - - - - - - 211.55555555555554 85 18 LDHC lactate dehydrogenase C 415 53 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533626.[MT7]-QVIQSAYEIIK[MT7].3y3_1.heavy 527.315 / 517.383 69311.0 35.41550064086914 46 16 10 10 10 2.565693243245385 31.707395154934805 0.0 3 0.9696847203196611 7.07014440824883 69311.0 25.418043336879204 0.0 - - - - - - - 1245.6666666666667 138 6 LDHC lactate dehydrogenase C 417 53 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533626.[MT7]-QVIQSAYEIIK[MT7].3b4_1.heavy 527.315 / 613.379 35335.0 35.41550064086914 46 16 10 10 10 2.565693243245385 31.707395154934805 0.0 3 0.9696847203196611 7.07014440824883 35335.0 62.595991977101775 0.0 - - - - - - - 752.3571428571429 70 14 LDHC lactate dehydrogenase C 419 53 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533626.[MT7]-QVIQSAYEIIK[MT7].3b5_1.heavy 527.315 / 700.411 26433.0 35.41550064086914 46 16 10 10 10 2.565693243245385 31.707395154934805 0.0 3 0.9696847203196611 7.07014440824883 26433.0 48.29025885481726 0.0 - - - - - - - 283.3333333333333 52 18 LDHC lactate dehydrogenase C 421 54 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36641.[MT7]-FRYLIGEK[MT7].2y4_1.heavy 657.395 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 423 54 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36641.[MT7]-FRYLIGEK[MT7].2b4_1.heavy 657.395 / 724.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 425 54 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36641.[MT7]-FRYLIGEK[MT7].2y6_1.heavy 657.395 / 866.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 427 54 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36641.[MT7]-FRYLIGEK[MT7].2y7_1.heavy 657.395 / 1022.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 429 55 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB37022.[MT7]-DIVSIQELIEVEEEEEILLNSYTTPSK[MT7].3b4_1.heavy 1136.93 / 559.321 1819.0 50.07500076293945 43 13 10 10 10 1.066871263861184 57.913946869466926 0.0 3 0.9181513629888002 4.283995076655684 1819.0 28.60790909090909 0.0 - - - - - - - 55.22222222222222 3 9 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 431 55 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB37022.[MT7]-DIVSIQELIEVEEEEEILLNSYTTPSK[MT7].3b8_1.heavy 1136.93 / 1042.59 2012.0 50.07500076293945 43 13 10 10 10 1.066871263861184 57.913946869466926 0.0 3 0.9181513629888002 4.283995076655684 2012.0 37.02975881261595 0.0 - - - - - - - 95.27272727272727 4 11 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 433 55 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB37022.[MT7]-DIVSIQELIEVEEEEEILLNSYTTPSK[MT7].3b7_1.heavy 1136.93 / 929.506 1682.0 50.07500076293945 43 13 10 10 10 1.066871263861184 57.913946869466926 0.0 3 0.9181513629888002 4.283995076655684 1682.0 62.40147186147186 0.0 - - - - - - - 61.69230769230769 3 13 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 435 55 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB37022.[MT7]-DIVSIQELIEVEEEEEILLNSYTTPSK[MT7].3y9_1.heavy 1136.93 / 1154.62 524.0 50.07500076293945 43 13 10 10 10 1.066871263861184 57.913946869466926 0.0 3 0.9181513629888002 4.283995076655684 524.0 2.6579710144927535 0.0 - - - - - - - 0.0 1 0 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 437 56 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18437.[MT7]-NEALK[MT7].2y4_1.heavy 431.765 / 604.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - ORC3;ATF4 origin recognition complex, subunit 3;activating transcription factor 4 (tax-responsive enhancer element B67) 439 56 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18437.[MT7]-NEALK[MT7].2b3_1.heavy 431.765 / 459.232 N/A N/A - - - - - - - - - 0.0 - - - - - - - ORC3;ATF4 origin recognition complex, subunit 3;activating transcription factor 4 (tax-responsive enhancer element B67) 441 56 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18437.[MT7]-NEALK[MT7].2b4_1.heavy 431.765 / 572.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - ORC3;ATF4 origin recognition complex, subunit 3;activating transcription factor 4 (tax-responsive enhancer element B67) 443 56 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18437.[MT7]-NEALK[MT7].2y3_1.heavy 431.765 / 475.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - ORC3;ATF4 origin recognition complex, subunit 3;activating transcription factor 4 (tax-responsive enhancer element B67) 445 57 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42076.[MT7]-LAALPNVYEVISK[MT7].2y4_1.heavy 853.011 / 590.399 560.0 41.43802547454834 36 10 10 6 10 1.572034999971543 47.27726092699618 0.038700103759765625 3 0.8318705140076618 2.9665991096060385 560.0 0.5137614678899083 8.0 - - - - - - - 0.0 1 0 MCM5 minichromosome maintenance complex component 5 447 57 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42076.[MT7]-LAALPNVYEVISK[MT7].2b4_1.heavy 853.011 / 513.352 8718.0 41.43802547454834 36 10 10 6 10 1.572034999971543 47.27726092699618 0.038700103759765625 3 0.8318705140076618 2.9665991096060385 8718.0 39.110569725371995 0.0 - - - - - - - 326.9166666666667 17 12 MCM5 minichromosome maintenance complex component 5 449 57 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42076.[MT7]-LAALPNVYEVISK[MT7].2y9_1.heavy 853.011 / 1192.67 3861.0 41.43802547454834 36 10 10 6 10 1.572034999971543 47.27726092699618 0.038700103759765625 3 0.8318705140076618 2.9665991096060385 3861.0 8.412729357798165 1.0 - - - - - - - 207.53333333333333 9 15 MCM5 minichromosome maintenance complex component 5 451 57 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42076.[MT7]-LAALPNVYEVISK[MT7].2y6_1.heavy 853.011 / 882.505 1245.0 41.43802547454834 36 10 10 6 10 1.572034999971543 47.27726092699618 0.038700103759765625 3 0.8318705140076618 2.9665991096060385 1245.0 3.9959893048128343 0.0 - - - - - - - 220.86363636363637 2 22 MCM5 minichromosome maintenance complex component 5 453 58 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 478207.0 18.033100128173828 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 478207.0 1968.3771461060874 0.0 - - - - - - - 225.0 956 9 455 58 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 296441.0 18.033100128173828 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 296441.0 1818.491756886213 0.0 - - - - - - - 275.1 592 10 457 58 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 334112.0 18.033100128173828 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 334112.0 6541.95808795915 0.0 - - - - - - - 224.88888888888889 668 9 459 59 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18440.[MT7]-AMAYK[MT7].2b3_1.heavy 436.251 / 418.224 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RA interleukin 2 receptor, alpha 461 59 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18440.[MT7]-AMAYK[MT7].2y4_1.heavy 436.251 / 656.356 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RA interleukin 2 receptor, alpha 463 59 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18440.[MT7]-AMAYK[MT7].2y3_1.heavy 436.251 / 525.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RA interleukin 2 receptor, alpha 465 60 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533621.[MT7]-VEEEEDESALK[MT7].3b6_1.heavy 522.598 / 875.375 5295.0 23.767399787902832 40 14 10 6 10 1.3063611130273078 51.03234167172663 0.03899955749511719 3 0.9436113983109504 5.172547699242873 5295.0 33.04670073733939 0.0 - - - - - - - 180.46153846153845 10 13 MCM6 minichromosome maintenance complex component 6 467 60 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533621.[MT7]-VEEEEDESALK[MT7].3b4_1.heavy 522.598 / 631.305 7291.0 23.767399787902832 40 14 10 6 10 1.3063611130273078 51.03234167172663 0.03899955749511719 3 0.9436113983109504 5.172547699242873 7291.0 12.727459990966976 0.0 - - - - - - - 248.0 14 7 MCM6 minichromosome maintenance complex component 6 469 60 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533621.[MT7]-VEEEEDESALK[MT7].3b3_1.heavy 522.598 / 502.263 4861.0 23.767399787902832 40 14 10 6 10 1.3063611130273078 51.03234167172663 0.03899955749511719 3 0.9436113983109504 5.172547699242873 4861.0 6.899042764296306 0.0 - - - - - - - 733.9090909090909 9 11 MCM6 minichromosome maintenance complex component 6 471 60 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533621.[MT7]-VEEEEDESALK[MT7].3y4_1.heavy 522.598 / 562.368 9461.0 23.767399787902832 40 14 10 6 10 1.3063611130273078 51.03234167172663 0.03899955749511719 3 0.9436113983109504 5.172547699242873 9461.0 14.787313597712673 0.0 - - - - - - - 744.1428571428571 18 7 MCM6 minichromosome maintenance complex component 6 473 61 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18443.[MT7]-AIGILSR.2y5_1.heavy 437.286 / 545.341 21270.0 30.525699615478516 46 16 10 10 10 1.9930644877324424 40.68147388613707 0.0 3 0.9615259054277399 6.271563367293407 21270.0 38.92239308339857 0.0 - - - - - - - 707.25 42 8 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 475 61 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18443.[MT7]-AIGILSR.2y3_2.heavy 437.286 / 188.121 10792.0 30.525699615478516 46 16 10 10 10 1.9930644877324424 40.68147388613707 0.0 3 0.9615259054277399 6.271563367293407 10792.0 14.623450048653066 0.0 - - - - - - - 1302.2857142857142 21 7 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 477 61 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18443.[MT7]-AIGILSR.2b4_1.heavy 437.286 / 499.336 9325.0 30.525699615478516 46 16 10 10 10 1.9930644877324424 40.68147388613707 0.0 3 0.9615259054277399 6.271563367293407 9325.0 23.141825395998875 0.0 - - - - - - - 265.53333333333336 18 15 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 479 61 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18443.[MT7]-AIGILSR.2y6_1.heavy 437.286 / 658.425 27976.0 30.525699615478516 46 16 10 10 10 1.9930644877324424 40.68147388613707 0.0 3 0.9615259054277399 6.271563367293407 27976.0 81.65989017298094 0.0 - - - - - - - 756.6666666666666 55 9 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 481 62 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18540.[MT7]-AIQDEIR.2y5_1.heavy 494.781 / 660.331 11796.0 24.67889976501465 41 14 9 10 8 1.5238179302753792 46.125031314330236 0.0 4 0.9451098699247886 5.243344596863667 11796.0 28.562225844241837 1.0 - - - - - - - 756.0909090909091 43 11 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 483 62 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18540.[MT7]-AIQDEIR.2b4_1.heavy 494.781 / 572.316 21562.0 24.67889976501465 41 14 9 10 8 1.5238179302753792 46.125031314330236 0.0 4 0.9451098699247886 5.243344596863667 21562.0 35.112245405824034 0.0 - - - - - - - 367.4 43 5 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 485 62 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18540.[MT7]-AIQDEIR.2y6_1.heavy 494.781 / 773.415 16534.0 24.67889976501465 41 14 9 10 8 1.5238179302753792 46.125031314330236 0.0 4 0.9451098699247886 5.243344596863667 16534.0 24.180849969751964 1.0 - - - - - - - 261.1 75 10 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 487 62 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18540.[MT7]-AIQDEIR.2b5_1.heavy 494.781 / 701.359 31231.0 24.67889976501465 41 14 9 10 8 1.5238179302753792 46.125031314330236 0.0 4 0.9451098699247886 5.243344596863667 31231.0 75.87493949924261 0.0 - - - - - - - 297.46153846153845 62 13 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 489 63 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18957.[MT7]-DFYVAFQDLPTR.2b3_1.heavy 808.415 / 570.268 9002.0 39.82379913330078 48 18 10 10 10 3.6186746332349644 24.143076207554245 0.0 3 0.98530739635818 10.169036521700447 9002.0 68.1945879873551 0.0 - - - - - - - 256.77777777777777 18 18 MCM6 minichromosome maintenance complex component 6 491 63 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18957.[MT7]-DFYVAFQDLPTR.2y8_1.heavy 808.415 / 947.495 9184.0 39.82379913330078 48 18 10 10 10 3.6186746332349644 24.143076207554245 0.0 3 0.98530739635818 10.169036521700447 9184.0 23.830558808722607 0.0 - - - - - - - 225.41176470588235 18 17 MCM6 minichromosome maintenance complex component 6 493 63 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18957.[MT7]-DFYVAFQDLPTR.2b4_1.heavy 808.415 / 669.336 6995.0 39.82379913330078 48 18 10 10 10 3.6186746332349644 24.143076207554245 0.0 3 0.98530739635818 10.169036521700447 6995.0 39.57697368421053 0.0 - - - - - - - 228.1 13 20 MCM6 minichromosome maintenance complex component 6 495 63 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18957.[MT7]-DFYVAFQDLPTR.2y9_1.heavy 808.415 / 1046.56 4562.0 39.82379913330078 48 18 10 10 10 3.6186746332349644 24.143076207554245 0.0 3 0.98530739635818 10.169036521700447 4562.0 48.85478890635527 0.0 - - - - - - - 177.41666666666666 9 12 MCM6 minichromosome maintenance complex component 6 497 64 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18541.[MT7]-TGFTFK[MT7].2b3_1.heavy 494.789 / 450.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 499 64 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18541.[MT7]-TGFTFK[MT7].2y4_1.heavy 494.789 / 686.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 501 64 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18541.[MT7]-TGFTFK[MT7].2y5_1.heavy 494.789 / 743.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 503 64 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18541.[MT7]-TGFTFK[MT7].2y3_1.heavy 494.789 / 539.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 505 65 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18761.[MT7]-C[CAM]VDFQTLK[MT7].2b3_1.heavy 649.854 / 519.235 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 507 65 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18761.[MT7]-C[CAM]VDFQTLK[MT7].2y5_1.heavy 649.854 / 780.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 509 65 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18761.[MT7]-C[CAM]VDFQTLK[MT7].2b4_1.heavy 649.854 / 666.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 511 65 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18761.[MT7]-C[CAM]VDFQTLK[MT7].2y3_1.heavy 649.854 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 513 66 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18954.[MT7]-MQLLEIITTEK[MT7].3y3_1.heavy 536.316 / 521.305 7462.0 43.2234992980957 39 13 10 6 10 2.5410662017751635 30.664581804114132 0.03759765625 3 0.9089943747577177 4.059553554494282 7462.0 21.178495575221234 0.0 - - - - - - - 565.4285714285714 14 7 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 515 66 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18954.[MT7]-MQLLEIITTEK[MT7].3b5_1.heavy 536.316 / 759.419 13906.0 43.2234992980957 39 13 10 6 10 2.5410662017751635 30.664581804114132 0.03759765625 3 0.9089943747577177 4.059553554494282 13906.0 59.60368854601025 0.0 - - - - - - - 166.25 27 16 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 517 66 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18954.[MT7]-MQLLEIITTEK[MT7].3y4_1.heavy 536.316 / 622.353 14698.0 43.2234992980957 39 13 10 6 10 2.5410662017751635 30.664581804114132 0.03759765625 3 0.9089943747577177 4.059553554494282 14698.0 88.44814159292034 0.0 - - - - - - - 172.73684210526315 29 19 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 519 66 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18954.[MT7]-MQLLEIITTEK[MT7].3b3_1.heavy 536.316 / 517.292 5879.0 43.2234992980957 39 13 10 6 10 2.5410662017751635 30.664581804114132 0.03759765625 3 0.9089943747577177 4.059553554494282 5879.0 9.36293874165708 1.0 - - - - - - - 199.76470588235293 11 17 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 521 67 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533767.[MT7]-DSIFSNLTGQLDYQGFEK[MT7].3y6_1.heavy 784.065 / 915.469 4503.0 42.523101806640625 44 14 10 10 10 2.282052194524437 34.418927263129724 0.0 3 0.9465569180104849 5.314509864937863 4503.0 42.720769230769235 0.0 - - - - - - - 185.58823529411765 9 17 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 523 67 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533767.[MT7]-DSIFSNLTGQLDYQGFEK[MT7].3b6_1.heavy 784.065 / 808.396 6608.0 42.523101806640625 44 14 10 10 10 2.282052194524437 34.418927263129724 0.0 3 0.9465569180104849 5.314509864937863 6608.0 19.441210139437196 0.0 - - - - - - - 216.2 13 20 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 525 67 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533767.[MT7]-DSIFSNLTGQLDYQGFEK[MT7].3b4_1.heavy 784.065 / 607.321 4094.0 42.523101806640625 44 14 10 10 10 2.282052194524437 34.418927263129724 0.0 3 0.9465569180104849 5.314509864937863 4094.0 14.858106701774183 0.0 - - - - - - - 237.1764705882353 8 17 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 527 67 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533767.[MT7]-DSIFSNLTGQLDYQGFEK[MT7].3y4_1.heavy 784.065 / 624.347 12398.0 42.523101806640625 44 14 10 10 10 2.282052194524437 34.418927263129724 0.0 3 0.9465569180104849 5.314509864937863 12398.0 32.20291843977691 0.0 - - - - - - - 279.27777777777777 24 18 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 529 68 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18823.[MT7]-LLLLGTGESGK[MT7].2y8_1.heavy 688.424 / 892.486 6972.0 36.736900329589844 48 18 10 10 10 5.463654330420135 18.302768431602146 0.0 3 0.9826491935103248 9.355620200508115 6972.0 59.891806674338326 0.0 - - - - - - - 193.58823529411765 13 17 GNA11;GNAQ;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha 14 531 68 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18823.[MT7]-LLLLGTGESGK[MT7].2y5_1.heavy 688.424 / 621.332 4012.0 36.736900329589844 48 18 10 10 10 5.463654330420135 18.302768431602146 0.0 3 0.9826491935103248 9.355620200508115 4012.0 9.678994223190022 0.0 - - - - - - - 257.0 8 21 GNA11;GNAQ;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha 14 533 68 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18823.[MT7]-LLLLGTGESGK[MT7].2y6_1.heavy 688.424 / 722.38 3026.0 36.736900329589844 48 18 10 10 10 5.463654330420135 18.302768431602146 0.0 3 0.9826491935103248 9.355620200508115 3026.0 9.074785866024643 0.0 - - - - - - - 220.4 6 20 GNA11;GNAQ;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha 14 535 68 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18823.[MT7]-LLLLGTGESGK[MT7].2y7_1.heavy 688.424 / 779.402 13944.0 36.736900329589844 48 18 10 10 10 5.463654330420135 18.302768431602146 0.0 3 0.9826491935103248 9.355620200508115 13944.0 48.48038777908343 0.0 - - - - - - - 246.75 27 16 GNA11;GNAQ;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha 14 537 69 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533639.[MT7]-DFYVAFQDLPTR.3b4_1.heavy 539.279 / 669.336 43660.0 39.82379913330078 47 17 10 10 10 3.001661162510564 33.31488618667433 0.0 3 0.976865013511512 8.098169964367354 43660.0 147.13260073260074 0.0 - - - - - - - 706.6666666666666 87 9 MCM6 minichromosome maintenance complex component 6 539 69 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533639.[MT7]-DFYVAFQDLPTR.3b5_1.heavy 539.279 / 740.374 43001.0 39.82379913330078 47 17 10 10 10 3.001661162510564 33.31488618667433 0.0 3 0.976865013511512 8.098169964367354 43001.0 149.47966666666667 0.0 - - - - - - - 231.42857142857142 86 21 MCM6 minichromosome maintenance complex component 6 541 69 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533639.[MT7]-DFYVAFQDLPTR.3b3_1.heavy 539.279 / 570.268 55535.0 39.82379913330078 47 17 10 10 10 3.001661162510564 33.31488618667433 0.0 3 0.976865013511512 8.098169964367354 55535.0 143.1939431007321 0.0 - - - - - - - 668.5714285714286 111 7 MCM6 minichromosome maintenance complex component 6 543 69 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533639.[MT7]-DFYVAFQDLPTR.3y5_1.heavy 539.279 / 601.33 42761.0 39.82379913330078 47 17 10 10 10 3.001661162510564 33.31488618667433 0.0 3 0.976865013511512 8.098169964367354 42761.0 178.4947803030303 0.0 - - - - - - - 324.0 85 15 MCM6 minichromosome maintenance complex component 6 545 70 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18449.[MT7]-LSIQK[MT7].2y4_1.heavy 438.791 / 619.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDR kinase insert domain receptor (a type III receptor tyrosine kinase) 547 70 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18449.[MT7]-LSIQK[MT7].2y3_1.heavy 438.791 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDR kinase insert domain receptor (a type III receptor tyrosine kinase) 549 71 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36366.[MT7]-VNTLSK[MT7].2y4_1.heavy 475.3 / 592.379 2700.0 20.616600036621094 45 18 9 10 8 5.682226007976158 17.598736808361668 0.0 4 0.9874097205933866 10.987223851594624 2700.0 3.0907005838198494 0.0 - - - - - - - 704.2727272727273 5 11 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 551 71 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36366.[MT7]-VNTLSK[MT7].2y5_1.heavy 475.3 / 706.422 8569.0 20.616600036621094 45 18 9 10 8 5.682226007976158 17.598736808361668 0.0 4 0.9874097205933866 10.987223851594624 8569.0 16.66735416666667 0.0 - - - - - - - 234.72727272727272 17 11 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 553 71 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36366.[MT7]-VNTLSK[MT7].2b4_1.heavy 475.3 / 572.352 1643.0 20.616600036621094 45 18 9 10 8 5.682226007976158 17.598736808361668 0.0 4 0.9874097205933866 10.987223851594624 1643.0 6.865139764432648 2.0 - - - - - - - 288.76 3 25 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 555 71 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36366.[MT7]-VNTLSK[MT7].2y3_1.heavy 475.3 / 491.331 3287.0 20.616600036621094 45 18 9 10 8 5.682226007976158 17.598736808361668 0.0 4 0.9874097205933866 10.987223851594624 3287.0 3.9270412985061025 1.0 - - - - - - - 727.7 20 10 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 557 72 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18447.[MT7]-VDILK[MT7].2b3_1.heavy 438.294 / 472.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - FIGLA;PPP3CA folliculogenesis specific basic helix-loop-helix;protein phosphatase 3, catalytic subunit, alpha isozyme 559 72 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18447.[MT7]-VDILK[MT7].2y4_1.heavy 438.294 / 632.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - FIGLA;PPP3CA folliculogenesis specific basic helix-loop-helix;protein phosphatase 3, catalytic subunit, alpha isozyme 561 72 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18447.[MT7]-VDILK[MT7].2b4_1.heavy 438.294 / 585.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - FIGLA;PPP3CA folliculogenesis specific basic helix-loop-helix;protein phosphatase 3, catalytic subunit, alpha isozyme 563 72 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18447.[MT7]-VDILK[MT7].2y3_1.heavy 438.294 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - FIGLA;PPP3CA folliculogenesis specific basic helix-loop-helix;protein phosphatase 3, catalytic subunit, alpha isozyme 565 73 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 1655740.0 36.736900329589844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1655740.0 1196.1951811984986 0.0 - - - - - - - 303.2 3311 10 567 73 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 762779.0 36.736900329589844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 762779.0 1686.3386144157432 0.0 - - - - - - - 133.625 1525 8 569 73 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1091390.0 36.736900329589844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1091390.0 1659.7995133740733 0.0 - - - - - - - 237.875 2182 8 571 74 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533535.[MT7]-LLLLGTGESGK[MT7].3b4_1.heavy 459.285 / 597.446 43784.0 36.72902488708496 46 20 10 6 10 8.732807345781737 11.45107134973081 0.03150177001953125 3 0.9909356404194947 12.952846246130653 43784.0 165.22343173078764 0.0 - - - - - - - 228.28571428571428 87 14 GNA11;GNAQ;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha 14 573 74 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533535.[MT7]-LLLLGTGESGK[MT7].3b5_1.heavy 459.285 / 654.467 32446.0 36.72902488708496 46 20 10 6 10 8.732807345781737 11.45107134973081 0.03150177001953125 3 0.9909356404194947 12.952846246130653 32446.0 220.95027392024463 0.0 - - - - - - - 184.0625 64 16 GNA11;GNAQ;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha 14 575 74 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533535.[MT7]-LLLLGTGESGK[MT7].3b3_1.heavy 459.285 / 484.362 131226.0 36.72902488708496 46 20 10 6 10 8.732807345781737 11.45107134973081 0.03150177001953125 3 0.9909356404194947 12.952846246130653 131226.0 568.7779067156787 0.0 - - - - - - - 167.16666666666666 262 12 GNA11;GNAQ;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha 14 577 74 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533535.[MT7]-LLLLGTGESGK[MT7].3y5_1.heavy 459.285 / 621.332 44723.0 36.72902488708496 46 20 10 6 10 8.732807345781737 11.45107134973081 0.03150177001953125 3 0.9909356404194947 12.952846246130653 44723.0 194.67819848184848 0.0 - - - - - - - 225.6 89 10 GNA11;GNAQ;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha 14 579 75 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36269.[MT7]-DDSAPR.2b3_1.heavy 402.702 / 462.195 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 581 75 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36269.[MT7]-DDSAPR.2y4_1.heavy 402.702 / 430.241 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 583 75 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36269.[MT7]-DDSAPR.2y5_1.heavy 402.702 / 545.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 585 75 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36269.[MT7]-DDSAPR.2b4_1.heavy 402.702 / 533.232 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 587 76 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533733.[MT7]-QYADIC[CAM]LFNTAQYK[MT7].3b6_1.heavy 675.011 / 895.41 4987.0 37.350274085998535 43 17 10 6 10 3.4021616750451327 29.393076976176747 0.034496307373046875 3 0.972047541019373 7.364368345215092 4987.0 24.257313247398667 0.0 - - - - - - - 229.6086956521739 9 23 ARRB1 arrestin, beta 1 589 76 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533733.[MT7]-QYADIC[CAM]LFNTAQYK[MT7].3b4_1.heavy 675.011 / 622.295 11323.0 37.350274085998535 43 17 10 6 10 3.4021616750451327 29.393076976176747 0.034496307373046875 3 0.972047541019373 7.364368345215092 11323.0 50.23032666991712 0.0 - - - - - - - 729.1428571428571 22 7 ARRB1 arrestin, beta 1 591 76 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533733.[MT7]-QYADIC[CAM]LFNTAQYK[MT7].3b5_1.heavy 675.011 / 735.379 5339.0 37.350274085998535 43 17 10 6 10 3.4021616750451327 29.393076976176747 0.034496307373046875 3 0.972047541019373 7.364368345215092 5339.0 20.16982543170203 0.0 - - - - - - - 217.47058823529412 10 17 ARRB1 arrestin, beta 1 593 76 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533733.[MT7]-QYADIC[CAM]LFNTAQYK[MT7].3b3_1.heavy 675.011 / 507.268 2288.0 37.350274085998535 43 17 10 6 10 3.4021616750451327 29.393076976176747 0.034496307373046875 3 0.972047541019373 7.364368345215092 2288.0 6.740601312375002 0.0 - - - - - - - 298.39130434782606 4 23 ARRB1 arrestin, beta 1 595 77 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18962.[MT7]-LIEDDENSQC[CAM]K[MT7].3b6_1.heavy 546.934 / 859.417 10933.0 23.59630012512207 48 18 10 10 10 8.30801341649592 12.036571799636924 0.0 3 0.9857635222335501 10.33105104265501 10933.0 25.893569113544903 0.0 - - - - - - - 225.8181818181818 21 11 LDHC lactate dehydrogenase C 597 77 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18962.[MT7]-LIEDDENSQC[CAM]K[MT7].3b4_1.heavy 546.934 / 615.347 10022.0 23.59630012512207 48 18 10 10 10 8.30801341649592 12.036571799636924 0.0 3 0.9857635222335501 10.33105104265501 10022.0 25.144004093526675 0.0 - - - - - - - 248.28571428571428 20 7 LDHC lactate dehydrogenase C 599 77 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18962.[MT7]-LIEDDENSQC[CAM]K[MT7].3b5_1.heavy 546.934 / 730.374 19381.0 23.59630012512207 48 18 10 10 10 8.30801341649592 12.036571799636924 0.0 3 0.9857635222335501 10.33105104265501 19381.0 36.577741420792705 0.0 - - - - - - - 155.5 38 8 LDHC lactate dehydrogenase C 601 77 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18962.[MT7]-LIEDDENSQC[CAM]K[MT7].3b3_1.heavy 546.934 / 500.32 10187.0 23.59630012512207 48 18 10 10 10 8.30801341649592 12.036571799636924 0.0 3 0.9857635222335501 10.33105104265501 10187.0 20.03092239199656 0.0 - - - - - - - 720.6 20 10 LDHC lactate dehydrogenase C 603 78 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36771.[MT7]-FRYELQIQK[MT7].2b4_1.heavy 756.942 / 740.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL3RA interleukin 3 receptor, alpha (low affinity) 605 78 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36771.[MT7]-FRYELQIQK[MT7].2y3_1.heavy 756.942 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL3RA interleukin 3 receptor, alpha (low affinity) 607 78 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36771.[MT7]-FRYELQIQK[MT7].2b6_1.heavy 756.942 / 981.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL3RA interleukin 3 receptor, alpha (low affinity) 609 78 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36771.[MT7]-FRYELQIQK[MT7].2b5_1.heavy 756.942 / 853.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL3RA interleukin 3 receptor, alpha (low affinity) 611 79 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18592.[MT7]-SDASPSSIR.2y8_1.heavy 532.279 / 832.416 4389.0 17.711800575256348 41 15 10 6 10 2.7894650235683662 35.849167906782725 0.038799285888671875 3 0.956599974689137 5.902473281993242 4389.0 21.255455390334575 0.0 - - - - - - - 125.92857142857143 8 14 MCM5 minichromosome maintenance complex component 5 613 79 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18592.[MT7]-SDASPSSIR.2y5_1.heavy 532.279 / 559.32 4238.0 17.711800575256348 41 15 10 6 10 2.7894650235683662 35.849167906782725 0.038799285888671875 3 0.956599974689137 5.902473281993242 4238.0 18.560733643050714 0.0 - - - - - - - 720.7142857142857 8 7 MCM5 minichromosome maintenance complex component 5 615 79 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18592.[MT7]-SDASPSSIR.2b4_1.heavy 532.279 / 505.237 3229.0 17.711800575256348 41 15 10 6 10 2.7894650235683662 35.849167906782725 0.038799285888671875 3 0.956599974689137 5.902473281993242 3229.0 11.099193587860988 0.0 - - - - - - - 257.8888888888889 6 18 MCM5 minichromosome maintenance complex component 5 617 79 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18592.[MT7]-SDASPSSIR.2y7_1.heavy 532.279 / 717.389 5953.0 17.711800575256348 41 15 10 6 10 2.7894650235683662 35.849167906782725 0.038799285888671875 3 0.956599974689137 5.902473281993242 5953.0 22.87991200796909 0.0 - - - - - - - 218.6 11 15 MCM5 minichromosome maintenance complex component 5 619 80 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36877.[MT7]-LDDIEEFENIRK[MT7].2y8_1.heavy 904.985 / 1208.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC26 cell division cycle 26 homolog (S. cerevisiae) 621 80 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36877.[MT7]-LDDIEEFENIRK[MT7].2b4_1.heavy 904.985 / 601.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC26 cell division cycle 26 homolog (S. cerevisiae) 623 80 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36877.[MT7]-LDDIEEFENIRK[MT7].2y6_1.heavy 904.985 / 950.554 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC26 cell division cycle 26 homolog (S. cerevisiae) 625 80 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36877.[MT7]-LDDIEEFENIRK[MT7].2y7_1.heavy 904.985 / 1079.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC26 cell division cycle 26 homolog (S. cerevisiae) 627 81 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19175.