Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18547.[MT7]-FLIGQK[MT7].2b3_1.heavy 497.32 / 518.346 5853.0 30.852075576782227 42 16 10 6 10 3.013483043735892 28.127674863864677 0.03170013427734375 3 0.9632425181025013 6.417267448441582 5853.0 7.163605126305171 0.0 - - - - - - - 1084.4285714285713 11 7 LDHAL6B lactate dehydrogenase A-like 6B 3 1 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18547.[MT7]-FLIGQK[MT7].2y4_1.heavy 497.32 / 589.379 8779.0 30.852075576782227 42 16 10 6 10 3.013483043735892 28.127674863864677 0.03170013427734375 3 0.9632425181025013 6.417267448441582 8779.0 10.133718104495747 1.0 - - - - - - - 722.6 17 10 LDHAL6B lactate dehydrogenase A-like 6B 5 1 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18547.[MT7]-FLIGQK[MT7].2y5_1.heavy 497.32 / 702.463 8962.0 30.852075576782227 42 16 10 6 10 3.013483043735892 28.127674863864677 0.03170013427734375 3 0.9632425181025013 6.417267448441582 8962.0 8.67423464965602 0.0 - - - - - - - 274.125 17 8 LDHAL6B lactate dehydrogenase A-like 6B 7 1 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18547.[MT7]-FLIGQK[MT7].2y3_1.heavy 497.32 / 476.295 16919.0 30.852075576782227 42 16 10 6 10 3.013483043735892 28.127674863864677 0.03170013427734375 3 0.9632425181025013 6.417267448441582 16919.0 11.013458743890428 0.0 - - - - - - - 1371.7142857142858 33 7 LDHAL6B lactate dehydrogenase A-like 6B 9 2 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18721.[MT7]-TYQGSYGFR.2b3_1.heavy 611.802 / 537.279 4689.0 26.4060001373291 47 17 10 10 10 10.919962520252579 9.157540588123465 0.0 3 0.9791398997069379 8.529946702274088 4689.0 34.877277880014724 0.0 - - - - - - - 267.4166666666667 9 12 TP53 tumor protein p53 11 2 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18721.[MT7]-TYQGSYGFR.2y8_1.heavy 611.802 / 977.448 13081.0 26.4060001373291 47 17 10 10 10 10.919962520252579 9.157540588123465 0.0 3 0.9791398997069379 8.529946702274088 13081.0 58.79310928712944 0.0 - - - - - - - 208.84615384615384 26 13 TP53 tumor protein p53 13 2 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18721.[MT7]-TYQGSYGFR.2y6_1.heavy 611.802 / 686.326 9132.0 26.4060001373291 47 17 10 10 10 10.919962520252579 9.157540588123465 0.0 3 0.9791398997069379 8.529946702274088 9132.0 42.64693097863466 0.0 - - - - - - - 246.83333333333334 18 18 TP53 tumor protein p53 15 2 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18721.[MT7]-TYQGSYGFR.2y7_1.heavy 611.802 / 814.384 5677.0 26.4060001373291 47 17 10 10 10 10.919962520252579 9.157540588123465 0.0 3 0.9791398997069379 8.529946702274088 5677.0 22.091846560024848 0.0 - - - - - - - 252.46666666666667 11 15 TP53 tumor protein p53 17 3 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36530.[MT7]-GIQNQAEPR.2b4_1.heavy 578.813 / 557.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 19 3 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36530.[MT7]-GIQNQAEPR.2b6_1.heavy 578.813 / 756.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 21 3 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36530.[MT7]-GIQNQAEPR.2b5_1.heavy 578.813 / 685.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 23 3 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36530.[MT7]-GIQNQAEPR.2y7_1.heavy 578.813 / 842.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 25 4 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533770.[MT7]-DLK[MT7]PENLLYATPAPDAPLK[MT7].4b8_2.heavy 625.361 / 606.365 16437.0 35.37892532348633 44 18 10 6 10 3.7456893946333762 26.697355136620423 0.0384979248046875 3 0.9836961931583983 9.652193793600865 16437.0 29.815916810592977 0.0 - - - - - - - 713.875 32 8 CAMK4 calcium/calmodulin-dependent protein kinase IV 27 4 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533770.[MT7]-DLK[MT7]PENLLYATPAPDAPLK[MT7].4b7_2.heavy 625.361 / 549.823 18598.0 35.37892532348633 44 18 10 6 10 3.7456893946333762 26.697355136620423 0.0384979248046875 3 0.9836961931583983 9.652193793600865 18598.0 85.70061217367024 0.0 - - - - - - - 237.46153846153845 37 13 CAMK4 calcium/calmodulin-dependent protein kinase IV 29 4 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533770.[MT7]-DLK[MT7]PENLLYATPAPDAPLK[MT7].4y6_1.heavy 625.361 / 784.469 8797.0 35.37892532348633 44 18 10 6 10 3.7456893946333762 26.697355136620423 0.0384979248046875 3 0.9836961931583983 9.652193793600865 8797.0 21.158480565371026 0.0 - - - - - - - 253.64285714285714 17 14 CAMK4 calcium/calmodulin-dependent protein kinase IV 31 4 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533770.[MT7]-DLK[MT7]PENLLYATPAPDAPLK[MT7].4y3_1.heavy 625.361 / 501.352 21607.0 35.37892532348633 44 18 10 6 10 3.7456893946333762 26.697355136620423 0.0384979248046875 3 0.9836961931583983 9.652193793600865 21607.0 36.079984991031225 0.0 - - - - - - - 713.8333333333334 43 12 CAMK4 calcium/calmodulin-dependent protein kinase IV 33 5 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18722.[MT7]-GTAAGPPVEER.2y8_1.heavy 614.326 / 854.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGKZ diacylglycerol kinase, zeta 35 5 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18722.[MT7]-GTAAGPPVEER.2y6_1.heavy 614.326 / 726.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGKZ diacylglycerol kinase, zeta 37 5 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18722.[MT7]-GTAAGPPVEER.2b5_1.heavy 614.326 / 502.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGKZ diacylglycerol kinase, zeta 39 5 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18722.[MT7]-GTAAGPPVEER.2y7_1.heavy 614.326 / 783.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGKZ diacylglycerol kinase, zeta 41 6 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533774.[MT7]-ELTERFEDVWVVSGPLTLPQTR.4b8_1.heavy 679.866 / 1164.57 820.0 43.01192378997803 37 11 10 6 10 2.560671482325902 39.05225667963009 0.033100128173828125 3 0.8540499448189303 3.1902948417187393 820.0 20.39728831821855 0.0 - - - - - - - 0.0 1 0 EXOG endo/exonuclease (5'-3'), endonuclease G-like 43 6 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533774.[MT7]-ELTERFEDVWVVSGPLTLPQTR.4y4_1.heavy 679.866 / 501.278 9146.0 43.01192378997803 37 11 10 6 10 2.560671482325902 39.05225667963009 0.033100128173828125 3 0.8540499448189303 3.1902948417187393 9146.0 59.684674164848076 0.0 - - - - - - - 210.52941176470588 18 17 EXOG endo/exonuclease (5'-3'), endonuclease G-like 45 6 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533774.[MT7]-ELTERFEDVWVVSGPLTLPQTR.4b8_2.heavy 679.866 / 582.786 2632.0 43.01192378997803 37 11 10 6 10 2.560671482325902 39.05225667963009 0.033100128173828125 3 0.8540499448189303 3.1902948417187393 2632.0 11.120151021003275 0.0 - - - - - - - 242.0 5 18 EXOG endo/exonuclease (5'-3'), endonuclease G-like 47 6 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533774.[MT7]-ELTERFEDVWVVSGPLTLPQTR.4y6_1.heavy 679.866 / 715.41 4012.0 43.01192378997803 37 11 10 6 10 2.560671482325902 39.05225667963009 0.033100128173828125 3 0.8540499448189303 3.1902948417187393 4012.0 43.48584837329023 0.0 - - - - - - - 166.5909090909091 8 22 EXOG endo/exonuclease (5'-3'), endonuclease G-like 49 7 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18866.[MT7]-EALQDVEDENQ.2b8_1.heavy 717.329 / 1044.5 4102.0 26.23419952392578 40 10 10 10 10 1.2069459637251956 72.25068019430684 0.0 3 0.8389246204944348 3.032760100794305 4102.0 55.72717073170731 0.0 - - - - - - - 199.14285714285714 8 14 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 51 7 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18866.[MT7]-EALQDVEDENQ.2b4_1.heavy 717.329 / 586.332 6974.0 26.23419952392578 40 10 10 10 10 1.2069459637251956 72.25068019430684 0.0 3 0.8389246204944348 3.032760100794305 6974.0 19.56121951219512 0.0 - - - - - - - 274.94117647058823 13 17 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 53 7 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18866.[MT7]-EALQDVEDENQ.2b6_1.heavy 717.329 / 800.427 10830.0 26.23419952392578 40 10 10 10 10 1.2069459637251956 72.25068019430684 0.0 3 0.8389246204944348 3.032760100794305 10830.0 19.418069761342775 0.0 - - - - - - - 280.1666666666667 21 12 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 55 7 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18866.[MT7]-EALQDVEDENQ.2b5_1.heavy 717.329 / 701.359 11158.0 26.23419952392578 40 10 10 10 10 1.2069459637251956 72.25068019430684 0.0 3 0.8389246204944348 3.032760100794305 11158.0 40.341805495233956 0.0 - - - - - - - 246.0 22 14 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 57 8 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18926.[MT7]-QNVAYNREEER.2b3_1.heavy 776.385 / 486.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 59 8 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18926.[MT7]-QNVAYNREEER.2y4_1.heavy 776.385 / 562.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 61 8 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18926.[MT7]-QNVAYNREEER.2b5_1.heavy 776.385 / 720.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 63 8 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18926.[MT7]-QNVAYNREEER.2b9_1.heavy 776.385 / 1248.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 65 9 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18871.[MT7]-GTQK[MT7]PYALK[MT7].3b6_2.heavy 479.965 / 482.279 1741.0 21.666200637817383 46 18 10 10 8 3.486682496049097 28.680558127479088 0.0 4 0.9813564788569507 9.024462617767668 1741.0 7.604367816091954 1.0 - - - - - - - 233.8125 3 16 CAMK4 calcium/calmodulin-dependent protein kinase IV 67 9 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18871.[MT7]-GTQK[MT7]PYALK[MT7].3y3_1.heavy 479.965 / 475.336 N/A 21.666200637817383 46 18 10 10 8 3.486682496049097 28.680558127479088 0.0 4 0.9813564788569507 9.024462617767668 3046.0 3.216198403729167 5.0 - - - - - - - 1206.2857142857142 6 7 CAMK4 calcium/calmodulin-dependent protein kinase IV 69 9 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18871.[MT7]-GTQK[MT7]PYALK[MT7].3y4_1.heavy 479.965 / 638.399 1828.0 21.666200637817383 46 18 10 10 8 3.486682496049097 28.680558127479088 0.0 4 0.9813564788569507 9.024462617767668 1828.0 3.466896551724138 4.0 - - - - - - - 261.0 4 14 CAMK4 calcium/calmodulin-dependent protein kinase IV 71 9 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18871.[MT7]-GTQK[MT7]PYALK[MT7].3y5_1.heavy 479.965 / 735.452 3743.0 21.666200637817383 46 18 10 10 8 3.486682496049097 28.680558127479088 0.0 4 0.9813564788569507 9.024462617767668 3743.0 25.13771756978654 0.0 - - - - - - - 181.9090909090909 7 11 CAMK4 calcium/calmodulin-dependent protein kinase IV 73 10 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18872.[MT7]-YLAEVAAGDDK[MT7].2y4_1.heavy 720.385 / 578.29 1727.0 30.34480094909668 37 11 10 10 6 1.831866480172884 54.58913140359576 0.0 5 0.851871778227547 3.166144210826889 1727.0 20.49626373626374 0.0 - - - - - - - 227.5 3 16 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 75 10 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18872.[MT7]-YLAEVAAGDDK[MT7].2y5_1.heavy 720.385 / 649.327 3182.0 30.34480094909668 37 11 10 10 6 1.831866480172884 54.58913140359576 0.0 5 0.851871778227547 3.166144210826889 3182.0 6.799401441317199 2.0 - - - - - - - 727.0 33 8 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 77 10 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18872.[MT7]-YLAEVAAGDDK[MT7].2y9_1.heavy 720.385 / 1019.51 1727.0 30.34480094909668 37 11 10 10 6 1.831866480172884 54.58913140359576 0.0 5 0.851871778227547 3.166144210826889 1727.0 4.428205128205128 0.0 - - - - - - - 218.4 3 10 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 79 10 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18872.[MT7]-YLAEVAAGDDK[MT7].2b4_1.heavy 720.385 / 621.336 33544.0 30.34480094909668 37 11 10 10 6 1.831866480172884 54.58913140359576 0.0 5 0.851871778227547 3.166144210826889 33544.0 63.05809735496777 0.0 - - - - - - - 681.5 67 8 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 81 11 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19133.[MT7]-LIIVSNPVDILTYVAWK[MT7].3b9_1.heavy 744.78 / 1095.65 129.0 50.02859878540039 35 5 10 10 10 0.39895109142493307 117.8238345752606 0.0 3 0.6380798565327545 1.9860495035628847 129.0 10.103940886699506 0.0 - - - - - - - 0.0 0 0 LDHAL6B lactate dehydrogenase A-like 6B 83 11 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19133.[MT7]-LIIVSNPVDILTYVAWK[MT7].3b6_1.heavy 744.78 / 784.505 186.0 50.02859878540039 35 5 10 10 10 0.39895109142493307 117.8238345752606 0.0 3 0.6380798565327545 1.9860495035628847 186.0 7.69655172413793 0.0 - - - - - - - 0.0 0 0 LDHAL6B lactate dehydrogenase A-like 6B 85 11 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19133.[MT7]-LIIVSNPVDILTYVAWK[MT7].3b4_1.heavy 744.78 / 583.43 443.0 50.02859878540039 35 5 10 10 10 0.39895109142493307 117.8238345752606 0.0 3 0.6380798565327545 1.9860495035628847 443.0 26.200285714285716 0.0 - - - - - - - 0.0 0 0 LDHAL6B lactate dehydrogenase A-like 6B 87 11 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19133.[MT7]-LIIVSNPVDILTYVAWK[MT7].3y4_1.heavy 744.78 / 647.4 1171.0 50.02859878540039 35 5 10 10 10 0.39895109142493307 117.8238345752606 0.0 3 0.6380798565327545 1.9860495035628847 1171.0 22.361382246970194 0.0 - - - - - - - 41.23529411764706 2 17 LDHAL6B lactate dehydrogenase A-like 6B 89 12 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42213.[MT7]-K[MT7]K[MT7]PLDGEYFTLQIR.3b5_2.heavy 714.088 / 507.837 4579.0 33.225799560546875 39 14 9 10 6 3.606259318035017 21.04263957671789 0.0 5 0.946768580400705 5.325161145834109 4579.0 27.004358974358972 0.0 - - - - - - - 230.36363636363637 9 11 TP53 tumor protein p53 91 12 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42213.[MT7]-K[MT7]K[MT7]PLDGEYFTLQIR.3y5_1.heavy 714.088 / 630.393 1559.0 33.225799560546875 39 14 9 10 6 3.606259318035017 21.04263957671789 0.0 5 0.946768580400705 5.325161145834109 1559.0 2.855646289194676 0.0 - - - - - - - 286.47058823529414 3 17 TP53 tumor protein p53 93 12 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42213.[MT7]-K[MT7]K[MT7]PLDGEYFTLQIR.3b7_2.heavy 714.088 / 600.869 1266.0 33.225799560546875 39 14 9 10 6 3.606259318035017 21.04263957671789 0.0 5 0.946768580400705 5.325161145834109 1266.0 1.2112903071293084 5.0 - - - - - - - 259.75 10 12 TP53 tumor protein p53 95 12 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42213.[MT7]-K[MT7]K[MT7]PLDGEYFTLQIR.3y9_1.heavy 714.088 / 1126.59 1169.0 33.225799560546875 39 14 9 10 6 3.606259318035017 21.04263957671789 0.0 5 0.946768580400705 5.325161145834109 1169.0 15.16640761300555 0.0 - - - - - - - 132.54545454545453 2 11 TP53 tumor protein p53 97 13 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18924.[MT7]-VWNTSTC[CAM]EFVR.2b3_1.heavy 771.878 / 544.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 99 13 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18924.[MT7]-VWNTSTC[CAM]EFVR.2y8_1.heavy 771.878 / 999.456 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 101 13 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18924.[MT7]-VWNTSTC[CAM]EFVR.2y9_1.heavy 771.878 / 1113.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 103 13 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18924.[MT7]-VWNTSTC[CAM]EFVR.2y7_1.heavy 771.878 / 898.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 105 14 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18925.[MT7]-LSGLVFFPHLDR.3b6_1.heavy 515.628 / 761.468 34920.0 41.920101165771484 48 18 10 10 10 4.490699451142895 17.049607956684426 0.0 3 0.983611852827929 9.627256549141624 34920.0 456.4136559036144 0.0 - - - - - - - 211.13333333333333 69 15 EXOG endo/exonuclease (5'-3'), endonuclease G-like 107 14 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18925.[MT7]-LSGLVFFPHLDR.3b4_1.heavy 515.628 / 515.331 N/A 41.920101165771484 48 18 10 10 10 4.490699451142895 17.049607956684426 0.0 3 0.983611852827929 9.627256549141624 103550.0 11.412792919869474 0.0 - - - - - - - 8876.0 207 1 EXOG endo/exonuclease (5'-3'), endonuclease G-like 109 14 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18925.[MT7]-LSGLVFFPHLDR.3b5_1.heavy 515.628 / 614.399 83965.0 41.920101165771484 48 18 10 10 10 4.490699451142895 17.049607956684426 0.0 3 0.983611852827929 9.627256549141624 83965.0 430.6421012920283 0.0 - - - - - - - 285.15384615384613 167 13 EXOG endo/exonuclease (5'-3'), endonuclease G-like 111 14 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18925.[MT7]-LSGLVFFPHLDR.3y5_1.heavy 515.628 / 637.342 121219.0 41.920101165771484 48 18 10 10 10 4.490699451142895 17.049607956684426 0.0 3 0.983611852827929 9.627256549141624 121219.0 293.00363999999996 0.0 - - - - - - - 624.9 242 10 EXOG endo/exonuclease (5'-3'), endonuclease G-like 113 15 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18556.[MT7]-VFYYK[MT7].2b3_1.heavy 504.294 / 554.31 2181.0 29.64429982503255 46 20 10 6 10 5.181317841309794 19.3001091735227 0.03959846496582031 3 0.9931870298475342 14.943325223034448 2181.0 4.51421185187889 4.0 - - - - - - - 711.2307692307693 4 13 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 115 15 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18556.[MT7]-VFYYK[MT7].2y4_1.heavy 504.294 / 764.41 14571.0 29.64429982503255 46 20 10 6 10 5.181317841309794 19.3001091735227 0.03959846496582031 3 0.9931870298475342 14.943325223034448 14571.0 27.887146098726113 0.0 - - - - - - - 726.8888888888889 29 9 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 117 15 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18556.[MT7]-VFYYK[MT7].2y3_1.heavy 504.294 / 617.341 8289.0 29.64429982503255 46 20 10 6 10 5.181317841309794 19.3001091735227 0.03959846496582031 3 0.9931870298475342 14.943325223034448 8289.0 10.716565254685817 0.0 - - - - - - - 717.2222222222222 16 9 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 119 16 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533505.[MT7]-TLWEIQNK[MT7].3y3_1.heavy 440.59 / 533.316 32189.0 33.14400100708008 50 20 10 10 10 5.798374260546294 17.246213422342713 0.0 3 0.9937685868014765 15.62583788930776 32189.0 43.5242392668514 0.0 - - - - - - - 748.8 64 10 LDHAL6B lactate dehydrogenase A-like 6B 121 16 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533505.[MT7]-TLWEIQNK[MT7].3b4_1.heavy 440.59 / 674.363 73228.0 33.14400100708008 50 20 10 10 10 5.798374260546294 17.246213422342713 0.0 3 0.9937685868014765 15.62583788930776 73228.0 722.4609144261293 0.0 - - - - - - - 291.6 146 5 LDHAL6B lactate dehydrogenase A-like 6B 123 16 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533505.[MT7]-TLWEIQNK[MT7].3y4_1.heavy 440.59 / 646.4 10892.0 33.14400100708008 50 20 10 10 10 5.798374260546294 17.246213422342713 0.0 3 0.9937685868014765 15.62583788930776 10892.0 23.544619782732987 0.0 - - - - - - - 234.91666666666666 21 12 LDHAL6B lactate dehydrogenase A-like 6B 125 16 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533505.[MT7]-TLWEIQNK[MT7].3b3_1.heavy 440.59 / 545.32 32870.0 33.14400100708008 50 20 10 10 10 5.798374260546294 17.246213422342713 0.0 3 0.9937685868014765 15.62583788930776 32870.0 81.59716954788922 0.0 - - - - - - - 265.09090909090907 65 11 LDHAL6B lactate dehydrogenase A-like 6B 127 17 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18555.[MT7]-EVEVDK[MT7].2b3_1.heavy 503.787 / 502.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 129 17 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18555.[MT7]-EVEVDK[MT7].2y4_1.heavy 503.787 / 634.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 131 17 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18555.[MT7]-EVEVDK[MT7].2y5_1.heavy 503.787 / 733.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 133 17 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18555.[MT7]-EVEVDK[MT7].2b5_1.heavy 503.787 / 716.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 135 18 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41866.[MT7]-SQGAEGALTGK[MT7].2y4_1.heavy 653.864 / 562.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 137 18 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41866.[MT7]-SQGAEGALTGK[MT7].2b6_1.heavy 653.864 / 674.323 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 139 18 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41866.[MT7]-SQGAEGALTGK[MT7].2y6_1.heavy 653.864 / 690.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 141 18 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41866.[MT7]-SQGAEGALTGK[MT7].2b5_1.heavy 653.864 / 617.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 143 19 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41867.[MT7]-TEEENLRK[MT7].3b4_1.heavy 436.245 / 633.285 4707.0 17.25132417678833 35 11 10 6 8 0.8815576743597333 67.81987930387727 0.03289985656738281 4 0.8714487636289713 3.4045374309303043 4707.0 37.50376196071848 0.0 - - - - - - - 188.8 9 20 TP53 tumor protein p53 145 19 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41867.[MT7]-TEEENLRK[MT7].3y7_2.heavy 436.245 / 531.289 7448.0 17.25132417678833 35 11 10 6 8 0.8815576743597333 67.81987930387727 0.03289985656738281 4 0.8714487636289713 3.4045374309303043 7448.0 12.162475822050292 0.0 - - - - - - - 724.0769230769231 14 13 TP53 tumor protein p53 147 19 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41867.[MT7]-TEEENLRK[MT7].3b3_1.heavy 436.245 / 504.242 3207.0 17.25132417678833 35 11 10 6 8 0.8815576743597333 67.81987930387727 0.03289985656738281 4 0.8714487636289713 3.4045374309303043 3207.0 9.295652173913043 1.0 - - - - - - - 210.74074074074073 6 27 TP53 tumor protein p53 149 19 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41867.[MT7]-TEEENLRK[MT7].3y5_1.heavy 436.245 / 803.486 931.0 17.25132417678833 35 11 10 6 8 0.8815576743597333 67.81987930387727 0.03289985656738281 4 0.8714487636289713 3.4045374309303043 931.0 2.6985507246376814 0.0 - - - - - - - 0.0 1 0 TP53 tumor protein p53 151 20 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18559.[MT7]-GATSIVYR.2b6_1.heavy 505.791 / 673.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 153 20 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18559.[MT7]-GATSIVYR.2y6_1.heavy 505.791 / 738.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 155 20 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18559.[MT7]-GATSIVYR.2b5_1.heavy 505.791 / 574.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 157 20 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18559.[MT7]-GATSIVYR.2y7_1.heavy 505.791 / 809.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 159 21 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41862.[MT7]-WVLEHISK[MT7].3y3_1.heavy 433.927 / 491.331 69692.0 31.669300079345703 45 15 10 10 10 2.4810831833763065 31.629340503031052 0.0 3 0.9577032581597317 5.979517370269176 69692.0 97.91438016528926 0.0 - - - - - - - 664.2857142857143 139 7 EXOG endo/exonuclease (5'-3'), endonuclease G-like 161 21 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41862.[MT7]-WVLEHISK[MT7].3b4_1.heavy 433.927 / 672.384 65412.0 31.669300079345703 45 15 10 10 10 2.4810831833763065 31.629340503031052 0.0 3 0.9577032581597317 5.979517370269176 65412.0 121.37571094397848 0.0 - - - - - - - 279.0 130 8 EXOG endo/exonuclease (5'-3'), endonuclease G-like 163 21 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41862.[MT7]-WVLEHISK[MT7].3y4_1.heavy 433.927 / 628.39 7444.0 31.669300079345703 45 15 10 10 10 2.4810831833763065 31.629340503031052 0.0 3 0.9577032581597317 5.979517370269176 7444.0 37.35340501792115 0.0 - - - - - - - 217.0 14 15 EXOG endo/exonuclease (5'-3'), endonuclease G-like 165 21 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41862.[MT7]-WVLEHISK[MT7].3b3_1.heavy 433.927 / 543.341 35172.0 31.669300079345703 45 15 10 10 10 2.4810831833763065 31.629340503031052 0.0 3 0.9577032581597317 5.979517370269176 35172.0 96.69041962716312 0.0 - - - - - - - 292.2857142857143 70 14 EXOG endo/exonuclease (5'-3'), endonuclease G-like 167 22 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533507.[MT7]-IADLGLASFK[MT7].3y3_1.heavy 441.602 / 525.315 89503.0 38.33440017700195 46 16 10 10 10 2.0971388967977633 37.8606790256454 0.0 3 0.9655710007209497 6.63202573134718 89503.0 362.2914253284678 0.0 - - - - - - - 197.58333333333334 179 12 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 169 22 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533507.[MT7]-IADLGLASFK[MT7].3b5_1.heavy 441.602 / 614.363 112746.0 38.33440017700195 46 16 10 10 10 2.0971388967977633 37.8606790256454 0.0 3 0.9655710007209497 6.63202573134718 112746.0 523.3147671840354 0.0 - - - - - - - 239.57142857142858 225 14 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 171 22 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533507.[MT7]-IADLGLASFK[MT7].3y4_1.heavy 441.602 / 596.352 50418.0 38.33440017700195 46 16 10 10 10 2.0971388967977633 37.8606790256454 0.0 3 0.9655710007209497 6.63202573134718 50418.0 378.7584374241675 0.0 - - - - - - - 224.47058823529412 100 17 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 173 22 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533507.[MT7]-IADLGLASFK[MT7].3b3_1.heavy 441.602 / 444.258 54234.0 38.33440017700195 46 16 10 10 10 2.0971388967977633 37.8606790256454 0.0 3 0.9655710007209497 6.63202573134718 54234.0 186.64150711264898 0.0 - - - - - - - 234.9375 108 16 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 175 23 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36522.[MT7]-QTYNSC[CAM]AR.2y5_1.heavy 572.27 / 607.262 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 177 23 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36522.[MT7]-QTYNSC[CAM]AR.2b4_1.heavy 572.27 / 651.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 179 23 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36522.[MT7]-QTYNSC[CAM]AR.2y6_1.heavy 572.27 / 770.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 181 23 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36522.[MT7]-QTYNSC[CAM]AR.2y7_1.heavy 572.27 / 871.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 183 24 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18417.[MT7]-LFQTR.2b3_1.heavy 404.743 / 533.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 185 24 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18417.[MT7]-LFQTR.2y4_1.heavy 404.743 / 551.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 187 24 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18417.[MT7]-LFQTR.2y3_1.heavy 404.743 / 404.225 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 189 25 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18419.[MT7]-GC[CAM]YLR.2y4_1.heavy 406.714 / 611.297 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAOK1;TAOK2 TAO kinase 1;TAO kinase 2 191 25 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18419.[MT7]-GC[CAM]YLR.2b3_1.heavy 406.714 / 525.225 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAOK1;TAOK2 TAO kinase 1;TAO kinase 2 193 25 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18419.[MT7]-GC[CAM]YLR.2b4_1.heavy 406.714 / 638.309 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAOK1;TAOK2 TAO kinase 1;TAO kinase 2 195 25 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18419.[MT7]-GC[CAM]YLR.2y3_1.heavy 406.714 / 451.266 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAOK1;TAOK2 TAO kinase 1;TAO kinase 2 197 26 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18878.[MT7]-DAQAGK[MT7]EPGGSR.2y8_1.heavy 730.888 / 931.508 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 199 26 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18878.[MT7]-DAQAGK[MT7]EPGGSR.2y9_1.heavy 730.888 / 1002.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 201 26 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18878.[MT7]-DAQAGK[MT7]EPGGSR.2b7_1.heavy 730.888 / 988.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 203 26 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18878.