[MT7]-EYSLFPGQVVIMEGINTTGRK[MT7].3b4_1.heavy 876.475 / 637.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 629 81 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19175.[MT7]-EYSLFPGQVVIMEGINTTGRK[MT7].3b5_1.heavy 876.475 / 784.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 631 81 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19175.[MT7]-EYSLFPGQVVIMEGINTTGRK[MT7].3y8_1.heavy 876.475 / 990.581 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 633 81 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19175.[MT7]-EYSLFPGQVVIMEGINTTGRK[MT7].3y9_1.heavy 876.475 / 1119.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 635 82 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19075.[MT7]-SFAGAVSPQEEEEFRR.3b4_1.heavy 661.661 / 507.268 3002.0 28.53580093383789 41 11 10 10 10 1.867078895316542 47.65200142930341 0.0 3 0.8696088225053586 3.3798872159635898 3002.0 23.61573333333333 0.0 - - - - - - - 215.3846153846154 6 13 MCM5 minichromosome maintenance complex component 5 637 82 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19075.[MT7]-SFAGAVSPQEEEEFRR.3y14_2.heavy 661.661 / 802.887 5303.0 28.53580093383789 41 11 10 10 10 1.867078895316542 47.65200142930341 0.0 3 0.8696088225053586 3.3798872159635898 5303.0 41.09824999999999 0.0 - - - - - - - 260.0 10 10 MCM5 minichromosome maintenance complex component 5 639 82 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19075.[MT7]-SFAGAVSPQEEEEFRR.3b5_1.heavy 661.661 / 578.305 7504.0 28.53580093383789 41 11 10 10 10 1.867078895316542 47.65200142930341 0.0 3 0.8696088225053586 3.3798872159635898 7504.0 33.768 0.0 - - - - - - - 207.14285714285714 15 14 MCM5 minichromosome maintenance complex component 5 641 82 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19075.[MT7]-SFAGAVSPQEEEEFRR.3y9_2.heavy 661.661 / 610.289 3802.0 28.53580093383789 41 11 10 10 10 1.867078895316542 47.65200142930341 0.0 3 0.8696088225053586 3.3798872159635898 3802.0 8.034789736603088 0.0 - - - - - - - 261.53846153846155 7 13 MCM5 minichromosome maintenance complex component 5 643 83 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19177.[MT7]-TVLGTPEVLLGALPGAGGTQRLPK[MT7].4b7_1.heavy 659.145 / 842.474 23605.0 41.16184997558594 37 11 10 6 10 2.0289035199202665 49.28770590527138 0.03710174560546875 3 0.8757722766866937 3.4645840756963904 23605.0 239.8167553191489 0.0 - - - - - - - 146.58333333333334 47 12 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 645 83 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19177.[MT7]-TVLGTPEVLLGALPGAGGTQRLPK[MT7].4y11_2.heavy 659.145 / 613.36 101952.0 41.16184997558594 37 11 10 6 10 2.0289035199202665 49.28770590527138 0.03710174560546875 3 0.8757722766866937 3.4645840756963904 101952.0 214.33333122236974 0.0 - - - - - - - 761.25 203 8 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 647 83 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19177.[MT7]-TVLGTPEVLLGALPGAGGTQRLPK[MT7].4y11_1.heavy 659.145 / 1225.71 7471.0 41.16184997558594 37 11 10 6 10 2.0289035199202665 49.28770590527138 0.03710174560546875 3 0.8757722766866937 3.4645840756963904 7471.0 177.82165873015873 0.0 - - - - - - - 146.66666666666666 14 3 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 649 83 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19177.[MT7]-TVLGTPEVLLGALPGAGGTQRLPK[MT7].4b5_1.heavy 659.145 / 616.379 23605.0 41.16184997558594 37 11 10 6 10 2.0289035199202665 49.28770590527138 0.03710174560546875 3 0.8757722766866937 3.4645840756963904 23605.0 124.96714340641005 0.0 - - - - - - - 260.6923076923077 47 13 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 651 84 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18834.[MT7]-VIGSGC[CAM]NLDSAR.2y8_1.heavy 696.855 / 892.394 1786.0 25.0625 48 18 10 10 10 3.606099482605781 27.73079347432191 0.0 3 0.9851198334139311 10.104584656277314 1786.0 30.127474747474746 0.0 - - - - - - - 148.66666666666666 3 6 LDHAL6A;LDHA;LDHB;LDHC lactate dehydrogenase A-like 6A;lactate dehydrogenase A;lactate dehydrogenase B;lactate dehydrogenase C 653 84 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18834.[MT7]-VIGSGC[CAM]NLDSAR.2y9_1.heavy 696.855 / 979.426 794.0 25.0625 48 18 10 10 10 3.606099482605781 27.73079347432191 0.0 3 0.9851198334139311 10.104584656277314 794.0 4.409090909090909 0.0 - - - - - - - 0.0 1 0 LDHAL6A;LDHA;LDHB;LDHC lactate dehydrogenase A-like 6A;lactate dehydrogenase A;lactate dehydrogenase B;lactate dehydrogenase C 655 84 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18834.[MT7]-VIGSGC[CAM]NLDSAR.2y10_1.heavy 696.855 / 1036.45 4465.0 25.0625 48 18 10 10 10 3.606099482605781 27.73079347432191 0.0 3 0.9851198334139311 10.104584656277314 4465.0 19.78631061918164 0.0 - - - - - - - 242.44444444444446 8 9 LDHAL6A;LDHA;LDHB;LDHC lactate dehydrogenase A-like 6A;lactate dehydrogenase A;lactate dehydrogenase B;lactate dehydrogenase C 657 84 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18834.[MT7]-VIGSGC[CAM]NLDSAR.2y11_1.heavy 696.855 / 1149.53 6847.0 25.0625 48 18 10 10 10 3.606099482605781 27.73079347432191 0.0 3 0.9851198334139311 10.104584656277314 6847.0 32.16711409395973 0.0 - - - - - - - 208.2 13 10 LDHAL6A;LDHA;LDHB;LDHC lactate dehydrogenase A-like 6A;lactate dehydrogenase A;lactate dehydrogenase B;lactate dehydrogenase C 659 85 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18832.[MT7]-AQQLTWDLNR.2y8_1.heavy 694.874 / 1045.54 5855.0 32.95560073852539 48 18 10 10 10 5.684328504757988 17.59222745770171 0.0 3 0.9842483350261839 9.820360063809181 5855.0 101.4480198019802 0.0 - - - - - - - 126.25 11 8 IL3RA interleukin 3 receptor, alpha (low affinity) 661 85 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18832.[MT7]-AQQLTWDLNR.2y9_1.heavy 694.874 / 1173.6 7268.0 32.95560073852539 48 18 10 10 10 5.684328504757988 17.59222745770171 0.0 3 0.9842483350261839 9.820360063809181 7268.0 73.75940594059406 0.0 - - - - - - - 121.2 14 10 IL3RA interleukin 3 receptor, alpha (low affinity) 663 85 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18832.[MT7]-AQQLTWDLNR.2y6_1.heavy 694.874 / 804.4 9287.0 32.95560073852539 48 18 10 10 10 5.684328504757988 17.59222745770171 0.0 3 0.9842483350261839 9.820360063809181 9287.0 60.68732673267327 0.0 - - - - - - - 213.22222222222223 18 9 IL3RA interleukin 3 receptor, alpha (low affinity) 665 85 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18832.[MT7]-AQQLTWDLNR.2y7_1.heavy 694.874 / 917.484 6157.0 32.95560073852539 48 18 10 10 10 5.684328504757988 17.59222745770171 0.0 3 0.9842483350261839 9.820360063809181 6157.0 80.46772277227724 0.0 - - - - - - - 223.64285714285714 12 14 IL3RA interleukin 3 receptor, alpha (low affinity) 667 86 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18456.[MT7]-STFIK[MT7].2b3_1.heavy 442.278 / 480.258 3368.0 24.35830020904541 42 16 10 6 10 3.8351826153610213 26.074377683991088 0.03759956359863281 3 0.9633511560274447 6.426830719879368 3368.0 7.880252003646705 0.0 - - - - - - - 221.36363636363637 6 11 GNA11;GNA15;GNAQ;ZNF749;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), alpha 15 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;zinc finger protein 749;guanine nucleotide binding protein (G protein), alpha 14 669 86 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18456.[MT7]-STFIK[MT7].2y4_1.heavy 442.278 / 652.415 10011.0 24.35830020904541 42 16 10 6 10 3.8351826153610213 26.074377683991088 0.03759956359863281 3 0.9633511560274447 6.426830719879368 10011.0 36.20459687371452 0.0 - - - - - - - 210.66666666666666 20 12 GNA11;GNA15;GNAQ;ZNF749;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), alpha 15 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;zinc finger protein 749;guanine nucleotide binding protein (G protein), alpha 14 671 86 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18456.[MT7]-STFIK[MT7].2b4_1.heavy 442.278 / 593.341 3088.0 24.35830020904541 42 16 10 6 10 3.8351826153610213 26.074377683991088 0.03759956359863281 3 0.9633511560274447 6.426830719879368 3088.0 17.996749394396453 2.0 - - - - - - - 678.25 6 8 GNA11;GNA15;GNAQ;ZNF749;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), alpha 15 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;zinc finger protein 749;guanine nucleotide binding protein (G protein), alpha 14 673 86 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18456.[MT7]-STFIK[MT7].2y3_1.heavy 442.278 / 551.367 5427.0 24.35830020904541 42 16 10 6 10 3.8351826153610213 26.074377683991088 0.03759956359863281 3 0.9633511560274447 6.426830719879368 5427.0 14.888965446318387 0.0 - - - - - - - 365.72727272727275 10 11 GNA11;GNA15;GNAQ;ZNF749;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), alpha 15 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;zinc finger protein 749;guanine nucleotide binding protein (G protein), alpha 14 675 87 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18599.[MT7]-FVFAAVK[MT7].2b3_1.heavy 535.336 / 538.315 6262.0 35.707401275634766 41 15 10 6 10 2.5744636546721344 31.47026620609786 0.035400390625 3 0.9537453192138832 5.716051507109182 6262.0 10.394568624302138 2.0 - - - - - - - 736.7272727272727 15 11 GNA11;GNAQ;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha 14 677 87 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18599.[MT7]-FVFAAVK[MT7].2y4_1.heavy 535.336 / 532.357 6705.0 35.707401275634766 41 15 10 6 10 2.5744636546721344 31.47026620609786 0.035400390625 3 0.9537453192138832 5.716051507109182 6705.0 13.346027984307177 1.0 - - - - - - - 715.7142857142857 13 14 GNA11;GNAQ;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha 14 679 87 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18599.[MT7]-FVFAAVK[MT7].2y5_1.heavy 535.336 / 679.426 8252.0 35.707401275634766 41 15 10 6 10 2.5744636546721344 31.47026620609786 0.035400390625 3 0.9537453192138832 5.716051507109182 8252.0 13.424204823010207 0.0 - - - - - - - 715.7142857142857 16 7 GNA11;GNAQ;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha 14 681 87 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18599.[MT7]-FVFAAVK[MT7].2y6_1.heavy 535.336 / 778.494 8031.0 35.707401275634766 41 15 10 6 10 2.5744636546721344 31.47026620609786 0.035400390625 3 0.9537453192138832 5.716051507109182 8031.0 79.33353402899621 0.0 - - - - - - - 199.2941176470588 16 17 GNA11;GNAQ;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha 14 683 88 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533547.[MT7]-LVVSGSSDNTIR.2y4_1.heavy 696.384 / 503.294 1535.0 26.600299835205078 44 14 10 10 10 3.7662893979362813 26.55133194352895 0.0 3 0.9489707120076502 5.4398669681388085 1535.0 9.25 0.0 - - - - - - - 180.92307692307693 3 13 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 685 88 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533547.[MT7]-LVVSGSSDNTIR.2y9_1.heavy 696.384 / 936.438 5218.0 26.600299835205078 44 14 10 10 10 3.7662893979362813 26.55133194352895 0.0 3 0.9489707120076502 5.4398669681388085 5218.0 45.5620487804878 0.0 - - - - - - - 179.25 10 8 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 687 88 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533547.[MT7]-LVVSGSSDNTIR.2y10_1.heavy 696.384 / 1035.51 2967.0 26.600299835205078 44 14 10 10 10 3.7662893979362813 26.55133194352895 0.0 3 0.9489707120076502 5.4398669681388085 2967.0 26.680099237739107 0.0 - - - - - - - 245.6 5 5 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 689 88 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533547.[MT7]-LVVSGSSDNTIR.2y11_1.heavy 696.384 / 1134.57 3274.0 26.600299835205078 44 14 10 10 10 3.7662893979362813 26.55133194352895 0.0 3 0.9489707120076502 5.4398669681388085 3274.0 36.89268382352942 0.0 - - - - - - - 131.42857142857142 6 7 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 691 89 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18981.[MT7]-INLNSEEEALFK[MT7].2y8_1.heavy 847.964 / 1096.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 693 89 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18981.[MT7]-INLNSEEEALFK[MT7].2b4_1.heavy 847.964 / 599.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 695 89 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18981.[MT7]-INLNSEEEALFK[MT7].2y3_1.heavy 847.964 / 551.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 697 89 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18981.[MT7]-INLNSEEEALFK[MT7].2y6_1.heavy 847.964 / 880.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 699 90 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36280.[MT7]-GLVEK[MT7].2b3_1.heavy 417.27 / 414.283 3268.0 20.89306704203288 38 20 2 6 10 7.491782796801105 13.34795771744727 0.03249931335449219 3 0.9959366318651399 19.354061494996735 3268.0 2.447940074906367 1.0 - - - - - - - 732.9444444444445 6 18 CDKN2B;MBLAC2;HADHA;AGRN cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4);metallo-beta-lactamase domain containing 2;hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit;agrin 701 90 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36280.[MT7]-GLVEK[MT7].2y4_1.heavy 417.27 / 632.41 3268.0 20.89306704203288 38 20 2 6 10 7.491782796801105 13.34795771744727 0.03249931335449219 3 0.9959366318651399 19.354061494996735 3268.0 0.12366412213740441 1.0 - - - - - - - 246.72727272727272 6 22 CDKN2B;MBLAC2;HADHA;AGRN cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4);metallo-beta-lactamase domain containing 2;hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit;agrin 703 90 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36280.[MT7]-GLVEK[MT7].2b4_1.heavy 417.27 / 543.326 N/A 20.89306704203288 38 20 2 6 10 7.491782796801105 13.34795771744727 0.03249931335449219 3 0.9959366318651399 19.354061494996735 4254.0 5.022698554090056 3.0 - - - - - - - 785.75 32 8 CDKN2B;MBLAC2;HADHA;AGRN cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4);metallo-beta-lactamase domain containing 2;hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit;agrin 705 90 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36280.[MT7]-GLVEK[MT7].2y3_1.heavy 417.27 / 519.326 6597.0 20.89306704203288 38 20 2 6 10 7.491782796801105 13.34795771744727 0.03249931335449219 3 0.9959366318651399 19.354061494996735 6597.0 10.406875424176157 0.0 - - - - - - - 731.0 13 7 CDKN2B;MBLAC2;HADHA;AGRN cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4);metallo-beta-lactamase domain containing 2;hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit;agrin 707 91 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18975.[MT7]-VLGC[CAM]PEALTGSYK[MT7].2y4_1.heavy 841.955 / 598.332 1751.0 32.38370132446289 37 12 10 5 10 1.272452566418184 62.717538936839034 0.04759979248046875 3 0.8917035002556545 3.7158275787444577 1751.0 10.426666666666666 0.0 - - - - - - - 231.75 3 12 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 709 91 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18975.[MT7]-VLGC[CAM]PEALTGSYK[MT7].2y5_1.heavy 841.955 / 699.379 2678.0 32.38370132446289 37 12 10 5 10 1.272452566418184 62.717538936839034 0.04759979248046875 3 0.8917035002556545 3.7158275787444577 2678.0 30.654 0.0 - - - - - - - 164.8 5 10 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 711 91 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18975.[MT7]-VLGC[CAM]PEALTGSYK[MT7].2b4_1.heavy 841.955 / 574.314 4944.0 32.38370132446289 37 12 10 5 10 1.272452566418184 62.717538936839034 0.04759979248046875 3 0.8917035002556545 3.7158275787444577 4944.0 20.339999999999996 0.0 - - - - - - - 231.75 9 8 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 713 91 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18975.[MT7]-VLGC[CAM]PEALTGSYK[MT7].2y9_1.heavy 841.955 / 1109.6 5253.0 32.38370132446289 37 12 10 5 10 1.272452566418184 62.717538936839034 0.04759979248046875 3 0.8917035002556545 3.7158275787444577 5253.0 49.980000000000004 0.0 - - - - - - - 206.0 10 7 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 715 92 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19063.[MT7]-LVYQNIFTAMQAMIR.3y7_1.heavy 648.35 / 820.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA11;GNAQ;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha 14 717 92 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19063.[MT7]-LVYQNIFTAMQAMIR.3b5_1.heavy 648.35 / 762.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA11;GNAQ;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha 14 719 92 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19063.[MT7]-LVYQNIFTAMQAMIR.3y8_1.heavy 648.35 / 921.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA11;GNAQ;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha 14 721 92 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19063.[MT7]-LVYQNIFTAMQAMIR.3y9_1.heavy 648.35 / 1068.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA11;GNAQ;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha 14 723 93 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36572.[MT7]-K[MT7]LTDIGIR.2b4_1.heavy 602.387 / 746.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 725 93 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36572.[MT7]-K[MT7]LTDIGIR.2b6_1.heavy 602.387 / 916.571 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 727 93 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36572.[MT7]-K[MT7]LTDIGIR.2y6_1.heavy 602.387 / 674.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 729 93 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36572.[MT7]-K[MT7]LTDIGIR.2y7_1.heavy 602.387 / 787.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 731 94 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41827.[MT7]-SFTTTIHK[MT7].3y3_1.heavy 408.239 / 541.358 8449.0 23.77714967727661 31 15 2 6 8 2.0866258238459703 41.093560427666894 0.03899955749511719 4 0.9590072127603101 6.074545505524178 8449.0 20.04131503039913 1.0 - - - - - - - 278.9166666666667 43 12 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 733 94 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41827.[MT7]-SFTTTIHK[MT7].3b4_1.heavy 408.239 / 581.305 6775.0 23.77714967727661 31 15 2 6 8 2.0866258238459703 41.093560427666894 0.03899955749511719 4 0.9590072127603101 6.074545505524178 6775.0 39.68619246861925 0.0 - - - - - - - 130.92857142857142 13 14 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 735 94 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41827.[MT7]-SFTTTIHK[MT7].3b5_1.heavy 408.239 / 682.353 5580.0 23.77714967727661 31 15 2 6 8 2.0866258238459703 41.093560427666894 0.03899955749511719 4 0.9590072127603101 6.074545505524178 5580.0 32.95686751377586 1.0 - - - - - - - 189.375 32 8 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 737 94 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41827.[MT7]-SFTTTIHK[MT7].3b3_1.heavy 408.239 / 480.258 7413.0 23.77714967727661 31 15 2 6 8 2.0866258238459703 41.093560427666894 0.03899955749511719 4 0.9590072127603101 6.074545505524178 7413.0 12.16162452775356 0.0 - - - - - - - 219.25 14 8 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 739 95 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36764.[MT7]-AFC[CAM]AENLEEK[MT7].2y4_1.heavy 749.876 / 662.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB1 arrestin, beta 1 741 95 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36764.[MT7]-AFC[CAM]AENLEEK[MT7].2b3_1.heavy 749.876 / 523.245 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB1 arrestin, beta 1 743 95 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36764.[MT7]-AFC[CAM]AENLEEK[MT7].2y3_1.heavy 749.876 / 549.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB1 arrestin, beta 1 745 95 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36764.[MT7]-AFC[CAM]AENLEEK[MT7].2b6_1.heavy 749.876 / 837.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB1 arrestin, beta 1 747 96 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41727.[MT7]-IVVEAPAK[MT7].2y4_1.heavy 557.857 / 530.342 N/A 26.600299835205078 43 15 10 10 8 1.551465163262235 46.02031513637223 0.0 4 0.9506288823433653 5.531242425691075 3940.0 1.820892045665568 3.0 - - - - - - - 1244.5 13 10 ORC6 origin recognition complex, subunit 6 749 96 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41727.[MT7]-IVVEAPAK[MT7].2y5_1.heavy 557.857 / 659.385 5185.0 26.600299835205078 43 15 10 10 8 1.551465163262235 46.02031513637223 0.0 4 0.9506288823433653 5.531242425691075 5185.0 13.523897131224624 0.0 - - - - - - - 230.44444444444446 10 9 ORC6 origin recognition complex, subunit 6 751 96 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41727.[MT7]-IVVEAPAK[MT7].2b4_1.heavy 557.857 / 585.373 5081.0 26.600299835205078 43 15 10 10 8 1.551465163262235 46.02031513637223 0.0 4 0.9506288823433653 5.531242425691075 5081.0 20.582339907894124 0.0 - - - - - - - 207.5 10 10 ORC6 origin recognition complex, subunit 6 753 96 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41727.[MT7]-IVVEAPAK[MT7].2y7_1.heavy 557.857 / 857.521 4355.0 26.600299835205078 43 15 10 10 8 1.551465163262235 46.02031513637223 0.0 4 0.9506288823433653 5.531242425691075 4355.0 19.17934374152559 1.0 - - - - - - - 188.0625 10 16 ORC6 origin recognition complex, subunit 6 755 97 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19069.[MT7]-ADMVIEAVFEDLSLK[MT7].2y4_1.heavy 984.534 / 604.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 757 97 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19069.[MT7]-ADMVIEAVFEDLSLK[MT7].2y9_1.heavy 984.534 / 1165.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 759 97 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19069.[MT7]-ADMVIEAVFEDLSLK[MT7].2b4_1.heavy 984.534 / 561.282 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 761 97 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19069.[MT7]-ADMVIEAVFEDLSLK[MT7].2b5_1.heavy 984.534 / 674.366 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 763 98 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 435322.0 33.968101501464844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 435322.0 919.3920938355637 0.0 - - - - - - - 178.0 870 1 765 98 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 122941.0 33.968101501464844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 122941.0 164.3280564227659 0.0 - - - - - - - 737.4285714285714 245 7 767 98 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 161577.0 33.968101501464844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 161577.0 123.39410427487883 0.0 - - - - - - - 267.0 323 1 769 99 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36864.[MT7]-LVFLAC[CAM]C[CAM]VAPTNPR.2b3_1.heavy 881.467 / 504.33 10818.0 38.72930145263672 43 13 10 10 10 1.1736703517357898 51.714483738426004 0.0 3 0.9102225835150632 4.087660544452267 10818.0 98.15394157951677 0.0 - - - - - - - 173.57142857142858 21 21 MCM6 minichromosome maintenance complex component 6 771 99 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36864.[MT7]-LVFLAC[CAM]C[CAM]VAPTNPR.2y5_1.heavy 881.467 / 584.315 12464.0 38.72930145263672 43 13 10 10 10 1.1736703517357898 51.714483738426004 0.0 3 0.9102225835150632 4.087660544452267 12464.0 35.95619507382683 0.0 - - - - - - - 223.45 24 20 MCM6 minichromosome maintenance complex component 6 773 99 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36864.[MT7]-LVFLAC[CAM]C[CAM]VAPTNPR.2b4_1.heavy 881.467 / 617.414 7349.0 38.72930145263672 43 13 10 10 10 1.1736703517357898 51.714483738426004 0.0 3 0.9102225835150632 4.087660544452267 7349.0 31.652916690755625 0.0 - - - - - - - 210.52631578947367 14 19 MCM6 minichromosome maintenance complex component 6 775 99 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36864.[MT7]-LVFLAC[CAM]C[CAM]VAPTNPR.2y10_1.heavy 881.467 / 1145.52 5762.0 38.72930145263672 43 13 10 10 10 1.1736703517357898 51.714483738426004 0.0 3 0.9102225835150632 4.087660544452267 5762.0 118.968875192604 0.0 - - - - - - - 165.375 11 16 MCM6 minichromosome maintenance complex component 6 777 100 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18468.[MT7]-FDDISR.2y4_1.heavy 448.733 / 490.262 3870.0 25.02389907836914 45 15 10 10 10 1.579177395072155 49.546137854986874 0.0 3 0.9510314738804176 5.554123020318944 3870.0 10.529826775412367 0.0 - - - - - - - 806.375 7 8 IL3RA interleukin 3 receptor, alpha (low affinity) 779 100 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18468.[MT7]-FDDISR.2b3_1.heavy 448.733 / 522.232 12999.0 25.02389907836914 45 15 10 10 10 1.579177395072155 49.546137854986874 0.0 3 0.9510314738804176 5.554123020318944 12999.0 28.59110615401804 0.0 - - - - - - - 818.625 25 8 IL3RA interleukin 3 receptor, alpha (low affinity) 781 100 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18468.[MT7]-FDDISR.2y5_1.heavy 448.733 / 605.289 8930.0 25.02389907836914 45 15 10 10 10 1.579177395072155 49.546137854986874 0.0 3 0.9510314738804176 5.554123020318944 8930.0 48.314457070707064 0.0 - - - - - - - 328.15384615384613 17 13 IL3RA interleukin 3 receptor, alpha (low affinity) 783 100 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18468.[MT7]-FDDISR.2b4_1.heavy 448.733 / 635.316 3473.0 25.02389907836914 45 15 10 10 10 1.579177395072155 49.546137854986874 0.0 3 0.9510314738804176 5.554123020318944 3473.0 10.075710295629042 1.0 - - - - - - - 247.83333333333334 10 12 IL3RA interleukin 3 receptor, alpha (low affinity) 785 101 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18706.[MT7]-K[MT7]LTDIGIR.3y7_1.heavy 401.927 / 787.467 N/A 27.63409996032715 36 18 0 10 8 6.0072949346761675 16.646427566385277 0.0 4 0.9880803126827835 11.29269515604902 1472.0 6.313013458868973 5.0 - - - - - - - 105.0 540 2 ACADL acyl-CoA dehydrogenase, long chain 787 101 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18706.[MT7]-K[MT7]LTDIGIR.3y6_1.heavy 401.927 / 674.383 9250.0 27.63409996032715 36 18 0 10 8 6.0072949346761675 16.646427566385277 0.0 4 0.9880803126827835 11.29269515604902 9250.0 28.840304182509506 0.0 - - - - - - - 288.75 18 8 ACADL acyl-CoA dehydrogenase, long chain 789 101 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18706.[MT7]-K[MT7]LTDIGIR.3y4_1.heavy 401.927 / 458.309 27224.0 27.63409996032715 36 18 0 10 8 6.0072949346761675 16.646427566385277 0.0 4 0.9880803126827835 11.29269515604902 27224.0 64.48204000661266 1.0 - - - - - - - 262.5 79 6 ACADL acyl-CoA dehydrogenase, long chain 791 101 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18706.[MT7]-K[MT7]LTDIGIR.3y5_1.heavy 401.927 / 573.336 16187.0 27.63409996032715 36 18 0 10 8 6.0072949346761675 16.646427566385277 0.0 4 0.9880803126827835 11.29269515604902 16187.0 16.54967729950085 0.0 - - - - - - - 283.5 32 10 ACADL acyl-CoA dehydrogenase, long chain 793 102 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18702.[MT7]-NLLSVAYK[MT7].2y4_1.heavy 598.368 / 624.384 12527.0 33.36899948120117 48 18 10 10 10 4.708051533917406 21.240209305184365 0.0 3 0.9881647717486635 11.332997347239509 12527.0 45.50678462808708 0.0 - - - - - - - 284.72727272727275 25 11 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 795 102 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18702.[MT7]-NLLSVAYK[MT7].2y5_1.heavy 598.368 / 711.416 28185.0 33.36899948120117 48 18 10 10 10 4.708051533917406 21.240209305184365 0.0 3 0.9881647717486635 11.332997347239509 28185.0 50.29293680297397 0.0 - - - - - - - 797.0 56 7 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 797 102 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18702.[MT7]-NLLSVAYK[MT7].2y3_1.heavy 598.368 / 525.315 20258.0 33.36899948120117 48 18 10 10 10 4.708051533917406 21.240209305184365 0.0 3 0.9881647717486635 11.332997347239509 20258.0 29.388698446633263 0.0 - - - - - - - 258.27272727272725 40 11 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 799 102 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18702.[MT7]-NLLSVAYK[MT7].2y6_1.heavy 598.368 / 824.5 N/A 33.36899948120117 48 18 10 10 10 4.708051533917406 21.240209305184365 0.0 3 0.9881647717486635 11.332997347239509 13505.0 14.995879250144222 1.0 - - - - - - - 734.0 27 8 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 801 103 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18704.[MT7]-IVSGAYDGK[MT7].2y4_1.heavy 599.34 / 626.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 803 103 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18704.[MT7]-IVSGAYDGK[MT7].2y8_1.heavy 599.34 / 940.486 N/A N/A - - - - - - - - - 0.0 - - - - - - - FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 805 103 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18704.[MT7]-IVSGAYDGK[MT7].2b4_1.heavy 599.34 / 501.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 807 103 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18704.[MT7]-IVSGAYDGK[MT7].2y7_1.heavy 599.34 / 841.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 809 104 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533303.[MT7]-SAETLWNIQK[MT7].3b4_1.heavy 493.28 / 533.269 76062.0 33.928199768066406 44 14 10 10 10 3.0299571936325247 33.003766591208176 0.0 3 0.9360071429004947 4.852359621448326 76062.0 112.74516268172678 0.0 - - - - - - - 325.0 152 7 LDHC lactate dehydrogenase C 811 104 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533303.[MT7]-SAETLWNIQK[MT7].3b3_1.heavy 493.28 / 432.221 27145.0 33.928199768066406 44 14 10 10 10 3.0299571936325247 33.003766591208176 0.0 3 0.9360071429004947 4.852359621448326 27145.0 48.385807871089895 0.0 - - - - - - - 651.0 54 7 LDHC lactate dehydrogenase C 813 104 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533303.[MT7]-SAETLWNIQK[MT7].3b7_1.heavy 493.28 / 946.475 12206.0 33.928199768066406 44 14 10 10 10 3.0299571936325247 33.003766591208176 0.0 3 0.9360071429004947 4.852359621448326 12206.0 162.29956043956045 0.0 - - - - - - - 215.0909090909091 24 11 LDHC lactate dehydrogenase C 815 105 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533513.[MT7]-ILENAASAQK[MT7].3b4_1.heavy 444.929 / 614.363 24643.0 25.181699752807617 39 13 10 10 6 1.438975250211077 49.44589654531093 0.0 5 0.922800228181721 4.412858498090153 24643.0 42.5564295653648 1.0 - - - - - - - 720.6666666666666 62 9 ORC6 origin recognition complex, subunit 6 817 105 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533513.[MT7]-ILENAASAQK[MT7].3b5_1.heavy 444.929 / 685.4 19156.0 25.181699752807617 39 13 10 10 6 1.438975250211077 49.44589654531093 0.0 5 0.922800228181721 4.412858498090153 19156.0 47.20858317636943 1.0 - - - - - - - 336.8125 54 16 ORC6 origin recognition complex, subunit 6 819 105 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533513.[MT7]-ILENAASAQK[MT7].3b3_1.heavy 444.929 / 500.32 9877.0 25.181699752807617 39 13 10 10 6 1.438975250211077 49.44589654531093 0.0 5 0.922800228181721 4.412858498090153 9877.0 16.969021314421912 0.0 - - - - - - - 765.0 19 9 ORC6 origin recognition complex, subunit 6 821 105 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533513.[MT7]-ILENAASAQK[MT7].3y4_1.heavy 444.929 / 577.343 31028.0 25.181699752807617 39 13 10 10 6 1.438975250211077 49.44589654531093 0.0 5 0.922800228181721 4.412858498090153 31028.0 32.76651743738431 0.0 - - - - - - - 769.8571428571429 62 7 ORC6 origin recognition complex, subunit 6 823 106 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18569.[MT7]-IAEALSK[MT7].2y4_1.heavy 510.321 / 562.368 3300.0 26.771499633789062 42 16 10 10 6 2.420102891883955 41.32055721075311 0.0 5 0.9634204489962634 6.43295269393782 3300.0 7.031848627416494 3.0 - - - - - - - 636.1666666666666 8 12 MCM5 minichromosome maintenance complex component 5 825 106 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18569.[MT7]-IAEALSK[MT7].2y5_1.heavy 510.321 / 691.411 1753.0 26.771499633789062 42 16 10 10 6 2.420102891883955 41.32055721075311 0.0 5 0.9634204489962634 6.43295269393782 1753.0 0.7710991379310345 2.0 - - - - - - - 195.9 3 10 MCM5 minichromosome maintenance complex component 5 827 106 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18569.[MT7]-IAEALSK[MT7].2b4_1.heavy 510.321 / 529.31 3197.0 26.771499633789062 42 16 10 10 6 2.420102891883955 41.32055721075311 0.0 5 0.9634204489962634 6.43295269393782 3197.0 4.775344325897187 0.0 - - - - - - - 247.2 6 5 MCM5 minichromosome maintenance complex component 5 829 106 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18569.[MT7]-IAEALSK[MT7].2y6_1.heavy 510.321 / 762.448 5260.0 26.771499633789062 42 16 10 10 6 2.420102891883955 41.32055721075311 0.0 5 0.9634204489962634 6.43295269393782 5260.0 33.680124121394485 0.0 - - - - - - - 268.06666666666666 10 15 MCM5 minichromosome maintenance complex component 5 831 107 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533515.[MT7]-DSTLIMQLLR.3b4_1.heavy 445.259 / 561.3 46917.0 44.690799713134766 44 14 10 10 10 1.2580398539211732 45.820306394705085 0.0 3 0.9417941784322393 5.090374942165655 46917.0 454.9579160583942 0.0 - - - - - - - 219.3 93 10 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 833 107 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533515.[MT7]-DSTLIMQLLR.3b5_1.heavy 445.259 / 674.384 14195.0 44.690799713134766 44 14 10 10 10 1.2580398539211732 45.820306394705085 0.0 3 0.9417941784322393 5.090374942165655 14195.0 109.30204870506378 0.0 - - - - - - - 220.64285714285714 28 14 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 835 107 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533515.[MT7]-DSTLIMQLLR.3y4_1.heavy 445.259 / 529.346 39496.0 44.690799713134766 44 14 10 10 10 1.2580398539211732 45.820306394705085 0.0 3 0.9417941784322393 5.090374942165655 39496.0 799.0669986613119 0.0 - - - - - - - 194.3 78 10 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 837 107 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533515.[MT7]-DSTLIMQLLR.3y5_1.heavy 445.259 / 660.386 21964.0 44.690799713134766 44 14 10 10 10 1.2580398539211732 45.820306394705085 0.0 3 0.9417941784322393 5.090374942165655 21964.0 272.0666331658291 0.0 - - - - - - - 230.375 43 8 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 839 108 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36554.[MT7]-DVEQQFK[MT7].2y5_1.heavy 591.324 / 823.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 841 108 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36554.[MT7]-DVEQQFK[MT7].2b4_1.heavy 591.324 / 616.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 843 108 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36554.[MT7]-DVEQQFK[MT7].2y6_1.heavy 591.324 / 922.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 845 108 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36554.[MT7]-DVEQQFK[MT7].2b5_1.heavy 591.324 / 744.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 847 109 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533516.[MT7]-DSTLIMQLLR.2y5_1.heavy 667.385 / 660.386 4380.0 44.690799713134766 44 14 10 10 10 2.1056806034345876 32.064666995525215 0.0 3 0.9454053878159793 5.2576485601800815 4380.0 24.11313190862196 0.0 - - - - - - - 192.27272727272728 8 22 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 849 109 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533516.[MT7]-DSTLIMQLLR.2b4_1.heavy 667.385 / 561.3 4134.0 44.690799713134766 44 14 10 10 10 2.1056806034345876 32.064666995525215 0.0 3 0.9454053878159793 5.2576485601800815 4134.0 27.811817258883245 0.0 - - - - - - - 145.05 8 20 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 851 109 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533516.[MT7]-DSTLIMQLLR.2y9_1.heavy 667.385 / 1074.63 3101.0 44.690799713134766 44 14 10 10 10 2.1056806034345876 32.064666995525215 0.0 3 0.9454053878159793 5.2576485601800815 3101.0 54.42571428571429 0.0 - - - - - - - 91.66666666666667 6 15 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 853 109 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533516.[MT7]-DSTLIMQLLR.2y6_1.heavy 667.385 / 773.47 3248.0 44.690799713134766 44 14 10 10 10 2.1056806034345876 32.064666995525215 0.0 3 0.9454053878159793 5.2576485601800815 3248.0 7.757875228561689 1.0 - - - - - - - 182.8095238095238 6 21 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 855 110 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533510.[MT7]-FVDLYGAQK[MT7].3b6_1.heavy 443.587 / 839.442 4928.0 32.64569854736328 44 14 10 10 10 2.7381323617736792 36.5212439676302 0.0 3 0.9463272023279945 5.303021256270457 4928.0 71.16251385271134 0.0 - - - - - - - 179.75 9 4 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 857 110 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533510.[MT7]-FVDLYGAQK[MT7].3b4_1.heavy 443.587 / 619.357 31829.0 32.64569854736328 44 14 10 10 10 2.7381323617736792 36.5212439676302 0.0 3 0.9463272023279945 5.303021256270457 31829.0 137.12408316744083 0.0 - - - - - - - 244.84615384615384 63 13 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 859 110 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533510.[MT7]-FVDLYGAQK[MT7].3y4_1.heavy 443.587 / 547.332 36141.0 32.64569854736328 44 14 10 10 10 2.7381323617736792 36.5212439676302 0.0 3 0.9463272023279945 5.303021256270457 36141.0 86.41588087687263 0.0 - - - - - - - 289.27272727272725 72 11 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 861 110 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533510.[MT7]-FVDLYGAQK[MT7].3b3_1.heavy 443.587 / 506.273 54006.0 32.64569854736328 44 14 10 10 10 2.7381323617736792 36.5212439676302 0.0 3 0.9463272023279945 5.303021256270457 54006.0 60.988245556507025 1.0 - - - - - - - 233.36363636363637 114 11 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 863 111 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18576.[MT7]-EIVFDK[MT7].2y4_1.heavy 519.807 / 652.379 6236.0 29.5693998336792 40 15 10 5 10 1.7049843279451375 58.65156550765536 0.04239845275878906 3 0.9500950653957136 5.50133065559465 6236.0 14.718509316770186 0.0 - - - - - - - 790.4285714285714 12 7 ACADL acyl-CoA dehydrogenase, long chain 865 111 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18576.[MT7]-EIVFDK[MT7].2y5_1.heavy 519.807 / 765.463 5633.0 29.5693998336792 40 15 10 5 10 1.7049843279451375 58.65156550765536 0.04239845275878906 3 0.9500950653957136 5.50133065559465 5633.0 19.261948310139168 0.0 - - - - - - - 274.27272727272725 11 11 ACADL acyl-CoA dehydrogenase, long chain 867 111 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18576.[MT7]-EIVFDK[MT7].2y3_1.heavy 519.807 / 553.31 9958.0 29.5693998336792 40 15 10 5 10 1.7049843279451375 58.65156550765536 0.04239845275878906 3 0.9500950653957136 5.50133065559465 9958.0 15.651616565913708 0.0 - - - - - - - 1206.875 19 8 ACADL acyl-CoA dehydrogenase, long chain 869 111 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18576.[MT7]-EIVFDK[MT7].2b5_1.heavy 519.807 / 748.4 5733.0 29.5693998336792 40 15 10 5 10 1.7049843279451375 58.65156550765536 0.04239845275878906 3 0.9500950653957136 5.50133065559465 5733.0 20.14133932984086 0.0 - - - - - - - 268.2 11 15 ACADL acyl-CoA dehydrogenase, long chain 871 112 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533308.[MT7]-QQEGETR.2b3_1.heavy 496.25 / 530.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 873 112 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533308.[MT7]-QQEGETR.2y5_1.heavy 496.25 / 591.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 875 112 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533308.[MT7]-QQEGETR.2y6_1.heavy 496.25 / 719.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 877 112 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533308.[MT7]-QQEGETR.2b5_1.heavy 496.25 / 716.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 879 113 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18574.[MT7]-LETPSAK[MT7].2y4_1.heavy 517.31 / 546.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 881 113 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18574.[MT7]-LETPSAK[MT7].2y5_1.heavy 517.31 / 647.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 883 113 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18574.[MT7]-LETPSAK[MT7].2y3_1.heavy 517.31 / 449.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 885 113 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18574.[MT7]-LETPSAK[MT7].2y6_1.heavy 517.31 / 776.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 887 114 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18985.[MT7]-LAALPNVYEVISK[MT7].3b4_1.heavy 569.009 / 513.352 63433.0 41.409000396728516 48 18 10 10 10 6.435017581931052 15.539973081160023 0.0 3 0.9895835512933695 12.081610325933628 63433.0 147.81245855614972 0.0 - - - - - - - 747.75 126 8 MCM5 minichromosome maintenance complex component 5 889 114 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18985.[MT7]-LAALPNVYEVISK[MT7].3y4_1.heavy 569.009 / 590.399 30221.0 41.409000396728516 48 18 10 10 10 6.435017581931052 15.539973081160023 0.0 3 0.9895835512933695 12.081610325933628 30221.0 93.00048624126133 0.0 - - - - - - - 330.6923076923077 60 13 MCM5 minichromosome maintenance complex component 5 891 114 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18985.[MT7]-LAALPNVYEVISK[MT7].3y5_1.heavy 569.009 / 719.442 18880.0 41.409000396728516 48 18 10 10 10 6.435017581931052 15.539973081160023 0.0 3 0.9895835512933695 12.081610325933628 18880.0 135.71761269677643 0.0 - - - - - - - 278.0769230769231 37 13 MCM5 minichromosome maintenance complex component 5 893 114 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18985.[MT7]-LAALPNVYEVISK[MT7].3b7_1.heavy 569.009 / 823.516 21061.0 41.409000396728516 48 18 10 10 10 6.435017581931052 15.539973081160023 0.0 3 0.9895835512933695 12.081610325933628 21061.0 151.39558479908942 0.0 - - - - - - - 230.5 42 10 MCM5 minichromosome maintenance complex component 5 895 115 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19095.[MT7]-ETDLASVIYVYVQDYR.3b6_1.heavy 693.357 / 761.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDR kinase insert domain receptor (a type III receptor tyrosine kinase) 897 115 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19095.[MT7]-ETDLASVIYVYVQDYR.3b4_1.heavy 693.357 / 603.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDR kinase insert domain receptor (a type III receptor tyrosine kinase) 899 115 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19095.[MT7]-ETDLASVIYVYVQDYR.3b5_1.heavy 693.357 / 674.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDR kinase insert domain receptor (a type III receptor tyrosine kinase) 901 115 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19095.[MT7]-ETDLASVIYVYVQDYR.3y8_1.heavy 693.357 / 1105.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDR kinase insert domain receptor (a type III receptor tyrosine kinase) 903 116 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533304.[MT7]-ISGLPVTR.2b4_1.heavy 493.809 / 515.331 16669.0 28.584624767303467 46 20 10 6 10 9.3773978434575 10.663939151282658 0.03970146179199219 3 0.9914641456626309 13.348407755907974 16669.0 41.52357311617318 0.0 - - - - - - - 687.3076923076923 33 13 LDHC lactate dehydrogenase C 905 116 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533304.[MT7]-ISGLPVTR.2b6_1.heavy 493.809 / 711.452 5121.0 28.584624767303467 46 20 10 6 10 9.3773978434575 10.663939151282658 0.03970146179199219 3 0.9914641456626309 13.348407755907974 5121.0 24.073803986710963 0.0 - - - - - - - 242.58333333333334 10 12 LDHC lactate dehydrogenase C 907 116 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533304.[MT7]-ISGLPVTR.2y6_1.heavy 493.809 / 642.393 6828.0 28.584624767303467 46 20 10 6 10 9.3773978434575 10.663939151282658 0.03970146179199219 3 0.9914641456626309 13.348407755907974 6828.0 5.991726287135217 0.0 - - - - - - - 677.625 13 8 LDHC lactate dehydrogenase C 909 116 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533304.[MT7]-ISGLPVTR.2y7_1.heavy 493.809 / 729.425 65571.0 28.584624767303467 46 20 10 6 10 9.3773978434575 10.663939151282658 0.03970146179199219 3 0.9914641456626309 13.348407755907974 65571.0 224.15586222097474 0.0 - - - - - - - 740.5 131 8 LDHC lactate dehydrogenase C 911 117 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19151.[MT7]-VGLTSEILNSFEHEFLSK[MT7].4y5_1.heavy 585.319 / 767.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 913 117 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19151.[MT7]-VGLTSEILNSFEHEFLSK[MT7].4y4_1.heavy 585.319 / 638.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 915 117 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19151.[MT7]-VGLTSEILNSFEHEFLSK[MT7].4b7_1.heavy 585.319 / 844.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 917 117 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19151.[MT7]-VGLTSEILNSFEHEFLSK[MT7].4b6_1.heavy 585.319 / 731.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 919 118 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19153.[MT7]-DSIFSNLTGQLDYQGFEK[MT7].4y4_1.heavy 588.301 / 624.347 11108.0 42.523101806640625 47 17 10 10 10 3.599289295131654 27.78326269445986 0.0 3 0.9755355145760022 7.87417259022187 11108.0 30.69224240526151 0.0 - - - - - - - 221.73333333333332 22 15 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 921 118 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19153.[MT7]-DSIFSNLTGQLDYQGFEK[MT7].4b4_1.heavy 588.301 / 607.321 3722.0 42.523101806640625 47 17 10 10 10 3.599289295131654 27.78326269445986 0.0 3 0.9755355145760022 7.87417259022187 3722.0 25.015396821366913 0.0 - - - - - - - 223.10526315789474 7 19 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 923 118 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19153.[MT7]-DSIFSNLTGQLDYQGFEK[MT7].4y3_1.heavy 588.301 / 567.326 2577.0 42.523101806640625 47 17 10 10 10 3.599289295131654 27.78326269445986 0.0 3 0.9755355145760022 7.87417259022187 2577.0 4.740832476875642 0.0 - - - - - - - 225.94444444444446 5 18 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 925 118 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19153.[MT7]-DSIFSNLTGQLDYQGFEK[MT7].4b6_1.heavy 588.301 / 808.396 3951.0 42.523101806640625 47 17 10 10 10 3.599289295131654 27.78326269445986 0.0 3 0.9755355145760022 7.87417259022187 3951.0 18.56031100842896 0.0 - - - - - - - 189.6875 7 16 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 927 119 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 211442.0 22.33799934387207 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 211442.0 539.2960269328863 0.0 - - - - - - - 687.5 422 8 929 119 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 335242.0 22.33799934387207 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 335242.0 519.5764459563342 0.0 - - - - - - - 332.0 670 6 931 119 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 1383470.0 22.33799934387207 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1383470.0 5155.028637487127 0.0 - - - - - - - 893.5 2766 2 933 120 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533655.[MT7]-VLGC[CAM]PEALTGSYK[MT7].3b6_1.heavy 561.639 / 800.409 20470.0 32.407501220703125 47 17 10 10 10 3.512199964602911 28.47218296447594 0.0 3 0.9733655689055275 7.545221323737483 20470.0 31.96334843126516 1.0 - - - - - - - 259.45454545454544 41 11 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 935 120 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533655.[MT7]-VLGC[CAM]PEALTGSYK[MT7].3b4_1.heavy 561.639 / 574.314 64568.0 32.407501220703125 47 17 10 10 10 3.512199964602911 28.47218296447594 0.0 3 0.9733655689055275 7.545221323737483 64568.0 100.52585994758556 0.0 - - - - - - - 683.8571428571429 129 7 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 937 120 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533655.[MT7]-VLGC[CAM]PEALTGSYK[MT7].3y4_1.heavy 561.639 / 598.332 63346.0 32.407501220703125 47 17 10 10 10 3.512199964602911 28.47218296447594 0.0 3 0.9733655689055275 7.545221323737483 63346.0 149.95075249341022 0.0 - - - - - - - 640.1428571428571 126 7 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 939 120 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533655.[MT7]-VLGC[CAM]PEALTGSYK[MT7].3y5_1.heavy 561.639 / 699.379 45829.0 32.407501220703125 47 17 10 10 10 3.512199964602911 28.47218296447594 0.0 3 0.9733655689055275 7.545221323737483 45829.0 137.46133156047497 0.0 - - - - - - - 292.75 91 8 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 941 121 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533654.[MT7]-RAEQEALTGEC[CAM]K[MT7].3b6_1.heavy 560.626 / 829.428 7722.0 19.608299255371094 44 14 10 10 10 3.647081128546116 27.419187145931225 0.0 3 0.939999724186532 5.012910774757024 7722.0 137.39834482758621 0.0 - - - - - - - 131.85714285714286 15 14 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 943 121 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533654.[MT7]-RAEQEALTGEC[CAM]K[MT7].3b5_1.heavy 560.626 / 758.391 4264.0 19.608299255371094 44 14 10 10 10 3.647081128546116 27.419187145931225 0.0 3 0.939999724186532 5.012910774757024 4264.0 47.08939130434783 0.0 - - - - - - - 115.2 8 10 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 945 121 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533654.[MT7]-RAEQEALTGEC[CAM]K[MT7].3y4_1.heavy 560.626 / 637.31 16077.0 19.608299255371094 44 14 10 10 10 3.647081128546116 27.419187145931225 0.0 3 0.939999724186532 5.012910774757024 16077.0 185.28354166666668 0.0 - - - - - - - 136.0909090909091 32 11 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 947 121 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533654.[MT7]-RAEQEALTGEC[CAM]K[MT7].3y5_1.heavy 560.626 / 738.357 9393.0 19.608299255371094 44 14 10 10 10 3.647081128546116 27.419187145931225 0.0 3 0.939999724186532 5.012910774757024 9393.0 115.16634782608696 0.0 - - - - - - - 218.9 18 10 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 949 122 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18474.[MT7]-C[CAM]VGLSAR.2b3_1.heavy 453.751 / 461.23 1256.0 21.177000045776367 42 14 10 10 8 13.855678507217023 7.2172575271512605 0.0 4 0.9407098826022752 5.0431480838824845 1256.0 2.2718283961659376 5.0 - - - - - - - 661.8 3 15 ORC6 origin recognition complex, subunit 6 951 122 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18474.[MT7]-C[CAM]VGLSAR.2y5_1.heavy 453.751 / 503.294 5591.0 21.177000045776367 42 14 10 10 8 13.855678507217023 7.2172575271512605 0.0 4 0.9407098826022752 5.0431480838824845 5591.0 12.706790654347332 0.0 - - - - - - - 717.25 11 12 ORC6 origin recognition complex, subunit 6 953 122 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18474.[MT7]-C[CAM]VGLSAR.2b4_1.heavy 453.751 / 574.314 2073.0 21.177000045776367 42 14 10 10 8 13.855678507217023 7.2172575271512605 0.0 4 0.9407098826022752 5.0431480838824845 2073.0 0.8485089463220674 4.0 - - - - - - - 578.1 5 10 ORC6 origin recognition complex, subunit 6 955 122 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18474.[MT7]-C[CAM]VGLSAR.2y6_1.heavy 453.751 / 602.362 8669.0 21.177000045776367 42 14 10 10 8 13.855678507217023 7.2172575271512605 0.0 4 0.9407098826022752 5.0431480838824845 8669.0 15.107324947454897 0.0 - - - - - - - 734.6153846153846 17 13 ORC6 origin recognition complex, subunit 6 957 123 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18810.[MT7]-RIVSGAYDGK[MT7].2b8_1.heavy 677.39 / 1006.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 959 123 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18810.[MT7]-RIVSGAYDGK[MT7].2y8_1.heavy 677.39 / 940.486 N/A N/A - - - - - - - - - 0.0 - - - - - - - FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 961 123 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18810.[MT7]-RIVSGAYDGK[MT7].2y9_1.heavy 677.39 / 1053.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 963 123 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18810.[MT7]-RIVSGAYDGK[MT7].2y7_1.heavy 677.39 / 841.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 965 124 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18812.[MT7]-K[MT7]LTDIGIRR.2b8_1.heavy 680.437 / 1185.76 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 967 124 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18812.[MT7]-K[MT7]LTDIGIRR.2y5_1.heavy 680.437 / 614.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 969 124 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18812.[MT7]-K[MT7]LTDIGIRR.2b4_1.heavy 680.437 / 746.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 971 124 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18812.[MT7]-K[MT7]LTDIGIRR.2b5_1.heavy 680.437 / 859.549 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 973 125 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533720.[MT7]-K[MT7]RAEQEALTGEC[CAM]K[MT7].4y5_1.heavy 488.77 / 738.357 4137.0 18.1472749710083 39 13 10 6 10 1.1402953794197472 51.95834022735632 0.035099029541015625 3 0.9159507674851011 4.226741248981667 4137.0 96.99339861386139 0.0 - - - - - - - 86.9090909090909 8 11 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 975 125 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533720.[MT7]-K[MT7]RAEQEALTGEC[CAM]K[MT7].4y4_1.heavy 488.77 / 637.31 10543.0 18.1472749710083 39 13 10 6 10 1.1402953794197472 51.95834022735632 0.035099029541015625 3 0.9159507674851011 4.226741248981667 10543.0 82.34467570692738 0.0 - - - - - - - 180.76470588235293 21 17 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 977 125 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533720.[MT7]-K[MT7]RAEQEALTGEC[CAM]K[MT7].4b7_2.heavy 488.77 / 551.316 23760.0 18.1472749710083 39 13 10 6 10 1.1402953794197472 51.95834022735632 0.035099029541015625 3 0.9159507674851011 4.226741248981667 23760.0 124.20447507305796 0.0 - - - - - - - 207.64705882352942 47 17 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 979 125 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533720.[MT7]-K[MT7]RAEQEALTGEC[CAM]K[MT7].4b6_2.heavy 488.77 / 515.798 9534.0 18.1472749710083 39 13 10 6 10 1.1402953794197472 51.95834022735632 0.035099029541015625 3 0.9159507674851011 4.226741248981667 9534.0 40.32828828828829 0.0 - - - - - - - 224.22222222222223 19 18 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 981 126 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18817.[MT7]-NVTDIEC[CAM]VK[MT7].2y5_1.heavy 683.368 / 792.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL3RA interleukin 3 receptor, alpha (low affinity) 983 126 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18817.[MT7]-NVTDIEC[CAM]VK[MT7].2b4_1.heavy 683.368 / 574.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL3RA interleukin 3 receptor, alpha (low affinity) 985 126 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18817.[MT7]-NVTDIEC[CAM]VK[MT7].2y3_1.heavy 683.368 / 550.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL3RA interleukin 3 receptor, alpha (low affinity) 987 126 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18817.[MT7]-NVTDIEC[CAM]VK[MT7].2y7_1.heavy 683.368 / 1008.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL3RA interleukin 3 receptor, alpha (low affinity) 989 127 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533526.[MT7]-RIVSGAYDGK[MT7].3b6_1.heavy 451.929 / 728.453 31619.0 20.600199699401855 40 14 10 6 10 2.1487755290948747 46.5381323670057 0.03280067443847656 3 0.9449733573433825 5.236775792315693 31619.0 89.71956683100771 0.0 - - - - - - - 734.1428571428571 63 7 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 991 127 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533526.[MT7]-RIVSGAYDGK[MT7].3y3_1.heavy 451.929 / 463.263 64792.0 20.600199699401855 40 14 10 6 10 2.1487755290948747 46.5381323670057 0.03280067443847656 3 0.9449733573433825 5.236775792315693 64792.0 53.51899298680674 0.0 - - - - - - - 725.5714285714286 129 7 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 993 127 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533526.[MT7]-RIVSGAYDGK[MT7].3b5_1.heavy 451.929 / 657.416 16736.0 20.600199699401855 40 14 10 6 10 2.1487755290948747 46.5381323670057 0.03280067443847656 3 0.9449733573433825 5.236775792315693 16736.0 50.76820083682009 0.0 - - - - - - - 277.5 33 14 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 995 127 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533526.[MT7]-RIVSGAYDGK[MT7].3y4_1.heavy 451.929 / 626.327 15660.0 20.600199699401855 40 14 10 6 10 2.1487755290948747 46.5381323670057 0.03280067443847656 3 0.9449733573433825 5.236775792315693 15660.0 17.02705863303528 0.0 - - - - - - - 666.0 31 7 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 997 128 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18577.[MT7]-IVIVTAGAR.2y8_1.heavy 522.338 / 786.483 141914.0 29.723100662231445 50 20 10 10 10 4.69748907101085 21.28796863352384 0.0 3 0.9910540537654061 13.038418929845259 141914.0 114.39598106438459 0.0 - - - - - - - 277.25 283 8 LDHC lactate dehydrogenase C 999 128 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18577.[MT7]-IVIVTAGAR.2b4_1.heavy 522.338 / 569.414 19251.0 29.723100662231445 50 20 10 10 10 4.69748907101085 21.28796863352384 0.0 3 0.9910540537654061 13.038418929845259 19251.0 23.649762575823758 0.0 - - - - - - - 750.4444444444445 38 9 LDHC lactate dehydrogenase C 1001 128 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18577.[MT7]-IVIVTAGAR.2y6_1.heavy 522.338 / 574.331 68135.0 29.723100662231445 50 20 10 10 10 4.69748907101085 21.28796863352384 0.0 3 0.9910540537654061 13.038418929845259 68135.0 33.32173449346911 0.0 - - - - - - - 1267.0 136 7 LDHC lactate dehydrogenase C 1003 128 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18577.[MT7]-IVIVTAGAR.2y7_1.heavy 522.338 / 687.415 75190.0 29.723100662231445 50 20 10 10 10 4.69748907101085 21.28796863352384 0.0 3 0.9910540537654061 13.038418929845259 75190.0 102.44234635745767 0.0 - - - - - - - 761.5555555555555 150 9 LDHC lactate dehydrogenase C 1005 129 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533727.[MT7]-TSFQLLNPGTYTVQIR.3b4_1.heavy 661.366 / 608.316 14452.0 42.101600646972656 42 14 10 10 8 2.10420368473613 47.52391639906293 0.0 4 0.9402197183157276 5.022220316967156 14452.0 70.92767905123691 0.0 - - - - - - - 205.4 28 15 IL3RA interleukin 3 receptor, alpha (low affinity) 1007 129 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533727.[MT7]-TSFQLLNPGTYTVQIR.3b5_1.heavy 661.366 / 721.4 2199.0 42.101600646972656 42 14 10 10 8 2.10420368473613 47.52391639906293 0.0 4 0.9402197183157276 5.022220316967156 2199.0 0.8235955056179777 3.0 - - - - - - - 184.6875 13 16 IL3RA interleukin 3 receptor, alpha (low affinity) 1009 129 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533727.[MT7]-TSFQLLNPGTYTVQIR.3y8_1.heavy 661.366 / 937.51 566.0 42.101600646972656 42 14 10 10 8 2.10420368473613 47.52391639906293 0.0 4 0.9402197183157276 5.022220316967156 566.0 2.099875629756108 4.0 - - - - - - - 140.58823529411765 3 17 IL3RA interleukin 3 receptor, alpha (low affinity) 1011 129 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533727.[MT7]-TSFQLLNPGTYTVQIR.3y9_1.heavy 661.366 / 1034.56 6535.0 42.101600646972656 42 14 10 10 8 2.10420368473613 47.52391639906293 0.0 4 0.9402197183157276 5.022220316967156 6535.0 98.35532614691432 0.0 - - - - - - - 136.25 13 12 IL3RA interleukin 3 receptor, alpha (low affinity) 1013 130 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18999.[MT7]-LVFLAC[CAM]C[CAM]VAPTNPR.3y6_1.heavy 587.98 / 655.352 53266.0 38.72930145263672 44 14 10 10 10 4.5346065185552975 17.49071616859511 0.0 3 0.9381060100479873 4.934830621564977 53266.0 141.8818361525373 0.0 - - - - - - - 314.70588235294116 106 17 MCM6 minichromosome maintenance complex component 6 1015 130 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18999.[MT7]-LVFLAC[CAM]C[CAM]VAPTNPR.3b4_1.heavy 587.98 / 617.414 40920.0 38.72930145263672 44 14 10 10 10 4.5346065185552975 17.49071616859511 0.0 3 0.9381060100479873 4.934830621564977 40920.0 202.88044000578958 0.0 - - - - - - - 723.3 81 10 MCM6 minichromosome maintenance complex component 6 1017 130 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18999.[MT7]-LVFLAC[CAM]C[CAM]VAPTNPR.3b3_1.heavy 587.98 / 504.33 28103.0 38.72930145263672 44 14 10 10 10 4.5346065185552975 17.49071616859511 0.0 3 0.9381060100479873 4.934830621564977 28103.0 56.220420001376645 0.0 - - - - - - - 614.1111111111111 56 9 MCM6 minichromosome maintenance complex component 6 1019 130 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18999.[MT7]-LVFLAC[CAM]C[CAM]VAPTNPR.3y5_1.heavy 587.98 / 584.315 71727.0 38.72930145263672 44 14 10 10 10 4.5346065185552975 17.49071616859511 0.0 3 0.9381060100479873 4.934830621564977 71727.0 166.18893188964714 0.0 - - - - - - - 670.2 143 10 MCM6 minichromosome maintenance complex component 6 1021 131 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18998.[MT7]-IIQDIETIESNWR.2y4_1.heavy 880.969 / 562.273 3398.0 47.2333984375 45 15 10 10 10 1.9559808695319894 40.82729181288035 0.0 3 0.9503885923852168 5.517718505915068 3398.0 29.49945811695642 0.0 - - - - - - - 139.1578947368421 6 19 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1023 131 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18998.[MT7]-IIQDIETIESNWR.2y8_1.heavy 880.969 / 1034.49 3673.0 47.2333984375 45 15 10 10 10 1.9559808695319894 40.82729181288035 0.0 3 0.9503885923852168 5.517718505915068 3673.0 133.97744717304397 0.0 - - - - - - - 137.33333333333334 7 15 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1025 131 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18998.[MT7]-IIQDIETIESNWR.2b4_1.heavy 880.969 / 614.363 8239.0 47.2333984375 45 15 10 10 10 1.9559808695319894 40.82729181288035 0.0 3 0.9503885923852168 5.517718505915068 8239.0 67.31781993110461 0.0 - - - - - - - 180.47826086956522 16 23 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1027 131 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18998.[MT7]-IIQDIETIESNWR.2y9_1.heavy 880.969 / 1147.57 3845.0 47.2333984375 45 15 10 10 10 1.9559808695319894 40.82729181288035 0.0 3 0.9503885923852168 5.517718505915068 3845.0 31.606603004748074 0.0 - - - - - - - 111.04761904761905 7 21 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1029 132 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18580.[MT7]-INSPNSK[MT7].2y4_1.heavy 524.305 / 589.343 2382.0 17.02120018005371 42 12 10 10 10 1.1796785817991307 55.717461704727086 0.0 3 0.8875321413314248 3.644946690236971 2382.0 11.736500713851196 0.0 - - - - - - - 179.65 4 20 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1031 132 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18580.[MT7]-INSPNSK[MT7].2y5_1.heavy 524.305 / 676.375 1312.0 17.02120018005371 42 12 10 10 10 1.1796785817991307 55.717461704727086 0.0 3 0.8875321413314248 3.644946690236971 1312.0 14.206020066889632 0.0 - - - - - - - 126.15 2 20 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1033 132 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18580.[MT7]-INSPNSK[MT7].2y3_1.heavy 524.305 / 492.29 N/A 17.02120018005371 42 12 10 10 10 1.1796785817991307 55.717461704727086 0.0 3 0.8875321413314248 3.644946690236971 967.0 0.21548746518105852 7.0 - - - - - - - 738.0 3 8 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1035 132 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18580.[MT7]-INSPNSK[MT7].2y6_1.heavy 524.305 / 790.417 3107.0 17.02120018005371 42 12 10 10 10 1.1796785817991307 55.717461704727086 0.0 3 0.8875321413314248 3.644946690236971 3107.0 37.53425724637681 1.0 - - - - - - - 187.47619047619048 6 21 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1037 133 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18997.