[MT7]-DAQAGK[MT7]EPGGSR.2y11_2.heavy 730.888 / 601.324 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 205 27 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41860.[MT7]-K[MT7]LQEFNAR.2y4_1.heavy 647.38 / 507.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 207 27 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41860.[MT7]-K[MT7]LQEFNAR.2b4_1.heavy 647.38 / 787.492 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 209 27 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41860.[MT7]-K[MT7]LQEFNAR.2y6_1.heavy 647.38 / 764.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 211 27 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41860.[MT7]-K[MT7]LQEFNAR.2y7_1.heavy 647.38 / 877.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 213 28 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18877.[MT7]-LTPEEEAHLK[MT7].3b6_1.heavy 485.608 / 843.422 6651.0 24.923874855041504 37 13 10 6 8 1.7167204912512428 41.18263910483829 0.036701202392578125 4 0.9295313870699837 4.621474493681867 6651.0 52.88746987951807 0.0 - - - - - - - 201.71428571428572 13 14 LDHAL6B lactate dehydrogenase A-like 6B 215 28 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18877.[MT7]-LTPEEEAHLK[MT7].3y3_1.heavy 485.608 / 541.358 12887.0 24.923874855041504 37 13 10 6 8 1.7167204912512428 41.18263910483829 0.036701202392578125 4 0.9295313870699837 4.621474493681867 12887.0 23.87819053574548 0.0 - - - - - - - 714.9 25 10 LDHAL6B lactate dehydrogenase A-like 6B 217 28 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18877.[MT7]-LTPEEEAHLK[MT7].3b4_1.heavy 485.608 / 585.336 6319.0 24.923874855041504 37 13 10 6 8 1.7167204912512428 41.18263910483829 0.036701202392578125 4 0.9295313870699837 4.621474493681867 6319.0 13.038131985838788 0.0 - - - - - - - 727.5 12 8 LDHAL6B lactate dehydrogenase A-like 6B 219 28 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18877.[MT7]-LTPEEEAHLK[MT7].3b5_1.heavy 485.608 / 714.379 6568.0 24.923874855041504 37 13 10 6 8 1.7167204912512428 41.18263910483829 0.036701202392578125 4 0.9295313870699837 4.621474493681867 6568.0 18.95157943431139 1.0 - - - - - - - 244.83333333333334 16 18 LDHAL6B lactate dehydrogenase A-like 6B 221 29 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19116.[MT7]-LLDFQEFTLYLSTRK[MT7].4y8_2.heavy 541.308 / 563.341 62040.0 46.16780090332031 38 8 10 10 10 1.0436550657975885 55.12752667885847 0.0 3 0.7643901520947117 2.490831729168335 62040.0 287.984955511022 0.0 - - - - - - - 216.4 124 15 EXOG endo/exonuclease (5'-3'), endonuclease G-like 223 29 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19116.[MT7]-LLDFQEFTLYLSTRK[MT7].4b4_1.heavy 541.308 / 633.373 23109.0 46.16780090332031 38 8 10 10 10 1.0436550657975885 55.12752667885847 0.0 3 0.7643901520947117 2.490831729168335 23109.0 149.1651170568562 0.0 - - - - - - - 210.3684210526316 46 19 EXOG endo/exonuclease (5'-3'), endonuclease G-like 225 29 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19116.[MT7]-LLDFQEFTLYLSTRK[MT7].4y7_2.heavy 541.308 / 512.817 36635.0 46.16780090332031 38 8 10 10 10 1.0436550657975885 55.12752667885847 0.0 3 0.7643901520947117 2.490831729168335 36635.0 158.23710979228485 0.0 - - - - - - - 226.10526315789474 73 19 EXOG endo/exonuclease (5'-3'), endonuclease G-like 227 29 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19116.[MT7]-LLDFQEFTLYLSTRK[MT7].4y6_1.heavy 541.308 / 911.543 6938.0 46.16780090332031 38 8 10 10 10 1.0436550657975885 55.12752667885847 0.0 3 0.7643901520947117 2.490831729168335 6938.0 74.61392982456141 0.0 - - - - - - - 124.91666666666667 13 12 EXOG endo/exonuclease (5'-3'), endonuclease G-like 229 30 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19117.[MT7]-LLDFQEFTLYLSTRK[MT7].3y7_1.heavy 721.408 / 1024.63 1697.0 46.16780090332031 47 17 10 10 10 12.33902250079513 8.104369693268326 0.0 3 0.9731572324828194 7.515751914183286 1697.0 20.49226822742475 0.0 - - - - - - - 139.8 3 10 EXOG endo/exonuclease (5'-3'), endonuclease G-like 231 30 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19117.[MT7]-LLDFQEFTLYLSTRK[MT7].3b6_1.heavy 721.408 / 890.474 3843.0 46.16780090332031 47 17 10 10 10 12.33902250079513 8.104369693268326 0.0 3 0.9731572324828194 7.515751914183286 3843.0 42.272999999999996 0.0 - - - - - - - 143.2 7 15 EXOG endo/exonuclease (5'-3'), endonuclease G-like 233 30 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19117.[MT7]-LLDFQEFTLYLSTRK[MT7].3y6_1.heavy 721.408 / 911.543 5340.0 46.16780090332031 47 17 10 10 10 12.33902250079513 8.104369693268326 0.0 3 0.9731572324828194 7.515751914183286 5340.0 47.00056112224449 0.0 - - - - - - - 143.625 10 16 EXOG endo/exonuclease (5'-3'), endonuclease G-like 235 30 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19117.[MT7]-LLDFQEFTLYLSTRK[MT7].3b5_1.heavy 721.408 / 761.431 3644.0 46.16780090332031 47 17 10 10 10 12.33902250079513 8.104369693268326 0.0 3 0.9731572324828194 7.515751914183286 3644.0 16.13028932875919 0.0 - - - - - - - 220.0909090909091 7 22 EXOG endo/exonuclease (5'-3'), endonuclease G-like 237 31 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18874.[MT7]-LVALLESGTEK[MT7].2y5_1.heavy 724.434 / 665.359 5780.0 38.41749954223633 41 15 10 6 10 1.9004527108454183 36.50030901005613 0.03279876708984375 3 0.9599595086907653 6.146852623462458 5780.0 9.564659288931134 0.0 - - - - - - - 715.25 11 8 DUSP16 dual specificity phosphatase 16 239 31 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18874.[MT7]-LVALLESGTEK[MT7].2y9_1.heavy 724.434 / 1091.61 3891.0 38.41749954223633 41 15 10 6 10 1.9004527108454183 36.50030901005613 0.03279876708984375 3 0.9599595086907653 6.146852623462458 3891.0 58.70631578947368 0.0 - - - - - - - 98.93333333333334 7 15 DUSP16 dual specificity phosphatase 16 241 31 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18874.[MT7]-LVALLESGTEK[MT7].2y6_1.heavy 724.434 / 794.401 8641.0 38.41749954223633 41 15 10 6 10 1.9004527108454183 36.50030901005613 0.03279876708984375 3 0.9599595086907653 6.146852623462458 8641.0 42.5508105331121 0.0 - - - - - - - 219.27777777777777 17 18 DUSP16 dual specificity phosphatase 16 243 31 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18874.[MT7]-LVALLESGTEK[MT7].2y7_1.heavy 724.434 / 907.485 6638.0 38.41749954223633 41 15 10 6 10 1.9004527108454183 36.50030901005613 0.03279876708984375 3 0.9599595086907653 6.146852623462458 6638.0 18.269854948544904 0.0 - - - - - - - 203.875 13 16 DUSP16 dual specificity phosphatase 16 245 32 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18884.[MT7]-IQYVC[CAM]EQNK[MT7].2b3_1.heavy 735.387 / 549.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 247 32 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18884.[MT7]-IQYVC[CAM]EQNK[MT7].2y8_1.heavy 735.387 / 1212.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 249 32 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18884.[MT7]-IQYVC[CAM]EQNK[MT7].2y5_1.heavy 735.387 / 822.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 251 32 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18884.[MT7]-IQYVC[CAM]EQNK[MT7].2y7_1.heavy 735.387 / 1084.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 253 33 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19122.[MT7]-RPILTIITLEDSSGNLLGR.3b6_1.heavy 738.098 / 838.563 2618.0 42.60914897918701 43 17 10 6 10 2.2646328672098752 31.369390469677242 0.030200958251953125 3 0.9728294581329746 7.470074789438323 2618.0 29.123313609467456 0.0 - - - - - - - 172.56521739130434 5 23 TP53 tumor protein p53 255 33 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19122.[MT7]-RPILTIITLEDSSGNLLGR.3b5_1.heavy 738.098 / 725.479 1520.0 42.60914897918701 43 17 10 6 10 2.2646328672098752 31.369390469677242 0.030200958251953125 3 0.9728294581329746 7.470074789438323 1520.0 2.173570019723866 1.0 - - - - - - - 194.6086956521739 3 23 TP53 tumor protein p53 257 33 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19122.[MT7]-RPILTIITLEDSSGNLLGR.3y10_1.heavy 738.098 / 1047.51 2829.0 42.60914897918701 43 17 10 6 10 2.2646328672098752 31.369390469677242 0.030200958251953125 3 0.9728294581329746 7.470074789438323 2829.0 42.51072696534235 0.0 - - - - - - - 120.15 5 20 TP53 tumor protein p53 259 33 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19122.[MT7]-RPILTIITLEDSSGNLLGR.3y9_1.heavy 738.098 / 918.464 3209.0 42.60914897918701 43 17 10 6 10 2.2646328672098752 31.369390469677242 0.030200958251953125 3 0.9728294581329746 7.470074789438323 3209.0 36.17115535321118 0.0 - - - - - - - 149.72727272727272 6 22 TP53 tumor protein p53 261 34 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19220.[MT7]-SSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEK[MT7].4b11_1.heavy 1095.08 / 1186.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 263 34 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19220.[MT7]-SSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEK[MT7].4b9_1.heavy 1095.08 / 1016.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 265 34 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19220.[MT7]-SSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEK[MT7].4b9_2.heavy 1095.08 / 508.773 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 267 34 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19220.[MT7]-SSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEK[MT7].4b6_1.heavy 1095.08 / 735.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 269 35 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1444290.0 29.38170051574707 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1444290.0 3281.4786358042707 0.0 - - - - - - - 349.0 2888 3 271 35 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 407195.0 29.38170051574707 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 407195.0 604.4063145012148 0.0 - - - - - - - 735.2857142857143 814 7 273 35 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 300511.0 29.38170051574707 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 300511.0 383.9530471735668 0.0 - - - - - - - 1199.5 601 8 275 36 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18740.[MT7]-APETPSENLR.2y9_1.heavy 629.331 / 1042.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYLK3 myosin light chain kinase 3 277 36 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18740.[MT7]-APETPSENLR.2y3_1.heavy 629.331 / 402.246 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYLK3 myosin light chain kinase 3 279 36 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18740.[MT7]-APETPSENLR.2y6_1.heavy 629.331 / 715.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYLK3 myosin light chain kinase 3 281 36 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18740.[MT7]-APETPSENLR.2y7_1.heavy 629.331 / 816.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYLK3 myosin light chain kinase 3 283 37 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18747.[MT7]-QVLGLGVNGK[MT7].2b8_2.heavy 636.898 / 463.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 285 37 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18747.[MT7]-QVLGLGVNGK[MT7].2b4_1.heavy 636.898 / 542.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 287 37 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18747.[MT7]-QVLGLGVNGK[MT7].2b6_1.heavy 636.898 / 712.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 289 37 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18747.[MT7]-QVLGLGVNGK[MT7].2b5_1.heavy 636.898 / 655.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 291 38 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36513.[MT7]-FSPIQEK[MT7].2y5_1.heavy 568.831 / 758.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 293 38 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36513.[MT7]-FSPIQEK[MT7].2b4_1.heavy 568.831 / 589.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 295 38 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36513.[MT7]-FSPIQEK[MT7].2y3_1.heavy 568.831 / 548.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 297 38 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36513.[MT7]-FSPIQEK[MT7].2y6_1.heavy 568.831 / 845.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 299 39 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533391.[MT7]-VNENLTK[MT7].2y4_1.heavy 553.326 / 619.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 301 39 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533391.[MT7]-VNENLTK[MT7].2b4_1.heavy 553.326 / 601.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 303 39 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533391.[MT7]-VNENLTK[MT7].2y3_1.heavy 553.326 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 305 39 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533391.[MT7]-VNENLTK[MT7].2y6_1.heavy 553.326 / 862.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 307 40 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18523.[MT7]-EAAEIMR.2y5_1.heavy 482.256 / 619.323 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 309 40 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18523.[MT7]-EAAEIMR.2b4_1.heavy 482.256 / 545.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 311 40 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18523.[MT7]-EAAEIMR.2y6_1.heavy 482.256 / 690.36 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 313 40 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18523.[MT7]-EAAEIMR.2b5_1.heavy 482.256 / 658.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 315 41 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 406788.0 15.336199760437012 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 406788.0 2406.57044441148 0.0 - - - - - - - 367.875 813 8 317 41 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 825109.0 15.336199760437012 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 825109.0 3643.0923793408274 0.0 - - - - - - - 659.75 1650 8 319 41 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 291396.0 15.336199760437012 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 291396.0 751.934390841393 0.0 - - - - - - - 714.2857142857143 582 7 321 42 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18522.[MT7]-ISAEIER.2y5_1.heavy 481.275 / 617.325 8196.0 24.76689910888672 48 20 10 10 8 3.8749757285629793 25.80661325511957 0.0 4 0.9907318426806516 12.80942614607019 8196.0 14.896974856554642 1.0 - - - - - - - 646.0909090909091 16 11 GNA14 guanine nucleotide binding protein (G protein), alpha 14 323 42 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18522.[MT7]-ISAEIER.2b4_1.heavy 481.275 / 545.305 19571.0 24.76689910888672 48 20 10 10 8 3.8749757285629793 25.80661325511957 0.0 4 0.9907318426806516 12.80942614607019 19571.0 47.60152563852603 1.0 - - - - - - - 719.2 44 10 GNA14 guanine nucleotide binding protein (G protein), alpha 14 325 42 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18522.[MT7]-ISAEIER.2y6_1.heavy 481.275 / 704.357 78533.0 24.76689910888672 48 20 10 10 8 3.8749757285629793 25.80661325511957 0.0 4 0.9907318426806516 12.80942614607019 78533.0 247.3746574303371 0.0 - - - - - - - 1191.875 157 8 GNA14 guanine nucleotide binding protein (G protein), alpha 14 327 42 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18522.[MT7]-ISAEIER.2b5_1.heavy 481.275 / 658.389 9618.0 24.76689910888672 48 20 10 10 8 3.8749757285629793 25.80661325511957 0.0 4 0.9907318426806516 12.80942614607019 9618.0 26.96328205128205 0.0 - - - - - - - 740.5714285714286 19 7 GNA14 guanine nucleotide binding protein (G protein), alpha 14 329 43 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18426.[MT7]-YASSK[MT7].2b3_1.heavy 422.244 / 466.242 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 331 43 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18426.[MT7]-YASSK[MT7].2y4_1.heavy 422.244 / 536.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 333 43 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18426.[MT7]-YASSK[MT7].2y3_1.heavy 422.244 / 465.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 335 44 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18424.[MT7]-VEGNLR.2y4_1.heavy 416.244 / 459.267 14308.0 19.204299926757812 43 13 10 10 10 2.7353848570347936 24.371951352737444 0.0 1 0.9108857789460453 4.103077183025303 14308.0 59.04888888888889 0.0 - - - - - - - 585.0 28 7 TP53 tumor protein p53 337 44 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18424.[MT7]-VEGNLR.2b3_1.heavy 416.244 / 430.242 N/A 19.204299926757812 43 13 10 10 10 2.7353848570347936 24.371951352737444 0.0 1 0.9108857789460453 4.103077183025303 630.0 0.4166666666666667 30.0 - - - - - - - 693.0 20 10 TP53 tumor protein p53 339 44 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18424.[MT7]-VEGNLR.2y5_1.heavy 416.244 / 588.31 8005.0 19.204299926757812 43 13 10 10 10 2.7353848570347936 24.371951352737444 0.0 1 0.9108857789460453 4.103077183025303 8005.0 10.62580368001749 1.0 - - - - - - - 693.0 16 7 TP53 tumor protein p53 341 44 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18424.[MT7]-VEGNLR.2b4_1.heavy 416.244 / 544.285 N/A 19.204299926757812 43 13 10 10 10 2.7353848570347936 24.371951352737444 0.0 1 0.9108857789460453 4.103077183025303 2836.0 2.7009523809523808 5.0 - - - - - - - 700.875 20 8 TP53 tumor protein p53 343 45 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18843.[MT7]-AIALVGATFQK[MT7].2b4_1.heavy 703.934 / 513.352 3905.0 35.459266662597656 39 13 10 6 10 1.3366903795028928 48.150753747728444 0.038600921630859375 3 0.9007907563664669 3.8853365816711922 3905.0 12.596774193548386 0.0 - - - - - - - 254.6 7 15 MYLK3 myosin light chain kinase 3 345 45 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18843.[MT7]-AIALVGATFQK[MT7].2y3_1.heavy 703.934 / 566.342 1302.0 35.459266662597656 39 13 10 6 10 1.3366903795028928 48.150753747728444 0.038600921630859375 3 0.9007907563664669 3.8853365816711922 1302.0 2.003076923076923 1.0 - - - - - - - 173.6875 2 16 MYLK3 myosin light chain kinase 3 347 45 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18843.[MT7]-AIALVGATFQK[MT7].2y6_1.heavy 703.934 / 795.448 3124.0 35.459266662597656 39 13 10 6 10 1.3366903795028928 48.150753747728444 0.038600921630859375 3 0.9007907563664669 3.8853365816711922 3124.0 12.732152516071825 0.0 - - - - - - - 173.72222222222223 6 18 MYLK3 myosin light chain kinase 3 349 45 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18843.[MT7]-AIALVGATFQK[MT7].2y7_1.heavy 703.934 / 894.516 N/A 35.459266662597656 39 13 10 6 10 1.3366903795028928 48.150753747728444 0.038600921630859375 3 0.9007907563664669 3.8853365816711922 1996.0 21.03175328762132 1.0 - - - - - - - 195.375 4 16 MYLK3 myosin light chain kinase 3 351 46 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36655.[MT7]-EYQLSDSAK[MT7].2b3_1.heavy 664.85 / 565.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA11;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), alpha 14 353 46 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36655.[MT7]-EYQLSDSAK[MT7].2y8_1.heavy 664.85 / 1055.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA11;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), alpha 14 355 46 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36655.[MT7]-EYQLSDSAK[MT7].2y5_1.heavy 664.85 / 651.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA11;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), alpha 14 357 46 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36655.[MT7]-EYQLSDSAK[MT7].2y6_1.heavy 664.85 / 764.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA11;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), alpha 14 359 47 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18845.[MT7]-LYQDQNPDK[MT7].2y8_1.heavy 704.869 / 1151.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 361 47 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18845.[MT7]-LYQDQNPDK[MT7].2b4_1.heavy 704.869 / 664.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 363 47 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18845.[MT7]-LYQDQNPDK[MT7].2y3_1.heavy 704.869 / 503.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 365 47 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18845.[MT7]-LYQDQNPDK[MT7].2y6_1.heavy 704.869 / 860.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 367 48 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533396.[MT7]-DIYQYLR.2b3_1.heavy 557.804 / 536.284 4232.0 34.823299407958984 50 20 10 10 10 4.7109033843867145 21.227351070588433 0.0 3 0.9905806236979543 12.706027979052704 4232.0 11.834164133738604 0.0 - - - - - - - 668.4444444444445 8 9 CCNB2 cyclin B2 369 48 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533396.[MT7]-DIYQYLR.2y5_1.heavy 557.804 / 742.388 9875.0 34.823299407958984 50 20 10 10 10 4.7109033843867145 21.227351070588433 0.0 3 0.9905806236979543 12.706027979052704 9875.0 17.255248462571572 0.0 - - - - - - - 303.6923076923077 19 13 CCNB2 cyclin B2 371 48 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533396.[MT7]-DIYQYLR.2b4_1.heavy 557.804 / 664.342 4703.0 34.823299407958984 50 20 10 10 10 4.7109033843867145 21.227351070588433 0.0 3 0.9905806236979543 12.706027979052704 4703.0 28.613363782304926 0.0 - - - - - - - 272.6 9 10 CCNB2 cyclin B2 373 48 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533396.[MT7]-DIYQYLR.2y6_1.heavy 557.804 / 855.472 9593.0 34.823299407958984 50 20 10 10 10 4.7109033843867145 21.227351070588433 0.0 3 0.9905806236979543 12.706027979052704 9593.0 21.317777777777778 0.0 - - - - - - - 235.0 19 10 CCNB2 cyclin B2 375 49 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18847.[MT7]-IVRTEIGVLLR.2b8_1.heavy 706.957 / 1012.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 377 49 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18847.[MT7]-IVRTEIGVLLR.2y6_1.heavy 706.957 / 670.461 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 379 49 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18847.[MT7]-IVRTEIGVLLR.2b7_1.heavy 706.957 / 913.559 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 381 49 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18847.[MT7]-IVRTEIGVLLR.2b5_1.heavy 706.957 / 743.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 383 50 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB37028.[MT7]-RSSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEK[MT7].4b7_1.heavy 1134.11 / 891.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 385 50 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB37028.[MT7]-RSSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEK[MT7].4b12_2.heavy 1134.11 / 671.876 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 387 50 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB37028.[MT7]-RSSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEK[MT7].4y7_1.heavy 1134.11 / 976.543 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 389 50 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB37028.[MT7]-RSSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEK[MT7].4b10_2.heavy 1134.11 / 586.823 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 391 51 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19111.[MT7]-K[MT7]K[MT7]PLDGEYFTLQIR.4y4_1.heavy 535.818 / 529.346 29434.0 33.225799560546875 47 17 10 10 10 10.760076260214987 9.293614430015387 0.0 3 0.9767427594772781 8.076774503518992 29434.0 21.931055299051707 0.0 - - - - - - - 1679.142857142857 58 7 TP53 tumor protein p53 393 51 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19111.[MT7]-K[MT7]K[MT7]PLDGEYFTLQIR.4y5_1.heavy 535.818 / 630.393 46628.0 33.225799560546875 47 17 10 10 10 10.760076260214987 9.293614430015387 0.0 3 0.9767427594772781 8.076774503518992 46628.0 39.20630608728052 0.0 - - - - - - - 486.0 93 1 TP53 tumor protein p53 395 51 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19111.[MT7]-K[MT7]K[MT7]PLDGEYFTLQIR.4b7_2.heavy 535.818 / 600.869 57703.0 33.225799560546875 47 17 10 10 10 10.760076260214987 9.293614430015387 0.0 3 0.9767427594772781 8.076774503518992 57703.0 51.922142063351636 0.0 - - - - - - - 749.2857142857143 115 7 TP53 tumor protein p53 397 51 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19111.[MT7]-K[MT7]K[MT7]PLDGEYFTLQIR.4b5_2.heavy 535.818 / 507.837 26908.0 33.225799560546875 47 17 10 10 10 10.760076260214987 9.293614430015387 0.0 3 0.9767427594772781 8.076774503518992 26908.0 23.873440273278636 0.0 - - - - - - - 825.5 53 8 TP53 tumor protein p53 399 52 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36391.[MT7]-DAADAVK[MT7].2y4_1.heavy 489.279 / 576.347 1142.0 17.362799962361652 32 16 4 6 6 0.9895189311315727 61.242496688181845 0.03179931640625 5 0.9633649565915404 6.428048605435369 1142.0 1.818384449105139 2.0 - - - - - - - 229.05882352941177 2 17 CAMK4 calcium/calmodulin-dependent protein kinase IV 401 52 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36391.[MT7]-DAADAVK[MT7].2b4_1.heavy 489.279 / 517.237 3011.0 17.362799962361652 32 16 4 6 6 0.9895189311315727 61.242496688181845 0.03179931640625 5 0.9633649565915404 6.428048605435369 3011.0 5.384181568088033 0.0 - - - - - - - 164.24 6 25 CAMK4 calcium/calmodulin-dependent protein kinase IV 403 52 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36391.[MT7]-DAADAVK[MT7].2y6_1.heavy 489.279 / 718.422 N/A 17.362799962361652 32 16 4 6 6 0.9895189311315727 61.242496688181845 0.03179931640625 5 0.9633649565915404 6.428048605435369 779.0 0.0 6.0 - - - - - - - 192.2 10 20 CAMK4 calcium/calmodulin-dependent protein kinase IV 405 52 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36391.[MT7]-DAADAVK[MT7].2b5_1.heavy 489.279 / 588.275 727.0 17.362799962361652 32 16 4 6 6 0.9895189311315727 61.242496688181845 0.03179931640625 5 0.9633649565915404 6.428048605435369 727.0 3.1967048103411737 8.0 - - - - - - - 243.7826086956522 2 23 CAMK4 calcium/calmodulin-dependent protein kinase IV 407 53 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36797.[MT7]-VEYLDDRNTFR.3y10_2.heavy 524.603 / 664.815 8647.0 28.63444995880127 36 10 10 6 10 3.5420818853037117 28.23198425053508 0.03510093688964844 3 0.8374300309993326 3.0183871720806223 8647.0 22.238482840852797 0.0 - - - - - - - 302.84615384615387 17 13 TP53 tumor protein p53 409 53 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36797.[MT7]-VEYLDDRNTFR.3b5_1.heavy 524.603 / 764.395 23715.0 28.63444995880127 36 10 10 6 10 3.5420818853037117 28.23198425053508 0.03510093688964844 3 0.8374300309993326 3.0183871720806223 23715.0 43.19924742733082 0.0 - - - - - - - 675.5555555555555 47 9 TP53 tumor protein p53 411 53 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36797.[MT7]-VEYLDDRNTFR.3b3_1.heavy 524.603 / 536.284 9674.0 28.63444995880127 36 10 10 6 10 3.5420818853037117 28.23198425053508 0.03510093688964844 3 0.8374300309993326 3.0183871720806223 9674.0 12.374627140504396 0.0 - - - - - - - 693.6 19 10 TP53 tumor protein p53 413 53 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36797.[MT7]-VEYLDDRNTFR.3y4_1.heavy 524.603 / 537.278 4709.0 28.63444995880127 36 10 10 6 10 3.5420818853037117 28.23198425053508 0.03510093688964844 3 0.8374300309993326 3.0183871720806223 4709.0 1.7004672897196262 3.0 - - - - - - - 751.6666666666666 13 9 TP53 tumor protein p53 415 54 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18750.[MT7]-GWGQYLFK[MT7].2b4_1.heavy 643.86 / 573.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 417 54 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18750.[MT7]-GWGQYLFK[MT7].2b6_1.heavy 643.86 / 849.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 419 54 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18750.[MT7]-GWGQYLFK[MT7].2y3_1.heavy 643.86 / 551.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 421 54 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18750.[MT7]-GWGQYLFK[MT7].2b5_1.heavy 643.86 / 736.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 423 55 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18947.