[MT7]-IIQDIETIESNWR.3y7_1.heavy 587.648 / 905.448 22445.0 47.2333984375 48 18 10 10 10 5.277588720251239 18.94804716712361 0.0 3 0.9844357774704355 9.879472388163615 22445.0 334.9546371997956 0.0 - - - - - - - 110.46153846153847 44 13 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1039 133 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18997.[MT7]-IIQDIETIESNWR.3b4_1.heavy 587.648 / 614.363 100389.0 47.2333984375 48 18 10 10 10 5.277588720251239 18.94804716712361 0.0 3 0.9844357774704355 9.879472388163615 100389.0 937.7653293635549 0.0 - - - - - - - 161.21428571428572 200 14 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1041 133 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18997.[MT7]-IIQDIETIESNWR.3y4_1.heavy 587.648 / 562.273 49373.0 47.2333984375 48 18 10 10 10 5.277588720251239 18.94804716712361 0.0 3 0.9844357774704355 9.879472388163615 49373.0 855.4948110777158 0.0 - - - - - - - 138.68421052631578 98 19 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1043 133 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18997.[MT7]-IIQDIETIESNWR.3y5_1.heavy 587.648 / 691.316 80989.0 47.2333984375 48 18 10 10 10 5.277588720251239 18.94804716712361 0.0 3 0.9844357774704355 9.879472388163615 80989.0 401.50726466916353 0.0 - - - - - - - 219.68421052631578 161 19 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1045 134 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18480.[MT7]-SQFLK[MT7].2y4_1.heavy 455.784 / 679.426 2553.0 24.889599800109863 26 14 2 6 4 1.7189075886183782 45.94187637588974 0.03759956359863281 7 0.9345891608384392 4.798895584677244 2553.0 9.958984777416477 2.0 - - - - - - - 203.28571428571428 14 14 MCM9;MCM2;MCM6;CD207;ZNF649 minichromosome maintenance complex component 9;minichromosome maintenance complex component 2;minichromosome maintenance complex component 6;CD207 molecule, langerin;zinc finger protein 649 1047 134 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18480.[MT7]-SQFLK[MT7].2b3_1.heavy 455.784 / 507.268 1669.0 24.889599800109863 26 14 2 6 4 1.7189075886183782 45.94187637588974 0.03759956359863281 7 0.9345891608384392 4.798895584677244 1669.0 2.5113212024587366 3.0 - - - - - - - 736.5 3 8 MCM9;MCM2;MCM6;CD207;ZNF649 minichromosome maintenance complex component 9;minichromosome maintenance complex component 2;minichromosome maintenance complex component 6;CD207 molecule, langerin;zinc finger protein 649 1049 134 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18480.[MT7]-SQFLK[MT7].2b4_1.heavy 455.784 / 620.352 1375.0 24.889599800109863 26 14 2 6 4 1.7189075886183782 45.94187637588974 0.03759956359863281 7 0.9345891608384392 4.798895584677244 1375.0 5.222996996789671 8.0 - - - - - - - 785.4285714285714 5 7 MCM9;MCM2;MCM6;CD207;ZNF649 minichromosome maintenance complex component 9;minichromosome maintenance complex component 2;minichromosome maintenance complex component 6;CD207 molecule, langerin;zinc finger protein 649 1051 134 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18480.[MT7]-SQFLK[MT7].2y3_1.heavy 455.784 / 551.367 3339.0 24.889599800109863 26 14 2 6 4 1.7189075886183782 45.94187637588974 0.03759956359863281 7 0.9345891608384392 4.798895584677244 3339.0 4.293359728506788 4.0 - - - - - - - 294.6666666666667 12 12 MCM9;MCM2;MCM6;CD207;ZNF649 minichromosome maintenance complex component 9;minichromosome maintenance complex component 2;minichromosome maintenance complex component 6;CD207 molecule, langerin;zinc finger protein 649 1053 135 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18582.[MT7]-EQLIEK[MT7].2y4_1.heavy 524.318 / 646.426 6633.0 24.326600392659504 46 20 10 6 10 3.6349256869046194 21.786205605254313 0.038700103759765625 3 0.9904932559816243 12.647416124450908 6633.0 19.159520501282643 0.0 - - - - - - - 322.25 13 12 LDHC;WDR87 lactate dehydrogenase C;WD repeat domain 87 1055 135 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18582.[MT7]-EQLIEK[MT7].2b3_1.heavy 524.318 / 515.295 N/A 24.326600392659504 46 20 10 6 10 3.6349256869046194 21.786205605254313 0.038700103759765625 3 0.9904932559816243 12.647416124450908 14923.0 7.777021918742724 0.0 - - - - - - - 1290.0 29 1 LDHC;WDR87 lactate dehydrogenase C;WD repeat domain 87 1057 135 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18582.[MT7]-EQLIEK[MT7].2y3_1.heavy 524.318 / 533.341 10225.0 24.326600392659504 46 20 10 6 10 3.6349256869046194 21.786205605254313 0.038700103759765625 3 0.9904932559816243 12.647416124450908 10225.0 13.139015235259727 0.0 - - - - - - - 245.41666666666666 20 12 LDHC;WDR87 lactate dehydrogenase C;WD repeat domain 87 1059 135 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18582.[MT7]-EQLIEK[MT7].2b5_1.heavy 524.318 / 757.421 5619.0 24.326600392659504 46 20 10 6 10 3.6349256869046194 21.786205605254313 0.038700103759765625 3 0.9904932559816243 12.647416124450908 5619.0 27.256804677921345 0.0 - - - - - - - 276.2352941176471 11 17 LDHC;WDR87 lactate dehydrogenase C;WD repeat domain 87 1061 136 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533722.[MT7]-VYTLTPFLANNREK[MT7].4y8_2.heavy 489.28 / 568.321 21198.0 35.725101470947266 44 14 10 10 10 5.290124537637193 18.9031466629072 0.0 3 0.9414106687395555 5.073521784316707 21198.0 22.52892638660635 0.0 - - - - - - - 659.0 42 11 ARRB1 arrestin, beta 1 1063 136 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533722.[MT7]-VYTLTPFLANNREK[MT7].4y9_2.heavy 489.28 / 616.847 36909.0 35.725101470947266 44 14 10 10 10 5.290124537637193 18.9031466629072 0.0 3 0.9414106687395555 5.073521784316707 36909.0 82.50343504553952 0.0 - - - - - - - 671.1818181818181 73 11 ARRB1 arrestin, beta 1 1065 136 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533722.[MT7]-VYTLTPFLANNREK[MT7].4y7_2.heavy 489.28 / 494.786 27089.0 35.725101470947266 44 14 10 10 10 5.290124537637193 18.9031466629072 0.0 3 0.9414106687395555 5.073521784316707 27089.0 86.52103306356781 0.0 - - - - - - - 677.2857142857143 54 7 ARRB1 arrestin, beta 1 1067 136 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533722.[MT7]-VYTLTPFLANNREK[MT7].4b3_1.heavy 489.28 / 508.289 16389.0 35.725101470947266 44 14 10 10 10 5.290124537637193 18.9031466629072 0.0 3 0.9414106687395555 5.073521784316707 16389.0 41.728450184501845 0.0 - - - - - - - 357.92857142857144 32 14 ARRB1 arrestin, beta 1 1069 137 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19143.[MT7]-LFLDFLEEFQSSDGEIK[MT7].4y4_1.heavy 577.052 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1071 137 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19143.[MT7]-LFLDFLEEFQSSDGEIK[MT7].4b4_1.heavy 577.052 / 633.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1073 137 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19143.[MT7]-LFLDFLEEFQSSDGEIK[MT7].4b5_1.heavy 577.052 / 780.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1075 137 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19143.[MT7]-LFLDFLEEFQSSDGEIK[MT7].4b3_1.heavy 577.052 / 518.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1077 138 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 484993.0 31.391199111938477 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 484993.0 903.8145195720579 0.0 - - - - - - - 315.0 969 2 1079 138 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 557444.0 31.391199111938477 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 557444.0 1899.3218663947735 0.0 - - - - - - - 315.0 1114 4 1081 138 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1056500.0 31.391199111938477 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1056500.0 910.9850378883644 0.0 - - - - - - - 315.0 2113 1 1083 139 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41503.[MT7]-LSTPGAR.2b3_1.heavy 423.252 / 446.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1085 139 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41503.[MT7]-LSTPGAR.2b6_1.heavy 423.252 / 671.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1087 139 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41503.[MT7]-LSTPGAR.2y6_1.heavy 423.252 / 588.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1089 139 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41503.[MT7]-LSTPGAR.2b5_1.heavy 423.252 / 600.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1091 140 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533661.[MT7]-INLNSEEEALFK[MT7].3b6_1.heavy 565.645 / 815.438 16519.0 38.099300384521484 42 12 10 10 10 1.4996289156535878 52.77267339301767 0.0 3 0.8925356797156787 3.730456501710282 16519.0 47.544656066536206 0.0 - - - - - - - 139.56521739130434 33 23 LDHC lactate dehydrogenase C 1093 140 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533661.[MT7]-INLNSEEEALFK[MT7].3y3_1.heavy 565.645 / 551.367 47981.0 38.099300384521484 42 12 10 10 10 1.4996289156535878 52.77267339301767 0.0 3 0.8925356797156787 3.730456501710282 47981.0 72.69334244850074 0.0 - - - - - - - 600.2857142857143 95 7 LDHC lactate dehydrogenase C 1095 140 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533661.[MT7]-INLNSEEEALFK[MT7].3b4_1.heavy 565.645 / 599.363 21773.0 38.099300384521484 42 12 10 10 10 1.4996289156535878 52.77267339301767 0.0 3 0.8925356797156787 3.730456501710282 21773.0 74.5896263904056 0.0 - - - - - - - 233.45454545454547 43 22 LDHC lactate dehydrogenase C 1097 140 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533661.[MT7]-INLNSEEEALFK[MT7].3b7_1.heavy 565.645 / 944.481 14184.0 38.099300384521484 42 12 10 10 10 1.4996289156535878 52.77267339301767 0.0 3 0.8925356797156787 3.730456501710282 14184.0 169.358864311654 0.0 - - - - - - - 150.07142857142858 28 14 LDHC lactate dehydrogenase C 1099 141 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36888.[MT7]-NVTDEQEGFAEGFVR.2y4_1.heavy 921.443 / 478.277 6272.0 34.14739990234375 41 15 10 6 10 2.0545261109752477 40.95214027306041 0.03900146484375 3 0.9537442980772802 5.715987918437571 6272.0 30.139061349879853 0.0 - - - - - - - 218.5 12 12 JUN jun proto-oncogene 1101 141 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36888.[MT7]-NVTDEQEGFAEGFVR.2y8_1.heavy 921.443 / 882.447 5149.0 34.14739990234375 41 15 10 6 10 2.0545261109752477 40.95214027306041 0.03900146484375 3 0.9537442980772802 5.715987918437571 5149.0 29.182138123314594 0.0 - - - - - - - 193.1875 10 16 JUN jun proto-oncogene 1103 141 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36888.[MT7]-NVTDEQEGFAEGFVR.2y5_1.heavy 921.443 / 607.32 1872.0 34.14739990234375 41 15 10 6 10 2.0545261109752477 40.95214027306041 0.03900146484375 3 0.9537442980772802 5.715987918437571 1872.0 13.00321616838259 1.0 - - - - - - - 187.33333333333334 3 12 JUN jun proto-oncogene 1105 141 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36888.[MT7]-NVTDEQEGFAEGFVR.2y9_1.heavy 921.443 / 1011.49 3370.0 34.14739990234375 41 15 10 6 10 2.0545261109752477 40.95214027306041 0.03900146484375 3 0.9537442980772802 5.715987918437571 3370.0 39.09683126635567 0.0 - - - - - - - 174.0 6 7 JUN jun proto-oncogene 1107 142 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19145.[MT7]-LFLDFLEEFQSSDGEIK[MT7].3y7_1.heavy 769.066 / 879.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1109 142 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19145.[MT7]-LFLDFLEEFQSSDGEIK[MT7].3b4_1.heavy 769.066 / 633.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1111 142 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19145.[MT7]-LFLDFLEEFQSSDGEIK[MT7].3b5_1.heavy 769.066 / 780.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1113 142 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19145.[MT7]-LFLDFLEEFQSSDGEIK[MT7].3y4_1.heavy 769.066 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1115 143 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18487.[MT7]-AEEYLR.2y4_1.heavy 462.749 / 580.309 7551.0 24.260799407958984 45 15 10 10 10 1.6682303668228335 42.131401700688606 0.0 3 0.9595881942048647 6.1183558302036545 7551.0 22.246092625187643 0.0 - - - - - - - 641.0 15 8 ORC6 origin recognition complex, subunit 6 1117 143 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18487.[MT7]-AEEYLR.2b3_1.heavy 462.749 / 474.232 11653.0 24.260799407958984 45 15 10 10 10 1.6682303668228335 42.131401700688606 0.0 3 0.9595881942048647 6.1183558302036545 11653.0 20.167044864043845 0.0 - - - - - - - 337.15384615384613 23 13 ORC6 origin recognition complex, subunit 6 1119 143 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18487.[MT7]-AEEYLR.2y5_1.heavy 462.749 / 709.352 16780.0 24.260799407958984 45 15 10 10 10 1.6682303668228335 42.131401700688606 0.0 3 0.9595881942048647 6.1183558302036545 16780.0 57.00179850076976 0.0 - - - - - - - 250.92307692307693 33 13 ORC6 origin recognition complex, subunit 6 1121 143 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18487.[MT7]-AEEYLR.2b4_1.heavy 462.749 / 637.295 17712.0 24.260799407958984 45 15 10 10 10 1.6682303668228335 42.131401700688606 0.0 3 0.9595881942048647 6.1183558302036545 17712.0 121.45371428571428 0.0 - - - - - - - 253.0 35 14 ORC6 origin recognition complex, subunit 6 1123 144 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36885.[MT7]-AFVDNC[CAM]LQLHEAK[MT7].3y6_1.heavy 611.657 / 869.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 1125 144 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36885.[MT7]-AFVDNC[CAM]LQLHEAK[MT7].3b4_1.heavy 611.657 / 577.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 1127 144 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36885.[MT7]-AFVDNC[CAM]LQLHEAK[MT7].3b5_1.heavy 611.657 / 691.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 1129 144 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36885.[MT7]-AFVDNC[CAM]LQLHEAK[MT7].3y4_1.heavy 611.657 / 628.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 1131 145 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18497.[MT7]-TIIEGTR.2b3_1.heavy 467.278 / 472.325 5294.0 22.54805040359497 40 14 10 6 10 1.7841812585663843 56.04811703960586 0.03700065612792969 3 0.9366317676957605 4.876475900703776 5294.0 22.83480633112528 0.0 - - - - - - - 321.6923076923077 10 13 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1133 145 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18497.[MT7]-TIIEGTR.2y5_1.heavy 467.278 / 575.315 9682.0 22.54805040359497 40 14 10 6 10 1.7841812585663843 56.04811703960586 0.03700065612792969 3 0.9366317676957605 4.876475900703776 9682.0 22.613524509648595 0.0 - - - - - - - 736.5714285714286 19 7 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1135 145 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18497.[MT7]-TIIEGTR.2b4_1.heavy 467.278 / 601.368 8568.0 22.54805040359497 40 14 10 6 10 1.7841812585663843 56.04811703960586 0.03700065612792969 3 0.9366317676957605 4.876475900703776 8568.0 21.193475156422522 0.0 - - - - - - - 226.41666666666666 17 12 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1137 145 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18497.[MT7]-TIIEGTR.2y6_1.heavy 467.278 / 688.399 14559.0 22.54805040359497 40 14 10 6 10 1.7841812585663843 56.04811703960586 0.03700065612792969 3 0.9366317676957605 4.876475900703776 14559.0 64.50320096099492 0.0 - - - - - - - 267.63157894736844 29 19 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1139 146 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19025.[MT7]-EDAFSGTDWMLEK[MT7].3y3_1.heavy 606.294 / 533.341 8841.0 38.2708740234375 43 17 10 6 10 2.749668279780062 29.574552013265595 0.0326995849609375 3 0.9750831949866848 7.8020777850540375 8841.0 15.092136597471756 0.0 - - - - - - - 720.1111111111111 17 9 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1141 146 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19025.[MT7]-EDAFSGTDWMLEK[MT7].3b5_1.heavy 606.294 / 694.316 1650.0 38.2708740234375 43 17 10 6 10 2.749668279780062 29.574552013265595 0.0326995849609375 3 0.9750831949866848 7.8020777850540375 1650.0 9.648305084745761 0.0 - - - - - - - 174.3181818181818 3 22 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1143 146 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19025.[MT7]-EDAFSGTDWMLEK[MT7].3y4_1.heavy 606.294 / 664.382 4126.0 38.2708740234375 43 17 10 6 10 2.749668279780062 29.574552013265595 0.0326995849609375 3 0.9750831949866848 7.8020777850540375 4126.0 25.888549834772412 0.0 - - - - - - - 200.04347826086956 8 23 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1145 146 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19025.[MT7]-EDAFSGTDWMLEK[MT7].3b8_1.heavy 606.294 / 967.412 3713.0 38.2708740234375 43 17 10 6 10 2.749668279780062 29.574552013265595 0.0326995849609375 3 0.9750831949866848 7.8020777850540375 3713.0 13.222173462634167 0.0 - - - - - - - 171.63636363636363 7 22 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1147 147 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 294631.0 26.062700271606445 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 294631.0 935.3994648766858 0.0 - - - - - - - 917.0 589 1 1149 147 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 381605.0 26.062700271606445 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 381605.0 467.34530360873146 0.0 - - - - - - - 1426.0 763 1 1151 147 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 512677.0 26.062700271606445 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 512677.0 2362.507542387903 0.0 - - - - - - - 1426.0 1025 1 1153 148 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42154.[MT7]-TIEYLEEVAITFAK[MT7].3y3_1.heavy 639.027 / 509.32 13730.0 49.29460144042969 39 9 10 10 10 0.603164474171011 89.516527553184 0.0 3 0.8139948378795961 2.8159570431168377 13730.0 344.21690140845067 0.0 - - - - - - - 93.3076923076923 27 13 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1155 148 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42154.[MT7]-TIEYLEEVAITFAK[MT7].3b4_1.heavy 639.027 / 651.347 8433.0 49.29460144042969 39 9 10 10 10 0.603164474171011 89.516527553184 0.0 3 0.8139948378795961 2.8159570431168377 8433.0 286.4844507042253 0.0 - - - - - - - 105.66666666666667 16 9 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1157 148 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42154.[MT7]-TIEYLEEVAITFAK[MT7].3b5_1.heavy 639.027 / 764.431 6818.0 49.29460144042969 39 9 10 10 10 0.603164474171011 89.516527553184 0.0 3 0.8139948378795961 2.8159570431168377 6818.0 359.2253755868544 0.0 - - - - - - - 128.5 13 10 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1159 148 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42154.[MT7]-TIEYLEEVAITFAK[MT7].3y4_1.heavy 639.027 / 610.368 17388.0 49.29460144042969 39 9 10 10 10 0.603164474171011 89.516527553184 0.0 3 0.8139948378795961 2.8159570431168377 17388.0 719.4355339805826 0.0 - - - - - - - 134.66666666666666 34 12 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1161 149 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18899.[MT7]-AFC[CAM]AENLEEK[MT7].3y3_1.heavy 500.253 / 549.3 39566.0 28.31450080871582 43 13 10 10 10 1.1159654260882241 54.08967950499947 0.0 3 0.9060503100218774 3.994426296811713 39566.0 41.88428282085412 0.0 - - - - - - - 678.2 79 10 ARRB1 arrestin, beta 1 1163 149 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18899.[MT7]-AFC[CAM]AENLEEK[MT7].3b4_1.heavy 500.253 / 594.283 26107.0 28.31450080871582 43 13 10 10 10 1.1159654260882241 54.08967950499947 0.0 3 0.9060503100218774 3.994426296811713 26107.0 43.4276784156112 0.0 - - - - - - - 708.3333333333334 52 9 ARRB1 arrestin, beta 1 1165 149 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18899.[MT7]-AFC[CAM]AENLEEK[MT7].3b5_1.heavy 500.253 / 723.325 15988.0 28.31450080871582 43 13 10 10 10 1.1159654260882241 54.08967950499947 0.0 3 0.9060503100218774 3.994426296811713 15988.0 25.909407114624507 0.0 - - - - - - - 261.5 31 12 ARRB1 arrestin, beta 1 1167 149 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18899.[MT7]-AFC[CAM]AENLEEK[MT7].3b3_1.heavy 500.253 / 523.245 17506.0 28.31450080871582 43 13 10 10 10 1.1159654260882241 54.08967950499947 0.0 3 0.9060503100218774 3.994426296811713 17506.0 31.829090909090908 0.0 - - - - - - - 728.6 35 10 ARRB1 arrestin, beta 1 1169 150 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41961.[MT7]-C[CAM]NTDQAGRPK[MT7].3y7_1.heavy 478.917 / 915.513 N/A 13.460899829864502 46 20 10 6 10 19.53057445380108 5.120177096508177 0.03419971466064453 2 0.9960096978754999 19.530571892349663 386.0 11.58 0.0 - - - - - - - 0.0 0 0 MCM5 minichromosome maintenance complex component 5 1171 150 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41961.[MT7]-C[CAM]NTDQAGRPK[MT7].3y8_1.heavy 478.917 / 1016.56 N/A 13.460899829864502 46 20 10 6 10 19.53057445380108 5.120177096508177 0.03419971466064453 2 0.9960096978754999 19.530571892349663 0.0 0.0 3.0 - - - - - - - 0.0 0 0 MCM5 minichromosome maintenance complex component 5 1173 150 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41961.[MT7]-C[CAM]NTDQAGRPK[MT7].3y5_1.heavy 478.917 / 672.427 440.0 13.460899829864502 46 20 10 6 10 19.53057445380108 5.120177096508177 0.03419971466064453 2 0.9960096978754999 19.530571892349663 440.0 7.741509433962264 1.0 - - - - - - - 0.0 0 0 MCM5 minichromosome maintenance complex component 5 1175 150 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41961.[MT7]-C[CAM]NTDQAGRPK[MT7].3b4_1.heavy 478.917 / 635.258 1319.0 13.460899829864502 46 20 10 6 10 19.53057445380108 5.120177096508177 0.03419971466064453 2 0.9960096978754999 19.530571892349663 1319.0 104.25173076923076 0.0 - - - - - - - 47.40625 2 32 MCM5 minichromosome maintenance complex component 5 1177 151 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36424.[MT7]-DLIEEVR.2y4_1.heavy 509.288 / 532.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1179 151 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36424.[MT7]-DLIEEVR.2y5_1.heavy 509.288 / 645.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1181 151 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36424.[MT7]-DLIEEVR.2b4_1.heavy 509.288 / 615.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1183 151 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36424.[MT7]-DLIEEVR.2b5_1.heavy 509.288 / 744.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1185 152 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18698.[MT7]-LVVWEAGK[MT7].2y4_1.heavy 595.363 / 548.316 N/A 34.322898864746094 46 16 10 10 10 2.3882935386560655 41.87090003026669 0.0 3 0.9635301472229093 6.442680014295008 3585.0 7.936810514489093 3.0 - - - - - - - 788.8 12 10 IL3RA interleukin 3 receptor, alpha (low affinity) 1187 152 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18698.[MT7]-LVVWEAGK[MT7].2y5_1.heavy 595.363 / 734.395 6005.0 34.322898864746094 46 16 10 10 10 2.3882935386560655 41.87090003026669 0.0 3 0.9635301472229093 6.442680014295008 6005.0 1.7344186046511627 1.0 - - - - - - - 213.53846153846155 12 13 IL3RA interleukin 3 receptor, alpha (low affinity) 1189 152 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18698.[MT7]-LVVWEAGK[MT7].2y6_1.heavy 595.363 / 833.464 2868.0 34.322898864746094 46 16 10 10 10 2.3882935386560655 41.87090003026669 0.0 3 0.9635301472229093 6.442680014295008 2868.0 3.231598513011152 1.0 - - - - - - - 179.41666666666666 5 12 IL3RA interleukin 3 receptor, alpha (low affinity) 1191 152 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18698.[MT7]-LVVWEAGK[MT7].2y7_1.heavy 595.363 / 932.532 2689.0 34.322898864746094 46 16 10 10 10 2.3882935386560655 41.87090003026669 0.0 3 0.9635301472229093 6.442680014295008 2689.0 7.311035297739786 0.0 - - - - - - - 233.0 5 15 IL3RA interleukin 3 receptor, alpha (low affinity) 1193 153 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19017.[MT7]-LDDIEEFENIRK[MT7].4b4_1.heavy 452.996 / 601.331 72191.0 34.66400146484375 41 11 10 10 10 2.1120720493221556 47.34686964495071 0.0 3 0.8686945860045391 3.3678305299473013 72191.0 46.395244215938305 0.0 - - - - - - - 0.0 144 0 CDC26 cell division cycle 26 homolog (S. cerevisiae) 1195 153 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19017.[MT7]-LDDIEEFENIRK[MT7].4y6_2.heavy 452.996 / 475.781 155650.0 34.66400146484375 41 11 10 10 10 2.1120720493221556 47.34686964495071 0.0 3 0.8686945860045391 3.3678305299473013 155650.0 708.7472943305054 0.0 - - - - - - - 0.0 311 0 CDC26 cell division cycle 26 homolog (S. cerevisiae) 1197 153 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19017.[MT7]-LDDIEEFENIRK[MT7].4y7_2.heavy 452.996 / 540.302 197178.0 34.66400146484375 41 11 10 10 10 2.1120720493221556 47.34686964495071 0.0 3 0.8686945860045391 3.3678305299473013 197178.0 468.7649495173948 0.0 - - - - - - - 0.0 394 0 CDC26 cell division cycle 26 homolog (S. cerevisiae) 1199 153 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19017.[MT7]-LDDIEEFENIRK[MT7].4b3_1.heavy 452.996 / 488.247 308241.0 34.66400146484375 41 11 10 10 10 2.1120720493221556 47.34686964495071 0.0 3 0.8686945860045391 3.3678305299473013 308241.0 229.22592507597838 0.0 - - - - - - - 0.0 616 0 CDC26 cell division cycle 26 homolog (S. cerevisiae) 1201 154 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19018.[MT7]-LDDIEEFENIRK[MT7].3y6_1.heavy 603.659 / 950.554 5204.0 34.69047451019287 34 8 10 6 10 1.735904084587357 38.40457964157279 0.035297393798828125 3 0.7844650544901594 2.6090061951167187 5204.0 93.672 0.0 - - - - - - - 160.0 10 11 CDC26 cell division cycle 26 homolog (S. cerevisiae) 1203 154 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19018.[MT7]-LDDIEEFENIRK[MT7].3b4_1.heavy 603.659 / 601.331 10087.0 34.69047451019287 34 8 10 6 10 1.735904084587357 38.40457964157279 0.035297393798828125 3 0.7844650544901594 2.6090061951167187 10087.0 14.791519361180638 0.0 - - - - - - - 676.8181818181819 20 11 CDC26 cell division cycle 26 homolog (S. cerevisiae) 1205 154 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19018.[MT7]-LDDIEEFENIRK[MT7].3b5_1.heavy 603.659 / 730.374 6805.0 34.69047451019287 34 8 10 6 10 1.735904084587357 38.40457964157279 0.035297393798828125 3 0.7844650544901594 2.6090061951167187 6805.0 21.510936329588013 0.0 - - - - - - - 282.10526315789474 13 19 CDC26 cell division cycle 26 homolog (S. cerevisiae) 1207 154 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19018.[MT7]-LDDIEEFENIRK[MT7].3y8_1.heavy 603.659 / 1208.64 881.0 34.69047451019287 34 8 10 6 10 1.735904084587357 38.40457964157279 0.035297393798828125 3 0.7844650544901594 2.6090061951167187 881.0 22.025 0.0 - - - - - - - 0.0 1 0 CDC26 cell division cycle 26 homolog (S. cerevisiae) 1209 155 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18489.[MT7]-YLLFAR.2y4_1.heavy 463.783 / 506.309 N/A 37.925533294677734 44 20 10 6 8 10.598820815452779 9.43501185096014 0.031402587890625 4 0.9976466837707416 25.435309040639527 15479.0 24.937490341727027 0.0 - - - - - - - 280.5 30 14 MCM6 minichromosome maintenance complex component 6 1211 155 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18489.[MT7]-YLLFAR.2b3_1.heavy 463.783 / 534.341 4339.0 37.925533294677734 44 20 10 6 8 10.598820815452779 9.43501185096014 0.031402587890625 4 0.9976466837707416 25.435309040639527 4339.0 6.516187299302403 0.0 - - - - - - - 718.25 8 8 MCM6 minichromosome maintenance complex component 6 1213 155 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18489.[MT7]-YLLFAR.2y5_1.heavy 463.783 / 619.393 8736.0 37.925533294677734 44 20 10 6 8 10.598820815452779 9.43501185096014 0.031402587890625 4 0.9976466837707416 25.435309040639527 8736.0 41.7356222301462 0.0 - - - - - - - 163.68421052631578 17 19 MCM6 minichromosome maintenance complex component 6 1215 155 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18489.[MT7]-YLLFAR.2b4_1.heavy 463.783 / 681.409 1524.0 37.925533294677734 44 20 10 6 8 10.598820815452779 9.43501185096014 0.031402587890625 4 0.9976466837707416 25.435309040639527 1524.0 6.488791102514506 3.0 - - - - - - - 172.3125 3 16 MCM6 minichromosome maintenance complex component 6 1217 156 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36739.[MT7]-SLC[CAM]AAELVC[CAM]K[MT7].2b3_1.heavy 719.885 / 505.256 2104.0 30.745899200439453 38 18 0 10 10 2.57918813229866 27.978383635053618 0.0 3 0.9810379976534735 8.94811621217156 2104.0 8.668378541289933 0.0 - - - - - - - 233.72222222222223 4 18 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1219 156 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36739.[MT7]-SLC[CAM]AAELVC[CAM]K[MT7].2b4_1.heavy 719.885 / 576.293 N/A 30.745899200439453 38 18 0 10 10 2.57918813229866 27.978383635053618 0.0 3 0.9810379976534735 8.94811621217156 2104.0 6.067702060221869 1.0 - - - - - - - 241.9 57 10 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1221 156 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36739.[MT7]-SLC[CAM]AAELVC[CAM]K[MT7].2b6_1.heavy 719.885 / 776.373 3051.0 30.745899200439453 38 18 0 10 10 2.57918813229866 27.978383635053618 0.0 3 0.9810379976534735 8.94811621217156 3051.0 42.13285714285714 0.0 - - - - - - - 219.72727272727272 6 11 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1223 156 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36739.[MT7]-SLC[CAM]AAELVC[CAM]K[MT7].2b5_1.heavy 719.885 / 647.33 2735.0 30.745899200439453 38 18 0 10 10 2.57918813229866 27.978383635053618 0.0 3 0.9810379976534735 8.94811621217156 2735.0 20.984819168173598 0.0 - - - - - - - 178.7 5 10 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1225 157 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42284.[MT7]-ELHSEFSEVMNEIWASDQIR.3y7_1.heavy 855.412 / 875.437 4300.0 45.58023452758789 47 20 10 7 10 18.425708270759806 5.427199786870195 0.02899932861328125 3 0.999050203335358 40.041714928353414 4300.0 43.47333500879618 0.0 - - - - - - - 168.34615384615384 8 26 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1227 157 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42284.[MT7]-ELHSEFSEVMNEIWASDQIR.3y6_1.heavy 855.412 / 689.358 2112.0 45.58023452758789 47 20 10 7 10 18.425708270759806 5.427199786870195 0.02899932861328125 3 0.999050203335358 40.041714928353414 2112.0 10.805027572719744 0.0 - - - - - - - 177.3793103448276 4 29 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1229 157 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42284.[MT7]-ELHSEFSEVMNEIWASDQIR.3b5_1.heavy 855.412 / 740.37 N/A 45.58023452758789 47 20 10 7 10 18.425708270759806 5.427199786870195 0.02899932861328125 3 0.999050203335358 40.041714928353414 614.0 0.21412137681159416 11.0 - - - - - - - 0.0 1 0 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1231 157 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42284.[MT7]-ELHSEFSEVMNEIWASDQIR.3b8_2.heavy 855.412 / 552.26 2150.0 45.58023452758789 47 20 10 7 10 18.425708270759806 5.427199786870195 0.02899932861328125 3 0.999050203335358 40.041714928353414 2150.0 11.435836001461203 0.0 - - - - - - - 205.96666666666667 4 30 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1233 158 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36341.[MT7]-ELPQER.2y4_1.heavy 458.254 / 529.273 25009.0 19.17729949951172 48 18 10 10 10 3.5921161813347924 27.838743223177445 0.0 3 0.9847887842648669 9.993747050155136 25009.0 56.2168861364722 0.0 - - - - - - - 273.0 50 10 ACADL acyl-CoA dehydrogenase, long chain 1235 158 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36341.[MT7]-ELPQER.2y5_1.heavy 458.254 / 642.357 22002.0 19.17729949951172 48 18 10 10 10 3.5921161813347924 27.838743223177445 0.0 3 0.9847887842648669 9.993747050155136 22002.0 197.60632016632016 0.0 - - - - - - - 264.6666666666667 44 12 ACADL acyl-CoA dehydrogenase, long chain 1237 158 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36341.[MT7]-ELPQER.2b4_1.heavy 458.254 / 612.347 4400.0 19.17729949951172 48 18 10 10 10 3.5921161813347924 27.838743223177445 0.0 3 0.9847887842648669 9.993747050155136 4400.0 43.840498375446415 0.0 - - - - - - - 196.86666666666667 8 15 ACADL acyl-CoA dehydrogenase, long chain 1239 158 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36341.