[MT7]-FLIPNASQAESK[MT7].3y3_1.heavy 531.634 / 507.289 93663.0 32.3838996887207 47 17 10 10 10 4.349620959322942 22.990509043244522 0.0 3 0.9764104143560337 8.019453279098153 93663.0 35.367263946738404 0.0 - - - - - - - 694.3333333333334 187 3 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 425 55 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18947.[MT7]-FLIPNASQAESK[MT7].3b5_1.heavy 531.634 / 729.442 53224.0 32.3838996887207 47 17 10 10 10 4.349620959322942 22.990509043244522 0.0 3 0.9764104143560337 8.019453279098153 53224.0 41.83877097799207 0.0 - - - - - - - 1178.5555555555557 106 9 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 427 55 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18947.[MT7]-FLIPNASQAESK[MT7].3y4_1.heavy 531.634 / 578.327 146414.0 32.3838996887207 47 17 10 10 10 4.349620959322942 22.990509043244522 0.0 3 0.9764104143560337 8.019453279098153 146414.0 36.3217868989081 0.0 - - - - - - - 805.0 292 6 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 429 55 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18947.[MT7]-FLIPNASQAESK[MT7].3b3_1.heavy 531.634 / 518.346 201533.0 32.3838996887207 47 17 10 10 10 4.349620959322942 22.990509043244522 0.0 3 0.9764104143560337 8.019453279098153 201533.0 28.779907818999995 0.0 - - - - - - - 379.0 403 1 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 431 56 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533757.[MT7]-RPTVSSDLENIDTGVNSK[MT7].4y5_1.heavy 555.798 / 648.38 8871.0 28.51692533493042 29 3 10 6 10 2.8338990047993353 35.28707262702217 0.03529930114746094 3 0.5987986971518484 1.8791308826808932 8871.0 22.26264535412693 0.0 - - - - - - - 664.4285714285714 17 7 CCNB2 cyclin B2 433 56 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533757.[MT7]-RPTVSSDLENIDTGVNSK[MT7].4b7_1.heavy 555.798 / 887.47 6804.0 28.51692533493042 29 3 10 6 10 2.8338990047993353 35.28707262702217 0.03529930114746094 3 0.5987986971518484 1.8791308826808932 6804.0 40.34274210343631 0.0 - - - - - - - 196.78571428571428 13 14 CCNB2 cyclin B2 435 56 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533757.[MT7]-RPTVSSDLENIDTGVNSK[MT7].4b9_2.heavy 555.798 / 565.302 23943.0 28.51692533493042 29 3 10 6 10 2.8338990047993353 35.28707262702217 0.03529930114746094 3 0.5987986971518484 1.8791308826808932 23943.0 19.967577933809437 0.0 - - - - - - - 267.8888888888889 47 9 CCNB2 cyclin B2 437 56 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533757.[MT7]-RPTVSSDLENIDTGVNSK[MT7].4b10_2.heavy 555.798 / 622.324 33417.0 28.51692533493042 29 3 10 6 10 2.8338990047993353 35.28707262702217 0.03529930114746094 3 0.5987986971518484 1.8791308826808932 33417.0 39.71629414696753 0.0 - - - - - - - 287.3333333333333 66 3 CCNB2 cyclin B2 439 57 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18539.[MT7]-ENAQIIR.2y5_1.heavy 494.289 / 600.383 2785.0 21.793699264526367 29 11 0 10 8 0.821445787381385 76.46766619874674 0.0 4 0.8731128512248224 3.427288205681276 2785.0 9.674584929757344 2.0 - - - - - - - 254.30769230769232 8 13 GNA14 guanine nucleotide binding protein (G protein), alpha 14 441 57 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18539.[MT7]-ENAQIIR.2b4_1.heavy 494.289 / 587.291 5484.0 21.793699264526367 29 11 0 10 8 0.821445787381385 76.46766619874674 0.0 4 0.8731128512248224 3.427288205681276 5484.0 39.29149425287356 0.0 - - - - - - - 242.35714285714286 10 14 GNA14 guanine nucleotide binding protein (G protein), alpha 14 443 57 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18539.[MT7]-ENAQIIR.2y6_1.heavy 494.289 / 714.426 7747.0 21.793699264526367 29 11 0 10 8 0.821445787381385 76.46766619874674 0.0 4 0.8731128512248224 3.427288205681276 7747.0 62.77741379310345 1.0 - - - - - - - 234.23076923076923 54 13 GNA14 guanine nucleotide binding protein (G protein), alpha 14 445 57 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18539.[MT7]-ENAQIIR.2b5_1.heavy 494.289 / 700.375 6615.0 21.793699264526367 29 11 0 10 8 0.821445787381385 76.46766619874674 0.0 4 0.8731128512248224 3.427288205681276 6615.0 29.197241379310345 0.0 - - - - - - - 237.8 13 15 GNA14 guanine nucleotide binding protein (G protein), alpha 14 447 58 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533761.[MT7]-VEGNLRVEYLDDRNTFR.4y4_1.heavy 560.794 / 537.278 2796.0 30.884525299072266 36 10 10 6 10 1.3727333530143913 62.082770189292965 0.0326995849609375 3 0.8307027120449374 2.956042873207973 2796.0 4.447726358148894 2.0 - - - - - - - 698.875 5 8 TP53 tumor protein p53 449 58 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533761.[MT7]-VEGNLRVEYLDDRNTFR.4b8_2.heavy 560.794 / 521.294 7362.0 30.884525299072266 36 10 10 6 10 1.3727333530143913 62.082770189292965 0.0326995849609375 3 0.8307027120449374 2.956042873207973 7362.0 7.775056321375323 0.0 - - - - - - - 769.0 14 8 TP53 tumor protein p53 451 58 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533761.[MT7]-VEGNLRVEYLDDRNTFR.4b11_2.heavy 560.794 / 716.881 53677.0 30.884525299072266 36 10 10 6 10 1.3727333530143913 62.082770189292965 0.0326995849609375 3 0.8307027120449374 2.956042873207973 53677.0 39.012063523681434 0.0 - - - - - - - 719.0 107 7 TP53 tumor protein p53 453 58 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533761.[MT7]-VEGNLRVEYLDDRNTFR.4b4_1.heavy 560.794 / 544.285 5125.0 30.884525299072266 36 10 10 6 10 1.3727333530143913 62.082770189292965 0.0326995849609375 3 0.8307027120449374 2.956042873207973 5125.0 4.397332085375425 1.0 - - - - - - - 815.625 10 8 TP53 tumor protein p53 455 59 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41889.[MT7]-RTVLEEIGNR.2y9_1.heavy 665.882 / 1030.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 457 59 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41889.[MT7]-RTVLEEIGNR.2b6_1.heavy 665.882 / 872.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 459 59 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41889.[MT7]-RTVLEEIGNR.2y6_1.heavy 665.882 / 717.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 461 59 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41889.[MT7]-RTVLEEIGNR.2y7_1.heavy 665.882 / 830.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 463 60 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18536.[MT7]-SPSFEK[MT7].2b3_1.heavy 491.776 / 416.226 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGF19 fibroblast growth factor 19 465 60 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18536.[MT7]-SPSFEK[MT7].2y4_1.heavy 491.776 / 654.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGF19 fibroblast growth factor 19 467 60 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18536.[MT7]-SPSFEK[MT7].2y5_1.heavy 491.776 / 751.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGF19 fibroblast growth factor 19 469 60 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18536.[MT7]-SPSFEK[MT7].2y3_1.heavy 491.776 / 567.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGF19 fibroblast growth factor 19 471 61 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533625.[MT7]-EANAFEEQLLK[MT7].3y3_1.heavy 527.291 / 517.383 N/A 35.02389907836914 40 18 2 10 10 5.217873321231572 19.164896087664516 0.0 3 0.9830623525054609 9.469366340216995 17981.0 20.202834716874875 1.0 - - - - - - - 639.0 161 2 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 473 61 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533625.[MT7]-EANAFEEQLLK[MT7].3b6_1.heavy 527.291 / 806.38 13417.0 35.02389907836914 40 18 2 10 10 5.217873321231572 19.164896087664516 0.0 3 0.9830623525054609 9.469366340216995 13417.0 63.122014498550136 0.0 - - - - - - - 213.06666666666666 26 15 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 475 61 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533625.[MT7]-EANAFEEQLLK[MT7].3b4_1.heavy 527.291 / 530.269 30029.0 35.02389907836914 40 18 2 10 10 5.217873321231572 19.164896087664516 0.0 3 0.9830623525054609 9.469366340216995 30029.0 48.594084341960134 0.0 - - - - - - - 743.1428571428571 60 7 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 477 61 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533625.[MT7]-EANAFEEQLLK[MT7].3b5_1.heavy 527.291 / 677.338 15699.0 35.02389907836914 40 18 2 10 10 5.217873321231572 19.164896087664516 0.0 3 0.9830623525054609 9.469366340216995 15699.0 45.99607036770008 1.0 - - - - - - - 286.0 31 15 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 479 62 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18854.[MT7]-AYSEAHEISK[MT7].3y3_1.heavy 474.92 / 491.331 13021.0 20.1907000541687 40 14 10 6 10 4.249884364644046 18.81889965197861 0.03560066223144531 3 0.9490002783298738 5.441457243394491 13021.0 20.2037598897804 0.0 - - - - - - - 669.625 26 8 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 481 62 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18854.[MT7]-AYSEAHEISK[MT7].3b4_1.heavy 474.92 / 595.284 6920.0 20.1907000541687 40 14 10 6 10 4.249884364644046 18.81889965197861 0.03560066223144531 3 0.9490002783298738 5.441457243394491 6920.0 22.81492128796812 0.0 - - - - - - - 247.8 13 15 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 483 62 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18854.[MT7]-AYSEAHEISK[MT7].3b5_1.heavy 474.92 / 666.321 14286.0 20.1907000541687 40 14 10 6 10 4.249884364644046 18.81889965197861 0.03560066223144531 3 0.9490002783298738 5.441457243394491 14286.0 112.54841604719053 0.0 - - - - - - - 213.9375 28 16 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 485 62 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18854.[MT7]-AYSEAHEISK[MT7].3y4_1.heavy 474.92 / 620.374 15253.0 20.1907000541687 40 14 10 6 10 4.249884364644046 18.81889965197861 0.03560066223144531 3 0.9490002783298738 5.441457243394491 15253.0 96.68874949250919 0.0 - - - - - - - 725.625 30 8 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 487 63 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42077.[MT7]-DIC[CAM]NDVLSLLEK[MT7].2y5_1.heavy 853.965 / 733.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 489 63 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42077.[MT7]-DIC[CAM]NDVLSLLEK[MT7].2b6_1.heavy 853.965 / 861.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 491 63 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42077.[MT7]-DIC[CAM]NDVLSLLEK[MT7].2y6_1.heavy 853.965 / 846.542 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 493 63 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42077.[MT7]-DIC[CAM]NDVLSLLEK[MT7].2b5_1.heavy 853.965 / 762.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 495 64 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533628.[MT7]-SEYSVHSSLASK[MT7].3y6_1.heavy 528.282 / 736.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 497 64 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533628.[MT7]-SEYSVHSSLASK[MT7].3b4_1.heavy 528.282 / 611.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 499 64 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533628.[MT7]-SEYSVHSSLASK[MT7].3b5_1.heavy 528.282 / 710.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 501 64 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533628.[MT7]-SEYSVHSSLASK[MT7].3b3_1.heavy 528.282 / 524.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 503 65 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 526398.0 17.880199432373047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 526398.0 1039.5399094112593 0.0 - - - - - - - 173.33333333333334 1052 6 505 65 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 343496.0 17.880199432373047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 343496.0 6692.526904844034 0.0 - - - - - - - 230.28571428571428 686 7 507 65 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 309672.0 17.880199432373047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 309672.0 6000.344502779928 0.0 - - - - - - - 236.36363636363637 619 11 509 66 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36920.[MT7]-YIQWVEENFPENK[MT7].3b4_1.heavy 662.007 / 735.395 7901.0 40.90769958496094 44 14 10 10 10 2.147922278874354 36.61286943569702 0.0 3 0.9440420735975988 5.192604863970789 7901.0 64.90260284380767 0.0 - - - - - - - 192.86363636363637 15 22 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 511 66 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36920.[MT7]-YIQWVEENFPENK[MT7].3b5_1.heavy 662.007 / 834.463 4699.0 40.90769958496094 44 14 10 10 10 2.147922278874354 36.61286943569702 0.0 3 0.9440420735975988 5.192604863970789 4699.0 30.320036202502315 1.0 - - - - - - - 206.0909090909091 10 22 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 513 66 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36920.[MT7]-YIQWVEENFPENK[MT7].3y4_1.heavy 662.007 / 631.353 21667.0 40.90769958496094 44 14 10 10 10 2.147922278874354 36.61286943569702 0.0 3 0.9440420735975988 5.192604863970789 21667.0 89.34341949449919 0.0 - - - - - - - 689.2857142857143 43 7 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 515 66 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36920.[MT7]-YIQWVEENFPENK[MT7].3b3_1.heavy 662.007 / 549.315 11187.0 40.90769958496094 44 14 10 10 10 2.147922278874354 36.61286943569702 0.0 3 0.9440420735975988 5.192604863970789 11187.0 26.66430448518817 0.0 - - - - - - - 734.75 22 12 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 517 67 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36921.[MT7]-VDQLLHFQEDVTEK[MT7].3b4_1.heavy 663.689 / 600.347 2742.0 35.53199863433838 34 8 10 6 10 0.6823075814602333 77.38749160941283 0.037601470947265625 3 0.7956237991857563 2.6819872368192623 2742.0 6.961147365788218 0.0 - - - - - - - 657.2857142857143 5 7 MYLK3 myosin light chain kinase 3 519 67 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36921.[MT7]-VDQLLHFQEDVTEK[MT7].3b5_1.heavy 663.689 / 713.431 3449.0 35.53199863433838 34 8 10 6 10 0.6823075814602333 77.38749160941283 0.037601470947265625 3 0.7956237991857563 2.6819872368192623 3449.0 20.049888992987537 0.0 - - - - - - - 732.8571428571429 6 7 MYLK3 myosin light chain kinase 3 521 67 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36921.[MT7]-VDQLLHFQEDVTEK[MT7].3y4_1.heavy 663.689 / 620.374 3095.0 35.53199863433838 34 8 10 6 10 0.6823075814602333 77.38749160941283 0.037601470947265625 3 0.7956237991857563 2.6819872368192623 3095.0 8.582126696832578 0.0 - - - - - - - 696.5 6 8 MYLK3 myosin light chain kinase 3 523 67 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36921.[MT7]-VDQLLHFQEDVTEK[MT7].3y5_1.heavy 663.689 / 735.401 973.0 35.53199863433838 34 8 10 6 10 0.6823075814602333 77.38749160941283 0.037601470947265625 3 0.7956237991857563 2.6819872368192623 973.0 1.590761707875834 4.0 - - - - - - - 193.375 2 16 MYLK3 myosin light chain kinase 3 525 68 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18763.[MT7]-WVLEHISK[MT7].2y4_1.heavy 650.387 / 628.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 527 68 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18763.[MT7]-WVLEHISK[MT7].2y5_1.heavy 650.387 / 757.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 529 68 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18763.[MT7]-WVLEHISK[MT7].2b4_1.heavy 650.387 / 672.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 531 68 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18763.[MT7]-WVLEHISK[MT7].2y6_1.heavy 650.387 / 870.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 533 69 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18955.[MT7]-IDLLSSLIYVSQN.2b4_1.heavy 804.952 / 599.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 535 69 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18955.[MT7]-IDLLSSLIYVSQN.2b6_1.heavy 804.952 / 773.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 537 69 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18955.[MT7]-IDLLSSLIYVSQN.2b7_1.heavy 804.952 / 886.537 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 539 69 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18955.[MT7]-IDLLSSLIYVSQN.2b5_1.heavy 804.952 / 686.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 541 70 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 1292680.0 36.66930135091146 23 -3 10 6 10 null 0.0 0.038700103759765625 3 0.0 0.0 1292680.0 543.9773201217452 0.0 - - - - - - - 346.14285714285717 2585 7 543 70 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 639088.0 36.66930135091146 23 -3 10 6 10 null 0.0 0.038700103759765625 3 0.0 0.0 639088.0 183.6038722867926 0.0 - - - - - - - 169.11111111111111 1278 9 545 70 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 833129.0 36.66930135091146 23 -3 10 6 10 null 0.0 0.038700103759765625 3 0.0 0.0 833129.0 268.9747407834926 0.0 - - - - - - - 311.5 1666 6 547 71 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18445.[MT7]-NILVK[MT7].2y4_1.heavy 437.802 / 616.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR1C;BMPR1B;TGFBR1;ACVR1;ACVR1B activin A receptor, type IC;bone morphogenetic protein receptor, type IB;transforming growth factor, beta receptor 1;activin A receptor, type I;activin A receptor, type IB 549 71 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18445.[MT7]-NILVK[MT7].2b3_1.heavy 437.802 / 485.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR1C;BMPR1B;TGFBR1;ACVR1;ACVR1B activin A receptor, type IC;bone morphogenetic protein receptor, type IB;transforming growth factor, beta receptor 1;activin A receptor, type I;activin A receptor, type IB 551 71 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18445.[MT7]-NILVK[MT7].2b4_1.heavy 437.802 / 584.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR1C;BMPR1B;TGFBR1;ACVR1;ACVR1B activin A receptor, type IC;bone morphogenetic protein receptor, type IB;transforming growth factor, beta receptor 1;activin A receptor, type I;activin A receptor, type IB 553 71 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18445.[MT7]-NILVK[MT7].2y3_1.heavy 437.802 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR1C;BMPR1B;TGFBR1;ACVR1;ACVR1B activin A receptor, type IC;bone morphogenetic protein receptor, type IB;transforming growth factor, beta receptor 1;activin A receptor, type I;activin A receptor, type IB 555 72 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533537.[MT7]-DYFVTANSNLVIITAGAR.3y7_1.heavy 690.376 / 701.43 12479.0 40.1822509765625 43 17 10 6 10 3.386210313269882 23.3493429251241 0.03170013427734375 3 0.9710802260725495 7.239568596571628 12479.0 29.220462960390016 0.0 - - - - - - - 716.5 24 12 LDHAL6B lactate dehydrogenase A-like 6B 557 72 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533537.[MT7]-DYFVTANSNLVIITAGAR.3b4_1.heavy 690.376 / 669.336 6152.0 40.1822509765625 43 17 10 6 10 3.386210313269882 23.3493429251241 0.03170013427734375 3 0.9710802260725495 7.239568596571628 6152.0 24.081223241590216 0.0 - - - - - - - 592.1428571428571 12 7 LDHAL6B lactate dehydrogenase A-like 6B 559 72 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533537.[MT7]-DYFVTANSNLVIITAGAR.3b3_1.heavy 690.376 / 570.268 5891.0 40.1822509765625 43 17 10 6 10 3.386210313269882 23.3493429251241 0.03170013427734375 3 0.9710802260725495 7.239568596571628 5891.0 12.377698215689458 0.0 - - - - - - - 702.7 11 10 LDHAL6B lactate dehydrogenase A-like 6B 561 72 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533537.[MT7]-DYFVTANSNLVIITAGAR.3y8_1.heavy 690.376 / 800.499 6545.0 40.1822509765625 43 17 10 6 10 3.386210313269882 23.3493429251241 0.03170013427734375 3 0.9710802260725495 7.239568596571628 6545.0 31.597600734830294 0.0 - - - - - - - 257.36842105263156 13 19 LDHAL6B lactate dehydrogenase A-like 6B 563 73 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36274.[MT7]-ELEQR.2b3_1.heavy 409.728 / 516.279 4459.0 16.15956687927246 26 10 6 6 4 1.440241684970783 53.18592223408779 0.03259849548339844 8 0.8470637142127245 3.114655897677186 4459.0 12.801437875872509 0.0 - - - - - - - 255.05263157894737 8 19 FAM71E2;TAOK1;HSD3B7;TAOK2;JAKMIP2 family with sequence similarity 71, member E2;TAO kinase 1;hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7;TAO kinase 2;janus kinase and microtubule interacting protein 2 565 73 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36274.[MT7]-ELEQR.2y4_1.heavy 409.728 / 545.304 1784.0 16.15956687927246 26 10 6 6 4 1.440241684970783 53.18592223408779 0.03259849548339844 8 0.8470637142127245 3.114655897677186 1784.0 3.873843248347498 1.0 - - - - - - - 752.6 4 10 FAM71E2;TAOK1;HSD3B7;TAOK2;JAKMIP2 family with sequence similarity 71, member E2;TAO kinase 1;hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7;TAO kinase 2;janus kinase and microtubule interacting protein 2 567 73 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36274.[MT7]-ELEQR.2b4_1.heavy 409.728 / 644.337 1003.0 16.15956687927246 26 10 6 6 4 1.440241684970783 53.18592223408779 0.03259849548339844 8 0.8470637142127245 3.114655897677186 1003.0 1.799103139013453 5.0 - - - - - - - 637.0 14 7 FAM71E2;TAOK1;HSD3B7;TAOK2;JAKMIP2 family with sequence similarity 71, member E2;TAO kinase 1;hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7;TAO kinase 2;janus kinase and microtubule interacting protein 2 569 74 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36275.[MT7]-GATVGK[MT7].2y4_1.heavy 410.76 / 548.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 571 74 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36275.[MT7]-GATVGK[MT7].2y5_1.heavy 410.76 / 619.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 573 74 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36275.[MT7]-GATVGK[MT7].2y3_1.heavy 410.76 / 447.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 575 74 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36275.[MT7]-GATVGK[MT7].2b5_1.heavy 410.76 / 530.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 577 75 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533538.[MT7]-LTETHLPAQAR.3y6_1.heavy 460.929 / 655.389 10486.0 23.761699676513672 48 18 10 10 10 4.28930898324773 23.31377860409654 0.0 3 0.9873039339842221 10.941257131973687 10486.0 47.25018149229503 0.0 - - - - - - - 211.0909090909091 20 11 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 579 75 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533538.[MT7]-LTETHLPAQAR.3b4_1.heavy 460.929 / 589.331 18221.0 23.761699676513672 48 18 10 10 10 4.28930898324773 23.31377860409654 0.0 3 0.9873039339842221 10.941257131973687 18221.0 54.03231480145055 0.0 - - - - - - - 672.1818181818181 36 11 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 581 75 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533538.[MT7]-LTETHLPAQAR.3b3_1.heavy 460.929 / 488.284 11603.0 23.761699676513672 48 18 10 10 10 4.28930898324773 23.31377860409654 0.0 3 0.9873039339842221 10.941257131973687 11603.0 23.3351947850599 0.0 - - - - - - - 265.1666666666667 23 12 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 583 75 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533538.[MT7]-LTETHLPAQAR.3y5_1.heavy 460.929 / 542.305 115685.0 23.761699676513672 48 18 10 10 10 4.28930898324773 23.31377860409654 0.0 3 0.9873039339842221 10.941257131973687 115685.0 326.0446566998893 0.0 - - - - - - - 636.3 231 10 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 585 76 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533539.[MT7]-VVSWIDVYTR.2y4_1.heavy 691.383 / 538.298 16238.0 40.36979961395264 47 20 10 7 10 7.7667760492143945 12.875355149465776 0.028797149658203125 3 0.9947774391210268 17.06991749957329 16238.0 55.02164959516145 0.0 - - - - - - - 236.5 32 20 VEGFB vascular endothelial growth factor B 587 76 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533539.[MT7]-VVSWIDVYTR.2y8_1.heavy 691.383 / 1039.52 14799.0 40.36979961395264 47 20 10 7 10 7.7667760492143945 12.875355149465776 0.028797149658203125 3 0.9947774391210268 17.06991749957329 14799.0 103.1864038079881 0.0 - - - - - - - 159.83333333333334 29 18 VEGFB vascular endothelial growth factor B 589 76 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533539.[MT7]-VVSWIDVYTR.2y9_1.heavy 691.383 / 1138.59 17722.0 40.36979961395264 47 20 10 7 10 7.7667760492143945 12.875355149465776 0.028797149658203125 3 0.9947774391210268 17.06991749957329 17722.0 177.8574820143885 0.0 - - - - - - - 146.1 35 20 VEGFB vascular endothelial growth factor B 591 76 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533539.[MT7]-VVSWIDVYTR.2y7_1.heavy 691.383 / 952.489 6820.0 40.36979961395264 47 20 10 7 10 7.7667760492143945 12.875355149465776 0.028797149658203125 3 0.9947774391210268 17.06991749957329 6820.0 68.42929020664869 0.0 - - - - - - - 175.78947368421052 13 19 VEGFB vascular endothelial growth factor B 593 77 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18827.[MT7]-NIC[CAM]SVDTC[CAM]K[MT7].3y3_1.heavy 462.232 / 552.293 15429.0 21.751699447631836 50 20 10 10 10 28.8629129312594 3.464653766519075 0.0 3 0.9952184734304564 17.84045317631429 15429.0 48.32658185131196 0.0 - - - - - - - 248.6 30 10 EXOG endo/exonuclease (5'-3'), endonuclease G-like 595 77 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18827.[MT7]-NIC[CAM]SVDTC[CAM]K[MT7].3b4_1.heavy 462.232 / 619.299 12172.0 21.751699447631836 50 20 10 10 10 28.8629129312594 3.464653766519075 0.0 3 0.9952184734304564 17.84045317631429 12172.0 47.18000529928705 0.0 - - - - - - - 278.6666666666667 24 12 EXOG endo/exonuclease (5'-3'), endonuclease G-like 597 77 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18827.[MT7]-NIC[CAM]SVDTC[CAM]K[MT7].3b3_1.heavy 462.232 / 532.267 10458.0 21.751699447631836 50 20 10 10 10 28.8629129312594 3.464653766519075 0.0 3 0.9952184734304564 17.84045317631429 10458.0 22.574066397943312 0.0 - - - - - - - 607.6363636363636 20 11 EXOG endo/exonuclease (5'-3'), endonuclease G-like 599 77 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18827.[MT7]-NIC[CAM]SVDTC[CAM]K[MT7].3y4_1.heavy 462.232 / 667.32 19201.0 21.751699447631836 50 20 10 10 10 28.8629129312594 3.464653766519075 0.0 3 0.9952184734304564 17.84045317631429 19201.0 110.40938598843583 0.0 - - - - - - - 257.3333333333333 38 6 EXOG endo/exonuclease (5'-3'), endonuclease G-like 601 78 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36781.[MT7]-EVTATAYEIIK[MT7].2y8_1.heavy 763.439 / 1052.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHAL6B lactate dehydrogenase A-like 6B 603 78 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36781.[MT7]-EVTATAYEIIK[MT7].2y5_1.heavy 763.439 / 809.489 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHAL6B lactate dehydrogenase A-like 6B 605 78 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36781.[MT7]-EVTATAYEIIK[MT7].2y3_1.heavy 763.439 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHAL6B lactate dehydrogenase A-like 6B 607 78 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36781.[MT7]-EVTATAYEIIK[MT7].2y7_1.heavy 763.439 / 981.574 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHAL6B lactate dehydrogenase A-like 6B 609 79 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19170.[MT7]-RPTISPNFNFLGQLLDYEK[MT7].3b9_2.heavy 847.463 / 586.321 9032.0 46.3812255859375 34 8 10 6 10 1.1312016845434643 51.60432809205655 0.034698486328125 3 0.7866187305509253 2.6226508837170357 9032.0 48.012286233979594 0.0 - - - - - - - 210.10526315789474 18 19 DUSP16 dual specificity phosphatase 16 611 79 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19170.[MT7]-RPTISPNFNFLGQLLDYEK[MT7].3y3_1.heavy 847.463 / 583.321 4441.0 46.3812255859375 34 8 10 6 10 1.1312016845434643 51.60432809205655 0.034698486328125 3 0.7866187305509253 2.6226508837170357 4441.0 22.535388200365933 0.0 - - - - - - - 259.55 8 20 DUSP16 dual specificity phosphatase 16 613 79 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19170.[MT7]-RPTISPNFNFLGQLLDYEK[MT7].3y8_1.heavy 847.463 / 1109.6 3892.0 46.3812255859375 34 8 10 6 10 1.1312016845434643 51.60432809205655 0.034698486328125 3 0.7866187305509253 2.6226508837170357 3892.0 37.657377926421404 0.0 - - - - - - - 112.375 7 16 DUSP16 dual specificity phosphatase 16 615 79 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19170.