[MT7]-ELPQER.2b5_1.heavy 458.254 / 741.39 6238.0 19.17729949951172 48 18 10 10 10 3.5921161813347924 27.838743223177445 0.0 3 0.9847887842648669 9.993747050155136 6238.0 40.980582959641254 0.0 - - - - - - - 167.1875 12 16 ACADL acyl-CoA dehydrogenase, long chain 1241 159 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533700.[MT7]-ELRDEEQTAESIK[MT7].4b7_2.heavy 459.745 / 522.758 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1243 159 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533700.[MT7]-ELRDEEQTAESIK[MT7].4b12_2.heavy 459.745 / 773.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1245 159 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533700.[MT7]-ELRDEEQTAESIK[MT7].4y3_1.heavy 459.745 / 491.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1247 159 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533700.[MT7]-ELRDEEQTAESIK[MT7].4b3_1.heavy 459.745 / 543.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1249 160 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 123863.0 35.89609909057617 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 123863.0 84.94114241611017 0.0 - - - - - - - 675.1428571428571 247 7 1251 160 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 332481.0 35.89609909057617 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 332481.0 103.15157921682984 0.0 - - - - - - - 276.1333333333333 664 15 1253 160 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 323870.0 35.89609909057617 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 323870.0 159.6260722047757 0.0 - - - - - - - 684.4285714285714 647 7 1255 161 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533701.[MT7]-SFEC[CAM]LLGLNSNIGIR.3b4_1.heavy 612.997 / 668.283 13611.0 42.9838981628418 45 15 10 10 10 2.647259708941294 30.117022481276194 0.0 3 0.9543303788518075 5.752833581846224 13611.0 90.18947125932425 0.0 - - - - - - - 195.2 27 15 ORC6 origin recognition complex, subunit 6 1257 161 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533701.[MT7]-SFEC[CAM]LLGLNSNIGIR.3b5_1.heavy 612.997 / 781.367 8787.0 42.9838981628418 45 15 10 10 10 2.647259708941294 30.117022481276194 0.0 3 0.9543303788518075 5.752833581846224 8787.0 50.375936346143845 0.0 - - - - - - - 207.27777777777777 17 18 ORC6 origin recognition complex, subunit 6 1259 161 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533701.[MT7]-SFEC[CAM]LLGLNSNIGIR.3b3_1.heavy 612.997 / 508.252 4307.0 42.9838981628418 45 15 10 10 10 2.647259708941294 30.117022481276194 0.0 3 0.9543303788518075 5.752833581846224 4307.0 13.616764852674343 0.0 - - - - - - - 279.53333333333336 8 15 ORC6 origin recognition complex, subunit 6 1261 161 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533701.[MT7]-SFEC[CAM]LLGLNSNIGIR.3y9_1.heavy 612.997 / 943.532 8213.0 42.9838981628418 45 15 10 10 10 2.647259708941294 30.117022481276194 0.0 3 0.9543303788518075 5.752833581846224 8213.0 151.76522911757004 0.0 - - - - - - - 195.2 16 15 ORC6 origin recognition complex, subunit 6 1263 162 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18889.[MT7]-SAETLWNIQK[MT7].2y8_1.heavy 739.416 / 1175.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 1265 162 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18889.[MT7]-SAETLWNIQK[MT7].2b4_1.heavy 739.416 / 533.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 1267 162 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18889.[MT7]-SAETLWNIQK[MT7].2y6_1.heavy 739.416 / 945.564 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 1269 162 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18889.[MT7]-SAETLWNIQK[MT7].2b7_1.heavy 739.416 / 946.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHC lactate dehydrogenase C 1271 163 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533703.[MT7]-NVTDEQEGFAEGFVR.3y6_1.heavy 614.631 / 678.357 82613.0 34.127899169921875 48 18 10 10 10 3.0933986378398175 25.71525691814032 0.0 3 0.985307730514005 10.169152446251555 82613.0 157.13206375553284 0.0 - - - - - - - 712.0 165 9 JUN jun proto-oncogene 1273 163 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533703.[MT7]-NVTDEQEGFAEGFVR.3b5_1.heavy 614.631 / 703.338 44957.0 34.127899169921875 48 18 10 10 10 3.0933986378398175 25.71525691814032 0.0 3 0.985307730514005 10.169152446251555 44957.0 130.4931647940075 0.0 - - - - - - - 289.25 89 12 JUN jun proto-oncogene 1275 163 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533703.[MT7]-NVTDEQEGFAEGFVR.3y8_1.heavy 614.631 / 882.447 48874.0 34.127899169921875 48 18 10 10 10 3.0933986378398175 25.71525691814032 0.0 3 0.985307730514005 10.169152446251555 48874.0 147.27099080694586 0.0 - - - - - - - 237.33333333333334 97 12 JUN jun proto-oncogene 1277 163 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533703.[MT7]-NVTDEQEGFAEGFVR.3y5_1.heavy 614.631 / 607.32 58043.0 34.127899169921875 48 18 10 10 10 3.0933986378398175 25.71525691814032 0.0 3 0.985307730514005 10.169152446251555 58043.0 98.08928585325532 0.0 - - - - - - - 682.3333333333334 116 9 JUN jun proto-oncogene 1279 164 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19030.[MT7]-SFEC[CAM]LLGLNSNIGIR.2b3_1.heavy 918.992 / 508.252 795.0 43.00872325897217 46 20 10 6 10 14.711539887841498 6.7973849618996045 0.033100128173828125 3 0.997436039063595 24.367660271588136 795.0 9.882355668907952 0.0 - - - - - - - 0.0 1 0 ORC6 origin recognition complex, subunit 6 1281 164 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19030.[MT7]-SFEC[CAM]LLGLNSNIGIR.2y10_1.heavy 918.992 / 1056.62 852.0 43.00872325897217 46 20 10 6 10 14.711539887841498 6.7973849618996045 0.033100128173828125 3 0.997436039063595 24.367660271588136 852.0 19.730526315789476 0.0 - - - - - - - 0.0 1 0 ORC6 origin recognition complex, subunit 6 1283 164 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19030.[MT7]-SFEC[CAM]LLGLNSNIGIR.2y9_1.heavy 918.992 / 943.532 1421.0 43.00872325897217 46 20 10 6 10 14.711539887841498 6.7973849618996045 0.033100128173828125 3 0.997436039063595 24.367660271588136 1421.0 8.802446414182112 0.0 - - - - - - - 170.52631578947367 2 19 ORC6 origin recognition complex, subunit 6 1285 164 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19030.[MT7]-SFEC[CAM]LLGLNSNIGIR.2b4_1.heavy 918.992 / 668.283 682.0 43.00872325897217 46 20 10 6 10 14.711539887841498 6.7973849618996045 0.033100128173828125 3 0.997436039063595 24.367660271588136 682.0 -0.5 1.0 - - - - - - - 0.0 1 0 ORC6 origin recognition complex, subunit 6 1287 165 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18894.[MT7]-GFYIYQEGVK[MT7].2y4_1.heavy 746.408 / 576.347 1143.0 33.51892566680908 42 17 10 5 10 2.950878613685257 29.8952027459311 0.041103363037109375 3 0.9716215971076074 7.308629733542177 1143.0 5.597202797202797 2.0 - - - - - - - 254.0 2 18 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1289 165 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18894.[MT7]-GFYIYQEGVK[MT7].2b3_1.heavy 746.408 / 512.263 2477.0 33.51892566680908 42 17 10 5 10 2.950878613685257 29.8952027459311 0.041103363037109375 3 0.9716215971076074 7.308629733542177 2477.0 5.052427147770652 0.0 - - - - - - - 262.0 4 12 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1291 165 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18894.[MT7]-GFYIYQEGVK[MT7].2b4_1.heavy 746.408 / 625.347 1906.0 33.51892566680908 42 17 10 5 10 2.950878613685257 29.8952027459311 0.041103363037109375 3 0.9716215971076074 7.308629733542177 1906.0 8.417245782703054 0.0 - - - - - - - 238.14285714285714 3 14 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1293 165 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18894.[MT7]-GFYIYQEGVK[MT7].2y6_1.heavy 746.408 / 867.469 1524.0 33.51892566680908 42 17 10 5 10 2.950878613685257 29.8952027459311 0.041103363037109375 3 0.9716215971076074 7.308629733542177 1524.0 2.3044755244755244 1.0 - - - - - - - 201.22222222222223 3 9 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1295 166 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36339.[MT7]-DSGHAGAR.2y5_1.heavy 457.732 / 511.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1297 166 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36339.[MT7]-DSGHAGAR.2b4_1.heavy 457.732 / 541.249 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1299 166 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36339.[MT7]-DSGHAGAR.2b7_1.heavy 457.732 / 740.344 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1301 166 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36339.[MT7]-DSGHAGAR.2y7_1.heavy 457.732 / 655.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1303 167 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533201.[MT7]-DLLSK[MT7].2b3_1.heavy 432.276 / 486.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIF3C;MAPK8;MAPK9;MAPK10;BLM;CAPRIN2;TTN;KIF3B kinesin family member 3C;mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10;Bloom syndrome, RecQ helicase-like;caprin family member 2;titin;kinesin family member 3B 1305 167 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533201.[MT7]-DLLSK[MT7].2y4_1.heavy 432.276 / 604.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIF3C;MAPK8;MAPK9;MAPK10;BLM;CAPRIN2;TTN;KIF3B kinesin family member 3C;mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10;Bloom syndrome, RecQ helicase-like;caprin family member 2;titin;kinesin family member 3B 1307 167 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533201.[MT7]-DLLSK[MT7].2y3_2.heavy 432.276 / 246.169 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIF3C;MAPK8;MAPK9;MAPK10;BLM;CAPRIN2;TTN;KIF3B kinesin family member 3C;mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10;Bloom syndrome, RecQ helicase-like;caprin family member 2;titin;kinesin family member 3B 1309 167 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533201.[MT7]-DLLSK[MT7].2y3_1.heavy 432.276 / 491.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIF3C;MAPK8;MAPK9;MAPK10;BLM;CAPRIN2;TTN;KIF3B kinesin family member 3C;mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10;Bloom syndrome, RecQ helicase-like;caprin family member 2;titin;kinesin family member 3B 1311 168 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36430.[MT7]-LGTDSDK[MT7].2b3_1.heavy 512.282 / 416.263 1060.0 18.719074726104736 41 15 10 6 10 1.7237285915454865 45.77308787031873 0.03890037536621094 3 0.9597229441843553 6.128651853167269 1060.0 3.2222222222222223 2.0 - - - - - - - 240.05882352941177 2 17 LDHC lactate dehydrogenase C 1313 168 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36430.[MT7]-LGTDSDK[MT7].2y4_1.heavy 512.282 / 608.301 1060.0 18.719074726104736 41 15 10 6 10 1.7237285915454865 45.77308787031873 0.03890037536621094 3 0.9597229441843553 6.128651853167269 1060.0 7.0249999999999995 0.0 - - - - - - - 170.1578947368421 2 19 LDHC lactate dehydrogenase C 1315 168 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36430.[MT7]-LGTDSDK[MT7].2b6_1.heavy 512.282 / 733.349 1644.0 18.719074726104736 41 15 10 6 10 1.7237285915454865 45.77308787031873 0.03890037536621094 3 0.9597229441843553 6.128651853167269 1644.0 9.30566037735849 1.0 - - - - - - - 180.8235294117647 3 17 LDHC lactate dehydrogenase C 1317 168 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36430.[MT7]-LGTDSDK[MT7].2y6_1.heavy 512.282 / 766.37 3606.0 18.719074726104736 41 15 10 6 10 1.7237285915454865 45.77308787031873 0.03890037536621094 3 0.9597229441843553 6.128651853167269 3606.0 37.42075471698113 0.0 - - - - - - - 155.21428571428572 7 14 LDHC lactate dehydrogenase C 1319 169 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18687.[MT7]-ERADSLAK[MT7].2y4_1.heavy 589.343 / 562.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1321 169 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18687.[MT7]-ERADSLAK[MT7].2b4_1.heavy 589.343 / 616.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1323 169 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18687.[MT7]-ERADSLAK[MT7].2y6_1.heavy 589.343 / 748.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1325 169 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18687.[MT7]-ERADSLAK[MT7].2b7_1.heavy 589.343 / 887.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1327 170 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533458.[MT7]-THINYGVK[MT7].3y3_1.heavy 407.239 / 447.305 33590.0 20.944275379180908 46 20 10 6 10 61.60564709515051 1.6232278162024505 0.031099319458007812 3 0.9983971558170845 30.821849191043526 33590.0 109.98365012830888 0.0 - - - - - - - 239.28571428571428 67 21 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1329 170 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533458.[MT7]-THINYGVK[MT7].3b3_2.heavy 407.239 / 248.654 3616.0 20.944275379180908 46 20 10 6 10 61.60564709515051 1.6232278162024505 0.031099319458007812 3 0.9983971558170845 30.821849191043526 3616.0 24.154899293050555 0.0 - - - - - - - 240.2 7 25 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1331 170 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533458.[MT7]-THINYGVK[MT7].3b3_1.heavy 407.239 / 496.3 6130.0 20.944275379180908 46 20 10 6 10 61.60564709515051 1.6232278162024505 0.031099319458007812 3 0.9983971558170845 30.821849191043526 6130.0 26.350297249334517 0.0 - - - - - - - 656.8571428571429 12 7 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1333 170 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533458.[MT7]-THINYGVK[MT7].3y5_1.heavy 407.239 / 724.411 4046.0 20.944275379180908 46 20 10 6 10 61.60564709515051 1.6232278162024505 0.031099319458007812 3 0.9983971558170845 30.821849191043526 4046.0 49.34146341463414 0.0 - - - - - - - 117.41666666666667 8 12 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1335 171 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19028.[MT7]-LQPFATEADVEEALR.3y7_1.heavy 611.655 / 831.421 22444.0 39.89690017700195 47 17 10 10 10 4.163124996608539 24.020417374319607 0.0 3 0.9733565821637096 7.543943021173832 22444.0 85.76162601626017 0.0 - - - - - - - 245.75 44 16 MCM5 minichromosome maintenance complex component 5 1337 171 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19028.[MT7]-LQPFATEADVEEALR.3y6_1.heavy 611.655 / 716.394 16356.0 39.89690017700195 47 17 10 10 10 4.163124996608539 24.020417374319607 0.0 3 0.9733565821637096 7.543943021173832 16356.0 74.5198438794981 0.0 - - - - - - - 204.73333333333332 32 15 MCM5 minichromosome maintenance complex component 5 1339 171 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19028.[MT7]-LQPFATEADVEEALR.3b4_1.heavy 611.655 / 630.373 14512.0 39.89690017700195 47 17 10 10 10 4.163124996608539 24.020417374319607 0.0 3 0.9733565821637096 7.543943021173832 14512.0 51.80403593113689 0.0 - - - - - - - 271.3333333333333 29 12 MCM5 minichromosome maintenance complex component 5 1341 171 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19028.[MT7]-LQPFATEADVEEALR.3y5_1.heavy 611.655 / 617.325 42981.0 39.89690017700195 47 17 10 10 10 4.163124996608539 24.020417374319607 0.0 3 0.9733565821637096 7.543943021173832 42981.0 268.4054812773039 0.0 - - - - - - - 245.75 85 12 MCM5 minichromosome maintenance complex component 5 1343 172 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19029.[MT7]-LQPFATEADVEEALR.2y8_1.heavy 916.979 / 902.458 1354.0 39.923298835754395 38 12 10 6 10 1.2163042060642746 53.10023838496656 0.035198211669921875 3 0.8901511478874387 3.688981416414004 1354.0 4.7122969837587005 1.0 - - - - - - - 272.1578947368421 2 19 MCM5 minichromosome maintenance complex component 5 1345 172 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19029.[MT7]-LQPFATEADVEEALR.2y6_1.heavy 916.979 / 716.394 1846.0 39.923298835754395 38 12 10 6 10 1.2163042060642746 53.10023838496656 0.035198211669921875 3 0.8901511478874387 3.688981416414004 1846.0 18.134417595684077 0.0 - - - - - - - 141.41176470588235 3 17 MCM5 minichromosome maintenance complex component 5 1347 172 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19029.[MT7]-LQPFATEADVEEALR.2y10_1.heavy 916.979 / 1132.55 2647.0 39.923298835754395 38 12 10 6 10 1.2163042060642746 53.10023838496656 0.035198211669921875 3 0.8901511478874387 3.688981416414004 2647.0 18.50747967479675 0.0 - - - - - - - 143.86666666666667 5 15 MCM5 minichromosome maintenance complex component 5 1349 172 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19029.[MT7]-LQPFATEADVEEALR.2y11_1.heavy 916.979 / 1203.59 1293.0 39.923298835754395 38 12 10 6 10 1.2163042060642746 53.10023838496656 0.035198211669921875 3 0.8901511478874387 3.688981416414004 1293.0 7.971463854098 0.0 - - - - - - - 189.91666666666666 2 12 MCM5 minichromosome maintenance complex component 5 1351 173 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533557.[MT7]-DTSASAVAVGLK[MT7].3b6_1.heavy 469.608 / 677.322 37453.0 27.59025001525879 43 17 10 6 10 2.6506816715474284 29.63028033671954 0.035400390625 3 0.9794769673890956 8.599952217636543 37453.0 42.0040706430883 0.0 - - - - - - - 315.0 74 10 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1353 173 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533557.[MT7]-DTSASAVAVGLK[MT7].3b4_1.heavy 469.608 / 519.253 10281.0 27.59025001525879 43 17 10 6 10 2.6506816715474284 29.63028033671954 0.035400390625 3 0.9794769673890956 8.599952217636543 10281.0 17.77930287715802 0.0 - - - - - - - 629.25 20 8 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1355 173 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533557.[MT7]-DTSASAVAVGLK[MT7].3b5_1.heavy 469.608 / 606.285 15107.0 27.59025001525879 43 17 10 6 10 2.6506816715474284 29.63028033671954 0.035400390625 3 0.9794769673890956 8.599952217636543 15107.0 23.943636415909634 0.0 - - - - - - - 256.6666666666667 30 9 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1357 173 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533557.[MT7]-DTSASAVAVGLK[MT7].3y4_1.heavy 469.608 / 560.389 24549.0 27.59025001525879 43 17 10 6 10 2.6506816715474284 29.63028033671954 0.035400390625 3 0.9794769673890956 8.599952217636543 24549.0 28.861582535203162 0.0 - - - - - - - 664.3333333333334 49 9 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1359 174 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533345.[MT7]-EVLTC[CAM]K[MT7].2y4_1.heavy 519.299 / 665.377 2970.0 21.68589973449707 46 18 10 10 8 3.997851576776016 25.013434861091795 0.0 4 0.9811944487156616 8.98537859849314 2970.0 19.362540798393173 1.0 - - - - - - - 207.57142857142858 8 14 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1361 174 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533345.[MT7]-EVLTC[CAM]K[MT7].2y5_1.heavy 519.299 / 764.446 3539.0 21.68589973449707 46 18 10 10 8 3.997851576776016 25.013434861091795 0.0 4 0.9811944487156616 8.98537859849314 3539.0 60.27134732169033 0.0 - - - - - - - 208.45 7 20 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1363 174 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533345.[MT7]-EVLTC[CAM]K[MT7].2b4_1.heavy 519.299 / 587.352 569.0 21.68589973449707 46 18 10 10 8 3.997851576776016 25.013434861091795 0.0 4 0.9811944487156616 8.98537859849314 569.0 1.1138794951178852 17.0 - - - - - - - 245.34615384615384 2 26 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1365 174 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533345.[MT7]-EVLTC[CAM]K[MT7].2y3_1.heavy 519.299 / 552.293 6762.0 21.68589973449707 46 18 10 10 8 3.997851576776016 25.013434861091795 0.0 4 0.9811944487156616 8.98537859849314 6762.0 20.240039521163872 0.0 - - - - - - - 225.61904761904762 13 21 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1367 175 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533344.[MT7]-GQVGGTFAR.2y8_1.heavy 518.786 / 835.442 4190.0 21.57550048828125 48 20 10 10 8 3.726855679163236 26.832270581095397 0.0 4 0.9914128918916643 13.308454871717897 4190.0 10.36050581395349 0.0 - - - - - - - 193.5 8 22 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1369 175 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533344.[MT7]-GQVGGTFAR.2y6_1.heavy 518.786 / 608.315 9130.0 21.57550048828125 48 20 10 10 8 3.726855679163236 26.832270581095397 0.0 4 0.9914128918916643 13.308454871717897 9130.0 36.507026642984016 0.0 - - - - - - - 261.6363636363636 18 22 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1371 175 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533344.[MT7]-GQVGGTFAR.2b5_1.heavy 518.786 / 543.301 1251.0 21.57550048828125 48 20 10 10 8 3.726855679163236 26.832270581095397 0.0 4 0.9914128918916643 13.308454871717897 1251.0 -0.9733526774407122 2.0 - - - - - - - 199.0909090909091 2 22 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1373 175 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533344.[MT7]-GQVGGTFAR.2y7_1.heavy 518.786 / 707.383 N/A 21.57550048828125 48 20 10 10 8 3.726855679163236 26.832270581095397 0.0 4 0.9914128918916643 13.308454871717897 5128.0 17.500803411513857 1.0 - - - - - - - 234.65 18 20 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1375 176 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19048.[MT7]-DLADELALVDVALDK[MT7].3y3_1.heavy 630.022 / 519.326 69056.0 47.198424339294434 38 11 10 7 10 0.9199009713849547 67.169508851688 0.027896881103515625 3 0.8611598087051613 3.2730070790527783 69056.0 417.1437376465351 0.0 - - - - - - - 205.14285714285714 138 21 LDHC lactate dehydrogenase C 1377 176 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19048.[MT7]-DLADELALVDVALDK[MT7].3b4_1.heavy 630.022 / 559.284 25732.0 47.198424339294434 38 11 10 7 10 0.9199009713849547 67.169508851688 0.027896881103515625 3 0.8611598087051613 3.2730070790527783 25732.0 148.95931639277856 0.0 - - - - - - - 151.52 51 25 LDHC lactate dehydrogenase C 1379 176 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19048.[MT7]-DLADELALVDVALDK[MT7].3b5_1.heavy 630.022 / 688.327 60053.0 47.198424339294434 38 11 10 7 10 0.9199009713849547 67.169508851688 0.027896881103515625 3 0.8611598087051613 3.2730070790527783 60053.0 318.4577741935484 0.0 - - - - - - - 271.8888888888889 120 18 LDHC lactate dehydrogenase C 1381 176 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19048.[MT7]-DLADELALVDVALDK[MT7].3b7_1.heavy 630.022 / 872.448 81405.0 47.198424339294434 38 11 10 7 10 0.9199009713849547 67.169508851688 0.027896881103515625 3 0.8611598087051613 3.2730070790527783 81405.0 406.6972826086957 0.0 - - - - - - - 180.0909090909091 162 22 LDHC lactate dehydrogenase C 1383 177 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41561.[MT7]-LSGLNK[MT7].2y4_1.heavy 460.294 / 575.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - ORC6 origin recognition complex, subunit 6 1385 177 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41561.[MT7]-LSGLNK[MT7].2y5_1.heavy 460.294 / 662.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - ORC6 origin recognition complex, subunit 6 1387 177 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41561.[MT7]-LSGLNK[MT7].2b4_1.heavy 460.294 / 515.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - ORC6 origin recognition complex, subunit 6 1389 177 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41561.[MT7]-LSGLNK[MT7].2y3_1.heavy 460.294 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - ORC6 origin recognition complex, subunit 6 1391 178 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533588.[MT7]-QVTPQPEEQK[MT7].3y3_1.heavy 491.271 / 548.316 17286.0 18.262149810791016 44 18 10 6 10 4.607705523915362 21.70277581346513 0.0364990234375 3 0.9820422248618861 9.195684053172062 17286.0 67.99479224376731 0.0 - - - - - - - 258.0 34 16 IL2RA interleukin 2 receptor, alpha 1393 178 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533588.[MT7]-QVTPQPEEQK[MT7].3b5_1.heavy 491.271 / 698.395 14190.0 18.262149810791016 44 18 10 6 10 4.607705523915362 21.70277581346513 0.0364990234375 3 0.9820422248618861 9.195684053172062 14190.0 98.56 0.0 - - - - - - - 175.6 28 15 IL2RA interleukin 2 receptor, alpha 1395 178 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533588.[MT7]-QVTPQPEEQK[MT7].3y4_1.heavy 491.271 / 677.359 8772.0 18.262149810791016 44 18 10 6 10 4.607705523915362 21.70277581346513 0.0364990234375 3 0.9820422248618861 9.195684053172062 8772.0 57.888641583519345 0.0 - - - - - - - 160.55555555555554 17 18 IL2RA interleukin 2 receptor, alpha 1397 178 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533588.[MT7]-QVTPQPEEQK[MT7].3y5_1.heavy 491.271 / 774.411 22447.0 18.262149810791016 44 18 10 6 10 4.607705523915362 21.70277581346513 0.0364990234375 3 0.9820422248618861 9.195684053172062 22447.0 226.0424878346929 0.0 - - - - - - - 175.5 44 10 IL2RA interleukin 2 receptor, alpha 1399 179 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19043.[MT7]-LAYAENIALLAETALR.3y6_1.heavy 626.027 / 660.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R4 phosphoinositide-3-kinase, regulatory subunit 4 1401 179 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19043.[MT7]-LAYAENIALLAETALR.3b6_1.heavy 626.027 / 806.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R4 phosphoinositide-3-kinase, regulatory subunit 4 1403 179 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19043.[MT7]-LAYAENIALLAETALR.3b4_1.heavy 626.027 / 563.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R4 phosphoinositide-3-kinase, regulatory subunit 4 1405 179 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19043.[MT7]-LAYAENIALLAETALR.3y8_1.heavy 626.027 / 886.536 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R4 phosphoinositide-3-kinase, regulatory subunit 4 1407 180 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19040.[MT7]-QPAEHLQLLEEAAK[MT7].3y6_1.heavy 622.351 / 804.458 3659.0 31.513700485229492 41 11 10 10 10 3.482517925924694 28.71485578166767 0.0 3 0.8616705340570451 3.279190721601683 3659.0 11.688634945611902 0.0 - - - - - - - 252.83333333333334 7 12 MCM5 minichromosome maintenance complex component 5 1409 180 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19040.[MT7]-QPAEHLQLLEEAAK[MT7].3b4_1.heavy 622.351 / 570.3 1987.0 31.513700485229492 41 11 10 10 10 3.482517925924694 28.71485578166767 0.0 3 0.8616705340570451 3.279190721601683 1987.0 2.465129411218155 1.0 - - - - - - - 705.625 5 8 MCM5 minichromosome maintenance complex component 5 1411 180 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19040.[MT7]-QPAEHLQLLEEAAK[MT7].3b5_1.heavy 622.351 / 707.359 2928.0 31.513700485229492 41 11 10 10 10 3.482517925924694 28.71485578166767 0.0 3 0.8616705340570451 3.279190721601683 2928.0 15.354488038277513 0.0 - - - - - - - 228.27272727272728 5 11 MCM5 minichromosome maintenance complex component 5 1413 180 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19040.[MT7]-QPAEHLQLLEEAAK[MT7].3y5_1.heavy 622.351 / 691.374 5228.0 31.513700485229492 41 11 10 10 10 3.482517925924694 28.71485578166767 0.0 3 0.8616705340570451 3.279190721601683 5228.0 23.238919127581546 0.0 - - - - - - - 275.72727272727275 10 11 MCM5 minichromosome maintenance complex component 5 1415 181 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533218.[MT7]-FIAIK[MT7].2b3_1.heavy 440.299 / 476.299 8386.0 31.844100952148438 41 11 10 10 10 1.4211520048587463 54.88859013345316 0.0 3 0.8552489087001038 3.2038183393382482 8386.0 20.03012165685839 0.0 - - - - - - - 230.6 16 5 C1orf101;CCNB2 chromosome 1 open reading frame 101;cyclin B2 1417 181 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533218.[MT7]-FIAIK[MT7].2y4_1.heavy 440.299 / 588.42 17820.0 31.844100952148438 41 11 10 10 10 1.4211520048587463 54.88859013345316 0.0 3 0.8552489087001038 3.2038183393382482 17820.0 30.00084327052987 0.0 - - - - - - - 301.25 35 8 C1orf101;CCNB2 chromosome 1 open reading frame 101;cyclin B2 1419 181 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533218.[MT7]-FIAIK[MT7].2y3_1.heavy 440.299 / 475.336 11321.0 31.844100952148438 41 11 10 10 10 1.4211520048587463 54.88859013345316 0.0 3 0.8552489087001038 3.2038183393382482 11321.0 25.008496244812463 0.0 - - - - - - - 602.75 22 8 C1orf101;CCNB2 chromosome 1 open reading frame 101;cyclin B2 1421 182 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42176.[MT7]-TSFQLLNPGTYTVQIR.2y9_1.heavy 991.545 / 1034.56 1761.0 41.063775062561035 35 13 10 6 6 1.9843132999818847 39.38568675513858 0.034099578857421875 5 0.9290367299685527 4.605144178388953 1761.0 5.047452229299363 0.0 - - - - - - - 180.8125 3 16 IL3RA interleukin 3 receptor, alpha (low affinity) 1423 182 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42176.[MT7]-TSFQLLNPGTYTVQIR.2b4_1.heavy 991.545 / 608.316 881.0 41.063775062561035 35 13 10 6 6 1.9843132999818847 39.38568675513858 0.034099578857421875 5 0.9290367299685527 4.605144178388953 881.0 5.792857142857143 3.0 - - - - - - - 0.0 1 0 IL3RA interleukin 3 receptor, alpha (low affinity) 1425 182 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42176.[MT7]-TSFQLLNPGTYTVQIR.2y10_1.heavy 991.545 / 1148.61 503.0 41.063775062561035 35 13 10 6 6 1.9843132999818847 39.38568675513858 0.034099578857421875 5 0.9290367299685527 4.605144178388953 503.0 6.387301587301588 1.0 - - - - - - - 0.0 1 0 IL3RA interleukin 3 receptor, alpha (low affinity) 1427 182 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42176.[MT7]-TSFQLLNPGTYTVQIR.2b5_1.heavy 991.545 / 721.4 566.0 41.063775062561035 35 13 10 6 6 1.9843132999818847 39.38568675513858 0.034099578857421875 5 0.9290367299685527 4.605144178388953 566.0 3.0952380952380953 4.0 - - - - - - - 0.0 1 0 IL3RA interleukin 3 receptor, alpha (low affinity) 1429 183 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533581.[MT7]-VLGIQVDTDGSGR.2y12_1.heavy 730.895 / 1217.61 4638.0 31.215700149536133 42 16 10 6 10 1.8408374627718993 43.267862920294256 0.038600921630859375 3 0.9624088069273884 6.345259236804331 4638.0 13.569504003922209 0.0 - - - - - - - 220.27272727272728 9 11 MCM5 minichromosome maintenance complex component 5 1431 183 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533581.[MT7]-VLGIQVDTDGSGR.2y9_1.heavy 730.895 / 934.422 4322.0 31.215700149536133 42 16 10 6 10 1.8408374627718993 43.267862920294256 0.038600921630859375 3 0.9624088069273884 6.345259236804331 4322.0 26.287607594936706 0.0 - - - - - - - 201.83333333333334 8 12 MCM5 minichromosome maintenance complex component 5 1433 183 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533581.[MT7]-VLGIQVDTDGSGR.2y6_1.heavy 730.895 / 592.268 3479.0 31.215700149536133 42 16 10 6 10 1.8408374627718993 43.267862920294256 0.038600921630859375 3 0.9624088069273884 6.345259236804331 3479.0 4.875732349841939 0.0 - - - - - - - 245.91666666666666 6 12 MCM5 minichromosome maintenance complex component 5 1435 183 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533581.[MT7]-VLGIQVDTDGSGR.2y11_1.heavy 730.895 / 1104.53 3373.0 31.215700149536133 42 16 10 6 10 1.8408374627718993 43.267862920294256 0.038600921630859375 3 0.9624088069273884 6.345259236804331 3373.0 41.9419029535865 0.0 - - - - - - - 175.33333333333334 6 9 MCM5 minichromosome maintenance complex component 5 1437 184 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41947.[MT7]-EILGIIVSYK[MT7].2y4_1.heavy 711.944 / 640.379 1844.0 42.052000999450684 42 16 10 6 10 1.7457548751987526 38.604327986833894 0.039600372314453125 3 0.9602758034778589 6.171440637829684 1844.0 7.463443678509204 0.0 - - - - - - - 215.0 3 16 ARRB1 arrestin, beta 1 1439 184 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41947.[MT7]-EILGIIVSYK[MT7].2b4_1.heavy 711.944 / 557.341 1598.0 42.052000999450684 42 16 10 6 10 1.7457548751987526 38.604327986833894 0.039600372314453125 3 0.9602758034778589 6.171440637829684 1598.0 5.983031169725377 0.0 - - - - - - - 224.11764705882354 3 17 ARRB1 arrestin, beta 1 1441 184 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41947.[MT7]-EILGIIVSYK[MT7].2y3_1.heavy 711.944 / 541.31 1414.0 42.052000999450684 42 16 10 6 10 1.7457548751987526 38.604327986833894 0.039600372314453125 3 0.9602758034778589 6.171440637829684 1414.0 2.696157591191671 0.0 - - - - - - - 265.2105263157895 2 19 ARRB1 arrestin, beta 1 1443 184 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41947.[MT7]-EILGIIVSYK[MT7].2y7_1.heavy 711.944 / 923.568 861.0 42.052000999450684 42 16 10 6 10 1.7457548751987526 38.604327986833894 0.039600372314453125 3 0.9602758034778589 6.171440637829684 861.0 4.53099891422367 0.0 - - - - - - - 0.0 1 0 ARRB1 arrestin, beta 1 1445 185 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42175.[MT7]-VFAIQDPTLPLTSYK[MT7].3y6_1.heavy 661.046 / 852.495 1433.0 42.06192588806152 22 3 10 3 6 0.5451597328884886 102.73330688616679 0.0792999267578125 5 0.5626202578640581 1.793310249169622 1433.0 -1.2783229259589652 2.0 - - - - - - - 169.0952380952381 8 21 PIK3R4 phosphoinositide-3-kinase, regulatory subunit 4 1447 185 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42175.[MT7]-VFAIQDPTLPLTSYK[MT7].3b6_1.heavy 661.046 / 818.453 997.0 42.06192588806152 22 3 10 3 6 0.5451597328884886 102.73330688616679 0.0792999267578125 5 0.5626202578640581 1.793310249169622 997.0 3.5989304812834226 3.0 - - - - - - - 227.1764705882353 5 17 PIK3R4 phosphoinositide-3-kinase, regulatory subunit 4 1449 185 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42175.[MT7]-VFAIQDPTLPLTSYK[MT7].3b4_1.heavy 661.046 / 575.367 10215.0 42.06192588806152 22 3 10 3 6 0.5451597328884886 102.73330688616679 0.0792999267578125 5 0.5626202578640581 1.793310249169622 10215.0 -1.192992700729926 0.0 - - - - - - - 285.3157894736842 20 19 PIK3R4 phosphoinositide-3-kinase, regulatory subunit 4 1451 185 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42175.[MT7]-VFAIQDPTLPLTSYK[MT7].3y4_1.heavy 661.046 / 642.358 561.0 42.06192588806152 22 3 10 3 6 0.5451597328884886 102.73330688616679 0.0792999267578125 5 0.5626202578640581 1.793310249169622 561.0 -0.35904000000000025 12.0 - - - - - - - 249.05 6 20 PIK3R4 phosphoinositide-3-kinase, regulatory subunit 4 1453 186 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 272969.0 38.72930145263672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 272969.0 318.3799783813972 0.0 - - - - - - - 251.8181818181818 545 11 1455 186 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 454517.0 38.72930145263672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 454517.0 198.17867707669507 0.0 - - - - - - - 316.625 909 8 1457 186 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 572997.0 38.72930145263672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 572997.0 271.4451194138164 0.0 - - - - - - - 618.5 1145 8 1459 187 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 525418.0 34.007999420166016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 525418.0 379.46803878620733 0.0 - - - - - - - 756.5 1050 14 1461 187 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 84839.0 34.007999420166016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 84839.0 146.16456928838952 0.0 - - - - - - - 783.2 169 10 1463 187 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 50298.0 34.007999420166016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 50298.0 99.48925561797753 0.0 - - - - - - - 685.8235294117648 100 17 1465 188 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41550.[MT7]-IK[MT7]AER.2b3_1.heavy 452.795 / 601.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - JUN;JUND jun proto-oncogene;jun D proto-oncogene 1467 188 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41550.[MT7]-IK[MT7]AER.2y4_1.heavy 452.795 / 647.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - JUN;JUND jun proto-oncogene;jun D proto-oncogene 1469 188 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41550.[MT7]-IK[MT7]AER.2b3_2.heavy 452.795 / 301.217 N/A N/A - - - - - - - - - 0.0 - - - - - - - JUN;JUND jun proto-oncogene;jun D proto-oncogene 1471 188 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41550.[MT7]-IK[MT7]AER.2b4_1.heavy 452.795 / 730.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - JUN;JUND jun proto-oncogene;jun D proto-oncogene 1473 189 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36713.[MT7]-DTSASAVAVGLK[MT7].2b4_1.heavy 703.908 / 519.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1475 189 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36713.[MT7]-DTSASAVAVGLK[MT7].2b6_1.heavy 703.908 / 677.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1477 189 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36713.[MT7]-DTSASAVAVGLK[MT7].2b7_1.heavy 703.908 / 776.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1479 189 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36713.[MT7]-DTSASAVAVGLK[MT7].2b5_1.heavy 703.908 / 606.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1481 190 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533574.[MT7]-SLC[CAM]AAELVC[CAM]K[MT7].3y3_1.heavy 480.259 / 550.314 127752.0 30.745899200439453 44 14 10 10 10 1.724780926356951 39.241091720464695 0.0 3 0.9490254036765815 5.442809737297473 127752.0 244.38930817610063 0.0 - - - - - - - 753.7777777777778 255 9 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1483 190 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533574.[MT7]-SLC[CAM]AAELVC[CAM]K[MT7].3b6_1.heavy 480.259 / 776.373 106230.0 30.745899200439453 44 14 10 10 10 1.724780926356951 39.241091720464695 0.0 3 0.9490254036765815 5.442809737297473 106230.0 375.61324528301884 0.0 - - - - - - - 247.33333333333334 212 12 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1485 190 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533574.[MT7]-SLC[CAM]AAELVC[CAM]K[MT7].3b4_1.heavy 480.259 / 576.293 69760.0 30.745899200439453 44 14 10 10 10 1.724780926356951 39.241091720464695 0.0 3 0.9490254036765815 5.442809737297473 69760.0 149.08795355587807 0.0 - - - - - - - 666.2857142857143 139 14 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1487 190 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533574.[MT7]-SLC[CAM]AAELVC[CAM]K[MT7].3b5_1.heavy 480.259 / 647.33 69866.0 30.745899200439453 44 14 10 10 10 1.724780926356951 39.241091720464695 0.0 3 0.9490254036765815 5.442809737297473 69866.0 114.34775450207684 0.0 - - - - - - - 802.5714285714286 139 7 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1489 191 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19055.[MT7]-TIEYLEEVAITFAK[MT7].2y4_1.heavy 958.037 / 610.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1491 191 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19055.[MT7]-TIEYLEEVAITFAK[MT7].2y9_1.heavy 958.037 / 1151.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1493 191 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19055.[MT7]-TIEYLEEVAITFAK[MT7].2b4_1.heavy 958.037 / 651.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1495 191 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19055.[MT7]-TIEYLEEVAITFAK[MT7].2y3_1.heavy 958.037 / 509.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1497 192 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42166.[MT7]-K[MT7]RAEQEALTGEC[CAM]K[MT7].3b6_2.heavy 651.358 / 515.798 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1499 192 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42166.[MT7]-K[MT7]RAEQEALTGEC[CAM]K[MT7].3y4_1.heavy 651.358 / 637.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1501 192 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42166.[MT7]-K[MT7]RAEQEALTGEC[CAM]K[MT7].3y5_1.heavy 651.358 / 738.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1503 192 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42166.[MT7]-K[MT7]RAEQEALTGEC[CAM]K[MT7].3b7_2.heavy 651.358 / 551.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1505 193 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42168.[MT7]-VYTLTPFLANNREK[MT7].3y7_1.heavy 652.038 / 988.566 876.0 35.716251373291016 25 2 9 6 8 0.3425484363491156 124.69565979790609 0.035400390625 4 0.4990996871932998 1.6650142409936624 876.0 11.692217573221757 1.0 - - - - - - - 0.0 1 0 ARRB1 arrestin, beta 1 1507 193 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42168.[MT7]-VYTLTPFLANNREK[MT7].3y6_1.heavy 652.038 / 875.482 1115.0 35.716251373291016 25 2 9 6 8 0.3425484363491156 124.69565979790609 0.035400390625 4 0.4990996871932998 1.6650142409936624 1115.0 5.994874476987448 2.0 - - - - - - - 204.34782608695653 2 23 ARRB1 arrestin, beta 1 1509 193 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42168.[MT7]-VYTLTPFLANNREK[MT7].3y9_2.heavy 652.038 / 616.847 5495.0 35.716251373291016 25 2 9 6 8 0.3425484363491156 124.69565979790609 0.035400390625 4 0.4990996871932998 1.6650142409936624 5495.0 7.343348261327712 1.0 - - - - - - - 748.4 12 10 ARRB1 arrestin, beta 1 1511 193 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42168.[MT7]-VYTLTPFLANNREK[MT7].3y9_1.heavy 652.038 / 1232.69 1593.0 35.716251373291016 25 2 9 6 8 0.3425484363491156 124.69565979790609 0.035400390625 4 0.4990996871932998 1.6650142409936624 1593.0 26.411556746861926 0.0 - - - - - - - 143.5 3 10 ARRB1 arrestin, beta 1 1513 194 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533228.[MT7]-AYLIK[MT7].2b3_1.heavy 448.296 / 492.294 N/A 28.18803342183431 46 20 10 6 10 5.9396165122332425 16.836103777750612 0.03520011901855469 3 0.9949786773613978 17.408903216200127 7566.0 3.622513464991024 2.0 - - - - - - - 350.0 21 3 ORC6 origin recognition complex, subunit 6 1515 194 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533228.[MT7]-AYLIK[MT7].2y4_1.heavy 448.296 / 680.446 9878.0 28.18803342183431 46 20 10 6 10 5.9396165122332425 16.836103777750612 0.03520011901855469 3 0.9949786773613978 17.408903216200127 9878.0 52.59852621086493 0.0 - - - - - - - 247.5 19 14 ORC6 origin recognition complex, subunit 6 1517 194 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533228.[MT7]-AYLIK[MT7].2b4_1.heavy 448.296 / 605.378 2627.0 28.18803342183431 46 20 10 6 10 5.9396165122332425 16.836103777750612 0.03520011901855469 3 0.9949786773613978 17.408903216200127 2627.0 11.475403174603176 0.0 - - - - - - - 642.2222222222222 5 9 ORC6 origin recognition complex, subunit 6 1519 194 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533228.[MT7]-AYLIK[MT7].2y3_1.heavy 448.296 / 517.383 8512.0 28.18803342183431 46 20 10 6 10 5.9396165122332425 16.836103777750612 0.03520011901855469 3 0.9949786773613978 17.408903216200127 8512.0 11.743459310571179 0.0 - - - - - - - 725.3 17 10 ORC6 origin recognition complex, subunit 6 1521 195 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41555.[MT7]-EEPPHR.2y4_1.heavy 454.739 / 506.283 11995.0 26.556299209594727 32 14 4 10 4 2.6929039052410633 27.846769297685547 0.0 8 0.9468648967637833 5.330028971951915 11995.0 29.831464042870767 0.0 - - - - - - - 677.6666666666666 55 9 ARRB1 arrestin, beta 1 1523 195 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41555.[MT7]-EEPPHR.2y5_1.heavy 454.739 / 635.326 15247.0 26.556299209594727 32 14 4 10 4 2.6929039052410633 27.846769297685547 0.0 8 0.9468648967637833 5.330028971951915 15247.0 40.882917861042856 0.0 - - - - - - - 653.5714285714286 30 7 ARRB1 arrestin, beta 1 1525 195 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41555.[MT7]-EEPPHR.2b5_1.heavy 454.739 / 734.359 915.0 26.556299209594727 32 14 4 10 4 2.6929039052410633 27.846769297685547 0.0 8 0.9468648967637833 5.330028971951915 915.0 1.6710674157303371 7.0 - - - - - - - 250.8 8 15 ARRB1 arrestin, beta 1 1527 196 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533223.[MT7]-TDAQGTR.2y5_1.heavy 446.734 / 532.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL3RA interleukin 3 receptor, alpha (low affinity) 1529 196 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533223.[MT7]-TDAQGTR.2b4_1.heavy 446.734 / 560.28 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL3RA interleukin 3 receptor, alpha (low affinity) 1531 196 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533223.[MT7]-TDAQGTR.2y6_1.heavy 446.734 / 647.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL3RA interleukin 3 receptor, alpha (low affinity) 1533 196 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533223.[MT7]-TDAQGTR.2b5_1.heavy 446.734 / 617.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL3RA interleukin 3 receptor, alpha (low affinity) 1535 197 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533325.[MT7]-LTISYLR.2y4_1.heavy 505.312 / 538.298 7389.0 34.52680015563965 46 20 10 6 10 6.241624962509586 16.021468864382513 0.03800201416015625 3 0.9910086738231695 13.005424992713294 7389.0 20.257483146067415 0.0 - - - - - - - 694.2 14 10 HIF1A;HIF3A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor);hypoxia inducible factor 3, alpha subunit 1537 197 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533325.[MT7]-LTISYLR.2y5_1.heavy 505.312 / 651.382 9080.0 34.52680015563965 46 20 10 6 10 6.241624962509586 16.021468864382513 0.03800201416015625 3 0.9910086738231695 13.005424992713294 9080.0 19.17172284644195 0.0 - - - - - - - 306.55555555555554 18 9 HIF1A;HIF3A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor);hypoxia inducible factor 3, alpha subunit 1539 197 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533325.[MT7]-LTISYLR.2b4_1.heavy 505.312 / 559.357 5430.0 34.52680015563965 46 20 10 6 10 6.241624962509586 16.021468864382513 0.03800201416015625 3 0.9910086738231695 13.005424992713294 5430.0 8.460224719101124 0.0 - - - - - - - 765.4 10 10 HIF1A;HIF3A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor);hypoxia inducible factor 3, alpha subunit 1541 197 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533325.[MT7]-LTISYLR.2y6_1.heavy 505.312 / 752.43 23413.0 34.52680015563965 46 20 10 6 10 6.241624962509586 16.021468864382513 0.03800201416015625 3 0.9910086738231695 13.005424992713294 23413.0 69.52922826654277 0.0 - - - - - - - 294.38461538461536 46 13 HIF1A;HIF3A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor);hypoxia inducible factor 3, alpha subunit 1543 198 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36314.[MT7]-IEVQPR.2b3_1.heavy 443.267 / 486.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - NFATC4 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4 1545 198 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36314.[MT7]-IEVQPR.2y4_1.heavy 443.267 / 499.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - NFATC4 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4 1547 198 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36314.[MT7]-IEVQPR.2y5_1.heavy 443.267 / 628.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - NFATC4 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4 1549 199 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533324.[MT7]-QSPC[CAM]IAVQVVRI.3b6_1.heavy 505.293 / 801.404 25616.0 36.077574729919434 45 18 10 7 10 4.806407227395399 20.805561257902443 0.026699066162109375 3 0.9826181924582338 9.347249139035666 25616.0 87.54835443037973 0.0 - - - - - - - 166.57142857142858 51 14 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1551 199 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533324.[MT7]-QSPC[CAM]IAVQVVRI.3y6_1.heavy 505.293 / 713.467 41097.0 36.077574729919434 45 18 10 7 10 4.806407227395399 20.805561257902443 0.026699066162109375 3 0.9826181924582338 9.347249139035666 41097.0 54.31580247666687 0.0 - - - - - - - 709.8888888888889 82 9 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1553 199 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533324.[MT7]-QSPC[CAM]IAVQVVRI.3b4_1.heavy 505.293 / 617.283 62228.0 36.077574729919434 45 18 10 7 10 4.806407227395399 20.805561257902443 0.026699066162109375 3 0.9826181924582338 9.347249139035666 62228.0 18.219853820598008 1.0 - - - - - - - 746.1428571428571 124 7 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1555 199 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533324.[MT7]-QSPC[CAM]IAVQVVRI.3y5_1.heavy 505.293 / 614.398 75313.0 36.077574729919434 45 18 10 7 10 4.806407227395399 20.805561257902443 0.026699066162109375 3 0.9826181924582338 9.347249139035666 75313.0 86.87318833594409 0.0 - - - - - - - 724.7 150 10 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1557 200 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41698.[MT7]-RPAADGAER.2b8_1.heavy 543.792 / 912.466 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1559 200 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41698.[MT7]-RPAADGAER.2y8_1.heavy 543.792 / 786.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1561 200 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41698.[MT7]-RPAADGAER.2b6_1.heavy 543.792 / 712.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1563 200 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41698.[MT7]-RPAADGAER.2b5_1.heavy 543.792 / 655.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1565 201 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533579.[MT7]-C[CAM]SPIGVYTSGK[MT7].3b9_2.heavy 486.262 / 555.274 N/A 27.622433344523113 44 18 10 6 10 6.069244340860633 16.476515754483493 0.034999847412109375 3 0.9876762917102343 11.105666916740931 57765.0 281.9482142857143 0.0 - - - - - - - 669.375 115 8 MCM5 minichromosome maintenance complex component 5 1567 201 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533579.[MT7]-C[CAM]SPIGVYTSGK[MT7].3b6_1.heavy 486.262 / 758.399 7877.0 27.622433344523113 44 18 10 6 10 6.069244340860633 16.476515754483493 0.034999847412109375 3 0.9876762917102343 11.105666916740931 7877.0 7.501904761904763 1.0 - - - - - - - 688.3333333333334 15 9 MCM5 minichromosome maintenance complex component 5 1569 201 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533579.[MT7]-C[CAM]SPIGVYTSGK[MT7].3b5_1.heavy 486.262 / 659.33 14074.0 27.622433344523113 44 18 10 6 10 6.069244340860633 16.476515754483493 0.034999847412109375 3 0.9876762917102343 11.105666916740931 14074.0 28.282038095238097 0.0 - - - - - - - 708.75 28 8 MCM5 minichromosome maintenance complex component 5 1571 201 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533579.[MT7]-C[CAM]SPIGVYTSGK[MT7].3y4_1.heavy 486.262 / 536.316 11133.0 27.622433344523113 44 18 10 6 10 6.069244340860633 16.476515754483493 0.034999847412109375 3 0.9876762917102343 11.105666916740931 11133.0 7.666681318681317 1.0 - - - - - - - 297.5 22 6 MCM5 minichromosome maintenance complex component 5 1573 202 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18660.[MT7]-GLYPAPLK[MT7].2y4_1.heavy 573.86 / 572.389 1147.0 30.358225345611572 31 5 10 6 10 0.6921443547122421 71.30870100246837 0.03489875793457031 3 0.6643558765602722 2.06752234209342 1147.0 2.5193264551931867 18.0 - - - - - - - 774.2857142857143 4 14 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1575 202 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18660.[MT7]-GLYPAPLK[MT7].2y5_1.heavy 573.86 / 669.442 13760.0 30.358225345611572 31 5 10 6 10 0.6921443547122421 71.30870100246837 0.03489875793457031 3 0.6643558765602722 2.06752234209342 13760.0 5.02878026496117 0.0 - - - - - - - 664.5 27 8 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1577 202 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18660.[MT7]-GLYPAPLK[MT7].2y3_1.heavy 573.86 / 501.352 3753.0 30.358225345611572 31 5 10 6 10 0.6921443547122421 71.30870100246837 0.03489875793457031 3 0.6643558765602722 2.06752234209342 3753.0 3.6 1.0 - - - - - - - 755.75 10 12 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1579 202 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18660.[MT7]-GLYPAPLK[MT7].2y6_1.heavy 573.86 / 832.505 1668.0 30.358225345611572 31 5 10 6 10 0.6921443547122421 71.30870100246837 0.03489875793457031 3 0.6643558765602722 2.06752234209342 1668.0 1.9552960000000001 1.0 - - - - - - - 256.53846153846155 3 13 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1581 203 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42256.[MT7]-VGLTSEILNSFEHEFLSK[MT7].3y6_1.heavy 780.089 / 904.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1583 203 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42256.[MT7]-VGLTSEILNSFEHEFLSK[MT7].3b6_1.heavy 780.089 / 731.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1585 203 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42256.[MT7]-VGLTSEILNSFEHEFLSK[MT7].3y4_1.heavy 780.089 / 638.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1587 203 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42256.[MT7]-VGLTSEILNSFEHEFLSK[MT7].3b7_1.heavy 780.089 / 844.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1589 204 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42060.[MT7]-DRLVVSGSSDNTIR.3y6_1.heavy 554.968 / 705.353 7446.0 23.90410041809082 46 16 10 10 10 1.8543511392242307 37.97822486869843 0.0 3 0.9617615747426302 6.2909853010232615 7446.0 9.291322527096963 0.0 - - - - - - - 245.4 14 10 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1591 204 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42060.[MT7]-DRLVVSGSSDNTIR.3y4_1.heavy 554.968 / 503.294 8800.0 23.90410041809082 46 16 10 10 10 1.8543511392242307 37.97822486869843 0.0 3 0.9617615747426302 6.2909853010232615 8800.0 14.68615592660068 0.0 - - - - - - - 714.5555555555555 17 9 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1593 204 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42060.[MT7]-DRLVVSGSSDNTIR.3y8_1.heavy 554.968 / 849.406 6600.0 23.90410041809082 46 16 10 10 10 1.8543511392242307 37.97822486869843 0.0 3 0.9617615747426302 6.2909853010232615 6600.0 33.25984251968504 0.0 - - - - - - - 192.88888888888889 13 18 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1595 204 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42060.[MT7]-DRLVVSGSSDNTIR.3y9_1.heavy 554.968 / 936.438 7700.0 23.90410041809082 46 16 10 10 10 1.8543511392242307 37.97822486869843 0.0 3 0.9617615747426302 6.2909853010232615 7700.0 53.102200943547096 0.0 - - - - - - - 246.75 15 12 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1597 205 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533373.[MT7]-LTVYLGK[MT7].2y4_1.heavy 541.347 / 624.384 18079.0 32.9995002746582 46 16 10 10 10 3.0211102276767656 33.10041423973465 0.0 3 0.9697487024141662 7.077655368069423 18079.0 16.857854914994455 0.0 - - - - - - - 337.25 36 8 ARRB1;ARRB2 arrestin, beta 1;arrestin, beta 2 1599 205 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533373.[MT7]-LTVYLGK[MT7].2y5_1.heavy 541.347 / 723.452 4695.0 32.9995002746582 46 16 10 10 10 3.0211102276767656 33.10041423973465 0.0 3 0.9697487024141662 7.077655368069423 4695.0 10.882237205069966 0.0 - - - - - - - 266.6666666666667 9 12 ARRB1;ARRB2 arrestin, beta 1;arrestin, beta 2 1601 205 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533373.[MT7]-LTVYLGK[MT7].2b4_1.heavy 541.347 / 621.373 8290.0 32.9995002746582 46 16 10 10 10 3.0211102276767656 33.10041423973465 0.0 3 0.9697487024141662 7.077655368069423 8290.0 18.46414299841562 0.0 - - - - - - - 384.15384615384613 16 13 ARRB1;ARRB2 arrestin, beta 1;arrestin, beta 2 1603 205 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533373.[MT7]-LTVYLGK[MT7].2y6_1.heavy 541.347 / 824.5 15682.0 32.9995002746582 46 16 10 10 10 3.0211102276767656 33.10041423973465 0.0 3 0.9697487024141662 7.077655368069423 15682.0 58.453947895791586 0.0 - - - - - - - 299.85714285714283 31 14 ARRB1;ARRB2 arrestin, beta 1;arrestin, beta 2 1605 206 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41682.[MT7]-K[MT7]VEEK[MT7].2b3_1.heavy 532.837 / 645.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - CHRM5;SEPT8;MACF1;HADHA;NEFM;TTN cholinergic receptor, muscarinic 5;septin 8;microtubule-actin crosslinking factor 1;hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit;neurofilament, medium polypeptide;titin 1607 206 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41682.[MT7]-K[MT7]VEEK[MT7].2y4_1.heavy 532.837 / 648.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - CHRM5;SEPT8;MACF1;HADHA;NEFM;TTN cholinergic receptor, muscarinic 5;septin 8;microtubule-actin crosslinking factor 1;hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit;neurofilament, medium polypeptide;titin 1609 206 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41682.[MT7]-K[MT7]VEEK[MT7].2b4_1.heavy 532.837 / 774.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - CHRM5;SEPT8;MACF1;HADHA;NEFM;TTN cholinergic receptor, muscarinic 5;septin 8;microtubule-actin crosslinking factor 1;hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit;neurofilament, medium polypeptide;titin 1611 206 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41682.[MT7]-K[MT7]VEEK[MT7].2y3_1.heavy 532.837 / 549.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - CHRM5;SEPT8;MACF1;HADHA;NEFM;TTN cholinergic receptor, muscarinic 5;septin 8;microtubule-actin crosslinking factor 1;hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit;neurofilament, medium polypeptide;titin 1613 207 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18635.[MT7]-DATLTALDR.2y8_1.heavy 560.31 / 860.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1615 207 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18635.[MT7]-DATLTALDR.2y5_1.heavy 560.31 / 575.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1617 207 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18635.[MT7]-DATLTALDR.2y6_1.heavy 560.31 / 688.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1619 207 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18635.[MT7]-DATLTALDR.2b5_1.heavy 560.31 / 646.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1621 208 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18655.[MT7]-FLLDTNK[MT7].2y4_1.heavy 569.839 / 621.332 2478.0 32.359901428222656 44 16 10 10 8 1.8242205797361926 43.49246628150771 0.0 4 0.9671405323140584 6.789466571279289 2478.0 4.883590726666708 2.0 - - - - - - - 263.6666666666667 5 9 MCM6 minichromosome maintenance complex component 6 1623 208 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18655.[MT7]-FLLDTNK[MT7].2b4_1.heavy 569.839 / 633.373 3097.0 32.359901428222656 44 16 10 10 8 1.8242205797361926 43.49246628150771 0.0 4 0.9671405323140584 6.789466571279289 3097.0 4.908685603935778 0.0 - - - - - - - 683.875 6 8 MCM6 minichromosome maintenance complex component 6 1625 208 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18655.[MT7]-FLLDTNK[MT7].2y3_1.heavy 569.839 / 506.306 4336.0 32.359901428222656 44 16 10 10 8 1.8242205797361926 43.49246628150771 0.0 4 0.9671405323140584 6.789466571279289 4336.0 7.139741814077987 0.0 - - - - - - - 788.3636363636364 8 11 MCM6 minichromosome maintenance complex component 6 1627 208 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18655.[MT7]-FLLDTNK[MT7].2y6_1.heavy 569.839 / 847.5 1549.0 32.359901428222656 44 16 10 10 8 1.8242205797361926 43.49246628150771 0.0 4 0.9671405323140584 6.789466571279289 1549.0 6.511011020389953 1.0 - - - - - - - 206.25 3 8 MCM6 minichromosome maintenance complex component 6 1629 209 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533231.[MT7]-ISGQVVR.2y5_1.heavy 451.781 / 558.336 7158.0 21.83049964904785 47 17 10 10 10 1.3147667875632645 45.58603738285758 0.0 3 0.9777106720429773 8.250948723242717 7158.0 14.635155968117559 0.0 - - - - - - - 0.0 14 0 MCM6 minichromosome maintenance complex component 6 1631 209 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533231.[MT7]-ISGQVVR.2b4_1.heavy 451.781 / 530.305 9158.0 21.83049964904785 47 17 10 10 10 1.3147667875632645 45.58603738285758 0.0 3 0.9777106720429773 8.250948723242717 9158.0 16.09255509327177 1.0 - - - - - - - 0.0 18 0 MCM6 minichromosome maintenance complex component 6 1633 209 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533231.[MT7]-ISGQVVR.2y6_1.heavy 451.781 / 645.368 55527.0 21.83049964904785 47 17 10 10 10 1.3147667875632645 45.58603738285758 0.0 3 0.9777106720429773 8.250948723242717 55527.0 93.94492826370885 0.0 - - - - - - - 0.0 111 0 MCM6 minichromosome maintenance complex component 6 1635 209 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533231.[MT7]-ISGQVVR.2b5_1.heavy 451.781 / 629.374 14059.0 21.83049964904785 47 17 10 10 10 1.3147667875632645 45.58603738285758 0.0 3 0.9777106720429773 8.250948723242717 14059.0 34.77124400147656 0.0 - - - - - - - 0.0 28 0 MCM6 minichromosome maintenance complex component 6 1637 210 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18656.[MT7]-DYSVSANSR.2b3_1.heavy 571.782 / 510.232 2072.0 18.835949420928955 44 18 10 6 10 2.8687216277107086 28.082889278227867 0.03899955749511719 3 0.9810992166333883 8.962641858932644 2072.0 16.936347826086955 0.0 - - - - - - - 172.8125 4 16 LDHC lactate dehydrogenase C 1639 210 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18656.[MT7]-DYSVSANSR.2y8_1.heavy 571.782 / 883.427 6102.0 18.835949420928955 44 18 10 6 10 2.8687216277107086 28.082889278227867 0.03899955749511719 3 0.9810992166333883 8.962641858932644 6102.0 80.56050867052022 0.0 - - - - - - - 172.8 12 15 LDHC lactate dehydrogenase C 1641 210 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18656.[MT7]-DYSVSANSR.2y5_1.heavy 571.782 / 534.263 3742.0 18.835949420928955 44 18 10 6 10 2.8687216277107086 28.082889278227867 0.03899955749511719 3 0.9810992166333883 8.962641858932644 3742.0 21.199012157428392 0.0 - - - - - - - 263.2142857142857 7 14 LDHC lactate dehydrogenase C 1643 210 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18656.[MT7]-DYSVSANSR.2y7_1.heavy 571.782 / 720.364 2936.0 18.835949420928955 44 18 10 6 10 2.8687216277107086 28.082889278227867 0.03899955749511719 3 0.9810992166333883 8.962641858932644 2936.0 12.31225806451613 0.0 - - - - - - - 189.42857142857142 5 14 LDHC lactate dehydrogenase C 1645 211 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18631.[MT7]-YRDELK[MT7].2y4_1.heavy 556.321 / 648.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 1647 211 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18631.[MT7]-YRDELK[MT7].2b3_1.heavy 556.321 / 579.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 1649 211 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18631.[MT7]-YRDELK[MT7].2b4_1.heavy 556.321 / 708.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 1651 211 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18631.[MT7]-YRDELK[MT7].2y3_1.heavy 556.321 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 1653 212 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18630.[MT7]-YIVSASGDR.2b3_1.heavy 556.297 / 520.325 8604.0 24.566499710083008 48 18 10 10 10 14.684441552209485 6.809928702052246 0.0 3 0.9891166517517882 11.819155239320425 8604.0 12.6 0.0 - - - - - - - 812.625 17 8 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1655 212 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18630.[MT7]-YIVSASGDR.2y8_1.heavy 556.297 / 804.421 17208.0 24.566499710083008 48 18 10 10 10 14.684441552209485 6.809928702052246 0.0 3 0.9891166517517882 11.819155239320425 17208.0 41.88706911919617 0.0 - - - - - - - 207.25 34 12 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1657 212 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18630.[MT7]-YIVSASGDR.2y6_1.heavy 556.297 / 592.268 11281.0 24.566499710083008 48 18 10 10 10 14.684441552209485 6.809928702052246 0.0 3 0.9891166517517882 11.819155239320425 11281.0 40.69797588675229 0.0 - - - - - - - 270.9166666666667 22 12 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1659 212 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18630.