[MT7]-RPTISPNFNFLGQLLDYEK[MT7].3b7_1.heavy 847.463 / 910.523 998.0 46.3812255859375 34 8 10 6 10 1.1312016845434643 51.60432809205655 0.034698486328125 3 0.7866187305509253 2.6226508837170357 998.0 13.972000000000001 1.0 - - - - - - - 166.38095238095238 2 21 DUSP16 dual specificity phosphatase 16 617 80 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19073.[MT7]-EVVVPLTVELMGTVAK[MT7].3b6_1.heavy 658.391 / 781.494 1415.0 45.22202396392822 38 12 10 6 10 2.6167640036623667 38.215138950261526 0.032901763916015625 3 0.896378901659954 3.800272618179204 1415.0 12.930436350522898 0.0 - - - - - - - 113.47058823529412 2 17 VEGFB vascular endothelial growth factor B 619 80 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19073.[MT7]-EVVVPLTVELMGTVAK[MT7].3b4_1.heavy 658.391 / 571.357 10046.0 45.22202396392822 38 12 10 6 10 2.6167640036623667 38.215138950261526 0.032901763916015625 3 0.896378901659954 3.800272618179204 10046.0 46.14770318021202 0.0 - - - - - - - 228.7 20 20 VEGFB vascular endothelial growth factor B 621 80 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19073.[MT7]-EVVVPLTVELMGTVAK[MT7].3b7_1.heavy 658.391 / 882.542 849.0 45.22202396392822 38 12 10 6 10 2.6167640036623667 38.215138950261526 0.032901763916015625 3 0.896378901659954 3.800272618179204 849.0 10.416808510638297 0.0 - - - - - - - 0.0 1 0 VEGFB vascular endothelial growth factor B 623 80 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19073.[MT7]-EVVVPLTVELMGTVAK[MT7].3y5_1.heavy 658.391 / 619.39 8160.0 45.22202396392822 38 12 10 6 10 2.6167640036623667 38.215138950261526 0.032901763916015625 3 0.896378901659954 3.800272618179204 8160.0 52.3275637279144 0.0 - - - - - - - 277.6666666666667 16 18 VEGFB vascular endothelial growth factor B 625 81 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18963.[MT7]-VLITELIQHSAK[MT7].4y4_1.heavy 410.755 / 586.343 12952.0 38.03329849243164 38 8 10 10 10 0.5979367898138233 87.20079473565191 0.0 3 0.7697811792697258 2.5210662189289725 12952.0 200.52803129074317 0.0 - - - - - - - 166.3 25 10 DUSP16 dual specificity phosphatase 16 627 81 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18963.[MT7]-VLITELIQHSAK[MT7].4y3_2.heavy 410.755 / 225.146 2198.0 38.03329849243164 38 8 10 10 10 0.5979367898138233 87.20079473565191 0.0 3 0.7697811792697258 2.5210662189289725 2198.0 29.552941176470586 1.0 - - - - - - - 152.1875 4 16 DUSP16 dual specificity phosphatase 16 629 81 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18963.[MT7]-VLITELIQHSAK[MT7].4y3_1.heavy 410.755 / 449.284 10516.0 38.03329849243164 38 8 10 10 10 0.5979367898138233 87.20079473565191 0.0 3 0.7697811792697258 2.5210662189289725 10516.0 83.26907199334165 0.0 - - - - - - - 140.27272727272728 21 11 DUSP16 dual specificity phosphatase 16 631 81 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18963.[MT7]-VLITELIQHSAK[MT7].4b3_1.heavy 410.755 / 470.346 17646.0 38.03329849243164 38 8 10 10 10 0.5979367898138233 87.20079473565191 0.0 3 0.7697811792697258 2.5210662189289725 17646.0 90.69599957469431 0.0 - - - - - - - 264.54545454545456 35 22 DUSP16 dual specificity phosphatase 16 633 82 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41927.[MT7]-VAAAASC[CAM]LSQK[MT7].2y3_1.heavy 697.389 / 506.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 635 82 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41927.[MT7]-VAAAASC[CAM]LSQK[MT7].2y6_1.heavy 697.389 / 866.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 637 82 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41927.[MT7]-VAAAASC[CAM]LSQK[MT7].2y10_1.heavy 697.389 / 1150.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 639 82 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41927.[MT7]-VAAAASC[CAM]LSQK[MT7].2b5_1.heavy 697.389 / 528.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 641 83 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42188.[MT7]-SSDFLESAELDSGGFGK[MT7].2y9_1.heavy 1017.5 / 1053.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 643 83 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42188.[MT7]-SSDFLESAELDSGGFGK[MT7].2b4_1.heavy 1017.5 / 581.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 645 83 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42188.[MT7]-SSDFLESAELDSGGFGK[MT7].2b6_1.heavy 1017.5 / 823.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 647 83 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42188.[MT7]-SSDFLESAELDSGGFGK[MT7].2y6_1.heavy 1017.5 / 696.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 649 84 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533736.[MT7]-TC[CAM]PVQLWVDSTPPPGTR.3b6_1.heavy 685.687 / 843.451 26438.0 36.42190074920654 40 14 10 6 10 2.207623214096981 38.83054602790282 0.037197113037109375 3 0.9499132321997361 5.491250893872491 26438.0 97.97423486682808 0.0 - - - - - - - 354.5 52 6 TP53 tumor protein p53 651 84 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533736.[MT7]-TC[CAM]PVQLWVDSTPPPGTR.3y6_1.heavy 685.687 / 624.346 53159.0 36.42190074920654 40 14 10 6 10 2.207623214096981 38.83054602790282 0.037197113037109375 3 0.9499132321997361 5.491250893872491 53159.0 70.46267302787389 0.0 - - - - - - - 496.0 106 3 TP53 tumor protein p53 653 84 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533736.[MT7]-TC[CAM]PVQLWVDSTPPPGTR.3b4_1.heavy 685.687 / 602.309 10632.0 36.42190074920654 40 14 10 6 10 2.207623214096981 38.83054602790282 0.037197113037109375 3 0.9499132321997361 5.491250893872491 10632.0 40.43741710450792 0.0 - - - - - - - 759.5714285714286 21 7 TP53 tumor protein p53 655 84 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533736.[MT7]-TC[CAM]PVQLWVDSTPPPGTR.3b5_1.heavy 685.687 / 730.367 23957.0 36.42190074920654 40 14 10 6 10 2.207623214096981 38.83054602790282 0.037197113037109375 3 0.9499132321997361 5.491250893872491 23957.0 17.28544914625093 1.0 - - - - - - - 212.6 47 5 TP53 tumor protein p53 657 85 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19172.[MT7]-GIVDQSQQAYQEAFEISK[MT7]K[MT7].4y4_1.heavy 651.103 / 763.528 2388.0 34.657901763916016 44 14 10 10 10 1.7209601925544322 47.32046283511715 0.0 3 0.9334989540092271 4.758953769469907 2388.0 23.05824345146379 0.0 - - - - - - - 203.84615384615384 4 13 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 659 85 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19172.[MT7]-GIVDQSQQAYQEAFEISK[MT7]K[MT7].4b4_1.heavy 651.103 / 529.31 7429.0 34.657901763916016 44 14 10 10 10 1.7209601925544322 47.32046283511715 0.0 3 0.9334989540092271 4.758953769469907 7429.0 15.950530698785332 0.0 - - - - - - - 707.7777777777778 14 9 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 661 85 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19172.[MT7]-GIVDQSQQAYQEAFEISK[MT7]K[MT7].4b5_1.heavy 651.103 / 657.369 5129.0 34.657901763916016 44 14 10 10 10 1.7209601925544322 47.32046283511715 0.0 3 0.9334989540092271 4.758953769469907 5129.0 19.99440677966102 0.0 - - - - - - - 287.375 10 16 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 663 85 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19172.[MT7]-GIVDQSQQAYQEAFEISK[MT7]K[MT7].4y3_1.heavy 651.103 / 650.444 N/A 34.657901763916016 44 14 10 10 10 1.7209601925544322 47.32046283511715 0.0 3 0.9334989540092271 4.758953769469907 11232.0 3.464938877224653 2.0 - - - - - - - 1327.0 22 1 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 665 86 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19072.[MT7]-EVVVPLTVELMGTVAK[MT7].2y8_1.heavy 987.083 / 992.557 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFB vascular endothelial growth factor B 667 86 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19072.[MT7]-EVVVPLTVELMGTVAK[MT7].2y5_1.heavy 987.083 / 619.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFB vascular endothelial growth factor B 669 86 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19072.[MT7]-EVVVPLTVELMGTVAK[MT7].2b4_1.heavy 987.083 / 571.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFB vascular endothelial growth factor B 671 86 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19072.[MT7]-EVVVPLTVELMGTVAK[MT7].2y10_1.heavy 987.083 / 1192.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFB vascular endothelial growth factor B 673 87 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18598.[MT7]-GDQAFTER.2y5_1.heavy 534.266 / 623.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3;MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 3;mitogen-activated protein kinase-activated protein kinase 2 675 87 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18598.[MT7]-GDQAFTER.2b4_1.heavy 534.266 / 516.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3;MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 3;mitogen-activated protein kinase-activated protein kinase 2 677 87 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18598.[MT7]-GDQAFTER.2y6_1.heavy 534.266 / 751.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3;MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 3;mitogen-activated protein kinase-activated protein kinase 2 679 87 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18598.[MT7]-GDQAFTER.2b5_1.heavy 534.266 / 663.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3;MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 3;mitogen-activated protein kinase-activated protein kinase 2 681 88 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533533.[MT7]-YLAEVATGEK[MT7].3b4_1.heavy 456.925 / 621.336 79676.0 30.34480094909668 46 16 10 10 10 1.6658124910222443 46.89484173330076 0.0 3 0.9677551987104911 6.854228499549263 79676.0 157.60349952371263 0.0 - - - - - - - 759.5714285714286 159 7 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 683 88 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533533.[MT7]-YLAEVATGEK[MT7].3b5_1.heavy 456.925 / 720.405 26679.0 30.34480094909668 46 16 10 10 10 1.6658124910222443 46.89484173330076 0.0 3 0.9677551987104911 6.854228499549263 26679.0 152.07961491065927 0.0 - - - - - - - 225.28571428571428 53 14 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 685 88 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533533.[MT7]-YLAEVATGEK[MT7].3y4_1.heavy 456.925 / 578.327 45426.0 30.34480094909668 46 16 10 10 10 1.6658124910222443 46.89484173330076 0.0 3 0.9677551987104911 6.854228499549263 45426.0 186.85022331874393 0.0 - - - - - - - 631.0 90 8 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 687 88 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533533.[MT7]-YLAEVATGEK[MT7].3b3_1.heavy 456.925 / 492.294 29653.0 30.34480094909668 46 16 10 10 10 1.6658124910222443 46.89484173330076 0.0 3 0.9677551987104911 6.854228499549263 29653.0 34.58216356633278 0.0 - - - - - - - 793.0 59 10 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 689 89 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19178.[MT7]-VRVPTTGIIEYPFDLENIIFR.4b8_1.heavy 659.87 / 968.601 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA11;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), alpha 14 691 89 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19178.[MT7]-VRVPTTGIIEYPFDLENIIFR.4b7_1.heavy 659.87 / 855.517 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA11;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), alpha 14 693 89 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19178.[MT7]-VRVPTTGIIEYPFDLENIIFR.4b10_1.heavy 659.87 / 1210.73 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA11;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), alpha 14 695 89 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19178.[MT7]-VRVPTTGIIEYPFDLENIIFR.4b10_2.heavy 659.87 / 605.867 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA11;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), alpha 14 697 90 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18454.[MT7]-ALYPK[MT7].2y4_1.heavy 440.281 / 664.415 6766.0 23.136233647664387 40 14 10 6 10 1.8749226897468934 53.335532471207955 0.038799285888671875 3 0.9397118796137496 5.000806760217752 6766.0 14.335666131621188 0.0 - - - - - - - 642.7777777777778 13 9 BTRC beta-transducin repeat containing 699 90 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18454.[MT7]-ALYPK[MT7].2b3_1.heavy 440.281 / 492.294 8546.0 23.136233647664387 40 14 10 6 10 1.8749226897468934 53.335532471207955 0.038799285888671875 3 0.9397118796137496 5.000806760217752 8546.0 22.38923970037453 0.0 - - - - - - - 259.5833333333333 17 12 BTRC beta-transducin repeat containing 701 90 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18454.[MT7]-ALYPK[MT7].2y3_1.heavy 440.281 / 551.331 8724.0 23.136233647664387 40 14 10 6 10 1.8749226897468934 53.335532471207955 0.038799285888671875 3 0.9397118796137496 5.000806760217752 8724.0 43.9467415730337 1.0 - - - - - - - 217.55555555555554 17 9 BTRC beta-transducin repeat containing 703 91 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18590.[MT7]-EQSGTQIR.2y5_1.heavy 531.787 / 574.331 1287.0 15.689599990844727 48 18 10 10 10 3.239372644030324 30.870174872991207 0.0 3 0.9837192573590794 9.659046966258854 1287.0 5.595652173913043 0.0 - - - - - - - 161.04347826086956 2 23 EXOG endo/exonuclease (5'-3'), endonuclease G-like 705 91 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18590.[MT7]-EQSGTQIR.2b6_1.heavy 531.787 / 775.37 2360.0 15.689599990844727 48 18 10 10 10 3.239372644030324 30.870174872991207 0.0 3 0.9837192573590794 9.659046966258854 2360.0 17.039252336448598 0.0 - - - - - - - 122.0909090909091 4 11 EXOG endo/exonuclease (5'-3'), endonuclease G-like 707 91 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18590.[MT7]-EQSGTQIR.2y6_1.heavy 531.787 / 661.363 2949.0 15.689599990844727 48 18 10 10 10 3.239372644030324 30.870174872991207 0.0 3 0.9837192573590794 9.659046966258854 2949.0 10.812362102530823 0.0 - - - - - - - 148.41176470588235 5 17 EXOG endo/exonuclease (5'-3'), endonuclease G-like 709 91 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18590.[MT7]-EQSGTQIR.2y7_1.heavy 531.787 / 789.421 6435.0 15.689599990844727 48 18 10 10 10 3.239372644030324 30.870174872991207 0.0 3 0.9837192573590794 9.659046966258854 6435.0 29.629641987254345 0.0 - - - - - - - 177.1 12 20 EXOG endo/exonuclease (5'-3'), endonuclease G-like 711 92 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19076.[MT7]-YIQWVEENFPENK[MT7].2b3_1.heavy 992.506 / 549.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 713 92 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19076.[MT7]-YIQWVEENFPENK[MT7].2y4_1.heavy 992.506 / 631.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 715 92 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19076.[MT7]-YIQWVEENFPENK[MT7].2b4_1.heavy 992.506 / 735.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 717 92 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19076.[MT7]-YIQWVEENFPENK[MT7].2y7_1.heavy 992.506 / 1021.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 719 93 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533427.[MT7]-ILPWLDK[MT7].2y4_1.heavy 586.868 / 705.405 1400.0 41.479549407958984 41 16 10 7 8 1.5624478007347886 47.90830509990644 0.0287017822265625 4 0.9604038041488842 6.18147455593334 1400.0 3.625580876524282 2.0 - - - - - - - 249.16666666666666 4 24 DUSP16 dual specificity phosphatase 16 721 93 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533427.[MT7]-ILPWLDK[MT7].2y5_1.heavy 586.868 / 802.458 13997.0 41.479549407958984 41 16 10 7 8 1.5624478007347886 47.90830509990644 0.0287017822265625 4 0.9604038041488842 6.18147455593334 13997.0 65.89909599136014 0.0 - - - - - - - 222.625 27 16 DUSP16 dual specificity phosphatase 16 723 93 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533427.[MT7]-ILPWLDK[MT7].2y3_1.heavy 586.868 / 519.326 1866.0 41.479549407958984 41 16 10 7 8 1.5624478007347886 47.90830509990644 0.0287017822265625 4 0.9604038041488842 6.18147455593334 1866.0 0.4449822388918657 1.0 - - - - - - - 660.4285714285714 4 7 DUSP16 dual specificity phosphatase 16 725 93 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533427.[MT7]-ILPWLDK[MT7].2y6_1.heavy 586.868 / 915.542 3181.0 41.479549407958984 41 16 10 7 8 1.5624478007347886 47.90830509990644 0.0287017822265625 4 0.9604038041488842 6.18147455593334 3181.0 24.129302617368655 0.0 - - - - - - - 103.55555555555556 6 18 DUSP16 dual specificity phosphatase 16 727 94 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18836.[MT7]-RATVVESSEK[MT7].3y3_1.heavy 465.268 / 507.289 19171.0 16.447900772094727 47 17 10 10 10 2.8991125883642908 27.535738523993828 0.0 3 0.9782779382958215 8.358388453983684 19171.0 77.51194464720194 0.0 - - - - - - - 242.95454545454547 38 22 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 729 94 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18836.[MT7]-RATVVESSEK[MT7].3b4_1.heavy 465.268 / 572.364 21382.0 16.447900772094727 47 17 10 10 10 2.8991125883642908 27.535738523993828 0.0 3 0.9782779382958215 8.358388453983684 21382.0 48.85354222131204 0.0 - - - - - - - 694.0 42 8 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 731 94 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18836.[MT7]-RATVVESSEK[MT7].3y4_1.heavy 465.268 / 594.321 27189.0 16.447900772094727 47 17 10 10 10 2.8991125883642908 27.535738523993828 0.0 3 0.9782779382958215 8.358388453983684 27189.0 104.75415584415583 0.0 - - - - - - - 281.2352941176471 54 17 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 733 94 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18836.[MT7]-RATVVESSEK[MT7].3y5_1.heavy 465.268 / 723.364 11153.0 16.447900772094727 47 17 10 10 10 2.8991125883642908 27.535738523993828 0.0 3 0.9782779382958215 8.358388453983684 11153.0 259.7271064153817 0.0 - - - - - - - 154.11764705882354 22 17 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 735 95 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18837.[MT7]-VWDLVAALDPR.2b3_1.heavy 699.897 / 545.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 737 95 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18837.[MT7]-VWDLVAALDPR.2b4_1.heavy 699.897 / 658.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 739 95 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18837.[MT7]-VWDLVAALDPR.2b6_1.heavy 699.897 / 828.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 741 95 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18837.[MT7]-VWDLVAALDPR.2b5_1.heavy 699.897 / 757.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 743 96 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18835.[MT7]-VAAAASC[CAM]LSQK[MT7].3y3_1.heavy 465.262 / 506.306 34872.0 24.951400756835938 45 15 10 10 10 3.0399315777199902 32.895477231432295 0.0 3 0.9583190679067093 6.023841193198677 34872.0 125.69325301204819 0.0 - - - - - - - 806.2857142857143 69 7 CCNB2 cyclin B2 745 96 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18835.[MT7]-VAAAASC[CAM]LSQK[MT7].3b4_1.heavy 465.262 / 457.289 18598.0 24.951400756835938 45 15 10 10 10 3.0399315777199902 32.895477231432295 0.0 3 0.9583190679067093 6.023841193198677 18598.0 20.315494325943728 0.0 - - - - - - - 1203.625 37 8 CCNB2 cyclin B2 747 96 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18835.[MT7]-VAAAASC[CAM]LSQK[MT7].3b5_1.heavy 465.262 / 528.326 15526.0 24.951400756835938 45 15 10 10 10 3.0399315777199902 32.895477231432295 0.0 3 0.9583190679067093 6.023841193198677 15526.0 23.514902703335522 0.0 - - - - - - - 788.5 31 12 CCNB2 cyclin B2 749 96 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18835.[MT7]-VAAAASC[CAM]LSQK[MT7].3y4_1.heavy 465.262 / 619.39 9133.0 24.951400756835938 45 15 10 10 10 3.0399315777199902 32.895477231432295 0.0 3 0.9583190679067093 6.023841193198677 9133.0 27.509036144578314 0.0 - - - - - - - 327.3888888888889 18 18 CCNB2 cyclin B2 751 97 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18457.[MT7]-IIPEK[MT7].2y4_1.heavy 444.294 / 630.394 21528.0 25.58613395690918 44 20 10 6 8 6.483302287675131 15.424238383902248 0.03380012512207031 4 0.9904653314810913 12.628852599350626 21528.0 35.600415584415586 0.0 - - - - - - - 804.0833333333334 43 12 TTN;BTRC titin;beta-transducin repeat containing 753 97 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18457.[MT7]-IIPEK[MT7].2y3_2.heavy 444.294 / 259.159 3547.0 25.58613395690918 44 20 10 6 8 6.483302287675131 15.424238383902248 0.03380012512207031 4 0.9904653314810913 12.628852599350626 3547.0 8.180343556847415 1.0 - - - - - - - 706.7857142857143 10 14 TTN;BTRC titin;beta-transducin repeat containing 755 97 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18457.[MT7]-IIPEK[MT7].2y3_1.heavy 444.294 / 517.31 56170.0 25.58613395690918 44 20 10 6 8 6.483302287675131 15.424238383902248 0.03380012512207031 4 0.9904653314810913 12.628852599350626 56170.0 116.08536392760121 0.0 - - - - - - - 742.1111111111111 112 9 TTN;BTRC titin;beta-transducin repeat containing 757 98 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41722.[MT7]-TENC[CAM]VAK[MT7].2y4_1.heavy 555.297 / 621.351 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 759 98 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41722.[MT7]-TENC[CAM]VAK[MT7].2y5_1.heavy 555.297 / 735.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 761 98 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41722.[MT7]-TENC[CAM]VAK[MT7].2b4_1.heavy 555.297 / 649.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 763 98 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41722.[MT7]-TENC[CAM]VAK[MT7].2y6_1.heavy 555.297 / 864.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 765 99 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533645.[MT7]-VLITELIQHSAK[MT7].3b6_1.heavy 547.338 / 813.52 27044.0 38.03329849243164 45 15 10 10 10 2.1471370175598206 37.184677545565684 0.0 3 0.9553101181560465 5.8160344286398376 27044.0 189.5581100435424 0.0 - - - - - - - 170.0 54 17 DUSP16 dual specificity phosphatase 16 767 99 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533645.[MT7]-VLITELIQHSAK[MT7].3b4_1.heavy 547.338 / 571.394 5480.0 38.03329849243164 45 15 10 10 10 2.1471370175598206 37.184677545565684 0.0 3 0.9553101181560465 5.8160344286398376 5480.0 10.820382165605094 0.0 - - - - - - - 690.1428571428571 10 7 DUSP16 dual specificity phosphatase 16 769 99 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533645.[MT7]-VLITELIQHSAK[MT7].3b5_1.heavy 547.338 / 700.436 34468.0 38.03329849243164 45 15 10 10 10 2.1471370175598206 37.184677545565684 0.0 3 0.9553101181560465 5.8160344286398376 34468.0 117.45994546326261 0.0 - - - - - - - 221.94117647058823 68 17 DUSP16 dual specificity phosphatase 16 771 99 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533645.[MT7]-VLITELIQHSAK[MT7].3y4_1.heavy 547.338 / 586.343 38534.0 38.03329849243164 45 15 10 10 10 2.1471370175598206 37.184677545565684 0.0 3 0.9553101181560465 5.8160344286398376 38534.0 45.752571462982274 0.0 - - - - - - - 707.0 77 8 DUSP16 dual specificity phosphatase 16 773 100 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18459.[MT7]-SELIER.2y4_1.heavy 445.757 / 530.33 9336.0 22.33489990234375 47 17 10 10 10 4.322952778788461 23.1323368810949 0.0 3 0.9799585788640333 8.703022567064673 9336.0 26.9704568951353 1.0 - - - - - - - 667.0 18 8 LDHAL6B lactate dehydrogenase A-like 6B 775 100 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18459.[MT7]-SELIER.2b3_1.heavy 445.757 / 474.268 18584.0 22.33489990234375 47 17 10 10 10 4.322952778788461 23.1323368810949 0.0 3 0.9799585788640333 8.703022567064673 18584.0 46.18103561024909 0.0 - - - - - - - 329.3 37 10 LDHAL6B lactate dehydrogenase A-like 6B 777 100 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18459.[MT7]-SELIER.2y5_1.heavy 445.757 / 659.372 13071.0 22.33489990234375 47 17 10 10 10 4.322952778788461 23.1323368810949 0.0 3 0.9799585788640333 8.703022567064673 13071.0 30.29454738065051 0.0 - - - - - - - 736.5714285714286 26 7 LDHAL6B lactate dehydrogenase A-like 6B 779 100 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18459.[MT7]-SELIER.2b4_1.heavy 445.757 / 587.352 9514.0 22.33489990234375 47 17 10 10 10 4.322952778788461 23.1323368810949 0.0 3 0.9799585788640333 8.703022567064673 9514.0 12.040453628417556 0.0 - - - - - - - 673.1428571428571 19 7 LDHAL6B lactate dehydrogenase A-like 6B 781 101 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36281.[MT7]-SETSK[MT7].2y4_1.heavy 420.239 / 608.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - ERI2;BTRC;TRIP12;TTLL4 ERI1 exoribonuclease family member 2;beta-transducin repeat containing;thyroid hormone receptor interactor 12;tubulin tyrosine ligase-like family, member 4 783 101 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36281.[MT7]-SETSK[MT7].2b4_1.heavy 420.239 / 549.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - ERI2;BTRC;TRIP12;TTLL4 ERI1 exoribonuclease family member 2;beta-transducin repeat containing;thyroid hormone receptor interactor 12;tubulin tyrosine ligase-like family, member 4 785 101 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36281.[MT7]-SETSK[MT7].2y3_1.heavy 420.239 / 479.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - ERI2;BTRC;TRIP12;TTLL4 ERI1 exoribonuclease family member 2;beta-transducin repeat containing;thyroid hormone receptor interactor 12;tubulin tyrosine ligase-like family, member 4 787 102 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533740.[MT7]-FEDVWVVSGPLTLPQTR.3b4_1.heavy 696.713 / 635.316 26226.0 44.43607425689697 37 11 10 6 10 2.372337888481966 42.15251144683649 0.035099029541015625 3 0.8602373455915483 3.261923573395384 26226.0 126.17620000000001 0.0 - - - - - - - 237.85714285714286 52 14 EXOG endo/exonuclease (5'-3'), endonuclease G-like 789 102 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533740.[MT7]-FEDVWVVSGPLTLPQTR.3b5_1.heavy 696.713 / 821.395 19973.0 44.43607425689697 37 11 10 6 10 2.372337888481966 42.15251144683649 0.035099029541015625 3 0.8602373455915483 3.261923573395384 19973.0 160.00592222222224 0.0 - - - - - - - 216.0 39 15 EXOG endo/exonuclease (5'-3'), endonuclease G-like 791 102 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533740.[MT7]-FEDVWVVSGPLTLPQTR.3y4_1.heavy 696.713 / 501.278 23392.0 44.43607425689697 37 11 10 6 10 2.372337888481966 42.15251144683649 0.035099029541015625 3 0.8602373455915483 3.261923573395384 23392.0 119.24181702741703 0.0 - - - - - - - 213.75 46 12 EXOG endo/exonuclease (5'-3'), endonuclease G-like 793 102 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533740.[MT7]-FEDVWVVSGPLTLPQTR.3b3_1.heavy 696.713 / 536.247 11921.0 44.43607425689697 37 11 10 6 10 2.372337888481966 42.15251144683649 0.035099029541015625 3 0.8602373455915483 3.261923573395384 11921.0 49.071629629629626 0.0 - - - - - - - 190.58823529411765 23 17 EXOG endo/exonuclease (5'-3'), endonuclease G-like 795 103 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18838.[MT7]-GADINAEEAPK[MT7].3b6_1.heavy 468.252 / 686.359 9578.0 20.716400146484375 48 18 10 10 10 5.201731338026029 19.224368484580047 0.0 3 0.986394749285617 10.568551593695776 9578.0 99.4517027564649 0.0 - - - - - - - 198.0 19 12 CAMK4 calcium/calmodulin-dependent protein kinase IV 797 103 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18838.[MT7]-GADINAEEAPK[MT7].3b4_1.heavy 468.252 / 501.279 10804.0 20.716400146484375 48 18 10 10 10 5.201731338026029 19.224368484580047 0.0 3 0.986394749285617 10.568551593695776 10804.0 32.23321868916288 0.0 - - - - - - - 246.42857142857142 21 14 CAMK4 calcium/calmodulin-dependent protein kinase IV 799 103 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18838.[MT7]-GADINAEEAPK[MT7].3b5_1.heavy 468.252 / 615.322 17853.0 20.716400146484375 48 18 10 10 10 5.201731338026029 19.224368484580047 0.0 3 0.986394749285617 10.568551593695776 17853.0 96.94486701184482 0.0 - - - - - - - 238.8235294117647 35 17 CAMK4 calcium/calmodulin-dependent protein kinase IV 801 103 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18838.