[MT7]-YIVSASGDR.2y7_1.heavy 556.297 / 691.337 15105.0 24.566499710083008 48 18 10 10 10 14.684441552209485 6.809928702052246 0.0 3 0.9891166517517882 11.819155239320425 15105.0 72.36164921465968 0.0 - - - - - - - 239.0 30 16 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1661 213 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 196775.0 42.0883674621582 23 -3 10 6 10 null 0.0 0.039699554443359375 3 0.0 0.0 196775.0 849.6842561955568 0.0 - - - - - - - 232.52941176470588 393 17 1663 213 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 360183.0 42.0883674621582 23 -3 10 6 10 null 0.0 0.039699554443359375 3 0.0 0.0 360183.0 423.0632329766455 0.0 - - - - - - - 265.5 720 10 1665 213 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 290674.0 42.0883674621582 23 -3 10 6 10 null 0.0 0.039699554443359375 3 0.0 0.0 290674.0 491.23680933023616 0.0 - - - - - - - 198.45454545454547 581 11 1667 214 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533590.[MT7]-AAVNVVDFDDK[MT7].3y3_1.heavy 494.268 / 521.269 49728.0 31.35070037841797 46 16 10 10 10 4.167963956746919 23.992529934939657 0.0 3 0.9636388635261065 6.452363571351561 49728.0 85.04324668224066 0.0 - - - - - - - 285.0 99 7 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1669 214 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533590.[MT7]-AAVNVVDFDDK[MT7].3b4_1.heavy 494.268 / 500.295 138064.0 31.35070037841797 46 16 10 10 10 4.167963956746919 23.992529934939657 0.0 3 0.9636388635261065 6.452363571351561 138064.0 124.64071072159958 0.0 - - - - - - - 1245.875 276 8 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1671 214 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533590.[MT7]-AAVNVVDFDDK[MT7].3b5_1.heavy 494.268 / 599.363 94526.0 31.35070037841797 46 16 10 10 10 4.167963956746919 23.992529934939657 0.0 3 0.9636388635261065 6.452363571351561 94526.0 114.97903573139882 0.0 - - - - - - - 734.0909090909091 189 11 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1673 214 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533590.[MT7]-AAVNVVDFDDK[MT7].3y5_1.heavy 494.268 / 783.364 63891.0 31.35070037841797 46 16 10 10 10 4.167963956746919 23.992529934939657 0.0 3 0.9636388635261065 6.452363571351561 63891.0 178.96732511493275 0.0 - - - - - - - 306.25 127 12 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1675 215 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533493.[MT7]-IEELGSELK[MT7].3y3_1.heavy 435.922 / 533.341 18755.0 32.11750030517578 50 20 10 10 10 9.847362238147946 10.155003703693103 0.0 3 0.9948785299029776 17.23770811801418 18755.0 44.473233352845 0.0 - - - - - - - 638.6 37 10 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1677 215 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533493.[MT7]-IEELGSELK[MT7].3b4_1.heavy 435.922 / 629.363 21847.0 32.11750030517578 50 20 10 10 10 9.847362238147946 10.155003703693103 0.0 3 0.9948785299029776 17.23770811801418 21847.0 68.40444174757282 0.0 - - - - - - - 629.4444444444445 43 9 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1679 215 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533493.[MT7]-IEELGSELK[MT7].3b5_1.heavy 435.922 / 686.384 21641.0 32.11750030517578 50 20 10 10 10 9.847362238147946 10.155003703693103 0.0 3 0.9948785299029776 17.23770811801418 21641.0 94.54805825242717 0.0 - - - - - - - 217.44444444444446 43 9 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1681 215 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533493.[MT7]-IEELGSELK[MT7].3b3_1.heavy 435.922 / 516.279 76980.0 32.11750030517578 50 20 10 10 10 9.847362238147946 10.155003703693103 0.0 3 0.9948785299029776 17.23770811801418 76980.0 111.61961920199832 0.0 - - - - - - - 218.875 153 8 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1683 216 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18791.[MT7]-NLLQGEELLR.2y8_1.heavy 664.886 / 957.536 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) 1685 216 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18791.[MT7]-NLLQGEELLR.2y9_1.heavy 664.886 / 1070.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) 1687 216 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18791.[MT7]-NLLQGEELLR.2y6_1.heavy 664.886 / 716.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) 1689 216 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18791.[MT7]-NLLQGEELLR.2y7_1.heavy 664.886 / 844.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) 1691 217 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18790.[MT7]-FVDLYGAQK[MT7].2y4_1.heavy 664.876 / 547.332 2259.0 32.64569854736328 46 18 10 10 8 4.9158633495074815 20.342306709973734 0.0 4 0.9890213077141555 11.767627950179056 2259.0 23.412985268104297 1.0 - - - - - - - 244.84615384615384 5 13 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1693 217 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18790.[MT7]-FVDLYGAQK[MT7].2b3_1.heavy 664.876 / 506.273 3594.0 32.64569854736328 46 18 10 10 8 4.9158633495074815 20.342306709973734 0.0 4 0.9890213077141555 11.767627950179056 3594.0 17.497568489904257 0.0 - - - - - - - 248.08333333333334 7 12 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1695 217 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18790.[MT7]-FVDLYGAQK[MT7].2y5_1.heavy 664.876 / 710.395 1848.0 32.64569854736328 46 18 10 10 8 4.9158633495074815 20.342306709973734 0.0 4 0.9890213077141555 11.767627950179056 1848.0 4.116496350364963 1.0 - - - - - - - 198.6 3 15 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1697 217 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18790.[MT7]-FVDLYGAQK[MT7].2y6_1.heavy 664.876 / 823.479 1437.0 32.64569854736328 46 18 10 10 8 4.9158633495074815 20.342306709973734 0.0 4 0.9890213077141555 11.767627950179056 1437.0 13.978678664456549 0.0 - - - - - - - 188.16666666666666 2 6 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1699 218 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533594.[MT7]-GFYIYQEGVK[MT7].3b4_1.heavy 497.941 / 625.347 45733.0 33.52920150756836 44 14 10 10 10 2.257992177997894 44.287133044308206 0.0 3 0.9467510678694391 5.324277477963276 45733.0 34.507940355497894 1.0 - - - - - - - 321.375 96 8 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1701 218 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533594.[MT7]-GFYIYQEGVK[MT7].3b5_1.heavy 497.941 / 788.41 9051.0 33.52920150756836 44 14 10 10 10 2.257992177997894 44.287133044308206 0.0 3 0.9467510678694391 5.324277477963276 9051.0 41.29734599351551 0.0 - - - - - - - 303.09090909090907 18 11 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1703 218 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533594.[MT7]-GFYIYQEGVK[MT7].3y4_1.heavy 497.941 / 576.347 31632.0 33.52920150756836 44 14 10 10 10 2.257992177997894 44.287133044308206 0.0 3 0.9467510678694391 5.324277477963276 31632.0 34.90834680630294 0.0 - - - - - - - 333.5 63 4 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1705 218 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533594.[MT7]-GFYIYQEGVK[MT7].3b3_1.heavy 497.941 / 512.263 51735.0 33.52920150756836 44 14 10 10 10 2.257992177997894 44.287133044308206 0.0 3 0.9467510678694391 5.324277477963276 51735.0 103.11834367521911 0.0 - - - - - - - 273.875 103 8 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1707 219 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18795.[MT7]-ILENAASAQK[MT7].2y4_1.heavy 666.89 / 577.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - ORC6 origin recognition complex, subunit 6 1709 219 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18795.[MT7]-ILENAASAQK[MT7].2y9_1.heavy 666.89 / 1075.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - ORC6 origin recognition complex, subunit 6 1711 219 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18795.[MT7]-ILENAASAQK[MT7].2b4_1.heavy 666.89 / 614.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - ORC6 origin recognition complex, subunit 6 1713 219 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18795.[MT7]-ILENAASAQK[MT7].2y7_1.heavy 666.89 / 833.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - ORC6 origin recognition complex, subunit 6 1715 220 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42311.[MT7]-K[MT7]LDSLTTSFGFPVGAATLVDEVGVDVAK[MT7].4y4_1.heavy 817.956 / 576.347 5714.0 46.22819995880127 35 8 10 7 10 0.9524884610089142 70.72920951020583 0.026401519775390625 3 0.7872868995262117 2.62692555643724 5714.0 40.494869565217385 0.0 - - - - - - - 623.875 11 8 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1717 220 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42311.[MT7]-K[MT7]LDSLTTSFGFPVGAATLVDEVGVDVAK[MT7].4b11_2.heavy 817.956 / 743.413 6141.0 46.22819995880127 35 8 10 7 10 0.9524884610089142 70.72920951020583 0.026401519775390625 3 0.7872868995262117 2.62692555643724 6141.0 31.060323193916346 0.0 - - - - - - - 252.36363636363637 12 22 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1719 220 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42311.[MT7]-K[MT7]LDSLTTSFGFPVGAATLVDEVGVDVAK[MT7].4b6_1.heavy 817.956 / 946.581 558.0 46.22819995880127 35 8 10 7 10 0.9524884610089142 70.72920951020583 0.026401519775390625 3 0.7872868995262117 2.62692555643724 558.0 2.0545454545454547 2.0 - - - - - - - 0.0 1 0 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1721 220 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42311.[MT7]-K[MT7]LDSLTTSFGFPVGAATLVDEVGVDVAK[MT7].4b10_2.heavy 817.956 / 669.879 5977.0 46.22819995880127 35 8 10 7 10 0.9524884610089142 70.72920951020583 0.026401519775390625 3 0.7872868995262117 2.62692555643724 5977.0 27.273099593495935 0.0 - - - - - - - 259.6190476190476 11 21 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1723 221 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42310.[MT7]-RDFVDHIDLVDPVDGVVLVDPEYLK[MT7].3b5_1.heavy 1052.57 / 777.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB1 arrestin, beta 1 1725 221 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42310.[MT7]-RDFVDHIDLVDPVDGVVLVDPEYLK[MT7].3b8_1.heavy 1052.57 / 1142.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB1 arrestin, beta 1 1727 221 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42310.[MT7]-RDFVDHIDLVDPVDGVVLVDPEYLK[MT7].3y5_1.heavy 1052.57 / 793.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB1 arrestin, beta 1 1729 221 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42310.[MT7]-RDFVDHIDLVDPVDGVVLVDPEYLK[MT7].3b8_2.heavy 1052.57 / 571.789 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB1 arrestin, beta 1 1731 222 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18786.[MT7]-IPGIIIAASAVR.2y8_1.heavy 662.925 / 800.499 12118.0 40.75790023803711 50 20 10 10 10 63.3204825553462 1.5792678129481015 0.0 3 0.9990421663210826 39.873342829925974 12118.0 79.87594164456233 0.0 - - - - - - - 185.10526315789474 24 19 MCM5 minichromosome maintenance complex component 5 1733 222 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18786.[MT7]-IPGIIIAASAVR.2y10_1.heavy 662.925 / 970.604 3705.0 40.75790023803711 50 20 10 10 10 63.3204825553462 1.5792678129481015 0.0 3 0.9990421663210826 39.873342829925974 3705.0 27.19985976789168 0.0 - - - - - - - 197.8 7 20 MCM5 minichromosome maintenance complex component 5 1735 222 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18786.[MT7]-IPGIIIAASAVR.2y11_1.heavy 662.925 / 1067.66 75473.0 40.75790023803711 50 20 10 10 10 63.3204825553462 1.5792678129481015 0.0 3 0.9990421663210826 39.873342829925974 75473.0 303.2658216248283 0.0 - - - - - - - 206.42857142857142 150 7 MCM5 minichromosome maintenance complex component 5 1737 222 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18786.[MT7]-IPGIIIAASAVR.2y7_1.heavy 662.925 / 687.415 8351.0 40.75790023803711 50 20 10 10 10 63.3204825553462 1.5792678129481015 0.0 3 0.9990421663210826 39.873342829925974 8351.0 34.874521616594336 0.0 - - - - - - - 237.94736842105263 16 19 MCM5 minichromosome maintenance complex component 5 1739 223 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42040.[MT7]-HEDTNLASSTLLR.3y7_1.heavy 534.285 / 747.436 10210.0 28.53580093383789 50 20 10 10 10 5.644876253254233 17.71518019413635 0.0 3 0.9910461562975986 13.032658983926364 10210.0 54.80367647058823 0.0 - - - - - - - 218.57142857142858 20 14 ARRB1 arrestin, beta 1 1741 223 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42040.[MT7]-HEDTNLASSTLLR.3y6_1.heavy 534.285 / 676.399 19400.0 28.53580093383789 50 20 10 10 10 5.644876253254233 17.71518019413635 0.0 3 0.9910461562975986 13.032658983926364 19400.0 71.835754976637 0.0 - - - - - - - 259.6363636363636 38 11 ARRB1 arrestin, beta 1 1743 223 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42040.[MT7]-HEDTNLASSTLLR.3b5_1.heavy 534.285 / 741.328 16643.0 28.53580093383789 50 20 10 10 10 5.644876253254233 17.71518019413635 0.0 3 0.9910461562975986 13.032658983926364 16643.0 46.583454764413666 0.0 - - - - - - - 216.75 33 8 ARRB1 arrestin, beta 1 1745 223 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42040.[MT7]-HEDTNLASSTLLR.3b3_1.heavy 534.285 / 526.238 N/A 28.53580093383789 50 20 10 10 10 5.644876253254233 17.71518019413635 0.0 3 0.9910461562975986 13.032658983926364 3880.0 2.2068188382941285 1.0 - - - - - - - 1254.142857142857 9 7 ARRB1 arrestin, beta 1 1747 224 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18626.[MT7]-GGAGNISLK[MT7].2y4_1.heavy 552.834 / 604.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1749 224 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18626.[MT7]-GGAGNISLK[MT7].2y8_1.heavy 552.834 / 903.538 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1751 224 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18626.[MT7]-GGAGNISLK[MT7].2b6_1.heavy 552.834 / 614.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1753 224 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18626.[MT7]-GGAGNISLK[MT7].2b5_1.heavy 552.834 / 501.254 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1755 225 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18627.[MT7]-LSAEAAEK[MT7].2y4_1.heavy 553.818 / 562.332 1745.0 21.10059992472331 35 20 2 7 6 10.19869730277283 9.80517384046803 0.029699325561523438 5 0.9952371786815956 17.875479583276306 1745.0 11.663174348697394 0.0 - - - - - - - 221.2 3 20 MCM5 minichromosome maintenance complex component 5 1757 225 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18627.[MT7]-LSAEAAEK[MT7].2b4_1.heavy 553.818 / 545.305 N/A 21.10059992472331 35 20 2 7 6 10.19869730277283 9.80517384046803 0.029699325561523438 5 0.9952371786815956 17.875479583276306 2680.0 1.2822141970824485 11.0 - - - - - - - 1854.375 14 8 MCM5 minichromosome maintenance complex component 5 1759 225 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18627.[MT7]-LSAEAAEK[MT7].2y6_1.heavy 553.818 / 762.411 935.0 21.10059992472331 35 20 2 7 6 10.19869730277283 9.80517384046803 0.029699325561523438 5 0.9952371786815956 17.875479583276306 935.0 0.8235849056603772 2.0 - - - - - - - 194.1153846153846 2 26 MCM5 minichromosome maintenance complex component 5 1761 225 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18627.[MT7]-LSAEAAEK[MT7].2y7_1.heavy 553.818 / 849.443 3304.0 21.10059992472331 35 20 2 7 6 10.19869730277283 9.80517384046803 0.029699325561523438 5 0.9952371786815956 17.875479583276306 3304.0 8.783540579430019 0.0 - - - - - - - 138.77272727272728 6 22 MCM5 minichromosome maintenance complex component 5 1763 226 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533243.[MT7]-ISIQC[CAM]R.2y4_1.heavy 460.759 / 576.292 2225.0 24.001450538635254 42 20 10 6 6 10.05920807071971 9.941140425465449 0.03849983215332031 5 0.9985186701209546 32.061427332314636 2225.0 5.528280929596719 2.0 - - - - - - - 684.2857142857143 14 7 MCM5 minichromosome maintenance complex component 5 1765 226 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533243.[MT7]-ISIQC[CAM]R.2y5_1.heavy 460.759 / 663.324 26181.0 24.001450538635254 42 20 10 6 6 10.05920807071971 9.941140425465449 0.03849983215332031 5 0.9985186701209546 32.061427332314636 26181.0 56.700408458542015 0.0 - - - - - - - 769.8888888888889 52 9 MCM5 minichromosome maintenance complex component 5 1767 226 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533243.[MT7]-ISIQC[CAM]R.2b4_1.heavy 460.759 / 586.368 2738.0 24.001450538635254 42 20 10 6 6 10.05920807071971 9.941140425465449 0.03849983215332031 5 0.9985186701209546 32.061427332314636 2738.0 5.588931566989528 3.0 - - - - - - - 598.75 6 8 MCM5 minichromosome maintenance complex component 5 1769 226 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533243.[MT7]-ISIQC[CAM]R.2y3_1.heavy 460.759 / 463.208 2396.0 24.001450538635254 42 20 10 6 6 10.05920807071971 9.941140425465449 0.03849983215332031 5 0.9985186701209546 32.061427332314636 2396.0 4.693870129870129 2.0 - - - - - - - 721.0 4 7 MCM5 minichromosome maintenance complex component 5 1771 227 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533484.[MT7]-DLIEEVRK[MT7].3b4_1.heavy 430.594 / 615.347 N/A 27.73979949951172 35 15 0 10 10 1.779893647865967 39.64489839875253 0.0 3 0.9534812674076085 5.699677966947132 34687.0 26.48218199850143 1.0 - - - - - - - 262.5 613 4 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1773 227 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533484.[MT7]-DLIEEVRK[MT7].3y7_2.heavy 430.594 / 515.823 45303.0 27.73979949951172 35 15 0 10 10 1.779893647865967 39.64489839875253 0.0 3 0.9534812674076085 5.699677966947132 45303.0 41.097465680252625 0.0 - - - - - - - 245.0 90 12 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1775 227 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533484.[MT7]-DLIEEVRK[MT7].3b5_1.heavy 430.594 / 744.39 29221.0 27.73979949951172 35 15 0 10 10 1.779893647865967 39.64489839875253 0.0 3 0.9534812674076085 5.699677966947132 29221.0 245.9156400506971 0.0 - - - - - - - 163.33333333333334 58 9 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1777 227 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533484.[MT7]-DLIEEVRK[MT7].3b3_1.heavy 430.594 / 486.304 31323.0 27.73979949951172 35 15 0 10 10 1.779893647865967 39.64489839875253 0.0 3 0.9534812674076085 5.699677966947132 31323.0 34.11979679169797 0.0 - - - - - - - 270.0 62 7 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1779 228 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19214.[MT7]-LFQVSTLDAALSGTLSGVEGFTSQEDQEMLSR.4b8_1.heavy 890.944 / 1048.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 1781 228 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19214.[MT7]-LFQVSTLDAALSGTLSGVEGFTSQEDQEMLSR.4b4_1.heavy 890.944 / 632.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 1783 228 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19214.[MT7]-LFQVSTLDAALSGTLSGVEGFTSQEDQEMLSR.4y6_1.heavy 890.944 / 763.377 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 1785 228 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19214.[MT7]-LFQVSTLDAALSGTLSGVEGFTSQEDQEMLSR.4b3_1.heavy 890.944 / 533.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 1787 229 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19212.[MT7]-DIVSIQELIEVEEEEEILLNSYTTPSK[MT7].4b8_1.heavy 852.95 / 1042.59 1301.0 49.891300201416016 48 18 10 10 10 3.705665150725131 21.14958220164109 0.0 3 0.9887045738699843 11.601159976127583 1301.0 44.74437733732236 0.0 - - - - - - - 73.4 2 10 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1789 229 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19212.[MT7]-DIVSIQELIEVEEEEEILLNSYTTPSK[MT7].4b7_1.heavy 852.95 / 929.506 2574.0 49.891300201416016 48 18 10 10 10 3.705665150725131 21.14958220164109 0.0 3 0.9887045738699843 11.601159976127583 2574.0 16.012941176470587 0.0 - - - - - - - 107.07142857142857 5 14 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1791 229 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19212.[MT7]-DIVSIQELIEVEEEEEILLNSYTTPSK[MT7].4b4_1.heavy 852.95 / 559.321 1103.0 49.891300201416016 48 18 10 10 10 3.705665150725131 21.14958220164109 0.0 3 0.9887045738699843 11.601159976127583 1103.0 10.18043548911277 1.0 - - - - - - - 85.0 2 14 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1793 229 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19212.[MT7]-DIVSIQELIEVEEEEEILLNSYTTPSK[MT7].4b6_1.heavy 852.95 / 800.463 707.0 49.891300201416016 48 18 10 10 10 3.705665150725131 21.14958220164109 0.0 3 0.9887045738699843 11.601159976127583 707.0 6.34194559268747 1.0 - - - - - - - 119.28571428571429 2 14 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1795 230 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19210.[MT7]-K[MT7]LDSLTTSFGFPVGAATLVDEVGVDVAK[MT7].3y3_1.heavy 1090.27 / 461.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1797 230 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19210.[MT7]-K[MT7]LDSLTTSFGFPVGAATLVDEVGVDVAK[MT7].3y4_1.heavy 1090.27 / 576.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1799 230 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19210.[MT7]-K[MT7]LDSLTTSFGFPVGAATLVDEVGVDVAK[MT7].3b10_2.heavy 1090.27 / 669.879 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1801 230 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19210.[MT7]-K[MT7]LDSLTTSFGFPVGAATLVDEVGVDVAK[MT7].3y10_1.heavy 1090.27 / 1174.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1803 231 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18521.[MT7]-EQGITLR.2y5_1.heavy 480.783 / 559.356 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 1805 231 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18521.[MT7]-EQGITLR.2b4_1.heavy 480.783 / 572.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 1807 231 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18521.[MT7]-EQGITLR.2y6_1.heavy 480.783 / 687.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 1809 231 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18521.[MT7]-EQGITLR.2b5_1.heavy 480.783 / 673.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 1811 232 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19005.[MT7]-YLQLAEELIRPER.3y11_2.heavy 592.004 / 677.378 14595.0 43.47232532501221 33 10 10 3 10 0.8263485821448979 74.11056629165722 0.06669998168945312 3 0.8422879772525947 3.065840665678821 14595.0 86.41892523364486 0.0 - - - - - - - 210.375 29 16 MCM6 minichromosome maintenance complex component 6 1813 232 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19005.[MT7]-YLQLAEELIRPER.3b4_1.heavy 592.004 / 662.399 6201.0 43.47232532501221 33 10 10 3 10 0.8263485821448979 74.11056629165722 0.06669998168945312 3 0.8422879772525947 3.065840665678821 6201.0 46.62614158163265 0.0 - - - - - - - 232.71428571428572 12 14 MCM6 minichromosome maintenance complex component 6 1815 232 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19005.[MT7]-YLQLAEELIRPER.3b5_1.heavy 592.004 / 733.437 8072.0 43.47232532501221 33 10 10 3 10 0.8263485821448979 74.11056629165722 0.06669998168945312 3 0.8422879772525947 3.065840665678821 8072.0 47.43066400644055 0.0 - - - - - - - 246.69230769230768 16 13 MCM6 minichromosome maintenance complex component 6 1817 232 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19005.[MT7]-YLQLAEELIRPER.3b3_1.heavy 592.004 / 549.315 11868.0 43.47232532501221 33 10 10 3 10 0.8263485821448979 74.11056629165722 0.06669998168945312 3 0.8422879772525947 3.065840665678821 11868.0 46.58785509938407 0.0 - - - - - - - 230.375 23 16 MCM6 minichromosome maintenance complex component 6 1819 233 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18909.[MT7]-FRYELQIQK[MT7].3b6_1.heavy 504.964 / 981.527 4032.0 30.78260040283203 25 5 0 10 10 0.8573511041662034 76.87277378202751 0.0 3 0.6900120526223359 2.156616182102298 4032.0 51.35094339622642 0.0 - - - - - - - 166.57142857142858 8 7 IL3RA interleukin 3 receptor, alpha (low affinity) 1821 233 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18909.[MT7]-FRYELQIQK[MT7].3y3_1.heavy 504.964 / 532.357 35225.0 30.78260040283203 25 5 0 10 10 0.8573511041662034 76.87277378202751 0.0 3 0.6900120526223359 2.156616182102298 35225.0 30.111613437676255 1.0 - - - - - - - 756.25 414 8 IL3RA interleukin 3 receptor, alpha (low affinity) 1823 233 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18909.[MT7]-FRYELQIQK[MT7].3b4_1.heavy 504.964 / 740.385 8594.0 30.78260040283203 25 5 0 10 10 0.8573511041662034 76.87277378202751 0.0 3 0.6900120526223359 2.156616182102298 8594.0 18.220494699646647 0.0 - - - - - - - 183.73333333333332 17 15 IL3RA interleukin 3 receptor, alpha (low affinity) 1825 233 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18909.[MT7]-FRYELQIQK[MT7].3b5_1.heavy 504.964 / 853.469 7321.0 30.78260040283203 25 5 0 10 10 0.8573511041662034 76.87277378202751 0.0 3 0.6900120526223359 2.156616182102298 7321.0 13.32727896625915 1.0 - - - - - - - 192.72727272727272 15 11 IL3RA interleukin 3 receptor, alpha (low affinity) 1827 234 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533359.[MT7]-LASPELER.2y5_1.heavy 529.802 / 643.341 22778.0 26.512300491333008 50 20 10 10 10 11.446451942302692 8.73633161647494 0.0 3 0.9950894138124249 17.604261882790553 22778.0 49.08652459016393 0.0 - - - - - - - 621.2222222222222 45 9 JUN;JUND jun proto-oncogene;jun D proto-oncogene 1829 234 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533359.[MT7]-LASPELER.2y6_1.heavy 529.802 / 730.373 15050.0 26.512300491333008 50 20 10 10 10 11.446451942302692 8.73633161647494 0.0 3 0.9950894138124249 17.604261882790553 15050.0 14.647598402471209 1.0 - - - - - - - 271.1666666666667 37 12 JUN;JUND jun proto-oncogene;jun D proto-oncogene 1831 234 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533359.[MT7]-LASPELER.2b5_1.heavy 529.802 / 642.358 14338.0 26.512300491333008 50 20 10 10 10 11.446451942302692 8.73633161647494 0.0 3 0.9950894138124249 17.604261882790553 14338.0 23.388244312171285 0.0 - - - - - - - 193.3 28 10 JUN;JUND jun proto-oncogene;jun D proto-oncogene 1833 234 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533359.[MT7]-LASPELER.2y7_1.heavy 529.802 / 801.41 48504.0 26.512300491333008 50 20 10 10 10 11.446451942302692 8.73633161647494 0.0 3 0.9950894138124249 17.604261882790553 48504.0 142.4904393442623 0.0 - - - - - - - 580.7142857142857 97 7 JUN;JUND jun proto-oncogene;jun D proto-oncogene 1835 235 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533482.[MT7]-ILQEGVDPK[MT7].3y3_1.heavy 429.59 / 503.295 6514.0 27.57254981994629 46 20 10 6 10 5.927920731868112 16.8693213899448 0.035400390625 3 0.9937443504047642 15.595507184530586 6514.0 22.538399231707185 0.0 - - - - - - - 229.0909090909091 13 11 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1837 235 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533482.[MT7]-ILQEGVDPK[MT7].3b4_1.heavy 429.59 / 628.379 5358.0 27.57254981994629 46 20 10 6 10 5.927920731868112 16.8693213899448 0.035400390625 3 0.9937443504047642 15.595507184530586 5358.0 24.077624739138688 1.0 - - - - - - - 210.0 10 10 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1839 235 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533482.[MT7]-ILQEGVDPK[MT7].3b5_1.heavy 429.59 / 685.4 23535.0 27.57254981994629 46 20 10 6 10 5.927920731868112 16.8693213899448 0.035400390625 3 0.9937443504047642 15.595507184530586 23535.0 84.76023948964652 0.0 - - - - - - - 190.9090909090909 47 11 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1841 235 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533482.[MT7]-ILQEGVDPK[MT7].3b3_1.heavy 429.59 / 499.336 23535.0 27.57254981994629 46 20 10 6 10 5.927920731868112 16.8693213899448 0.035400390625 3 0.9937443504047642 15.595507184530586 23535.0 32.32919264850672 0.0 - - - - - - - 315.0 47 9 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1843 236 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18517.[MT7]-EIPLAK[MT7].2y4_1.heavy 479.812 / 572.389 39252.0 26.68829917907715 41 17 10 10 4 1.4216218271952714 41.35412558492158 0.0 7 0.9779812871679161 8.301685675119026 39252.0 64.35217779936846 0.0 - - - - - - - 670.2222222222222 78 9 MCM6 minichromosome maintenance complex component 6 1845 236 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18517.[MT7]-EIPLAK[MT7].2y5_1.heavy 479.812 / 685.473 6644.0 26.68829917907715 41 17 10 10 4 1.4216218271952714 41.35412558492158 0.0 7 0.9779812871679161 8.301685675119026 6644.0 10.401565557729942 1.0 - - - - - - - 248.0 20 7 MCM6 minichromosome maintenance complex component 6 1847 236 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18517.[MT7]-EIPLAK[MT7].2y3_1.heavy 479.812 / 475.336 4702.0 26.68829917907715 41 17 10 10 4 1.4216218271952714 41.35412558492158 0.0 7 0.9779812871679161 8.301685675119026 4702.0 2.3453253364695117 6.0 - - - - - - - 1285.0 11 7 MCM6 minichromosome maintenance complex component 6 1849 237 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18511.[MT7]-QQVYK[MT7].2b3_1.heavy 477.287 / 500.295 1657.0 17.36389923095703 43 13 10 10 10 1.7031711499995261 46.71348340617807 0.0 3 0.9268656085281283 4.535430334084379 1657.0 7.565860230053648 0.0 - - - - - - - 194.47368421052633 3 19 AKAP9;HADHA A kinase (PRKA) anchor protein (yotiao) 9;hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1851 237 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18511.[MT7]-QQVYK[MT7].2y4_1.heavy 477.287 / 681.405 3030.0 17.36389923095703 43 13 10 10 10 1.7031711499995261 46.71348340617807 0.0 3 0.9268656085281283 4.535430334084379 3030.0 36.75488721804511 0.0 - - - - - - - 135.63636363636363 6 22 AKAP9;HADHA A kinase (PRKA) anchor protein (yotiao) 9;hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1853 237 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18511.[MT7]-QQVYK[MT7].2b4_1.heavy 477.287 / 663.358 1515.0 17.36389923095703 43 13 10 10 10 1.7031711499995261 46.71348340617807 0.0 3 0.9268656085281283 4.535430334084379 1515.0 3.386832789786788 0.0 - - - - - - - 159.1818181818182 3 22 AKAP9;HADHA A kinase (PRKA) anchor protein (yotiao) 9;hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1855 237 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18511.[MT7]-QQVYK[MT7].2y3_1.heavy 477.287 / 553.347 2414.0 17.36389923095703 43 13 10 10 10 1.7031711499995261 46.71348340617807 0.0 3 0.9268656085281283 4.535430334084379 2414.0 9.35 0.0 - - - - - - - 201.78947368421052 4 19 AKAP9;HADHA A kinase (PRKA) anchor protein (yotiao) 9;hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1857 238 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533682.[MT7]-TLQEVTQLSQEAQR.3y7_1.heavy 592.319 / 831.432 46229.0 32.407501220703125 46 16 10 10 10 2.8283395876865005 27.563632291118722 0.0 3 0.9636573398646194 6.454013601482715 46229.0 137.03960895616524 0.0 - - - - - - - 215.85714285714286 92 7 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1859 238 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533682.[MT7]-TLQEVTQLSQEAQR.3y6_1.heavy 592.319 / 718.348 143925.0 32.407501220703125 46 16 10 10 10 2.8283395876865005 27.563632291118722 0.0 3 0.9636573398646194 6.454013601482715 143925.0 147.34669494631086 0.0 - - - - - - - 285.5 287 6 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1861 238 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533682.[MT7]-TLQEVTQLSQEAQR.3b4_1.heavy 592.319 / 616.342 116731.0 32.407501220703125 46 16 10 10 10 2.8283395876865005 27.563632291118722 0.0 3 0.9636573398646194 6.454013601482715 116731.0 163.05251220651655 0.0 - - - - - - - 302.14285714285717 233 7 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1863 238 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533682.[MT7]-TLQEVTQLSQEAQR.3b5_1.heavy 592.319 / 715.411 67884.0 32.407501220703125 46 16 10 10 10 2.8283395876865005 27.563632291118722 0.0 3 0.9636573398646194 6.454013601482715 67884.0 170.1645670239164 0.0 - - - - - - - 287.57142857142856 135 7 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1865 239 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19208.