[MT7]-GADINAEEAPK[MT7].3b7_1.heavy 468.252 / 815.402 2605.0 20.716400146484375 48 18 10 10 10 5.201731338026029 19.224368484580047 0.0 3 0.986394749285617 10.568551593695776 2605.0 26.59409633418585 0.0 - - - - - - - 129.375 5 16 CAMK4 calcium/calmodulin-dependent protein kinase IV 803 104 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19060.[MT7]-GLSDELALVDLDEDK[MT7].3b6_1.heavy 640.673 / 759.401 17957.0 39.6515007019043 45 15 10 10 10 2.486609826707868 34.993235165078474 0.0 3 0.9547599164626493 5.7802899747631 17957.0 43.43319215859344 0.0 - - - - - - - 663.2 35 10 LDHAL6B lactate dehydrogenase A-like 6B 805 104 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19060.[MT7]-GLSDELALVDLDEDK[MT7].3b4_1.heavy 640.673 / 517.274 15102.0 39.6515007019043 45 15 10 10 10 2.486609826707868 34.993235165078474 0.0 3 0.9547599164626493 5.7802899747631 15102.0 46.637977639751554 0.0 - - - - - - - 670.4444444444445 30 9 LDHAL6B lactate dehydrogenase A-like 6B 807 104 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19060.[MT7]-GLSDELALVDLDEDK[MT7].3b5_1.heavy 640.673 / 646.316 28132.0 39.6515007019043 45 15 10 10 10 2.486609826707868 34.993235165078474 0.0 3 0.9547599164626493 5.7802899747631 28132.0 111.6571169697351 0.0 - - - - - - - 651.9230769230769 56 13 LDHAL6B lactate dehydrogenase A-like 6B 809 104 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19060.[MT7]-GLSDELALVDLDEDK[MT7].3b7_1.heavy 640.673 / 830.438 37018.0 39.6515007019043 45 15 10 10 10 2.486609826707868 34.993235165078474 0.0 3 0.9547599164626493 5.7802899747631 37018.0 82.28291890401516 0.0 - - - - - - - 791.3636363636364 74 11 LDHAL6B lactate dehydrogenase A-like 6B 811 105 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18976.[MT7]-NRIIGSGC[CAM]NLDTAR.3b9_2.heavy 564.297 / 558.789 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHAL6B lactate dehydrogenase A-like 6B 813 105 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18976.[MT7]-NRIIGSGC[CAM]NLDTAR.3b9_1.heavy 564.297 / 1116.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHAL6B lactate dehydrogenase A-like 6B 815 105 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18976.[MT7]-NRIIGSGC[CAM]NLDTAR.3y6_1.heavy 564.297 / 689.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHAL6B lactate dehydrogenase A-like 6B 817 105 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18976.[MT7]-NRIIGSGC[CAM]NLDTAR.3y5_1.heavy 564.297 / 575.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHAL6B lactate dehydrogenase A-like 6B 819 106 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19061.[MT7]-GLSDELALVDLDEDK[MT7].2b4_1.heavy 960.506 / 517.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHAL6B lactate dehydrogenase A-like 6B 821 106 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19061.[MT7]-GLSDELALVDLDEDK[MT7].2b6_1.heavy 960.506 / 759.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHAL6B lactate dehydrogenase A-like 6B 823 106 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19061.[MT7]-GLSDELALVDLDEDK[MT7].2b5_1.heavy 960.506 / 646.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHAL6B lactate dehydrogenase A-like 6B 825 106 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19061.[MT7]-GLSDELALVDLDEDK[MT7].2y7_1.heavy 960.506 / 977.491 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHAL6B lactate dehydrogenase A-like 6B 827 107 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533540.[MT7]-VQPSPTVHTK[MT7].3y6_1.heavy 461.273 / 826.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 829 107 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533540.[MT7]-VQPSPTVHTK[MT7].3b6_1.heavy 461.273 / 754.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 831 107 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533540.[MT7]-VQPSPTVHTK[MT7].3y3_1.heavy 461.273 / 529.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 833 107 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533540.[MT7]-VQPSPTVHTK[MT7].3b4_1.heavy 461.273 / 556.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 835 108 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533181.[MT7]-QEIER.2b3_1.heavy 409.728 / 515.295 5248.0 15.418899536132812 43 15 10 10 8 2.1390615013077454 37.49954032634979 0.0 4 0.9510211011867677 5.553529977944609 5248.0 14.007745794392523 0.0 - - - - - - - 172.21428571428572 10 14 DDIT3;TNIP2 DNA-damage-inducible transcript 3;TNFAIP3 interacting protein 2 837 108 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533181.[MT7]-QEIER.2y4_1.heavy 409.728 / 546.288 8997.0 15.418899536132812 43 15 10 10 8 2.1390615013077454 37.49954032634979 0.0 4 0.9510211011867677 5.553529977944609 8997.0 29.264868656716416 1.0 - - - - - - - 274.8666666666667 20 15 DDIT3;TNIP2 DNA-damage-inducible transcript 3;TNFAIP3 interacting protein 2 839 108 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533181.[MT7]-QEIER.2b4_1.heavy 409.728 / 644.337 8676.0 15.418899536132812 43 15 10 10 8 2.1390615013077454 37.49954032634979 0.0 4 0.9510211011867677 5.553529977944609 8676.0 18.058777986525783 1.0 - - - - - - - 242.3684210526316 18 19 DDIT3;TNIP2 DNA-damage-inducible transcript 3;TNFAIP3 interacting protein 2 841 108 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533181.[MT7]-QEIER.2y3_1.heavy 409.728 / 417.246 4927.0 15.418899536132812 43 15 10 10 8 2.1390615013077454 37.49954032634979 0.0 4 0.9510211011867677 5.553529977944609 4927.0 14.964663179742631 0.0 - - - - - - - 235.65 9 20 DDIT3;TNIP2 DNA-damage-inducible transcript 3;TNFAIP3 interacting protein 2 843 109 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42195.[MT7]-GLDHIAENILSYLDAK[MT7].4y4_1.heavy 515.787 / 590.363 5177.0 47.545074462890625 31 5 10 6 10 0.38584429204668513 104.30511297620174 0.0364990234375 3 0.6874084621800577 2.1470891172745006 5177.0 60.32356586145133 0.0 - - - - - - - 94.9090909090909 10 11 BTRC beta-transducin repeat containing 845 109 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42195.[MT7]-GLDHIAENILSYLDAK[MT7].4b4_1.heavy 515.787 / 567.301 2044.0 47.545074462890625 31 5 10 6 10 0.38584429204668513 104.30511297620174 0.0364990234375 3 0.6874084621800577 2.1470891172745006 2044.0 66.53606837606837 0.0 - - - - - - - 90.71428571428571 4 7 BTRC beta-transducin repeat containing 847 109 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42195.[MT7]-GLDHIAENILSYLDAK[MT7].4b3_1.heavy 515.787 / 430.242 2906.0 47.545074462890625 31 5 10 6 10 0.38584429204668513 104.30511297620174 0.0364990234375 3 0.6874084621800577 2.1470891172745006 2906.0 26.134276018099545 0.0 - - - - - - - 166.46666666666667 5 15 BTRC beta-transducin repeat containing 849 109 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42195.[MT7]-GLDHIAENILSYLDAK[MT7].4b6_1.heavy 515.787 / 751.422 908.0 47.545074462890625 31 5 10 6 10 0.38584429204668513 104.30511297620174 0.0364990234375 3 0.6874084621800577 2.1470891172745006 908.0 24.10246642246642 0.0 - - - - - - - 0.0 1 0 BTRC beta-transducin repeat containing 851 110 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18979.[MT7]-IIQSFLWYLNPR.3y7_1.heavy 565.323 / 961.525 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGKZ diacylglycerol kinase, zeta 853 110 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18979.[MT7]-IIQSFLWYLNPR.3y6_1.heavy 565.323 / 848.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGKZ diacylglycerol kinase, zeta 855 110 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18979.[MT7]-IIQSFLWYLNPR.3b4_1.heavy 565.323 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGKZ diacylglycerol kinase, zeta 857 110 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18979.[MT7]-IIQSFLWYLNPR.3b5_1.heavy 565.323 / 733.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGKZ diacylglycerol kinase, zeta 859 111 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18978.[MT7]-SVTEQGAELSNEER.2b4_1.heavy 846.911 / 561.3 8948.0 22.884899139404297 42 12 10 10 10 0.9736592541032687 62.64369399678646 0.0 3 0.8806867562171652 3.53673292922662 8948.0 73.69994496789795 0.0 - - - - - - - 156.25 17 8 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 861 111 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18978.[MT7]-SVTEQGAELSNEER.2y9_1.heavy 846.911 / 1004.46 6084.0 22.884899139404297 42 12 10 10 10 0.9736592541032687 62.64369399678646 0.0 3 0.8806867562171652 3.53673292922662 6084.0 43.13283582089552 0.0 - - - - - - - 167.5 12 8 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 863 111 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18978.[MT7]-SVTEQGAELSNEER.2y6_1.heavy 846.911 / 747.363 4921.0 22.884899139404297 42 12 10 10 10 0.9736592541032687 62.64369399678646 0.0 3 0.8806867562171652 3.53673292922662 4921.0 28.99134953723005 0.0 - - - - - - - 158.77777777777777 9 9 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 865 111 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18978.[MT7]-SVTEQGAELSNEER.2y10_1.heavy 846.911 / 1132.52 4205.0 22.884899139404297 42 12 10 10 10 0.9736592541032687 62.64369399678646 0.0 3 0.8806867562171652 3.53673292922662 4205.0 56.39572531542276 0.0 - - - - - - - 178.7 8 10 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 867 112 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19169.[MT7]-RPTISPNFNFLGQLLDYEK[MT7].4y4_1.heavy 635.849 / 698.348 16927.0 46.37255096435547 34 8 10 6 10 0.6717470833950241 81.43692354779188 0.034698486328125 3 0.7976599847080512 2.6959427922077372 16927.0 104.14485108514191 0.0 - - - - - - - 190.625 33 16 DUSP16 dual specificity phosphatase 16 869 112 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19169.[MT7]-RPTISPNFNFLGQLLDYEK[MT7].4b7_1.heavy 635.849 / 910.523 2597.0 46.37255096435547 34 8 10 6 10 0.6717470833950241 81.43692354779188 0.034698486328125 3 0.7976599847080512 2.6959427922077372 2597.0 88.03829999999999 0.0 - - - - - - - 83.33333333333333 5 9 DUSP16 dual specificity phosphatase 16 871 112 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19169.[MT7]-RPTISPNFNFLGQLLDYEK[MT7].4b9_1.heavy 635.849 / 1171.63 1049.0 46.37255096435547 34 8 10 6 10 0.6717470833950241 81.43692354779188 0.034698486328125 3 0.7976599847080512 2.6959427922077372 1049.0 24.3368 0.0 - - - - - - - 219.6 2 5 DUSP16 dual specificity phosphatase 16 873 112 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19169.[MT7]-RPTISPNFNFLGQLLDYEK[MT7].4y3_1.heavy 635.849 / 583.321 14181.0 46.37255096435547 34 8 10 6 10 0.6717470833950241 81.43692354779188 0.034698486328125 3 0.7976599847080512 2.6959427922077372 14181.0 47.35414384016579 0.0 - - - - - - - 194.9 28 20 DUSP16 dual specificity phosphatase 16 875 113 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533186.[MT7]-DAVLK[MT7].2b3_1.heavy 417.27 / 430.242 4780.0 20.766599655151367 36 20 2 6 8 6.178401276786619 16.185416828738244 0.03840065002441406 4 0.9942853930650525 16.31782052991732 4780.0 12.273216823592112 1.0 - - - - - - - 303.1875 12 16 CCDC91;MAPKAPK3;C8orf41 coiled-coil domain containing 91;mitogen-activated protein kinase-activated protein kinase 3;chromosome 8 open reading frame 41 877 113 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533186.[MT7]-DAVLK[MT7].2y4_1.heavy 417.27 / 574.404 6511.0 20.766599655151367 36 20 2 6 8 6.178401276786619 16.185416828738244 0.03840065002441406 4 0.9942853930650525 16.31782052991732 6511.0 10.183863910076274 0.0 - - - - - - - 321.1818181818182 13 11 CCDC91;MAPKAPK3;C8orf41 coiled-coil domain containing 91;mitogen-activated protein kinase-activated protein kinase 3;chromosome 8 open reading frame 41 879 113 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533186.[MT7]-DAVLK[MT7].2b4_1.heavy 417.27 / 543.326 N/A 20.766599655151367 36 20 2 6 8 6.178401276786619 16.185416828738244 0.03840065002441406 4 0.9942853930650525 16.31782052991732 3879.0 4.687277515375216 2.0 - - - - - - - 742.0 28 7 CCDC91;MAPKAPK3;C8orf41 coiled-coil domain containing 91;mitogen-activated protein kinase-activated protein kinase 3;chromosome 8 open reading frame 41 881 113 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533186.[MT7]-DAVLK[MT7].2y3_1.heavy 417.27 / 503.367 3602.0 20.766599655151367 36 20 2 6 8 6.178401276786619 16.185416828738244 0.03840065002441406 4 0.9942853930650525 16.31782052991732 3602.0 7.9844847221705315 0.0 - - - - - - - 692.6666666666666 7 9 CCDC91;MAPKAPK3;C8orf41 coiled-coil domain containing 91;mitogen-activated protein kinase-activated protein kinase 3;chromosome 8 open reading frame 41 883 114 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533643.[MT7]-TVLEEIGNRVTTR.3y11_2.heavy 544.645 / 644.354 19629.0 33.51060104370117 44 14 10 10 10 2.052045706169483 38.86233924415143 0.0 3 0.9363441461727687 4.86532713026322 19629.0 38.99715712559916 0.0 - - - - - - - 296.7 39 10 CCNB2 cyclin B2 885 114 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533643.[MT7]-TVLEEIGNRVTTR.3b4_1.heavy 544.645 / 587.352 17426.0 33.51060104370117 44 14 10 10 10 2.052045706169483 38.86233924415143 0.0 3 0.9363441461727687 4.86532713026322 17426.0 46.73682972316482 0.0 - - - - - - - 744.5555555555555 34 9 CCNB2 cyclin B2 887 114 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533643.[MT7]-TVLEEIGNRVTTR.3b5_1.heavy 544.645 / 716.395 22405.0 33.51060104370117 44 14 10 10 10 2.052045706169483 38.86233924415143 0.0 3 0.9363441461727687 4.86532713026322 22405.0 34.822997974805205 0.0 - - - - - - - 272.38461538461536 44 13 CCNB2 cyclin B2 889 114 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533643.[MT7]-TVLEEIGNRVTTR.3y12_2.heavy 544.645 / 693.889 37438.0 33.51060104370117 44 14 10 10 10 2.052045706169483 38.86233924415143 0.0 3 0.9363441461727687 4.86532713026322 37438.0 205.35782292289522 0.0 - - - - - - - 191.5 74 8 CCNB2 cyclin B2 891 115 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 325603.0 33.83649826049805 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 325603.0 110.56847025396931 1.0 - - - - - - - 329.0 654 2 893 115 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 91511.0 33.83649826049805 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 91511.0 168.73768688746588 0.0 - - - - - - - 329.0 183 4 895 115 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 115118.0 33.83649826049805 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 115118.0 89.12694890470179 0.0 - - - - - - - 235.0 230 4 897 116 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19167.[MT7]-IVSYQVIGEDNVAVPSHLYK[MT7].4b4_1.heavy 630.599 / 607.357 3280.0 35.14139938354492 50 20 10 10 10 9.572438027314693 10.446659431448154 0.0 3 0.9977469684322416 25.995439103427124 3280.0 8.060988519266663 0.0 - - - - - - - 296.0 6 14 EXOG endo/exonuclease (5'-3'), endonuclease G-like 899 116 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19167.[MT7]-IVSYQVIGEDNVAVPSHLYK[MT7].4b5_1.heavy 630.599 / 735.416 9496.0 35.14139938354492 50 20 10 10 10 9.572438027314693 10.446659431448154 0.0 3 0.9977469684322416 25.995439103427124 9496.0 28.18702279202279 0.0 - - - - - - - 305.46153846153845 18 13 EXOG endo/exonuclease (5'-3'), endonuclease G-like 901 116 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19167.[MT7]-IVSYQVIGEDNVAVPSHLYK[MT7].4y6_1.heavy 630.599 / 888.506 11136.0 35.14139938354492 50 20 10 10 10 9.572438027314693 10.446659431448154 0.0 3 0.9977469684322416 25.995439103427124 11136.0 19.954692448449112 0.0 - - - - - - - 283.64285714285717 22 14 EXOG endo/exonuclease (5'-3'), endonuclease G-like 903 116 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19167.[MT7]-IVSYQVIGEDNVAVPSHLYK[MT7].4b6_1.heavy 630.599 / 834.484 4834.0 35.14139938354492 50 20 10 10 10 9.572438027314693 10.446659431448154 0.0 3 0.9977469684322416 25.995439103427124 4834.0 20.997104247104247 0.0 - - - - - - - 232.30769230769232 9 13 EXOG endo/exonuclease (5'-3'), endonuclease G-like 905 117 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533642.[MT7]-SVTC[CAM]TYSPALNK[MT7].3y3_1.heavy 543.623 / 518.342 17880.0 26.022549629211426 43 17 10 6 10 4.319212328313493 23.15236955230831 0.03809928894042969 3 0.9748352006938302 7.763376677756778 17880.0 25.835096316659694 0.0 - - - - - - - 778.2222222222222 35 9 TP53 tumor protein p53 907 117 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533642.[MT7]-SVTC[CAM]TYSPALNK[MT7].3b5_1.heavy 543.623 / 693.336 12607.0 26.022549629211426 43 17 10 6 10 4.319212328313493 23.15236955230831 0.03809928894042969 3 0.9748352006938302 7.763376677756778 12607.0 29.679812688271156 0.0 - - - - - - - 264.7142857142857 25 14 TP53 tumor protein p53 909 117 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533642.[MT7]-SVTC[CAM]TYSPALNK[MT7].3y4_1.heavy 543.623 / 589.379 10959.0 26.022549629211426 43 17 10 6 10 4.319212328313493 23.15236955230831 0.03809928894042969 3 0.9748352006938302 7.763376677756778 10959.0 23.106446235574282 0.0 - - - - - - - 750.7777777777778 21 9 TP53 tumor protein p53 911 117 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533642.[MT7]-SVTC[CAM]TYSPALNK[MT7].3y5_1.heavy 543.623 / 686.432 30158.0 26.022549629211426 43 17 10 6 10 4.319212328313493 23.15236955230831 0.03809928894042969 3 0.9748352006938302 7.763376677756778 30158.0 36.59563943058885 0.0 - - - - - - - 772.625 60 8 TP53 tumor protein p53 913 118 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41729.[MT7]-QPDGSAEK[MT7].2y4_1.heavy 560.298 / 578.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 915 118 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41729.[MT7]-QPDGSAEK[MT7].2y5_1.heavy 560.298 / 635.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 917 118 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41729.[MT7]-QPDGSAEK[MT7].2y6_1.heavy 560.298 / 750.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 919 118 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41729.[MT7]-QPDGSAEK[MT7].2y7_1.heavy 560.298 / 847.428 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 921 119 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18465.[MT7]-LEALFR.2y4_1.heavy 446.772 / 506.309 8532.0 37.45109939575195 39 11 10 10 8 1.4024578426074157 45.94950884419613 0.0 4 0.8730003799830862 3.4257365754419973 8532.0 30.04243342455581 1.0 - - - - - - - 220.58823529411765 18 17 MYLK3;DOPEY2 myosin light chain kinase 3;dopey family member 2 923 119 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18465.[MT7]-LEALFR.2b3_1.heavy 446.772 / 458.273 8079.0 37.45109939575195 39 11 10 10 8 1.4024578426074157 45.94950884419613 0.0 4 0.8730003799830862 3.4257365754419973 8079.0 20.450303737284386 0.0 - - - - - - - 703.7777777777778 16 9 MYLK3;DOPEY2 myosin light chain kinase 3;dopey family member 2 925 119 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18465.[MT7]-LEALFR.2y5_1.heavy 446.772 / 635.351 22622.0 37.45109939575195 39 11 10 10 8 1.4024578426074157 45.94950884419613 0.0 4 0.8730003799830862 3.4257365754419973 22622.0 65.12209281221341 0.0 - - - - - - - 237.0 45 15 MYLK3;DOPEY2 myosin light chain kinase 3;dopey family member 2 927 119 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18465.[MT7]-LEALFR.2b4_1.heavy 446.772 / 571.357 9372.0 37.45109939575195 39 11 10 10 8 1.4024578426074157 45.94950884419613 0.0 4 0.8730003799830862 3.4257365754419973 9372.0 28.595476797290594 0.0 - - - - - - - 157.0 18 7 MYLK3;DOPEY2 myosin light chain kinase 3;dopey family member 2 929 120 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19064.[MT7]-QLWQDPGIQEC[CAM]YDR.2b3_1.heavy 976.458 / 572.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 931 120 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19064.[MT7]-QLWQDPGIQEC[CAM]YDR.2y4_1.heavy 976.458 / 613.24 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 933 120 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19064.[MT7]-QLWQDPGIQEC[CAM]YDR.2y9_1.heavy 976.458 / 1137.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 935 120 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19064.[MT7]-QLWQDPGIQEC[CAM]YDR.2b5_1.heavy 976.458 / 815.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 937 121 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18460.[MT7]-LDLDK[MT7].2y4_1.heavy 446.273 / 634.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - AFAP1L1;PPP3R2;EOMES actin filament associated protein 1-like 1;protein phosphatase 3, regulatory subunit B, beta;eomesodermin 939 121 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18460.[MT7]-LDLDK[MT7].2y3_2.heavy 446.273 / 260.167 N/A N/A - - - - - - - - - 0.0 - - - - - - - AFAP1L1;PPP3R2;EOMES actin filament associated protein 1-like 1;protein phosphatase 3, regulatory subunit B, beta;eomesodermin 941 121 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18460.[MT7]-LDLDK[MT7].2b4_1.heavy 446.273 / 601.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - AFAP1L1;PPP3R2;EOMES actin filament associated protein 1-like 1;protein phosphatase 3, regulatory subunit B, beta;eomesodermin 943 121 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18460.[MT7]-LDLDK[MT7].2y3_1.heavy 446.273 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - AFAP1L1;PPP3R2;EOMES actin filament associated protein 1-like 1;protein phosphatase 3, regulatory subunit B, beta;eomesodermin 945 122 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41524.[MT7]-AAQVAK[MT7].2y4_1.heavy 438.281 / 589.379 2406.0 15.499899864196777 48 18 10 10 10 3.817759640373403 26.19337240157406 0.0 3 0.9832362860918845 9.518503571931502 2406.0 13.53375 0.0 - - - - - - - 201.6 4 20 SMARCA4;CCNB2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4;cyclin B2 947 122 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41524.[MT7]-AAQVAK[MT7].2y5_1.heavy 438.281 / 660.416 6099.0 15.499899864196777 48 18 10 10 10 3.817759640373403 26.19337240157406 0.0 3 0.9832362860918845 9.518503571931502 6099.0 15.092023039578013 0.0 - - - - - - - 171.73333333333332 12 15 SMARCA4;CCNB2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4;cyclin B2 949 122 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41524.[MT7]-AAQVAK[MT7].2b4_1.heavy 438.281 / 514.311 4141.0 15.499899864196777 48 18 10 10 10 3.817759640373403 26.19337240157406 0.0 3 0.9832362860918845 9.518503571931502 4141.0 20.071173469387755 0.0 - - - - - - - 262.3157894736842 8 19 SMARCA4;CCNB2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4;cyclin B2 951 122 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41524.[MT7]-AAQVAK[MT7].2y3_1.heavy 438.281 / 461.32 5148.0 15.499899864196777 48 18 10 10 10 3.817759640373403 26.19337240157406 0.0 3 0.9832362860918845 9.518503571931502 5148.0 32.27714285714286 0.0 - - - - - - - 187.76470588235293 10 17 SMARCA4;CCNB2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4;cyclin B2 953 123 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19163.[MT7]-TAFDEAIAELDTLSEESYK[MT7].3b6_1.heavy 807.404 / 779.369 20902.0 48.99825096130371 43 17 10 6 10 5.126394528547125 19.506887236855157 0.036098480224609375 3 0.97337403904921 7.546426735247072 20902.0 296.40669461680363 0.0 - - - - - - - 194.47058823529412 41 17 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 955 123 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19163.[MT7]-TAFDEAIAELDTLSEESYK[MT7].3b4_1.heavy 807.404 / 579.289 6655.0 48.99825096130371 43 17 10 6 10 5.126394528547125 19.506887236855157 0.036098480224609375 3 0.97337403904921 7.546426735247072 6655.0 186.1965257048093 0.0 - - - - - - - 89.44444444444444 13 9 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 957 123 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19163.[MT7]-TAFDEAIAELDTLSEESYK[MT7].3b5_1.heavy 807.404 / 708.332 5270.0 48.99825096130371 43 17 10 6 10 5.126394528547125 19.506887236855157 0.036098480224609375 3 0.97337403904921 7.546426735247072 5270.0 79.99122924702331 0.0 - - - - - - - 121.07142857142857 10 14 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 959 123 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19163.[MT7]-TAFDEAIAELDTLSEESYK[MT7].3b7_1.heavy 807.404 / 892.453 9915.0 48.99825096130371 43 17 10 6 10 5.126394528547125 19.506887236855157 0.036098480224609375 3 0.97337403904921 7.546426735247072 9915.0 173.15916484990777 0.0 - - - - - - - 144.23076923076923 19 13 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 961 124 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533415.[MT7]-DFITALPAR.2b3_1.heavy 574.333 / 520.289 17826.0 33.83649826049805 45 15 10 10 10 1.1088101232080323 57.7582822732535 0.0 3 0.9517917531711756 5.598109097777113 17826.0 20.528293299980973 0.0 - - - - - - - 778.3333333333334 35 12 BTRC beta-transducin repeat containing 963 124 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533415.[MT7]-DFITALPAR.2y8_1.heavy 574.333 / 888.53 11035.0 33.83649826049805 45 15 10 10 10 1.1088101232080323 57.7582822732535 0.0 3 0.9517917531711756 5.598109097777113 11035.0 40.225506078936334 0.0 - - - - - - - 248.63636363636363 22 11 BTRC beta-transducin repeat containing 965 124 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533415.[MT7]-DFITALPAR.2y6_1.heavy 574.333 / 628.378 31502.0 33.83649826049805 45 15 10 10 10 1.1088101232080323 57.7582822732535 0.0 3 0.9517917531711756 5.598109097777113 31502.0 63.47168610816543 0.0 - - - - - - - 282.84615384615387 63 13 BTRC beta-transducin repeat containing 967 124 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533415.[MT7]-DFITALPAR.2y7_1.heavy 574.333 / 741.462 8488.0 33.83649826049805 45 15 10 10 10 1.1088101232080323 57.7582822732535 0.0 3 0.9517917531711756 5.598109097777113 8488.0 23.794393404004712 0.0 - - - - - - - 377.46153846153845 16 13 BTRC beta-transducin repeat containing 969 125 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36860.[MT7]-FELGRPLPLHFLR.3b9_2.heavy 580.346 / 584.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 971 125 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36860.[MT7]-FELGRPLPLHFLR.3y6_1.heavy 580.346 / 782.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 973 125 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36860.[MT7]-FELGRPLPLHFLR.3y4_1.heavy 580.346 / 572.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 975 125 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36860.[MT7]-FELGRPLPLHFLR.3y8_1.heavy 580.346 / 992.604 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 977 126 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533414.[MT7]-NQTGASGPK[MT7].2y4_1.heavy 574.319 / 532.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 979 126 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533414.[MT7]-NQTGASGPK[MT7].2b4_1.heavy 574.319 / 545.28 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 981 126 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533414.[MT7]-NQTGASGPK[MT7].2y6_1.heavy 574.319 / 660.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 983 126 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533414.[MT7]-NQTGASGPK[MT7].2y7_1.heavy 574.319 / 761.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 985 127 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36382.[MT7]-TTNVNK[MT7].2y4_1.heavy 482.787 / 618.369 1120.0 14.587275266647339 42 16 10 6 10 3.810754598161866 26.24152183618316 0.03970050811767578 3 0.9623490100253107 6.340186461546455 1120.0 11.4539189014121 0.0 - - - - - - - 141.2941176470588 2 17 CCNB2 cyclin B2 987 127 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36382.[MT7]-TTNVNK[MT7].2y5_1.heavy 482.787 / 719.417 4522.0 14.587275266647339 42 16 10 6 10 3.810754598161866 26.24152183618316 0.03970050811767578 3 0.9623490100253107 6.340186461546455 4522.0 37.574106280193234 0.0 - - - - - - - 156.71428571428572 9 14 CCNB2 cyclin B2 989 127 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36382.[MT7]-TTNVNK[MT7].2b4_1.heavy 482.787 / 560.316 1327.0 14.587275266647339 42 16 10 6 10 3.810754598161866 26.24152183618316 0.03970050811767578 3 0.9623490100253107 6.340186461546455 1327.0 5.116144578313253 0.0 - - - - - - - 191.94736842105263 2 19 CCNB2 cyclin B2 991 127 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36382.[MT7]-TTNVNK[MT7].2y3_1.heavy 482.787 / 504.326 1369.0 14.587275266647339 42 16 10 6 10 3.810754598161866 26.24152183618316 0.03970050811767578 3 0.9623490100253107 6.340186461546455 1369.0 9.75500860585198 0.0 - - - - - - - 204.53333333333333 2 15 CCNB2 cyclin B2 993 128 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36694.[MT7]-VIITGSSDSTVR.2y8_1.heavy 689.887 / 808.38 2561.0 25.890399932861328 46 16 10 10 10 2.5618131239925432 31.874252058747192 0.0 3 0.9603855714936798 6.180042342931115 2561.0 26.386060606060607 0.0 - - - - - - - 177.0 5 7 BTRC beta-transducin repeat containing 995 128 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36694.[MT7]-VIITGSSDSTVR.2y9_1.heavy 689.887 / 909.427 5452.0 25.890399932861328 46 16 10 10 10 2.5618131239925432 31.874252058747192 0.0 3 0.9603855714936798 6.180042342931115 5452.0 77.96364771434406 0.0 - - - - - - - 183.77777777777777 10 9 BTRC beta-transducin repeat containing 997 128 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36694.[MT7]-VIITGSSDSTVR.2y10_1.heavy 689.887 / 1022.51 3965.0 25.890399932861328 46 16 10 10 10 2.5618131239925432 31.874252058747192 0.0 3 0.9603855714936798 6.180042342931115 3965.0 33.161818181818184 0.0 - - - - - - - 220.33333333333334 7 9 BTRC beta-transducin repeat containing 999 128 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36694.[MT7]-VIITGSSDSTVR.2y11_1.heavy 689.887 / 1135.6 2891.0 25.890399932861328 46 16 10 10 10 2.5618131239925432 31.874252058747192 0.0 3 0.9603855714936798 6.180042342931115 2891.0 43.929604547221146 0.0 - - - - - - - 141.85714285714286 5 7 BTRC beta-transducin repeat containing 1001 129 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36696.[MT7]-NIC[CAM]SVDTC[CAM]K[MT7].2y6_1.heavy 692.844 / 853.421 N/A 21.751699447631836 40 12 10 10 8 0.9694792159873387 61.0439380410013 0.0 4 0.8875289256852036 3.644893564787635 333.0 5.21566265060241 1.0 - - - - - - - 0.0 0 0 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1003 129 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36696.[MT7]-NIC[CAM]SVDTC[CAM]K[MT7].2y4_1.heavy 692.844 / 667.32 583.0 21.751699447631836 40 12 10 10 8 0.9694792159873387 61.0439380410013 0.0 4 0.8875289256852036 3.644893564787635 583.0 5.338313253012048 1.0 - - - - - - - 0.0 1 0 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1005 129 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36696.[MT7]-NIC[CAM]SVDTC[CAM]K[MT7].2y3_1.heavy 692.844 / 552.293 832.0 21.751699447631836 40 12 10 10 8 0.9694792159873387 61.0439380410013 0.0 4 0.8875289256852036 3.644893564787635 832.0 7.160305365606571 0.0 - - - - - - - 0.0 1 0 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1007 129 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36696.[MT7]-NIC[CAM]SVDTC[CAM]K[MT7].2y7_1.heavy 692.844 / 1013.45 1082.0 21.751699447631836 40 12 10 10 8 0.9694792159873387 61.0439380410013 0.0 4 0.8875289256852036 3.644893564787635 1082.0 14.410675662650604 0.0 - - - - - - - 190.0 2 7 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1009 130 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36342.[MT7]-SEVNPAR.2b3_1.heavy 458.752 / 460.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 1011 130 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36342.[MT7]-SEVNPAR.2y5_1.heavy 458.752 / 556.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 1013 130 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36342.[MT7]-SEVNPAR.2b4_1.heavy 458.752 / 574.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 1015 130 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36342.[MT7]-SEVNPAR.2y6_1.heavy 458.752 / 685.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 1017 131 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18707.[MT7]-IISSIEQK[MT7].2y5_1.heavy 603.371 / 748.432 2265.0 29.134400685628254 44 20 10 6 8 7.908714062803022 12.64428062588949 0.036899566650390625 4 0.9936570491022484 15.48769789261375 2265.0 8.610698184476668 0.0 - - - - - - - 253.0909090909091 4 11 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1019 131 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18707.[MT7]-IISSIEQK[MT7].2y3_1.heavy 603.371 / 548.316 1568.0 29.134400685628254 44 20 10 6 8 7.908714062803022 12.64428062588949 0.036899566650390625 4 0.9936570491022484 15.48769789261375 1568.0 8.110344827586207 5.0 - - - - - - - 232.06666666666666 4 15 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1021 131 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18707.[MT7]-IISSIEQK[MT7].2y6_1.heavy 603.371 / 835.464 4965.0 29.134400685628254 44 20 10 6 8 7.908714062803022 12.64428062588949 0.036899566650390625 4 0.9936570491022484 15.48769789261375 4965.0 31.007471264367812 0.0 - - - - - - - 223.85714285714286 9 14 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1023 131 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18707.[MT7]-IISSIEQK[MT7].2y7_1.heavy 603.371 / 948.548 N/A 29.134400685628254 44 20 10 6 8 7.908714062803022 12.64428062588949 0.036899566650390625 4 0.9936570491022484 15.48769789261375 3223.0 0.8931512272367379 1.0 - - - - - - - 174.11111111111111 6 9 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1025 132 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41900.[MT7]-LLGVIIEEGK[MT7].2y8_1.heavy 679.928 / 988.58 2980.0 39.73125076293945 42 16 10 6 10 2.047667118321048 34.25255943430364 0.035400390625 3 0.9681806620329491 6.900148580090301 2980.0 19.6440854611777 0.0 - - - - - - - 106.63157894736842 5 19 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1027 132 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41900.[MT7]-LLGVIIEEGK[MT7].2y5_1.heavy 679.928 / 719.406 4293.0 39.73125076293945 42 16 10 6 10 2.047667118321048 34.25255943430364 0.035400390625 3 0.9681806620329491 6.900148580090301 4293.0 16.561805267650286 0.0 - - - - - - - 143.27777777777777 8 18 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1029 132 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41900.[MT7]-LLGVIIEEGK[MT7].2b4_1.heavy 679.928 / 527.367 6212.0 39.73125076293945 42 16 10 6 10 2.047667118321048 34.25255943430364 0.035400390625 3 0.9681806620329491 6.900148580090301 6212.0 21.321716171617165 0.0 - - - - - - - 230.27777777777777 12 18 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1031 132 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41900.[MT7]-LLGVIIEEGK[MT7].2y6_1.heavy 679.928 / 832.49 5606.0 39.73125076293945 42 16 10 6 10 2.047667118321048 34.25255943430364 0.035400390625 3 0.9681806620329491 6.900148580090301 5606.0 45.20143270848824 0.0 - - - - - - - 184.08 11 25 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1033 133 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18992.[MT7]-LQLVGITALLLASK[MT7].3b6_1.heavy 576.713 / 768.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1035 133 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18992.[MT7]-LQLVGITALLLASK[MT7].3b4_1.heavy 576.713 / 598.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1037 133 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18992.[MT7]-LQLVGITALLLASK[MT7].3b5_1.heavy 576.713 / 655.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1039 133 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18992.[MT7]-LQLVGITALLLASK[MT7].3y4_1.heavy 576.713 / 562.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1041 134 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18807.[MT7]-IQGDGAQAAVK[MT7].2y4_1.heavy 673.388 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1043 134 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18807.[MT7]-IQGDGAQAAVK[MT7].2y9_1.heavy 673.388 / 960.523 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1045 134 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18807.[MT7]-IQGDGAQAAVK[MT7].2b4_1.heavy 673.388 / 558.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1047 134 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18807.[MT7]-IQGDGAQAAVK[MT7].2y7_1.heavy 673.388 / 788.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1049 135 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18994.[MT7]-FELGRPLPLHFLR.4y4_1.heavy 435.511 / 572.33 35063.0 38.09989929199219 44 14 10 10 10 1.1556221572896643 56.51249879583639 0.0 3 0.9479793609699139 5.387330524808141 35063.0 203.35287873079318 0.0 - - - - - - - 203.75 70 12 CCNB2 cyclin B2 1051 135 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18994.[MT7]-FELGRPLPLHFLR.4b8_2.heavy 435.511 / 527.812 30112.0 38.09989929199219 44 14 10 10 10 1.1556221572896643 56.51249879583639 0.0 3 0.9479793609699139 5.387330524808141 30112.0 154.04545945804148 0.0 - - - - - - - 178.92307692307693 60 13 CCNB2 cyclin B2 1053 135 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18994.[MT7]-FELGRPLPLHFLR.4b7_2.heavy 435.511 / 479.285 71058.0 38.09989929199219 44 14 10 10 10 1.1556221572896643 56.51249879583639 0.0 3 0.9479793609699139 5.387330524808141 71058.0 388.937814775968 0.0 - - - - - - - 227.91666666666666 142 12 CCNB2 cyclin B2 1055 135 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18994.[MT7]-FELGRPLPLHFLR.4b9_2.heavy 435.511 / 584.354 49973.0 38.09989929199219 44 14 10 10 10 1.1556221572896643 56.51249879583639 0.0 3 0.9479793609699139 5.387330524808141 49973.0 270.2730554473991 0.0 - - - - - - - 228.0 99 12 CCNB2 cyclin B2 1057 136 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18809.[MT7]-ELNEALELK[MT7].2b3_1.heavy 673.892 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1059 136 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18809.[MT7]-ELNEALELK[MT7].2y5_1.heavy 673.892 / 717.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1061 136 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18809.[MT7]-ELNEALELK[MT7].2b4_1.heavy 673.892 / 630.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1063 136 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18809.[MT7]-ELNEALELK[MT7].2b5_1.heavy 673.892 / 701.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1065 137 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18567.[MT7]-NELVQK[MT7].2y4_1.heavy 509.81 / 631.426 2441.0 20.77299976348877 38 15 9 6 8 3.567360895063601 28.031926945876652 0.03840065002441406 4 0.9563207191990536 5.883435693443118 2441.0 0.5330713422007254 8.0 - - - - - - - 822.4444444444445 22 9 CENPI;APBB1;YWHAZ centromere protein I;amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65);tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1067 137 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18567.[MT7]-NELVQK[MT7].2b3_1.heavy 509.81 / 501.279 9136.0 20.77299976348877 38 15 9 6 8 3.567360895063601 28.031926945876652 0.03840065002441406 4 0.9563207191990536 5.883435693443118 9136.0 5.46500248015873 0.0 - - - - - - - 1676.4285714285713 18 7 CENPI;APBB1;YWHAZ centromere protein I;amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65);tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1069 137 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18567.[MT7]-NELVQK[MT7].2b4_1.heavy 509.81 / 600.347 2757.0 20.77299976348877 38 15 9 6 8 3.567360895063601 28.031926945876652 0.03840065002441406 4 0.9563207191990536 5.883435693443118 2757.0 6.297715736040609 2.0 - - - - - - - 302.0 12 18 CENPI;APBB1;YWHAZ centromere protein I;amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65);tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1071 137 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18567.[MT7]-NELVQK[MT7].2y3_1.heavy 509.81 / 518.342 3938.0 20.77299976348877 38 15 9 6 8 3.567360895063601 28.031926945876652 0.03840065002441406 4 0.9563207191990536 5.883435693443118 3938.0 17.454383167220378 0.0 - - - - - - - 748.25 7 8 CENPI;APBB1;YWHAZ centromere protein I;amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65);tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1073 138 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19092.[MT7]-TC[CAM]PVQLWVDSTPPPGTR.2y8_1.heavy 1028.03 / 812.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1075 138 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19092.[MT7]-TC[CAM]PVQLWVDSTPPPGTR.2y6_1.heavy 1028.03 / 624.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1077 138 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19092.[MT7]-TC[CAM]PVQLWVDSTPPPGTR.2b5_1.heavy 1028.03 / 730.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1079 138 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19092.[MT7]-TC[CAM]PVQLWVDSTPPPGTR.2y11_1.heavy 1028.03 / 1212.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1081 139 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36491.[MT7]-VLEC[CAM]FHR.2y4_1.heavy 552.791 / 619.277 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 1083 139 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36491.[MT7]-VLEC[CAM]FHR.2y5_1.heavy 552.791 / 748.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 1085 139 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36491.[MT7]-VLEC[CAM]FHR.2b4_1.heavy 552.791 / 646.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 1087 139 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36491.[MT7]-VLEC[CAM]FHR.2y6_1.heavy 552.791 / 861.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 1089 140 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36756.[MT7]-EAAENSLVAYK[MT7].2b4_1.heavy 741.906 / 545.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1091 140 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36756.[MT7]-EAAENSLVAYK[MT7].2b6_1.heavy 741.906 / 746.344 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1093 140 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36756.[MT7]-EAAENSLVAYK[MT7].2y3_1.heavy 741.906 / 525.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1095 140 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36756.[MT7]-EAAENSLVAYK[MT7].2b7_1.heavy 741.906 / 859.428 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1097 141 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18572.[MT7]-AIPEGEK[MT7].2y4_1.heavy 516.302 / 606.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1099 141 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18572.[MT7]-AIPEGEK[MT7].2y5_1.heavy 516.302 / 703.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1101 141 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18572.[MT7]-AIPEGEK[MT7].2y3_1.heavy 516.302 / 477.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1103 141 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18572.[MT7]-AIPEGEK[MT7].2y6_1.heavy 516.302 / 816.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1105 142 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41636.[MT7]-EVDGTAK[MT7].2y4_1.heavy 504.284 / 520.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1107 142 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41636.[MT7]-EVDGTAK[MT7].2y5_1.heavy 504.284 / 635.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1109 142 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41636.[MT7]-EVDGTAK[MT7].2b4_1.heavy 504.284 / 545.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1111 142 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41636.[MT7]-EVDGTAK[MT7].2y6_1.heavy 504.284 / 734.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1113 143 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533711.[MT7]-AVLEQFGFPLTGTEAR.3y6_1.heavy 627.339 / 634.315 68552.0 41.872751235961914 45 18 10 7 10 8.226340399473207 12.156073678449257 0.02700042724609375 3 0.9868474248112352 10.749290840256378 68552.0 380.7181697612732 0.0 - - - - - - - 794.8888888888889 137 9 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1115 143 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533711.[MT7]-AVLEQFGFPLTGTEAR.3b4_1.heavy 627.339 / 557.341 40058.0 41.872751235961914 45 18 10 7 10 8.226340399473207 12.156073678449257 0.02700042724609375 3 0.9868474248112352 10.749290840256378 40058.0 23.608232674717218 1.0 - - - - - - - 236.5625 80 16 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1117 143 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533711.[MT7]-AVLEQFGFPLTGTEAR.3b5_1.heavy 627.339 / 685.4 62521.0 41.872751235961914 45 18 10 7 10 8.226340399473207 12.156073678449257 0.02700042724609375 3 0.9868474248112352 10.749290840256378 62521.0 510.2502745604808 0.0 - - - - - - - 277.4 125 15 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1119 143 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533711.[MT7]-AVLEQFGFPLTGTEAR.3y8_1.heavy 627.339 / 844.452 93386.0 41.872751235961914 45 18 10 7 10 8.226340399473207 12.156073678449257 0.02700042724609375 3 0.9868474248112352 10.749290840256378 93386.0 516.3237877161598 0.0 - - - - - - - 171.22222222222223 186 9 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1121 144 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19150.[MT7]-GIVDQSQQAYQEAFEISK[MT7].4y5_1.heavy 583.053 / 767.442 5860.0 36.18007469177246 37 11 10 6 10 1.2251424624595901 54.11649189844142 0.03530120849609375 3 0.877612689543361 3.491097298377329 5860.0 18.981304347826086 0.0 - - - - - - - 239.68421052631578 11 19 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1123 144 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19150.[MT7]-GIVDQSQQAYQEAFEISK[MT7].4y4_1.heavy 583.053 / 620.374 10893.0 36.18007469177246 37 11 10 6 10 1.2251424624595901 54.11649189844142 0.03530120849609375 3 0.877612689543361 3.491097298377329 10893.0 34.49148659752004 0.0 - - - - - - - 689.2 21 10 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1125 144 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19150.[MT7]-GIVDQSQQAYQEAFEISK[MT7].4b4_1.heavy 583.053 / 529.31 9859.0 36.18007469177246 37 11 10 6 10 1.2251424624595901 54.11649189844142 0.03530120849609375 3 0.877612689543361 3.491097298377329 9859.0 8.744911783879267 0.0 - - - - - - - 715.0 19 8 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1127 144 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19150.[MT7]-GIVDQSQQAYQEAFEISK[MT7].4b5_1.heavy 583.053 / 657.369 9100.0 36.18007469177246 37 11 10 6 10 1.2251424624595901 54.11649189844142 0.03530120849609375 3 0.877612689543361 3.491097298377329 9100.0 27.52255947497949 0.0 - - - - - - - 296.7 18 20 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1129 145 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36495.[MT7]-TSADGNEK[MT7].2y4_1.heavy 555.287 / 591.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 1131 145 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36495.[MT7]-TSADGNEK[MT7].2y5_1.heavy 555.287 / 706.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 1133 145 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36495.[MT7]-TSADGNEK[MT7].2b4_1.heavy 555.287 / 519.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 1135 145 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36495.[MT7]-TSADGNEK[MT7].2y7_1.heavy 555.287 / 864.418 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 1137 146 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19093.[MT7]-GLDHIAENILSYLDAK[MT7].3b8_1.heavy 687.38 / 994.507 579.0 47.542032877604164 37 13 10 6 8 2.201298938983096 45.42772370852803 0.0364990234375 4 0.9291412916387477 4.608581916673097 579.0 15.975741379310346 0.0 - - - - - - - 0.0 1 0 BTRC beta-transducin repeat containing 1139 146 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19093.[MT7]-GLDHIAENILSYLDAK[MT7].3y6_1.heavy 687.38 / 840.458 N/A 47.542032877604164 37 13 10 6 8 2.201298938983096 45.42772370852803 0.0364990234375 4 0.9291412916387477 4.608581916673097 2412.0 38.08256896551724 0.0 - - - - - - - 144.7 4 10 BTRC beta-transducin repeat containing 1141 146 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19093.[MT7]-GLDHIAENILSYLDAK[MT7].3b4_1.heavy 687.38 / 567.301 2171.0 47.542032877604164 37 13 10 6 8 2.201298938983096 45.42772370852803 0.0364990234375 4 0.9291412916387477 4.608581916673097 2171.0 49.7258091286307 0.0 - - - - - - - 137.07692307692307 4 13 BTRC beta-transducin repeat containing 1143 146 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19093.[MT7]-GLDHIAENILSYLDAK[MT7].3y4_1.heavy 687.38 / 590.363 1351.0 47.542032877604164 37 13 10 6 8 2.201298938983096 45.42772370852803 0.0364990234375 4 0.9291412916387477 4.608581916673097 1351.0 23.626149723374823 1.0 - - - - - - - 141.83333333333334 3 18 BTRC beta-transducin repeat containing 1145 147 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36979.[MT7]-GIVDQSQQAYQEAFEISK[MT7].3b4_1.heavy 777.069 / 529.31 10246.0 36.17124938964844 39 13 10 6 10 2.2449701684671584 44.54402174452008 0.03530120849609375 3 0.9293077087755713 4.614068971354961 10246.0 12.953556782775461 0.0 - - - - - - - 258.61538461538464 20 13 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1147 147 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36979.[MT7]-GIVDQSQQAYQEAFEISK[MT7].3b5_1.heavy 777.069 / 657.369 8278.0 36.17124938964844 39 13 10 6 10 2.2449701684671584 44.54402174452008 0.03530120849609375 3 0.9293077087755713 4.614068971354961 8278.0 29.023475609756098 0.0 - - - - - - - 241.44444444444446 16 18 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1149 147 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36979.[MT7]-GIVDQSQQAYQEAFEISK[MT7].3b7_1.heavy 777.069 / 872.459 4262.0 36.17124938964844 39 13 10 6 10 2.2449701684671584 44.54402174452008 0.03530120849609375 3 0.9293077087755713 4.614068971354961 4262.0 39.76134146341463 0.0 - - - - - - - 147.6 8 15 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1151 147 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36979.[MT7]-GIVDQSQQAYQEAFEISK[MT7].3y5_1.heavy 777.069 / 767.442 9836.0 36.17124938964844 39 13 10 6 10 2.2449701684671584 44.54402174452008 0.03530120849609375 3 0.9293077087755713 4.614068971354961 9836.0 33.14052733902625 0.0 - - - - - - - 768.75 19 8 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1153 148 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18986.[MT7]-DIC[CAM]NDVLSLLEK[MT7].3y6_1.heavy 569.646 / 846.542 10189.0 45.32050132751465 43 17 10 6 10 2.598306676706024 30.814764313719284 0.03279876708984375 3 0.9773251903918145 8.180248249501343 10189.0 92.38730569948186 0.0 - - - - - - - 135.75 20 16 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1155 148 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18986.[MT7]-DIC[CAM]NDVLSLLEK[MT7].3b6_1.heavy 569.646 / 861.389 23565.0 45.32050132751465 43 17 10 6 10 2.598306676706024 30.814764313719284 0.03279876708984375 3 0.9773251903918145 8.180248249501343 23565.0 458.812246849685 0.0 - - - - - - - 126.625 47 16 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1157 148 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18986.[MT7]-DIC[CAM]NDVLSLLEK[MT7].3b5_1.heavy 569.646 / 762.321 50317.0 45.32050132751465 43 17 10 6 10 2.598306676706024 30.814764313719284 0.03279876708984375 3 0.9773251903918145 8.180248249501343 50317.0 211.5978778634388 0.0 - - - - - - - 209.2 100 15 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1159 148 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18986.[MT7]-DIC[CAM]NDVLSLLEK[MT7].3y5_1.heavy 569.646 / 733.458 29649.0 45.32050132751465 43 17 10 6 10 2.598306676706024 30.814764313719284 0.03279876708984375 3 0.9773251903918145 8.180248249501343 29649.0 113.36355287252863 0.0 - - - - - - - 156.23529411764707 59 17 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1161 149 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19152.[MT7]-DLK[MT7]PENILVDNDFHIK[MT7].4b8_2.heavy 586.332 / 606.365 4549.0 35.56019973754883 44 14 10 10 10 2.2605131208177123 44.23774366937815 0.0 3 0.9356774827386747 4.839773031405357 4549.0 7.750609657573947 0.0 - - - - - - - 234.42857142857142 9 14 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1163 149 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19152.[MT7]-DLK[MT7]PENILVDNDFHIK[MT7].4b7_2.heavy 586.332 / 549.823 6991.0 35.56019973754883 44 14 10 10 10 2.2605131208177123 44.23774366937815 0.0 3 0.9356774827386747 4.839773031405357 6991.0 18.683334704390322 0.0 - - - - - - - 247.0 13 15 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1165 149 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19152.[MT7]-DLK[MT7]PENILVDNDFHIK[MT7].4y3_1.heavy 586.332 / 541.358 4633.0 35.56019973754883 44 14 10 10 10 2.2605131208177123 44.23774366937815 0.0 3 0.9356774827386747 4.839773031405357 4633.0 7.206088047657003 0.0 - - - - - - - 674.0 9 9 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1167 149 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19152.[MT7]-DLK[MT7]PENILVDNDFHIK[MT7].4b3_1.heavy 586.332 / 645.417 1937.0 35.56019973754883 44 14 10 10 10 2.2605131208177123 44.23774366937815 0.0 3 0.9356774827386747 4.839773031405357 1937.0 1.9374094720606312 1.0 - - - - - - - 648.7 4 10 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1169 150 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18471.[MT7]-IETELR.2b3_1.heavy 452.765 / 488.284 17964.0 25.496999740600586 44 14 10 10 10 2.7179514939979987 36.79241525127587 0.0 3 0.9483717435573014 5.40794430160143 17964.0 29.319429670920854 0.0 - - - - - - - 810.25 35 12 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1171 150 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18471.[MT7]-IETELR.2y4_1.heavy 452.765 / 518.293 16233.0 25.496999740600586 44 14 10 10 10 2.7179514939979987 36.79241525127587 0.0 3 0.9483717435573014 5.40794430160143 16233.0 19.7062215477997 0.0 - - - - - - - 765.2857142857143 32 7 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1173 150 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18471.[MT7]-IETELR.2y5_1.heavy 452.765 / 647.336 50018.0 25.496999740600586 44 14 10 10 10 2.7179514939979987 36.79241525127587 0.0 3 0.9483717435573014 5.40794430160143 50018.0 79.87266459846974 0.0 - - - - - - - 321.4 100 10 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1175 150 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18471.[MT7]-IETELR.2b4_1.heavy 452.765 / 617.326 49606.0 25.496999740600586 44 14 10 10 10 2.7179514939979987 36.79241525127587 0.0 3 0.9483717435573014 5.40794430160143 49606.0 105.47343867092928 0.0 - - - - - - - 278.25 99 8 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1177 151 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19097.[MT7]-EENLC[CAM]QAFSDALLC[CAM]K[MT7].3y3_1.heavy 696.011 / 564.33 6741.0 41.83890151977539 45 15 10 10 10 1.5143725873391138 44.02263169845532 0.0 3 0.9501474920306726 5.504247087456639 6741.0 39.17342962714142 0.0 - - - - - - - 252.80769230769232 13 26 CCNB2 cyclin B2 1179 151 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19097.[MT7]-EENLC[CAM]QAFSDALLC[CAM]K[MT7].3b4_1.heavy 696.011 / 630.321 5950.0 41.83890151977539 45 15 10 10 10 1.5143725873391138 44.02263169845532 0.0 3 0.9501474920306726 5.504247087456639 5950.0 32.51951951951952 0.0 - - - - - - - 201.57692307692307 11 26 CCNB2 cyclin B2 1181 151 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19097.[MT7]-EENLC[CAM]QAFSDALLC[CAM]K[MT7].3b3_1.heavy 696.011 / 517.237 4577.0 41.83890151977539 45 15 10 10 10 1.5143725873391138 44.02263169845532 0.0 3 0.9501474920306726 5.504247087456639 4577.0 17.570111328426083 1.0 - - - - - - - 224.2258064516129 9 31 CCNB2 cyclin B2 1183 151 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19097.[MT7]-EENLC[CAM]QAFSDALLC[CAM]K[MT7].3b7_1.heavy 696.011 / 989.448 3246.0 41.83890151977539 45 15 10 10 10 1.5143725873391138 44.02263169845532 0.0 3 0.9501474920306726 5.504247087456639 3246.0 30.83830361445783 0.0 - - - - - - - 109.19047619047619 6 21 CCNB2 cyclin B2 1185 152 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19098.[MT7]-FEDVWVVSGPLTLPQTR.2b3_1.heavy 1044.57 / 536.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 1187 152 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19098.[MT7]-FEDVWVVSGPLTLPQTR.2b4_1.heavy 1044.57 / 635.