[MT7]-AQDTAELFFEDIRLPASALLGEENK[MT7].3b6_1.heavy 1022.54 / 760.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 1867 239 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19208.[MT7]-AQDTAELFFEDIRLPASALLGEENK[MT7].3y20_2.heavy 1022.54 / 1218.15 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 1869 239 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19208.[MT7]-AQDTAELFFEDIRLPASALLGEENK[MT7].3b4_1.heavy 1022.54 / 560.28 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 1871 239 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19208.[MT7]-AQDTAELFFEDIRLPASALLGEENK[MT7].3b7_1.heavy 1022.54 / 873.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 1873 240 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19207.[MT7]-AQDTAELFFEDIRLPASALLGEENK[MT7].4y5_1.heavy 767.156 / 720.364 23495.0 48.0226993560791 37 11 10 6 10 1.7106848404386288 58.45612098506669 0.03440093994140625 3 0.8669402521012496 3.3450410437018077 23495.0 342.4077519379845 0.0 - - - - - - - 172.95238095238096 46 21 ACADL acyl-CoA dehydrogenase, long chain 1875 240 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19207.[MT7]-AQDTAELFFEDIRLPASALLGEENK[MT7].4b7_1.heavy 767.156 / 873.443 5239.0 48.0226993560791 37 11 10 6 10 1.7106848404386288 58.45612098506669 0.03440093994140625 3 0.8669402521012496 3.3450410437018077 5239.0 19.585046728971964 0.0 - - - - - - - 149.85714285714286 10 21 ACADL acyl-CoA dehydrogenase, long chain 1877 240 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19207.[MT7]-AQDTAELFFEDIRLPASALLGEENK[MT7].4b4_1.heavy 767.156 / 560.28 2186.0 48.0226993560791 37 11 10 6 10 1.7106848404386288 58.45612098506669 0.03440093994140625 3 0.8669402521012496 3.3450410437018077 2186.0 7.172225281472577 0.0 - - - - - - - 208.05263157894737 4 19 ACADL acyl-CoA dehydrogenase, long chain 1879 240 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19207.[MT7]-AQDTAELFFEDIRLPASALLGEENK[MT7].4b6_1.heavy 767.156 / 760.359 5946.0 48.0226993560791 37 11 10 6 10 1.7106848404386288 58.45612098506669 0.03440093994140625 3 0.8669402521012496 3.3450410437018077 5946.0 72.4118532428138 0.0 - - - - - - - 150.5 11 22 ACADL acyl-CoA dehydrogenase, long chain 1881 241 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41983.[MT7]-AAVNVVDFDDK[MT7].2y4_1.heavy 740.898 / 668.337 3036.0 31.341050148010254 38 15 9 6 8 2.5585986303344406 33.94987888176085 0.038600921630859375 4 0.9590591712020955 6.078425639394185 3036.0 16.693129003893983 0.0 - - - - - - - 240.8 6 10 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1883 241 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41983.[MT7]-AAVNVVDFDDK[MT7].2y5_1.heavy 740.898 / 783.364 2722.0 31.341050148010254 38 15 9 6 8 2.5585986303344406 33.94987888176085 0.038600921630859375 4 0.9590591712020955 6.078425639394185 2722.0 31.923496924128504 0.0 - - - - - - - 225.46153846153845 5 13 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1885 241 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41983.[MT7]-AAVNVVDFDDK[MT7].2b4_1.heavy 740.898 / 500.295 4607.0 31.341050148010254 38 15 9 6 8 2.5585986303344406 33.94987888176085 0.038600921630859375 4 0.9590591712020955 6.078425639394185 4607.0 50.992950558213714 0.0 - - - - - - - 228.45454545454547 9 11 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1887 241 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41983.[MT7]-AAVNVVDFDDK[MT7].2y6_1.heavy 740.898 / 882.432 2932.0 31.341050148010254 38 15 9 6 8 2.5585986303344406 33.94987888176085 0.038600921630859375 4 0.9590591712020955 6.078425639394185 2932.0 28.323991507430996 1.0 - - - - - - - 167.5 11 10 FBXW11;BTRC F-box and WD repeat domain containing 11;beta-transducin repeat containing 1889 242 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18615.[MT7]-DLVVPEK[MT7].2y4_1.heavy 544.334 / 616.379 N/A 27.067399978637695 35 11 10 10 4 2.0723669281390555 48.25400301567156 0.0 10 0.8584405730984767 3.2406443003888277 4451.0 3.1658886239137645 2.0 - - - - - - - 241.88888888888889 9 9 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 1891 242 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18615.[MT7]-DLVVPEK[MT7].2b4_1.heavy 544.334 / 571.357 9315.0 27.067399978637695 35 11 10 10 4 2.0723669281390555 48.25400301567156 0.0 10 0.8584405730984767 3.2406443003888277 9315.0 16.55418618266979 0.0 - - - - - - - 349.625 18 8 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 1893 242 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18615.[MT7]-DLVVPEK[MT7].2y3_1.heavy 544.334 / 517.31 11800.0 27.067399978637695 35 11 10 10 4 2.0723669281390555 48.25400301567156 0.0 10 0.8584405730984767 3.2406443003888277 11800.0 16.04278812974465 0.0 - - - - - - - 1207.6666666666667 23 9 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 1895 242 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18615.[MT7]-DLVVPEK[MT7].2y6_1.heavy 544.334 / 828.531 621.0 27.067399978637695 35 11 10 10 4 2.0723669281390555 48.25400301567156 0.0 10 0.8584405730984767 3.2406443003888277 621.0 2.31 12.0 - - - - - - - 273.7857142857143 4 14 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 1897 243 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18673.[MT7]-C[CAM]SHSGGEER.2y8_1.heavy 581.755 / 858.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 1899 243 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18673.[MT7]-C[CAM]SHSGGEER.2y5_1.heavy 581.755 / 547.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 1901 243 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18673.[MT7]-C[CAM]SHSGGEER.2y6_1.heavy 581.755 / 634.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 1903 243 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18673.[MT7]-C[CAM]SHSGGEER.2y7_1.heavy 581.755 / 771.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADL acyl-CoA dehydrogenase, long chain 1905 244 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36811.[MT7]-RAISTPETPLTK[MT7].3b11_2.heavy 534.654 / 656.373 4332.0 25.4237003326416 46 16 10 10 10 25.77434674530462 3.8798267513110596 0.0 3 0.965500041130455 6.625162159291979 4332.0 9.627804355362265 0.0 - - - - - - - 232.53846153846155 8 13 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1907 244 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36811.[MT7]-RAISTPETPLTK[MT7].3y3_1.heavy 534.654 / 505.347 21360.0 25.4237003326416 46 16 10 10 10 25.77434674530462 3.8798267513110596 0.0 3 0.965500041130455 6.625162159291979 21360.0 10.741287434318965 1.0 - - - - - - - 604.6666666666666 43 9 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1909 244 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36811.[MT7]-RAISTPETPLTK[MT7].3b5_1.heavy 534.654 / 673.411 20856.0 25.4237003326416 46 16 10 10 10 25.77434674530462 3.8798267513110596 0.0 3 0.965500041130455 6.625162159291979 20856.0 121.76652522395096 0.0 - - - - - - - 247.45454545454547 41 11 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1911 244 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36811.[MT7]-RAISTPETPLTK[MT7].3y4_1.heavy 534.654 / 602.399 57732.0 25.4237003326416 46 16 10 10 10 25.77434674530462 3.8798267513110596 0.0 3 0.965500041130455 6.625162159291979 57732.0 98.91134543851173 0.0 - - - - - - - 214.1875 115 16 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1913 245 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18773.[MT7]-GIYPSETFTR.2y6_1.heavy 657.844 / 740.357 N/A 30.03190040588379 46 20 10 10 6 10.169253056423232 9.833563925015785 0.0 5 0.9966486592601048 21.31236832435975 832.0 1.2000000000000002 2.0 - - - - - - - 0.0 1 0 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 1915 245 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18773.[MT7]-GIYPSETFTR.2y4_1.heavy 657.844 / 524.283 1144.0 30.03190040588379 46 20 10 10 6 10.169253056423232 9.833563925015785 0.0 5 0.9966486592601048 21.31236832435975 1144.0 10.120000000000001 2.0 - - - - - - - 200.57142857142858 2 14 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 1917 245 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18773.[MT7]-GIYPSETFTR.2y8_1.heavy 657.844 / 1000.47 2183.0 30.03190040588379 46 20 10 10 6 10.169253056423232 9.833563925015785 0.0 5 0.9966486592601048 21.31236832435975 2183.0 20.360511550300412 1.0 - - - - - - - 208.0 5 5 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 1919 245 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18773.[MT7]-GIYPSETFTR.2y7_1.heavy 657.844 / 837.41 8629.0 30.03190040588379 46 20 10 10 6 10.169253056423232 9.833563925015785 0.0 5 0.9966486592601048 21.31236832435975 8629.0 35.12445512820513 0.0 - - - - - - - 208.0 17 10 MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) 1921 246 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18772.[MT7]-FRYLIGEK[MT7].3y3_1.heavy 438.599 / 477.279 52674.0 31.12019920349121 48 18 10 10 10 2.0988710695043222 34.89278708531846 0.0 3 0.9889426417245546 11.725616503066965 52674.0 104.35415094339623 0.0 - - - - - - - 808.25 105 8 LDHC lactate dehydrogenase C 1923 246 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18772.[MT7]-FRYLIGEK[MT7].3b4_1.heavy 438.599 / 724.426 5723.0 31.12019920349121 48 18 10 10 10 2.0988710695043222 34.89278708531846 0.0 3 0.9889426417245546 11.725616503066965 5723.0 29.01992924528302 0.0 - - - - - - - 176.66666666666666 11 6 LDHC lactate dehydrogenase C 1925 246 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18772.[MT7]-FRYLIGEK[MT7].3b3_1.heavy 438.599 / 611.342 N/A 31.12019920349121 48 18 10 10 10 2.0988710695043222 34.89278708531846 0.0 3 0.9889426417245546 11.725616503066965 1060.0 1.3285714285714285 2.0 - - - - - - - 273.8333333333333 3 12 LDHC lactate dehydrogenase C 1927 246 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18772.[MT7]-FRYLIGEK[MT7].3y4_1.heavy 438.599 / 590.363 12082.0 31.12019920349121 48 18 10 10 10 2.0988710695043222 34.89278708531846 0.0 3 0.9889426417245546 11.725616503066965 12082.0 11.333069626743232 0.0 - - - - - - - 742.0 24 8 LDHC lactate dehydrogenase C 1929 247 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18771.[MT7]-NFTGSSALLTR.2y8_1.heavy 655.863 / 804.457 N/A 30.45599937438965 47 17 10 10 10 3.2823164358028194 30.46628865797976 0.0 3 0.9782078313305789 8.344883711145368 4847.0 5.863933791172306 0.0 - - - - - - - 195.28571428571428 9 7 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1931 247 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18771.[MT7]-NFTGSSALLTR.2b4_1.heavy 655.863 / 564.29 1686.0 30.45599937438965 47 17 10 10 10 3.2823164358028194 30.46628865797976 0.0 3 0.9782078313305789 8.344883711145368 1686.0 7.511090047393364 0.0 - - - - - - - 263.3333333333333 3 18 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1933 247 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18771.[MT7]-NFTGSSALLTR.2y9_1.heavy 655.863 / 905.505 4320.0 30.45599937438965 47 17 10 10 10 3.2823164358028194 30.46628865797976 0.0 3 0.9782078313305789 8.344883711145368 4320.0 8.111392405063292 0.0 - - - - - - - 245.8 8 15 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1935 247 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18771.[MT7]-NFTGSSALLTR.2y10_1.heavy 655.863 / 1052.57 5374.0 30.45599937438965 47 17 10 10 10 3.2823164358028194 30.46628865797976 0.0 3 0.9782078313305789 8.344883711145368 5374.0 52.849192284508746 0.0 - - - - - - - 219.41666666666666 10 12 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 1937 248 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42126.[MT7]-ELRDEEQTAESIK[MT7].2b4_1.heavy 918.483 / 658.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1939 248 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42126.[MT7]-ELRDEEQTAESIK[MT7].2y3_1.heavy 918.483 / 491.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1941 248 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42126.[MT7]-ELRDEEQTAESIK[MT7].2b6_1.heavy 918.483 / 916.449 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1943 248 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42126.[MT7]-ELRDEEQTAESIK[MT7].2y6_1.heavy 918.483 / 792.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM6 minichromosome maintenance complex component 6 1945 249 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42220.[MT7]-DLFVANVQSFPPAPEDK[MT7].3b6_1.heavy 721.384 / 804.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB1 arrestin, beta 1 1947 249 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42220.[MT7]-DLFVANVQSFPPAPEDK[MT7].3b4_1.heavy 721.384 / 619.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB1 arrestin, beta 1 1949 249 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42220.[MT7]-DLFVANVQSFPPAPEDK[MT7].3b3_1.heavy 721.384 / 520.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB1 arrestin, beta 1 1951 249 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB42220.[MT7]-DLFVANVQSFPPAPEDK[MT7].3y5_1.heavy 721.384 / 703.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB1 arrestin, beta 1 1953 250 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18917.[MT7]-VSGVDGYETEGIR.2y8_1.heavy 763.384 / 924.442 2417.0 27.528200149536133 46 16 10 10 10 3.544188715653239 28.215201848124146 0.0 3 0.9665054906132811 6.724435610984704 2417.0 13.044126984126985 0.0 - - - - - - - 248.1818181818182 4 11 MCM6 minichromosome maintenance complex component 6 1955 250 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18917.[MT7]-VSGVDGYETEGIR.2y5_1.heavy 763.384 / 575.315 N/A 27.528200149536133 46 16 10 10 10 3.544188715653239 28.215201848124146 0.0 3 0.9665054906132811 6.724435610984704 841.0 7.475555555555555 1.0 - - - - - - - 0.0 1 0 MCM6 minichromosome maintenance complex component 6 1957 250 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18917.[MT7]-VSGVDGYETEGIR.2y9_1.heavy 763.384 / 1039.47 1681.0 27.528200149536133 46 16 10 10 10 3.544188715653239 28.215201848124146 0.0 3 0.9665054906132811 6.724435610984704 1681.0 25.615238095238094 0.0 - - - - - - - 210.0 3 7 MCM6 minichromosome maintenance complex component 6 1959 250 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18917.[MT7]-VSGVDGYETEGIR.2y11_1.heavy 763.384 / 1195.56 1156.0 27.528200149536133 46 16 10 10 10 3.544188715653239 28.215201848124146 0.0 3 0.9665054906132811 6.724435610984704 1156.0 7.706666666666666 0.0 - - - - - - - 186.66666666666666 2 9 MCM6 minichromosome maintenance complex component 6 1961 251 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533368.[MT7]-FVDFQK[MT7].2b3_1.heavy 536.307 / 506.273 N/A 22.470866521199543 40 20 4 6 10 7.471022933149065 13.385047923798783 0.03700065612792969 3 0.994486697153555 16.613330703808167 10277.0 13.899761347276984 1.0 - - - - - - - 663.5 35 8 MCM6 minichromosome maintenance complex component 6 1963 251 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533368.[MT7]-FVDFQK[MT7].2y4_1.heavy 536.307 / 681.369 6717.0 22.470866521199543 40 20 4 6 10 7.471022933149065 13.385047923798783 0.03700065612792969 3 0.994486697153555 16.613330703808167 6717.0 16.796366171241463 0.0 - - - - - - - 241.8 13 10 MCM6 minichromosome maintenance complex component 6 1965 251 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533368.[MT7]-FVDFQK[MT7].2y5_1.heavy 536.307 / 780.437 5777.0 22.470866521199543 40 20 4 6 10 7.471022933149065 13.385047923798783 0.03700065612792969 3 0.994486697153555 16.613330703808167 5777.0 35.191436216348905 0.0 - - - - - - - 225.57142857142858 11 14 MCM6 minichromosome maintenance complex component 6 1967 251 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533368.[MT7]-FVDFQK[MT7].2y3_1.heavy 536.307 / 566.342 7658.0 22.470866521199543 40 20 4 6 10 7.471022933149065 13.385047923798783 0.03700065612792969 3 0.994486697153555 16.613330703808167 7658.0 6.5174468085106385 1.0 - - - - - - - 241.8 15 15 MCM6 minichromosome maintenance complex component 6 1969 252 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18607.[MT7]-EIQYLK[MT7].2b3_1.heavy 541.328 / 515.295 N/A 27.958900451660156 47 17 10 10 10 2.307048179776522 34.71813793490959 0.0 3 0.9701866558560068 7.129713783303506 8547.0 1.9133034857691076 2.0 - - - - - - - 938.0 17 1 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1971 252 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18607.[MT7]-EIQYLK[MT7].2y5_1.heavy 541.328 / 808.505 8025.0 27.958900451660156 47 17 10 10 10 2.307048179776522 34.71813793490959 0.0 3 0.9701866558560068 7.129713783303506 8025.0 32.953706900122896 0.0 - - - - - - - 236.13333333333333 16 15 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1973 252 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18607.[MT7]-EIQYLK[MT7].2b4_1.heavy 541.328 / 678.358 6254.0 27.958900451660156 47 17 10 10 10 2.307048179776522 34.71813793490959 0.0 3 0.9701866558560068 7.129713783303506 6254.0 20.387263772420418 0.0 - - - - - - - 299.5625 12 16 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1975 252 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18607.[MT7]-EIQYLK[MT7].2y3_1.heavy 541.328 / 567.362 7296.0 27.958900451660156 47 17 10 10 10 2.307048179776522 34.71813793490959 0.0 3 0.9701866558560068 7.129713783303506 7296.0 71.30998153846154 0.0 - - - - - - - 653.8181818181819 14 11 ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) 1977 253 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36417.[MT7]-AVYTSGK[MT7].2y4_1.heavy 507.297 / 536.316 3914.0 18.316999435424805 44 14 10 10 10 4.3955254120509135 22.750408796599558 0.0 3 0.9486740674563823 5.423987342077505 3914.0 12.401956594323874 0.0 - - - - - - - 203.3684210526316 7 19 MCM6 minichromosome maintenance complex component 6 1979 253 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36417.[MT7]-AVYTSGK[MT7].2y5_1.heavy 507.297 / 699.379 3868.0 18.316999435424805 44 14 10 10 10 4.3955254120509135 22.750408796599558 0.0 3 0.9486740674563823 5.423987342077505 3868.0 41.202608695652174 0.0 - - - - - - - 135.44444444444446 7 18 MCM6 minichromosome maintenance complex component 6 1981 253 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36417.[MT7]-AVYTSGK[MT7].2y3_1.heavy 507.297 / 435.268 1473.0 18.316999435424805 44 14 10 10 10 4.3955254120509135 22.750408796599558 0.0 3 0.9486740674563823 5.423987342077505 1473.0 2.301902173913043 2.0 - - - - - - - 262.47058823529414 4 17 MCM6 minichromosome maintenance complex component 6 1983 253 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB36417.[MT7]-AVYTSGK[MT7].2y6_1.heavy 507.297 / 798.448 2532.0 18.316999435424805 44 14 10 10 10 4.3955254120509135 22.750408796599558 0.0 3 0.9486740674563823 5.423987342077505 2532.0 19.265217391304347 0.0 - - - - - - - 134.0 5 23 MCM6 minichromosome maintenance complex component 6 1985 254 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41656.[MT7]-THIC[CAM]VTR.2y6_1.heavy 515.783 / 785.409 1465.0 18.243900299072266 50 20 10 10 10 44.92656330692916 2.2258546534445625 0.0 3 0.9998556700367164 102.72564943679554 1465.0 19.94110997500568 0.0 - - - - - - - 120.38888888888889 2 18 ACADL acyl-CoA dehydrogenase, long chain 1987 254 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41656.[MT7]-THIC[CAM]VTR.2y4_1.heavy 515.783 / 535.266 1085.0 18.243900299072266 50 20 10 10 10 44.92656330692916 2.2258546534445625 0.0 3 0.9998556700367164 102.72564943679554 1085.0 8.678027720972505 0.0 - - - - - - - 120.33333333333333 2 18 ACADL acyl-CoA dehydrogenase, long chain 1989 254 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41656.[MT7]-THIC[CAM]VTR.2y5_1.heavy 515.783 / 648.35 1248.0 18.243900299072266 50 20 10 10 10 44.92656330692916 2.2258546534445625 0.0 3 0.9998556700367164 102.72564943679554 1248.0 3.0625766871165645 0.0 - - - - - - - 165.76470588235293 2 17 ACADL acyl-CoA dehydrogenase, long chain 1991 254 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB41656.[MT7]-THIC[CAM]VTR.2y3_1.heavy 515.783 / 375.235 N/A 18.243900299072266 50 20 10 10 10 44.92656330692916 2.2258546534445625 0.0 3 0.9998556700367164 102.72564943679554 108.0 0.5115821742832812 38.0 - - - - - - - 0.0 1 0 ACADL acyl-CoA dehydrogenase, long chain 1993 255 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18767.[MT7]-IEELGSELK[MT7].2b3_1.heavy 653.379 / 516.279 2166.0 32.11750030517578 42 12 10 10 10 1.0076139981281749 59.43640424352546 0.0 3 0.8928066826891388 3.7352569685865986 2166.0 8.25411156790418 1.0 - - - - - - - 184.0 4 14 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1995 255 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18767.[MT7]-IEELGSELK[MT7].2y8_1.heavy 653.379 / 1048.56 1341.0 32.11750030517578 42 12 10 10 10 1.0076139981281749 59.43640424352546 0.0 3 0.8928066826891388 3.7352569685865986 1341.0 7.3342718446601936 0.0 - - - - - - - 206.0 2 9 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1997 255 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18767.[MT7]-IEELGSELK[MT7].2y5_1.heavy 653.379 / 677.395 3919.0 32.11750030517578 42 12 10 10 10 1.0076139981281749 59.43640424352546 0.0 3 0.8928066826891388 3.7352569685865986 3919.0 13.913891765542314 0.0 - - - - - - - 269.61538461538464 7 13 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 1999 255 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18767.[MT7]-IEELGSELK[MT7].2y6_1.heavy 653.379 / 790.479 1031.0 32.11750030517578 42 12 10 10 10 1.0076139981281749 59.43640424352546 0.0 3 0.8928066826891388 3.7352569685865986 1031.0 2.383877380205064 3.0 - - - - - - - 213.5 8 14 POLA2 polymerase (DNA directed), alpha 2 (70kD subunit) 2001 256 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533262.[MT7]-ELC[CAM]VK[MT7].2b3_1.heavy 468.775 / 547.267 N/A 22.9424991607666 30 14 2 10 4 2.0802448114868715 39.23946919823231 0.0 7 0.9480271290005754 5.389827564894877 1504.0 1.049912739965096 3.0 - - - - - - - 644.2857142857143 17 7 SMG5;BTRC Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans);beta-transducin repeat containing 2003 256 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533262.[MT7]-ELC[CAM]VK[MT7].2y4_1.heavy 468.775 / 663.398 4082.0 22.9424991607666 30 14 2 10 4 2.0802448114868715 39.23946919823231 0.0 7 0.9480271290005754 5.389827564894877 4082.0 24.350400155904897 0.0 - - - - - - - 210.94444444444446 8 18 SMG5;BTRC Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans);beta-transducin repeat containing 2005 256 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533262.[MT7]-ELC[CAM]VK[MT7].2b4_1.heavy 468.775 / 646.335 1074.0 22.9424991607666 30 14 2 10 4 2.0802448114868715 39.23946919823231 0.0 7 0.9480271290005754 5.389827564894877 1074.0 0.9958325024925223 12.0 - - - - - - - 613.7142857142857 3 7 SMG5;BTRC Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans);beta-transducin repeat containing 2007 256 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533262.[MT7]-ELC[CAM]VK[MT7].2y3_1.heavy 468.775 / 550.314 2291.0 22.9424991607666 30 14 2 10 4 2.0802448114868715 39.23946919823231 0.0 7 0.9480271290005754 5.389827564894877 2291.0 3.71243738244255 2.0 - - - - - - - 632.3333333333334 6 12 SMG5;BTRC Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans);beta-transducin repeat containing 2009 257 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19006.[MT7]-TLQEVTQLSQEAQR.2b3_1.heavy 887.974 / 487.3 4996.0 32.38370132446289 43 18 10 5 10 4.290417407013456 23.307755519668568 0.04759979248046875 3 0.9879530844466151 11.232785822362997 4996.0 41.1435294117647 0.0 - - - - - - - 147.33333333333334 9 9 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 2011 257 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19006.[MT7]-TLQEVTQLSQEAQR.2b4_1.heavy 887.974 / 616.342 9279.0 32.38370132446289 43 18 10 5 10 4.290417407013456 23.307755519668568 0.04759979248046875 3 0.9879530844466151 11.232785822362997 9279.0 50.03382352941176 0.0 - - - - - - - 226.66666666666666 18 9 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 2013 257 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19006.[MT7]-TLQEVTQLSQEAQR.2y9_1.heavy 887.974 / 1060.54 7749.0 32.38370132446289 43 18 10 5 10 4.290417407013456 23.307755519668568 0.04759979248046875 3 0.9879530844466151 11.232785822362997 7749.0 49.38088235294118 0.0 - - - - - - - 204.0 15 5 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 2015 257 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB19006.[MT7]-TLQEVTQLSQEAQR.2y10_1.heavy 887.974 / 1159.61 5812.0 32.38370132446289 43 18 10 5 10 4.290417407013456 23.307755519668568 0.04759979248046875 3 0.9879530844466151 11.232785822362997 5812.0 68.34798039215686 0.0 - - - - - - - 142.8 11 5 HADHA hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit 2017 258 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18764.[MT7]-FDMIFIVK[MT7].2b3_1.heavy 650.883 / 538.245 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 2019 258 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18764.[MT7]-FDMIFIVK[MT7].2y4_1.heavy 650.883 / 650.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 2021 258 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18764.[MT7]-FDMIFIVK[MT7].2y5_1.heavy 650.883 / 763.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 2023 258 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18764.[MT7]-FDMIFIVK[MT7].2y3_1.heavy 650.883 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM5 minichromosome maintenance complex component 5 2025 259 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533260.[MT7]-LFENLR.2y4_1.heavy 468.275 / 531.289 2341.0 33.720749855041504 40 20 10 6 4 15.238922455062799 6.562143766718702 0.038600921630859375 8 0.9962331879635616 20.10198642166512 2341.0 5.2488031639066115 6.0 - - - - - - - 204.9 14 10 HDAC1;HDAC2;PGM2 histone deacetylase 1;histone deacetylase 2;phosphoglucomutase 2 2027 259 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533260.[MT7]-LFENLR.2b3_1.heavy 468.275 / 534.304 2634.0 33.720749855041504 40 20 10 6 4 15.238922455062799 6.562143766718702 0.038600921630859375 8 0.9962331879635616 20.10198642166512 2634.0 4.908880425839077 2.0 - - - - - - - 312.26666666666665 7 15 HDAC1;HDAC2;PGM2 histone deacetylase 1;histone deacetylase 2;phosphoglucomutase 2 2029 259 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533260.[MT7]-LFENLR.2y5_1.heavy 468.275 / 678.357 8584.0 33.720749855041504 40 20 10 6 4 15.238922455062799 6.562143766718702 0.038600921630859375 8 0.9962331879635616 20.10198642166512 8584.0 27.15801036850217 0.0 - - - - - - - 253.8 17 15 HDAC1;HDAC2;PGM2 histone deacetylase 1;histone deacetylase 2;phosphoglucomutase 2 2031 259 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533260.[MT7]-LFENLR.2b4_1.heavy 468.275 / 648.347 2146.0 33.720749855041504 40 20 10 6 4 15.238922455062799 6.562143766718702 0.038600921630859375 8 0.9962331879635616 20.10198642166512 2146.0 19.708163265306123 3.0 - - - - - - - 251.0 6 14 HDAC1;HDAC2;PGM2 histone deacetylase 1;histone deacetylase 2;phosphoglucomutase 2 2033 260 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533265.[MT7]-GLYGIK[MT7].2y4_1.heavy 469.799 / 624.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA;LDHC lactate dehydrogenase A;lactate dehydrogenase C 2035 260 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533265.[MT7]-GLYGIK[MT7].2y5_1.heavy 469.799 / 737.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA;LDHC lactate dehydrogenase A;lactate dehydrogenase C 2037 260 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533265.[MT7]-GLYGIK[MT7].2b4_1.heavy 469.799 / 535.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA;LDHC lactate dehydrogenase A;lactate dehydrogenase C 2039 260 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533265.[MT7]-GLYGIK[MT7].2y3_1.heavy 469.799 / 461.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA;LDHC lactate dehydrogenase A;lactate dehydrogenase C 2041 261 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18601.[MT7]-RLPDGLTR.2y6_1.heavy 536.323 / 658.352 1315.0 23.78689956665039 44 18 10 10 6 3.429584116293225 24.790746776216796 0.0 5 0.9833111045781058 9.539875903078093 1315.0 1.4985754985754987 6.0 - - - - - - - 276.15 3 20 MCM5 minichromosome maintenance complex component 5 2043 261 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18601.[MT7]-RLPDGLTR.2b5_1.heavy 536.323 / 683.396 N/A 23.78689956665039 44 18 10 10 6 3.429584116293225 24.790746776216796 0.0 5 0.9833111045781058 9.539875903078093 526.0 0.5994301994301995 13.0 - - - - - - - 185.11111111111111 3 18 MCM5 minichromosome maintenance complex component 5 2045 261 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18601.[MT7]-RLPDGLTR.2b4_1.heavy 536.323 / 626.374 4034.0 23.78689956665039 44 18 10 10 6 3.429584116293225 24.790746776216796 0.0 5 0.9833111045781058 9.539875903078093 4034.0 15.421398510339081 0.0 - - - - - - - 204.6 8 15 MCM5 minichromosome maintenance complex component 5 2047 261 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB18601.[MT7]-RLPDGLTR.2y7_1.heavy 536.323 / 771.436 1754.0 23.78689956665039 44 18 10 10 6 3.429584116293225 24.790746776216796 0.0 5 0.9833111045781058 9.539875903078093 1754.0 2.6676806083650195 1.0 - - - - - - - 159.0625 3 16 MCM5 minichromosome maintenance complex component 5 2049 262 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533676.[MT7]-NSDLLTSPDVGLLK[MT7].2y5_1.heavy 880.506 / 673.473 2170.0 37.06517505645752 41 15 10 6 10 4.7902764547207255 20.875621886384433 0.033100128173828125 3 0.959776467408683 6.132755790431968 2170.0 5.924914675767918 0.0 - - - - - - - 146.8181818181818 4 22 JUN jun proto-oncogene 2051 262 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533676.[MT7]-NSDLLTSPDVGLLK[MT7].2y9_1.heavy 880.506 / 1073.63 3461.0 37.06517505645752 41 15 10 6 10 4.7902764547207255 20.875621886384433 0.033100128173828125 3 0.959776467408683 6.132755790431968 3461.0 10.57453237061446 0.0 - - - - - - - 153.46153846153845 6 13 JUN jun proto-oncogene 2053 262 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533676.[MT7]-NSDLLTSPDVGLLK[MT7].2b5_1.heavy 880.506 / 687.379 4986.0 37.06517505645752 41 15 10 6 10 4.7902764547207255 20.875621886384433 0.033100128173828125 3 0.959776467408683 6.132755790431968 4986.0 12.044587129288622 0.0 - - - - - - - 214.05 9 20 JUN jun proto-oncogene 2055 262 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533676.[MT7]-NSDLLTSPDVGLLK[MT7].2y7_1.heavy 880.506 / 885.553 4106.0 37.06517505645752 41 15 10 6 10 4.7902764547207255 20.875621886384433 0.033100128173828125 3 0.959776467408683 6.132755790431968 4106.0 22.023937121646195 0.0 - - - - - - - 168.04545454545453 8 22 JUN jun proto-oncogene 2057 263 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533675.[MT7]-NSDLLTSPDVGLLK[MT7].3y7_1.heavy 587.34 / 885.553 19403.0 37.05690002441406 50 20 10 10 10 6.796915044393421 14.712556997823171 0.0 3 0.9954202905183641 18.22961600906203 19403.0 130.5702304483533 0.0 - - - - - - - 172.1875 38 16 JUN jun proto-oncogene 2059 263 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533675.[MT7]-NSDLLTSPDVGLLK[MT7].3y3_1.heavy 587.34 / 517.383 21983.0 37.05690002441406 50 20 10 10 10 6.796915044393421 14.712556997823171 0.0 3 0.9954202905183641 18.22961600906203 21983.0 56.77646946158757 0.0 - - - - - - - 639.0 43 10 JUN jun proto-oncogene 2061 263 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533675.[MT7]-NSDLLTSPDVGLLK[MT7].3b5_1.heavy 587.34 / 687.379 39510.0 37.05690002441406 50 20 10 10 10 6.796915044393421 14.712556997823171 0.0 3 0.9954202905183641 18.22961600906203 39510.0 87.65017064846415 0.0 - - - - - - - 716.5555555555555 79 9 JUN jun proto-oncogene 2063 263 B20140221_KEGG1700_set03_02 B20140221_KEGG1700_set03_02 TB533675.[MT7]-NSDLLTSPDVGLLK[MT7].3y5_1.heavy 587.34 / 673.473 24269.0 37.05690002441406 50 20 10 10 10 6.796915044393421 14.712556997823171 0.0 3 0.9954202905183641 18.22961600906203 24269.0 60.35771256790575 0.0 - - - - - - - 668.3 48 10 JUN jun proto-oncogene