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 1189 152 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19098.[MT7]-FEDVWVVSGPLTLPQTR.2y10_1.heavy 1044.57 / 1069.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 1191 152 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19098.[MT7]-FEDVWVVSGPLTLPQTR.2y11_1.heavy 1044.57 / 1168.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 1193 153 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533650.[MT7]-EIGHGSFGAVYFAR.3y7_1.heavy 552.287 / 783.415 50273.0 32.9833984375 50 20 10 10 10 17.098440993332947 5.848486422767559 0.0 3 0.9930508918088232 14.796057673347514 50273.0 143.76364419689614 0.0 - - - - - - - 284.7142857142857 100 14 TAOK1;TAOK2 TAO kinase 1;TAO kinase 2 1195 153 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533650.[MT7]-EIGHGSFGAVYFAR.3y4_1.heavy 552.287 / 556.288 34423.0 32.9833984375 50 20 10 10 10 17.098440993332947 5.848486422767559 0.0 3 0.9930508918088232 14.796057673347514 34423.0 80.64367172193799 0.0 - - - - - - - 263.7142857142857 68 7 TAOK1;TAOK2 TAO kinase 1;TAO kinase 2 1197 153 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533650.[MT7]-EIGHGSFGAVYFAR.3y8_1.heavy 552.287 / 930.483 12544.0 32.9833984375 50 20 10 10 10 17.098440993332947 5.848486422767559 0.0 3 0.9930508918088232 14.796057673347514 12544.0 107.33525773195876 0.0 - - - - - - - 164.23076923076923 25 13 TAOK1;TAOK2 TAO kinase 1;TAO kinase 2 1199 153 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533650.[MT7]-EIGHGSFGAVYFAR.3y5_1.heavy 552.287 / 655.356 23824.0 32.9833984375 50 20 10 10 10 17.098440993332947 5.848486422767559 0.0 3 0.9930508918088232 14.796057673347514 23824.0 52.42450924657146 0.0 - - - - - - - 753.75 47 8 TAOK1;TAOK2 TAO kinase 1;TAO kinase 2 1201 154 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19155.[MT7]-AAFDDAIAELDTLSEESYK[MT7].4b7_1.heavy 594.798 / 848.427 1487.0 46.779701232910156 45 15 10 10 10 1.518043095266825 44.13452646821583 0.0 3 0.9566288976854592 5.904455514326602 1487.0 38.46974141414141 0.0 - - - - - - - 76.46153846153847 2 13 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1203 154 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19155.[MT7]-AAFDDAIAELDTLSEESYK[MT7].4b5_1.heavy 594.798 / 664.306 8475.0 46.779701232910156 45 15 10 10 10 1.518043095266825 44.13452646821583 0.0 3 0.9566288976854592 5.904455514326602 8475.0 108.30028472645921 0.0 - - - - - - - 110.5909090909091 16 22 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1205 154 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19155.[MT7]-AAFDDAIAELDTLSEESYK[MT7].4y3_1.heavy 594.798 / 541.31 5699.0 46.779701232910156 45 15 10 10 10 1.518043095266825 44.13452646821583 0.0 3 0.9566288976854592 5.904455514326602 5699.0 75.94488514173999 0.0 - - - - - - - 192.47058823529412 11 17 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1207 154 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19155.[MT7]-AAFDDAIAELDTLSEESYK[MT7].4b6_1.heavy 594.798 / 735.343 5501.0 46.779701232910156 45 15 10 10 10 1.518043095266825 44.13452646821583 0.0 3 0.9566288976854592 5.904455514326602 5501.0 78.7876259236662 0.0 - - - - - - - 125.8 11 15 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1209 155 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 240988.0 22.20509910583496 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 240988.0 294.2973360230414 0.0 - - - - - - - 634.2857142857143 481 7 1211 155 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 396290.0 22.20509910583496 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 396290.0 1226.760684020766 0.0 - - - - - - - 239.15384615384616 792 13 1213 155 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 1565290.0 22.20509910583496 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1565290.0 1341.4060227628286 0.0 - - - - - - - 786.5714285714286 3130 7 1215 156 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19156.[MT7]-AAFDDAIAELDTLSEESYK[MT7].3y6_1.heavy 792.728 / 886.427 15408.0 46.779701232910156 39 9 10 10 10 2.3333553769218325 42.85673797873011 0.0 3 0.8037273383465282 2.738790015274819 15408.0 133.95243243243243 0.0 - - - - - - - 166.31578947368422 30 19 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1217 156 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19156.[MT7]-AAFDDAIAELDTLSEESYK[MT7].3b6_1.heavy 792.728 / 735.343 20346.0 46.779701232910156 39 9 10 10 10 2.3333553769218325 42.85673797873011 0.0 3 0.8037273383465282 2.738790015274819 20346.0 233.9540049140049 0.0 - - - - - - - 202.68421052631578 40 19 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1219 156 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19156.[MT7]-AAFDDAIAELDTLSEESYK[MT7].3b5_1.heavy 792.728 / 664.306 6074.0 46.779701232910156 39 9 10 10 10 2.3333553769218325 42.85673797873011 0.0 3 0.8037273383465282 2.738790015274819 6074.0 27.603146661674195 0.0 - - - - - - - 252.10526315789474 12 19 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1221 156 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19156.[MT7]-AAFDDAIAELDTLSEESYK[MT7].3b7_1.heavy 792.728 / 848.427 12889.0 46.779701232910156 39 9 10 10 10 2.3333553769218325 42.85673797873011 0.0 3 0.8037273383465282 2.738790015274819 12889.0 161.98337837837838 0.0 - - - - - - - 145.2941176470588 25 17 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1223 157 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36757.[MT7]-HRLPVSLSSAK[MT7].2b3_1.heavy 741.953 / 551.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGF19 fibroblast growth factor 19 1225 157 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36757.[MT7]-HRLPVSLSSAK[MT7].2y4_1.heavy 741.953 / 536.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGF19 fibroblast growth factor 19 1227 157 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36757.[MT7]-HRLPVSLSSAK[MT7].2y8_1.heavy 741.953 / 932.553 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGF19 fibroblast growth factor 19 1229 157 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36757.[MT7]-HRLPVSLSSAK[MT7].2y6_1.heavy 741.953 / 736.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGF19 fibroblast growth factor 19 1231 158 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533719.[MT7]-QLWQDPGIQEC[CAM]YDR.3y6_1.heavy 651.308 / 870.341 13765.0 33.55059814453125 50 20 10 10 10 12.068983394597009 8.285702012380561 0.0 3 0.9979692572305165 27.381761890709495 13765.0 32.82578947368421 1.0 - - - - - - - 217.14285714285714 27 14 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1233 158 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533719.[MT7]-QLWQDPGIQEC[CAM]YDR.3b5_1.heavy 651.308 / 815.417 12246.0 33.55059814453125 50 20 10 10 10 12.068983394597009 8.285702012380561 0.0 3 0.9979692572305165 27.381761890709495 12246.0 55.55816842105263 0.0 - - - - - - - 201.1764705882353 24 17 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1235 158 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533719.[MT7]-QLWQDPGIQEC[CAM]YDR.3y4_1.heavy 651.308 / 613.24 7310.0 33.55059814453125 50 20 10 10 10 12.068983394597009 8.285702012380561 0.0 3 0.9979692572305165 27.381761890709495 7310.0 22.314736842105262 0.0 - - - - - - - 245.41666666666666 14 12 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1237 158 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533719.[MT7]-QLWQDPGIQEC[CAM]YDR.3y5_1.heavy 651.308 / 742.282 7784.0 33.55059814453125 50 20 10 10 10 12.068983394597009 8.285702012380561 0.0 3 0.9979692572305165 27.381761890709495 7784.0 19.388521138912857 0.0 - - - - - - - 205.83333333333334 15 12 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1239 159 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533652.[MT7]-YLAEFATGNDRK[MT7].3y7_1.heavy 558.301 / 905.492 3234.0 31.168099403381348 42 16 10 6 10 3.7059701902414073 21.55820275465075 0.03940010070800781 3 0.9682153470133641 6.903932635701746 3234.0 13.718231046931407 0.0 - - - - - - - 195.52941176470588 6 17 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1241 159 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533652.[MT7]-YLAEFATGNDRK[MT7].3y6_1.heavy 558.301 / 834.455 3418.0 31.168099403381348 42 16 10 6 10 3.7059701902414073 21.55820275465075 0.03940010070800781 3 0.9682153470133641 6.903932635701746 3418.0 21.253696946043515 0.0 - - - - - - - 222.7058823529412 6 17 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1243 159 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533652.[MT7]-YLAEFATGNDRK[MT7].3b4_1.heavy 558.301 / 621.336 4619.0 31.168099403381348 42 16 10 6 10 3.7059701902414073 21.55820275465075 0.03940010070800781 3 0.9682153470133641 6.903932635701746 4619.0 10.471178749670742 0.0 - - - - - - - 277.29411764705884 9 17 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1245 159 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533652.[MT7]-YLAEFATGNDRK[MT7].3y8_1.heavy 558.301 / 1052.56 1571.0 31.168099403381348 42 16 10 6 10 3.7059701902414073 21.55820275465075 0.03940010070800781 3 0.9682153470133641 6.903932635701746 1571.0 13.217814336075204 0.0 - - - - - - - 211.0 3 7 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1247 160 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19158.[MT7]-TAFDDAIAELDTLNEDSYK[MT7].3y3_1.heavy 807.063 / 541.31 9565.0 46.563899993896484 50 20 10 10 10 5.078034800522575 19.692657480352263 0.0 3 0.990440619412014 12.612492472526101 9565.0 40.271855417309965 0.0 - - - - - - - 202.23529411764707 19 17 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 1249 160 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19158.[MT7]-TAFDDAIAELDTLNEDSYK[MT7].3b6_1.heavy 807.063 / 765.354 21471.0 46.563899993896484 50 20 10 10 10 5.078034800522575 19.692657480352263 0.0 3 0.990440619412014 12.612492472526101 21471.0 82.71492526496965 0.0 - - - - - - - 306.7894736842105 42 19 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 1251 160 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19158.[MT7]-TAFDDAIAELDTLNEDSYK[MT7].3b5_1.heavy 807.063 / 694.316 9017.0 46.563899993896484 50 20 10 10 10 5.078034800522575 19.692657480352263 0.0 3 0.990440619412014 12.612492472526101 9017.0 38.25213716178583 0.0 - - - - - - - 264.5625 18 16 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 1253 160 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19158.[MT7]-TAFDDAIAELDTLNEDSYK[MT7].3b7_1.heavy 807.063 / 878.438 11757.0 46.563899993896484 50 20 10 10 10 5.078034800522575 19.692657480352263 0.0 3 0.990440619412014 12.612492472526101 11757.0 31.58720995091477 0.0 - - - - - - - 175.68421052631578 23 19 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 1255 161 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533668.[MT7]-YLAEVAAGDDK[MT7]K[MT7].4b4_1.heavy 428.745 / 621.336 56907.0 27.687599182128906 41 11 10 10 10 0.7578889167358317 70.35718660420164 0.0 3 0.8761124042833203 3.469439794476904 56907.0 200.87843824751354 0.0 - - - - - - - 259.1875 113 16 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1257 161 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533668.[MT7]-YLAEVAAGDDK[MT7]K[MT7].4b5_1.heavy 428.745 / 720.405 12768.0 27.687599182128906 41 11 10 10 10 0.7578889167358317 70.35718660420164 0.0 3 0.8761124042833203 3.469439794476904 12768.0 29.70454029789839 0.0 - - - - - - - 201.76923076923077 25 13 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1259 161 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533668.[MT7]-YLAEVAAGDDK[MT7]K[MT7].4y6_2.heavy 428.745 / 461.266 76270.0 27.687599182128906 41 11 10 10 10 0.7578889167358317 70.35718660420164 0.0 3 0.8761124042833203 3.469439794476904 76270.0 132.17006369426753 0.0 - - - - - - - 722.0 152 13 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1261 161 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533668.[MT7]-YLAEVAAGDDK[MT7]K[MT7].4b3_1.heavy 428.745 / 492.294 27988.0 27.687599182128906 41 11 10 10 10 0.7578889167358317 70.35718660420164 0.0 3 0.8761124042833203 3.469439794476904 27988.0 37.629210900483756 0.0 - - - - - - - 687.125 55 8 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1263 162 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36890.[MT7]-DALSDFFEVESELGR.3y6_1.heavy 619.971 / 690.342 9433.0 47.780799865722656 44 14 10 10 10 2.032308716768093 44.425316068896706 0.0 3 0.9347112013649511 4.803428691793214 9433.0 206.541834145091 0.0 - - - - - - - 134.84615384615384 18 13 CAMK4 calcium/calmodulin-dependent protein kinase IV 1265 162 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36890.[MT7]-DALSDFFEVESELGR.3b4_1.heavy 619.971 / 531.289 1138.0 47.780799865722656 44 14 10 10 10 2.032308716768093 44.425316068896706 0.0 3 0.9347112013649511 4.803428691793214 1138.0 29.32472879832185 0.0 - - - - - - - 155.57142857142858 2 7 CAMK4 calcium/calmodulin-dependent protein kinase IV 1267 162 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36890.[MT7]-DALSDFFEVESELGR.3b5_1.heavy 619.971 / 646.316 11614.0 47.780799865722656 44 14 10 10 10 2.032308716768093 44.425316068896706 0.0 3 0.9347112013649511 4.803428691793214 11614.0 122.68309859154928 0.0 - - - - - - - 161.0 23 15 CAMK4 calcium/calmodulin-dependent protein kinase IV 1269 162 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36890.[MT7]-DALSDFFEVESELGR.3y5_1.heavy 619.971 / 561.299 8438.0 47.780799865722656 44 14 10 10 10 2.032308716768093 44.425316068896706 0.0 3 0.9347112013649511 4.803428691793214 8438.0 63.75412527798369 0.0 - - - - - - - 162.42857142857142 16 14 CAMK4 calcium/calmodulin-dependent protein kinase IV 1271 163 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18818.[MT7]-YLAEVATGEK[MT7].2y4_1.heavy 684.884 / 578.327 1903.0 30.34480094909668 46 16 10 10 10 2.7279386982823883 36.65771524226835 0.0 3 0.9661575544816807 6.689582756179554 1903.0 10.66306185405302 0.0 - - - - - - - 186.9375 3 16 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 1273 163 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18818.[MT7]-YLAEVATGEK[MT7].2y5_1.heavy 684.884 / 649.364 5620.0 30.34480094909668 46 16 10 10 10 2.7279386982823883 36.65771524226835 0.0 3 0.9661575544816807 6.689582756179554 5620.0 6.1985294117647065 0.0 - - - - - - - 654.6666666666666 11 9 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 1275 163 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18818.[MT7]-YLAEVATGEK[MT7].2y9_1.heavy 684.884 / 1061.6 1903.0 30.34480094909668 46 16 10 10 10 2.7279386982823883 36.65771524226835 0.0 3 0.9661575544816807 6.689582756179554 1903.0 24.638241758241755 0.0 - - - - - - - 254.0 3 5 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 1277 163 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18818.[MT7]-YLAEVATGEK[MT7].2b4_1.heavy 684.884 / 621.336 2991.0 30.34480094909668 46 16 10 10 10 2.7279386982823883 36.65771524226835 0.0 3 0.9661575544816807 6.689582756179554 2991.0 4.387429022082019 0.0 - - - - - - - 203.9375 5 16 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 1279 164 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533528.[MT7]-LLGVIIEEGK[MT7].3b4_1.heavy 453.621 / 527.367 140380.0 39.7224006652832 48 18 10 10 10 5.110468740917772 19.56767667891876 0.0 3 0.9838354920142321 9.69380703044167 140380.0 278.1061864161503 0.0 - - - - - - - 174.44444444444446 280 9 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1281 164 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533528.[MT7]-LLGVIIEEGK[MT7].3b5_1.heavy 453.621 / 640.451 88351.0 39.7224006652832 48 18 10 10 10 5.110468740917772 19.56767667891876 0.0 3 0.9838354920142321 9.69380703044167 88351.0 511.7746700680272 0.0 - - - - - - - 196.28571428571428 176 14 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1283 164 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533528.[MT7]-LLGVIIEEGK[MT7].3y4_1.heavy 453.621 / 606.321 71221.0 39.7224006652832 48 18 10 10 10 5.110468740917772 19.56767667891876 0.0 3 0.9838354920142321 9.69380703044167 71221.0 262.5594429797029 0.0 - - - - - - - 200.9090909090909 142 11 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1285 164 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533528.[MT7]-LLGVIIEEGK[MT7].3y5_1.heavy 453.621 / 719.406 14872.0 39.7224006652832 48 18 10 10 10 5.110468740917772 19.56767667891876 0.0 3 0.9838354920142321 9.69380703044167 14872.0 97.67341618521135 0.0 - - - - - - - 213.71428571428572 29 14 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1287 165 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18714.[MT7]-FLQVQPVSR.2b3_1.heavy 609.36 / 533.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1289 165 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18714.[MT7]-FLQVQPVSR.2y8_1.heavy 609.36 / 926.542 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1291 165 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18714.[MT7]-FLQVQPVSR.2y6_1.heavy 609.36 / 685.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1293 165 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18714.[MT7]-FLQVQPVSR.2y7_1.heavy 609.36 / 813.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1295 166 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533527.[MT7]-C[CAM]FPGLC[CAM]EGK[MT7].2y4_1.heavy 678.338 / 637.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 1297 166 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533527.[MT7]-C[CAM]FPGLC[CAM]EGK[MT7].2y8_1.heavy 678.338 / 1051.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 1299 166 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533527.[MT7]-C[CAM]FPGLC[CAM]EGK[MT7].2y6_1.heavy 678.338 / 807.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 1301 166 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533527.[MT7]-C[CAM]FPGLC[CAM]EGK[MT7].2y7_1.heavy 678.338 / 904.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 1303 167 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533524.[MT7]-ELNEALELK[MT7].3y3_1.heavy 449.597 / 533.341 61427.0 32.79209899902344 43 13 10 10 10 1.125602233848074 53.51527196708902 0.0 3 0.9246278771115645 4.4667401830207405 61427.0 344.7468361135268 0.0 - - - - - - - 347.7142857142857 122 7 TP53 tumor protein p53 1305 167 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533524.[MT7]-ELNEALELK[MT7].3b4_1.heavy 449.597 / 630.321 57435.0 32.79209899902344 43 13 10 10 10 1.125602233848074 53.51527196708902 0.0 3 0.9246278771115645 4.4667401830207405 57435.0 160.77351297362446 0.0 - - - - - - - 254.46153846153845 114 13 TP53 tumor protein p53 1307 167 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533524.[MT7]-ELNEALELK[MT7].3b5_1.heavy 449.597 / 701.359 42736.0 32.79209899902344 43 13 10 10 10 1.125602233848074 53.51527196708902 0.0 3 0.9246278771115645 4.4667401830207405 42736.0 491.00984324247986 0.0 - - - - - - - 239.53846153846155 85 13 TP53 tumor protein p53 1309 167 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533524.[MT7]-ELNEALELK[MT7].3b3_1.heavy 449.597 / 501.279 31151.0 32.79209899902344 43 13 10 10 10 1.125602233848074 53.51527196708902 0.0 3 0.9246278771115645 4.4667401830207405 31151.0 40.53834635380019 0.0 - - - - - - - 767.7777777777778 62 9 TP53 tumor protein p53 1311 168 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18579.[MT7]-AAEEEVVR.2b4_1.heavy 523.784 / 545.269 934.0 20.057300567626953 34 16 0 10 8 2.719740206008426 30.145549938834428 0.0 4 0.9683030389594571 6.913527272562182 934.0 2.1710850914584796 2.0 - - - - - - - 0.0 1 0 DGKZ diacylglycerol kinase, zeta 1313 168 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18579.[MT7]-AAEEEVVR.2b6_1.heavy 523.784 / 773.38 N/A 20.057300567626953 34 16 0 10 8 2.719740206008426 30.145549938834428 0.0 4 0.9683030389594571 6.913527272562182 2155.0 4.003484320557492 5.0 - - - - - - - 174.42857142857142 628 21 DGKZ diacylglycerol kinase, zeta 1315 168 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18579.[MT7]-AAEEEVVR.2b5_1.heavy 523.784 / 674.311 2658.0 20.057300567626953 34 16 0 10 8 2.719740206008426 30.145549938834428 0.0 4 0.9683030389594571 6.913527272562182 2658.0 8.757591909413087 0.0 - - - - - - - 220.57142857142858 5 14 DGKZ diacylglycerol kinase, zeta 1317 168 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18579.[MT7]-AAEEEVVR.2y7_1.heavy 523.784 / 831.421 3735.0 20.057300567626953 34 16 0 10 8 2.719740206008426 30.145549938834428 0.0 4 0.9683030389594571 6.913527272562182 3735.0 25.943279944289696 0.0 - - - - - - - 209.5 7 12 DGKZ diacylglycerol kinase, zeta 1319 169 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36745.[MT7]-RTEEENLRK[MT7].3b6_1.heavy 488.279 / 903.429 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1321 169 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36745.[MT7]-RTEEENLRK[MT7].3b4_1.heavy 488.279 / 660.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1323 169 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36745.[MT7]-RTEEENLRK[MT7].3b5_1.heavy 488.279 / 789.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1325 169 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36745.[MT7]-RTEEENLRK[MT7].3y8_2.heavy 488.279 / 581.813 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1327 170 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533523.[MT7]-IQGDGAQAAVK[MT7].3y3_1.heavy 449.261 / 461.32 18297.0 20.619150161743164 38 12 10 6 10 1.2540318370895527 52.73863165051843 0.038898468017578125 3 0.8946375235919206 3.7681685181265983 18297.0 32.213304091480126 0.0 - - - - - - - 263.09090909090907 36 11 CAMK4 calcium/calmodulin-dependent protein kinase IV 1329 170 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533523.[MT7]-IQGDGAQAAVK[MT7].3b6_1.heavy 449.261 / 686.359 13371.0 20.619150161743164 38 12 10 6 10 1.2540318370895527 52.73863165051843 0.038898468017578125 3 0.8946375235919206 3.7681685181265983 13371.0 56.922118592843326 0.0 - - - - - - - 234.53333333333333 26 15 CAMK4 calcium/calmodulin-dependent protein kinase IV 1331 170 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533523.[MT7]-IQGDGAQAAVK[MT7].3b5_1.heavy 449.261 / 615.322 17046.0 20.619150161743164 38 12 10 6 10 1.2540318370895527 52.73863165051843 0.038898468017578125 3 0.8946375235919206 3.7681685181265983 17046.0 25.145646523198778 0.0 - - - - - - - 670.2857142857143 34 7 CAMK4 calcium/calmodulin-dependent protein kinase IV 1333 170 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533523.[MT7]-IQGDGAQAAVK[MT7].3y4_1.heavy 449.261 / 532.357 15013.0 20.619150161743164 38 12 10 6 10 1.2540318370895527 52.73863165051843 0.038898468017578125 3 0.8946375235919206 3.7681685181265983 15013.0 26.431564427249885 0.0 - - - - - - - 684.375 30 8 CAMK4 calcium/calmodulin-dependent protein kinase IV 1335 171 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18585.[MT7]-VPVQPTK[MT7].2b3_1.heavy 528.836 / 440.299 2377.0 20.990999221801758 40 10 10 10 10 1.4726294341485697 50.664135242798054 0.0 3 0.8234640428344572 2.8929389578626585 2377.0 16.32237951457438 0.0 - - - - - - - 197.9 4 10 CCNB2 cyclin B2 1337 171 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18585.[MT7]-VPVQPTK[MT7].2y4_1.heavy 528.836 / 617.374 1268.0 20.990999221801758 40 10 10 10 10 1.4726294341485697 50.664135242798054 0.0 3 0.8234640428344572 2.8929389578626585 1268.0 0.5175184611559305 5.0 - - - - - - - 683.5 3 8 CCNB2 cyclin B2 1339 171 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18585.[MT7]-VPVQPTK[MT7].2y3_1.heavy 528.836 / 489.315 7210.0 20.990999221801758 40 10 10 10 10 1.4726294341485697 50.664135242798054 0.0 3 0.8234640428344572 2.8929389578626585 7210.0 6.287486855941115 0.0 - - - - - - - 285.0 14 5 CCNB2 cyclin B2 1341 171 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18585.[MT7]-VPVQPTK[MT7].2y6_1.heavy 528.836 / 813.495 16481.0 20.990999221801758 40 10 10 10 10 1.4726294341485697 50.664135242798054 0.0 3 0.8234640428344572 2.8929389578626585 16481.0 66.00330517961116 1.0 - - - - - - - 193.44444444444446 32 9 CCNB2 cyclin B2 1343 172 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18584.[MT7]-VEYLDDR.2b3_1.heavy 527.27 / 536.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1345 172 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18584.[MT7]-VEYLDDR.2y5_1.heavy 527.27 / 681.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1347 172 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18584.[MT7]-VEYLDDR.2b4_1.heavy 527.27 / 649.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1349 172 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18584.[MT7]-VEYLDDR.2y6_1.heavy 527.27 / 810.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1351 173 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19081.[MT7]-K[MT7]LQLVGITALLLASK[MT7].3b6_1.heavy 667.445 / 927.623 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1353 173 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19081.[MT7]-K[MT7]LQLVGITALLLASK[MT7].3b4_1.heavy 667.445 / 771.533 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1355 173 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19081.[MT7]-K[MT7]LQLVGITALLLASK[MT7].3b3_1.heavy 667.445 / 658.449 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1357 173 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19081.[MT7]-K[MT7]LQLVGITALLLASK[MT7].3y4_1.heavy 667.445 / 562.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1359 174 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18583.[MT7]-WDWAGGGR.2y3_2.heavy 524.758 / 145.085 N/A 32.13359832763672 42 17 9 10 6 6.164335389901287 16.222348992208445 0.0 6 0.9776489414934028 8.239504116412965 12477.0 5.787508893690079 3.0 - - - - - - - 1985.0 27 1 DGKZ diacylglycerol kinase, zeta 1361 174 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18583.[MT7]-WDWAGGGR.2b4_1.heavy 524.758 / 703.332 851.0 32.13359832763672 42 17 9 10 6 6.164335389901287 16.222348992208445 0.0 6 0.9776489414934028 8.239504116412965 851.0 -0.3301940035273368 21.0 - - - - - - - 734.3846153846154 6 13 DGKZ diacylglycerol kinase, zeta 1363 174 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18583.[MT7]-WDWAGGGR.2y6_1.heavy 524.758 / 603.3 7279.0 32.13359832763672 42 17 9 10 6 6.164335389901287 16.222348992208445 0.0 6 0.9776489414934028 8.239504116412965 7279.0 12.414703548850413 0.0 - - - - - - - 231.33333333333334 14 9 DGKZ diacylglycerol kinase, zeta 1365 174 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18583.[MT7]-WDWAGGGR.2y7_1.heavy 524.758 / 718.327 5199.0 32.13359832763672 42 17 9 10 6 6.164335389901287 16.222348992208445 0.0 6 0.9776489414934028 8.239504116412965 5199.0 9.666994264980985 0.0 - - - - - - - 634.7142857142857 10 7 DGKZ diacylglycerol kinase, zeta 1367 175 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 496525.0 31.308799743652344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 496525.0 1799.01155952114 0.0 - - - - - - - 279.0 993 1 1369 175 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 572319.0 31.308799743652344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 572319.0 585.3321474577159 0.0 - - - - - - - 93.0 1144 1 1371 175 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 955277.0 31.308799743652344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 955277.0 1614.4271176252644 0.0 - - - - - - - 1413.0 1910 6 1373 176 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533660.[MT7]-SVTEQGAELSNEER.3b6_1.heavy 564.943 / 746.38 37762.0 22.884899139404297 44 14 10 10 10 2.813996117108181 35.53665173595391 0.0 3 0.9405218327971028 5.035088743994223 37762.0 103.8632120075047 0.0 - - - - - - - 621.8571428571429 75 7 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1375 176 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533660.[MT7]-SVTEQGAELSNEER.3y6_1.heavy 564.943 / 747.363 46469.0 22.884899139404297 44 14 10 10 10 2.813996117108181 35.53665173595391 0.0 3 0.9405218327971028 5.035088743994223 46469.0 50.46180382123414 0.0 - - - - - - - 258.72727272727275 92 11 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1377 176 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533660.[MT7]-SVTEQGAELSNEER.3b4_1.heavy 564.943 / 561.3 39627.0 22.884899139404297 44 14 10 10 10 2.813996117108181 35.53665173595391 0.0 3 0.9405218327971028 5.035088743994223 39627.0 75.84697031729786 0.0 - - - - - - - 809.6666666666666 79 9 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1379 176 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533660.[MT7]-SVTEQGAELSNEER.3y5_1.heavy 564.943 / 634.279 120304.0 22.884899139404297 44 14 10 10 10 2.813996117108181 35.53665173595391 0.0 3 0.9405218327971028 5.035088743994223 120304.0 308.11722078781855 0.0 - - - - - - - 355.3333333333333 240 3 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1381 177 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18484.[MT7]-TDSLWR.2b3_1.heavy 461.249 / 448.216 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 1383 177 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18484.[MT7]-TDSLWR.2y5_1.heavy 461.249 / 676.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 1385 178 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36963.[MT7]-RPTVSSDLENIDTGVNSK[MT7].3b9_1.heavy 740.729 / 1129.6 1627.0 28.499550342559814 33 7 10 6 10 0.4840585765527299 97.29264611022647 0.03420066833496094 3 0.7228095681433773 2.287645499277637 1627.0 13.677266081871345 0.0 - - - - - - - 154.26666666666668 3 15 CCNB2 cyclin B2 1387 178 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36963.[MT7]-RPTVSSDLENIDTGVNSK[MT7].3y7_1.heavy 740.729 / 864.454 4281.0 28.499550342559814 33 7 10 6 10 0.4840585765527299 97.29264611022647 0.03420066833496094 3 0.7228095681433773 2.287645499277637 4281.0 4.996167056074766 1.0 - - - - - - - 178.41666666666666 8 12 CCNB2 cyclin B2 1389 178 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36963.[MT7]-RPTVSSDLENIDTGVNSK[MT7].3y6_1.heavy 740.729 / 749.427 3767.0 28.499550342559814 33 7 10 6 10 0.4840585765527299 97.29264611022647 0.03420066833496094 3 0.7228095681433773 2.287645499277637 3767.0 26.43508771929825 0.0 - - - - - - - 186.8181818181818 7 11 CCNB2 cyclin B2 1391 178 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36963.[MT7]-RPTVSSDLENIDTGVNSK[MT7].3b7_1.heavy 740.729 / 887.47 2140.0 28.499550342559814 33 7 10 6 10 0.4840585765527299 97.29264611022647 0.03420066833496094 3 0.7228095681433773 2.287645499277637 2140.0 5.0037587011490885 0.0 - - - - - - - 226.58823529411765 4 17 CCNB2 cyclin B2 1393 179 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19089.[MT7]-SSDFLESAELDSGGFGK[MT7].3y7_1.heavy 678.668 / 811.407 10879.0 36.89430046081543 40 14 10 6 10 3.4733202861337222 24.62471797535853 0.037799835205078125 3 0.9471601175873747 5.345031997779905 10879.0 39.36035714285714 0.0 - - - - - - - 245.375 21 16 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1395 179 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19089.[MT7]-SSDFLESAELDSGGFGK[MT7].3y6_1.heavy 678.668 / 696.38 12231.0 36.89430046081543 40 14 10 6 10 3.4733202861337222 24.62471797535853 0.037799835205078125 3 0.9471601175873747 5.345031997779905 12231.0 53.92952803294267 0.0 - - - - - - - 671.1428571428571 24 7 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1397 179 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19089.[MT7]-SSDFLESAELDSGGFGK[MT7].3b4_1.heavy 678.668 / 581.269 10750.0 36.89430046081543 40 14 10 6 10 3.4733202861337222 24.62471797535853 0.037799835205078125 3 0.9471601175873747 5.345031997779905 10750.0 39.03702590588986 0.0 - - - - - - - 643.5714285714286 21 7 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1399 179 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19089.[MT7]-SSDFLESAELDSGGFGK[MT7].3b5_1.heavy 678.668 / 694.353 11780.0 36.89430046081543 40 14 10 6 10 3.4733202861337222 24.62471797535853 0.037799835205078125 3 0.9471601175873747 5.345031997779905 11780.0 34.31956838875195 0.0 - - - - - - - 636.4444444444445 23 9 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1401 180 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18485.[MT7]-TEGAEK[MT7].2y4_1.heavy 461.758 / 548.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - MFAP3;YWHAZ;MFAP3L microfibrillar-associated protein 3;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide;microfibrillar-associated protein 3-like 1403 180 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18485.[MT7]-TEGAEK[MT7].2y5_1.heavy 461.758 / 677.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - MFAP3;YWHAZ;MFAP3L microfibrillar-associated protein 3;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide;microfibrillar-associated protein 3-like 1405 180 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18485.[MT7]-TEGAEK[MT7].2b4_1.heavy 461.758 / 503.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - MFAP3;YWHAZ;MFAP3L microfibrillar-associated protein 3;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide;microfibrillar-associated protein 3-like 1407 180 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18485.[MT7]-TEGAEK[MT7].2b5_1.heavy 461.758 / 632.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - MFAP3;YWHAZ;MFAP3L microfibrillar-associated protein 3;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide;microfibrillar-associated protein 3-like 1409 181 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18488.[MT7]-LVYDK[MT7].2y4_1.heavy 463.283 / 668.374 13279.0 24.854533513387043 39 13 10 6 10 1.6484653837200205 50.21165737542078 0.03669929504394531 3 0.9208997068256424 4.3588120654692935 13279.0 29.50693640343622 0.0 - - - - - - - 678.75 26 8 PPARA;MED30 peroxisome proliferator-activated receptor alpha;mediator complex subunit 30 1411 181 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18488.[MT7]-LVYDK[MT7].2b4_1.heavy 463.283 / 635.352 8101.0 24.854533513387043 39 13 10 6 10 1.6484653837200205 50.21165737542078 0.03669929504394531 3 0.9208997068256424 4.3588120654692935 8101.0 16.707612851220638 0.0 - - - - - - - 620.5714285714286 16 7 PPARA;MED30 peroxisome proliferator-activated receptor alpha;mediator complex subunit 30 1413 181 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18488.[MT7]-LVYDK[MT7].2y3_1.heavy 463.283 / 569.305 9772.0 24.854533513387043 39 13 10 6 10 1.6484653837200205 50.21165737542078 0.03669929504394531 3 0.9208997068256424 4.3588120654692935 9772.0 19.596784450685135 0.0 - - - - - - - 705.4444444444445 19 9 PPARA;MED30 peroxisome proliferator-activated receptor alpha;mediator complex subunit 30 1415 182 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533560.[MT7]-IVRTEIGVLLR.3y6_1.heavy 471.641 / 670.461 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1417 182 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533560.[MT7]-IVRTEIGVLLR.3b8_1.heavy 471.641 / 1012.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1419 182 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533560.[MT7]-IVRTEIGVLLR.3b7_1.heavy 471.641 / 913.559 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1421 182 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533560.[MT7]-IVRTEIGVLLR.3y5_1.heavy 471.641 / 557.377 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1423 183 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533561.[MT7]-IIGSGC[CAM]NLDTAR.3b4_1.heavy 474.249 / 515.331 6099.0 27.249900341033936 38 15 9 6 8 1.6307865684625973 41.88928947152867 0.03479957580566406 4 0.9520549312995599 5.613577854946166 6099.0 7.567297830786745 0.0 - - - - - - - 1114.111111111111 12 9 LDHAL6B lactate dehydrogenase A-like 6B 1425 183 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533561.[MT7]-IIGSGC[CAM]NLDTAR.3b5_1.heavy 474.249 / 572.352 8355.0 27.249900341033936 38 15 9 6 8 1.6307865684625973 41.88928947152867 0.03479957580566406 4 0.9520549312995599 5.613577854946166 8355.0 10.663279568163357 0.0 - - - - - - - 768.6 16 10 LDHAL6B lactate dehydrogenase A-like 6B 1427 183 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533561.[MT7]-IIGSGC[CAM]NLDTAR.3y5_1.heavy 474.249 / 575.315 9357.0 27.249900341033936 38 15 9 6 8 1.6307865684625973 41.88928947152867 0.03479957580566406 4 0.9520549312995599 5.613577854946166 9357.0 9.872892059058259 1.0 - - - - - - - 723.8333333333334 22 12 LDHAL6B lactate dehydrogenase A-like 6B 1429 183 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533561.[MT7]-IIGSGC[CAM]NLDTAR.3y9_2.heavy 474.249 / 497.224 7352.0 27.249900341033936 38 15 9 6 8 1.6307865684625973 41.88928947152867 0.03479957580566406 4 0.9520549312995599 5.613577854946166 7352.0 12.86666887220035 0.0 - - - - - - - 599.8181818181819 14 11 LDHAL6B lactate dehydrogenase A-like 6B 1431 184 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42297.[MT7]-ELTERFEDVWVVSGPLTLPQTR.3y6_1.heavy 906.152 / 715.41 3002.0 42.99537372589111 34 8 10 6 10 4.716574357812402 16.850788533949217 0.033100128173828125 3 0.7528767302839008 2.4295543080951725 3002.0 15.307895525182548 0.0 - - - - - - - 201.9090909090909 6 22 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1433 184 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42297.[MT7]-ELTERFEDVWVVSGPLTLPQTR.3y8_1.heavy 906.152 / 925.547 3785.0 42.99537372589111 34 8 10 6 10 4.716574357812402 16.850788533949217 0.033100128173828125 3 0.7528767302839008 2.4295543080951725 3785.0 47.85632183908046 0.0 - - - - - - - 149.33333333333334 7 21 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1435 184 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42297.[MT7]-ELTERFEDVWVVSGPLTLPQTR.3b8_1.heavy 906.152 / 1164.57 1653.0 42.99537372589111 34 8 10 6 10 4.716574357812402 16.850788533949217 0.033100128173828125 3 0.7528767302839008 2.4295543080951725 1653.0 18.95648854961832 0.0 - - - - - - - 115.55 3 20 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1437 184 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42297.[MT7]-ELTERFEDVWVVSGPLTLPQTR.3y10_1.heavy 906.152 / 1069.6 4786.0 42.99537372589111 34 8 10 6 10 4.716574357812402 16.850788533949217 0.033100128173828125 3 0.7528767302839008 2.4295543080951725 4786.0 68.31923664122137 0.0 - - - - - - - 150.16666666666666 9 18 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1439 185 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36980.[MT7]-GIVDQSQQAYQEAFEISK[MT7].2b3_1.heavy 1165.1 / 414.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1441 185 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36980.[MT7]-GIVDQSQQAYQEAFEISK[MT7].2b4_1.heavy 1165.1 / 529.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1443 185 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36980.[MT7]-GIVDQSQQAYQEAFEISK[MT7].2b5_1.heavy 1165.1 / 657.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1445 185 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36980.[MT7]-GIVDQSQQAYQEAFEISK[MT7].2b10_1.heavy 1165.1 / 1234.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1447 186 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36821.[MT7]-SVTC[CAM]TYSPALNK[MT7].2y5_1.heavy 814.931 / 686.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1449 186 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36821.[MT7]-SVTC[CAM]TYSPALNK[MT7].2y3_1.heavy 814.931 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1451 186 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36821.[MT7]-SVTC[CAM]TYSPALNK[MT7].2y6_1.heavy 814.931 / 773.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1453 186 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36821.[MT7]-SVTC[CAM]TYSPALNK[MT7].2y7_1.heavy 814.931 / 936.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - TP53 tumor protein p53 1455 187 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19024.[MT7]-IATPSFVPTQQDVLR.2y8_1.heavy 908.508 / 956.516 10230.0 36.20070012410482 43 17 10 6 10 3.7104832129688856 26.950667678667802 0.035400390625 3 0.9762915808123426 7.99925019780013 10230.0 79.17828603139368 0.0 - - - - - - - 216.27272727272728 20 11 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1457 187 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19024.[MT7]-IATPSFVPTQQDVLR.2y9_1.heavy 908.508 / 1055.58 2538.0 36.20070012410482 43 17 10 6 10 3.7104832129688856 26.950667678667802 0.035400390625 3 0.9762915808123426 7.99925019780013 2538.0 35.823162325032676 0.0 - - - - - - - 183.0 5 13 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1459 187 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19024.[MT7]-IATPSFVPTQQDVLR.2y3_1.heavy 908.508 / 387.271 3172.0 36.20070012410482 43 17 10 6 10 3.7104832129688856 26.950667678667802 0.035400390625 3 0.9762915808123426 7.99925019780013 3172.0 21.267190838480502 0.0 - - - - - - - 224.72222222222223 6 18 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1461 188 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18495.[MT7]-EEPAAK[MT7].2y4_1.heavy 466.768 / 530.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1463 188 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18495.[MT7]-EEPAAK[MT7].2y5_1.heavy 466.768 / 659.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1465 188 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18495.[MT7]-EEPAAK[MT7].2y3_1.heavy 466.768 / 433.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1467 189 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 249366.0 25.927400588989258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 249366.0 729.7262545164145 0.0 - - - - - - - 992.0 498 1 1469 189 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 326621.0 25.927400588989258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 326621.0 1246.202063397129 0.0 - - - - - - - 2282.625 653 8 1471 189 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 415527.0 25.927400588989258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 415527.0 807.0705996746353 0.0 - - - - - - - 1280.5 831 2 1473 190 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533462.[MT7]-DTILQLNLR.2y8_1.heavy 615.37 / 970.604 3799.0 37.10546747843424 41 17 8 6 10 2.347185483854531 33.89907472063828 0.03530120849609375 3 0.9770730549043865 8.134971028232378 3799.0 12.874756554307115 1.0 - - - - - - - 203.66666666666666 7 18 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1475 190 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533462.[MT7]-DTILQLNLR.2y5_1.heavy 615.37 / 643.389 5065.0 37.10546747843424 41 17 8 6 10 2.347185483854531 33.89907472063828 0.03530120849609375 3 0.9770730549043865 8.134971028232378 5065.0 5.321861997030789 0.0 - - - - - - - 633.0 10 8 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1477 190 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533462.[MT7]-DTILQLNLR.2b4_1.heavy 615.37 / 587.352 N/A 37.10546747843424 41 17 8 6 10 2.347185483854531 33.89907472063828 0.03530120849609375 3 0.9770730549043865 8.134971028232378 4132.0 2.361142857142857 7.0 - - - - - - - 1261.1538461538462 16 13 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1479 190 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533462.[MT7]-DTILQLNLR.2y6_1.heavy 615.37 / 756.473 6398.0 37.10546747843424 41 17 8 6 10 2.347185483854531 33.89907472063828 0.03530120849609375 3 0.9770730549043865 8.134971028232378 6398.0 12.594807776261938 0.0 - - - - - - - 229.66666666666666 12 18 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1481 191 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36426.[MT7]-AVEDGIK[MT7].2y4_1.heavy 510.302 / 576.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1483 191 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36426.[MT7]-AVEDGIK[MT7].2b4_1.heavy 510.302 / 559.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1485 191 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36426.[MT7]-AVEDGIK[MT7].2y6_1.heavy 510.302 / 804.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1487 191 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36426.[MT7]-AVEDGIK[MT7].2b5_1.heavy 510.302 / 616.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1489 192 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42018.[MT7]-QNVAYNREEER.3b9_2.heavy 517.926 / 624.808 4592.0 16.388224601745605 37 11 10 6 10 0.8932909406461911 67.18934880722482 0.034099578857421875 3 0.8603135321356707 3.262834838582518 4592.0 22.400000000000002 1.0 - - - - - - - 179.16666666666666 9 18 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1491 192 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42018.[MT7]-QNVAYNREEER.3y10_2.heavy 517.926 / 640.305 5904.0 16.388224601745605 37 11 10 6 10 0.8932909406461911 67.18934880722482 0.034099578857421875 3 0.8603135321356707 3.262834838582518 5904.0 41.67965076019871 0.0 - - - - - - - 178.17391304347825 11 23 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1493 192 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42018.[MT7]-QNVAYNREEER.3b4_1.heavy 517.926 / 557.316 3772.0 16.388224601745605 37 11 10 6 10 0.8932909406461911 67.18934880722482 0.034099578857421875 3 0.8603135321356707 3.262834838582518 3772.0 18.003635433789952 0.0 - - - - - - - 164.05555555555554 7 18 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1495 192 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42018.[MT7]-QNVAYNREEER.3y4_1.heavy 517.926 / 562.247 1749.0 16.388224601745605 37 11 10 6 10 0.8932909406461911 67.18934880722482 0.034099578857421875 3 0.8603135321356707 3.262834838582518 1749.0 30.39905487804878 0.0 - - - - - - - 185.9 3 20 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1497 193 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36323.[MT7]-NSFEVR.2y4_1.heavy 448.241 / 550.298 2231.0 23.065099716186523 43 17 10 6 10 5.62695790988516 17.771591968783873 0.038799285888671875 3 0.9799301187245113 8.696828928678539 2231.0 11.77775104549806 1.0 - - - - - - - 773.2222222222222 4 9 TP53 tumor protein p53 1499 193 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36323.[MT7]-NSFEVR.2b3_1.heavy 448.241 / 493.253 3213.0 23.065099716186523 43 17 10 6 10 5.62695790988516 17.771591968783873 0.038799285888671875 3 0.9799301187245113 8.696828928678539 3213.0 6.885 0.0 - - - - - - - 631.4615384615385 6 13 TP53 tumor protein p53 1501 193 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36323.[MT7]-NSFEVR.2y5_1.heavy 448.241 / 637.33 6158.0 23.065099716186523 43 17 10 6 10 5.62695790988516 17.771591968783873 0.038799285888671875 3 0.9799301187245113 8.696828928678539 6158.0 26.78591928251121 0.0 - - - - - - - 261.2142857142857 12 14 TP53 tumor protein p53 1503 193 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36323.[MT7]-NSFEVR.2b4_1.heavy 448.241 / 622.295 14458.0 23.065099716186523 43 17 10 6 10 5.62695790988516 17.771591968783873 0.038799285888671875 3 0.9799301187245113 8.696828928678539 14458.0 21.013503999999998 1.0 - - - - - - - 243.27272727272728 28 11 TP53 tumor protein p53 1505 194 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533333.[MT7]-VLQEDK[MT7].2y4_1.heavy 510.302 / 663.343 2370.0 20.677499771118164 40 20 0 10 10 14.622509534957215 6.838771399733787 0.0 2 0.9984438086656184 31.28056126166283 2370.0 3.1651290116460395 2.0 - - - - - - - 268.06666666666666 4 15 MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 1507 194 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533333.[MT7]-VLQEDK[MT7].2y5_1.heavy 510.302 / 776.427 N/A 20.677499771118164 40 20 0 10 10 14.622509534957215 6.838771399733787 0.0 2 0.9984438086656184 31.28056126166283 6034.0 28.593170731707318 2.0 - - - - - - - 185.88235294117646 129 17 MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 1509 194 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533333.[MT7]-VLQEDK[MT7].2b4_1.heavy 510.302 / 614.363 1365.0 20.677499771118164 40 20 0 10 10 14.622509534957215 6.838771399733787 0.0 2 0.9984438086656184 31.28056126166283 1365.0 3.417232801320859 0.0 - - - - - - - 211.1764705882353 2 17 MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 1511 194 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533333.[MT7]-VLQEDK[MT7].2y3_1.heavy 510.302 / 535.284 1796.0 20.677499771118164 40 20 0 10 10 14.622509534957215 6.838771399733787 0.0 2 0.9984438086656184 31.28056126166283 1796.0 5.501322958204344 0.0 - - - - - - - 228.0 3 17 MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 1513 195 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533551.[MT7]-NFVDSC[CAM]LQK[MT7].3y3_1.heavy 466.914 / 532.357 21650.0 28.186100006103516 33 17 0 10 6 2.7247942927736624 29.54871966302845 0.0 5 0.9717453205822523 7.324690324733417 21650.0 27.07602455473307 0.0 - - - - - - - 1271.4285714285713 43 7 TAOK1;TAOK2 TAO kinase 1;TAO kinase 2 1515 195 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533551.[MT7]-NFVDSC[CAM]LQK[MT7].3b4_1.heavy 466.914 / 620.316 22420.0 28.186100006103516 33 17 0 10 6 2.7247942927736624 29.54871966302845 0.0 5 0.9717453205822523 7.324690324733417 22420.0 31.68663408553723 2.0 - - - - - - - 256.7142857142857 152 7 TAOK1;TAOK2 TAO kinase 1;TAO kinase 2 1517 195 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533551.[MT7]-NFVDSC[CAM]LQK[MT7].3b5_1.heavy 466.914 / 707.348 6076.0 28.186100006103516 33 17 0 10 6 2.7247942927736624 29.54871966302845 0.0 5 0.9717453205822523 7.324690324733417 6076.0 41.916330545991144 0.0 - - - - - - - 191.41176470588235 12 17 TAOK1;TAOK2 TAO kinase 1;TAO kinase 2 1519 195 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533551.[MT7]-NFVDSC[CAM]LQK[MT7].3b3_1.heavy 466.914 / 505.289 13178.0 28.186100006103516 33 17 0 10 6 2.7247942927736624 29.54871966302845 0.0 5 0.9717453205822523 7.324690324733417 13178.0 13.380837165755374 0.0 - - - - - - - 770.1428571428571 26 7 TAOK1;TAOK2 TAO kinase 1;TAO kinase 2 1521 196 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19034.[MT7]-LIRGESEFSFEELR.3y6_1.heavy 619.327 / 780.389 6606.0 36.27215003967285 37 13 10 6 8 1.7892353222463102 43.70778450580248 0.03820037841796875 4 0.9074365514631073 4.02470709110582 6606.0 27.650092020161804 0.0 - - - - - - - 226.85 13 20 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 1523 196 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19034.[MT7]-LIRGESEFSFEELR.3y4_1.heavy 619.327 / 546.288 4298.0 36.27215003967285 37 13 10 6 8 1.7892353222463102 43.70778450580248 0.03820037841796875 4 0.9074365514631073 4.02470709110582 4298.0 16.91240091671748 0.0 - - - - - - - 313.8888888888889 8 18 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 1525 196 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19034.[MT7]-LIRGESEFSFEELR.3y5_1.heavy 619.327 / 693.357 2467.0 36.27215003967285 37 13 10 6 8 1.7892353222463102 43.70778450580248 0.03820037841796875 4 0.9074365514631073 4.02470709110582 2467.0 1.1264840182648403 2.0 - - - - - - - 725.2222222222222 8 9 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 1527 196 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19034.[MT7]-LIRGESEFSFEELR.3b7_1.heavy 619.327 / 929.517 1433.0 36.27215003967285 37 13 10 6 8 1.7892353222463102 43.70778450580248 0.03820037841796875 4 0.9074365514631073 4.02470709110582 1433.0 2.7404522613065327 1.0 - - - - - - - 199.08333333333334 2 12 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 1529 197 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533349.[MT7]-TEIGVLLR.2y5_1.heavy 522.83 / 557.377 8001.0 34.98569869995117 35 15 2 10 8 7.6245966508063985 13.115447882665862 0.0 4 0.9524520172984419 5.637159233687311 8001.0 9.275749357693405 0.0 - - - - - - - 723.3333333333334 16 9 CAMK4 calcium/calmodulin-dependent protein kinase IV 1531 197 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533349.[MT7]-TEIGVLLR.2b4_1.heavy 522.83 / 545.305 4466.0 34.98569869995117 35 15 2 10 8 7.6245966508063985 13.115447882665862 0.0 4 0.9524520172984419 5.637159233687311 4466.0 3.7082701563150833 0.0 - - - - - - - 651.0 8 7 CAMK4 calcium/calmodulin-dependent protein kinase IV 1533 197 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533349.[MT7]-TEIGVLLR.2y6_1.heavy 522.83 / 670.461 8094.0 34.98569869995117 35 15 2 10 8 7.6245966508063985 13.115447882665862 0.0 4 0.9524520172984419 5.637159233687311 8094.0 22.01916129032258 1.0 - - - - - - - 322.7647058823529 48 17 CAMK4 calcium/calmodulin-dependent protein kinase IV 1535 197 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533349.[MT7]-TEIGVLLR.2y7_1.heavy 522.83 / 799.504 11723.0 34.98569869995117 35 15 2 10 8 7.6245966508063985 13.115447882665862 0.0 4 0.9524520172984419 5.637159233687311 11723.0 67.01858422939068 0.0 - - - - - - - 251.64705882352942 23 17 CAMK4 calcium/calmodulin-dependent protein kinase IV 1537 198 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19035.[MT7]-DALSDFFEVESELGR.2b3_1.heavy 929.453 / 444.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1539 198 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19035.[MT7]-DALSDFFEVESELGR.2y5_1.heavy 929.453 / 561.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1541 198 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19035.[MT7]-DALSDFFEVESELGR.2y10_1.heavy 929.453 / 1212.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1543 198 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19035.[MT7]-DALSDFFEVESELGR.2b5_1.heavy 929.453 / 646.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1545 199 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 169833.0 35.880401611328125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 169833.0 127.26755810209548 0.0 - - - - - - - 263.52941176470586 339 17 1547 199 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 350669.0 35.880401611328125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 350669.0 85.53322714363368 0.0 - - - - - - - 226.0 701 16 1549 199 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 287090.0 35.880401611328125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 287090.0 140.97361197114003 0.0 - - - - - - - 260.0 574 13 1551 200 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533209.[MT7]-LVNLK[MT7].2b3_1.heavy 437.802 / 471.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSS2;SESTD1 acyl-CoA synthetase short-chain family member 2;SEC14 and spectrin domains 1 1553 200 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533209.[MT7]-LVNLK[MT7].2y4_1.heavy 437.802 / 617.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSS2;SESTD1 acyl-CoA synthetase short-chain family member 2;SEC14 and spectrin domains 1 1555 200 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533209.[MT7]-LVNLK[MT7].2y3_1.heavy 437.802 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSS2;SESTD1 acyl-CoA synthetase short-chain family member 2;SEC14 and spectrin domains 1 1557 201 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533702.[MT7]-DVK[MT7]PENLLYTSK[MT7].3b3_1.heavy 613.691 / 631.402 1922.0 29.3072247505188 36 13 10 3 10 1.3430854052296637 54.45036220415528 0.07349967956542969 3 0.9121058702172273 4.131891444328159 1922.0 5.341948424068768 0.0 - - - - - - - 215.46666666666667 3 15 MAPKAPK3;MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 3;mitogen-activated protein kinase-activated protein kinase 2 1559 201 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533702.[MT7]-DVK[MT7]PENLLYTSK[MT7].3y4_1.heavy 613.691 / 642.358 9434.0 29.3072247505188 36 13 10 3 10 1.3430854052296637 54.45036220415528 0.07349967956542969 3 0.9121058702172273 4.131891444328159 9434.0 22.29318843853429 0.0 - - - - - - - 268.6923076923077 18 13 MAPKAPK3;MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 3;mitogen-activated protein kinase-activated protein kinase 2 1561 201 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533702.[MT7]-DVK[MT7]PENLLYTSK[MT7].3y5_1.heavy 613.691 / 755.442 2271.0 29.3072247505188 36 13 10 3 10 1.3430854052296637 54.45036220415528 0.07349967956542969 3 0.9121058702172273 4.131891444328159 2271.0 2.0787185354691076 1.0 - - - - - - - 268.14285714285717 4 14 MAPKAPK3;MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 3;mitogen-activated protein kinase-activated protein kinase 2 1563 201 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533702.[MT7]-DVK[MT7]PENLLYTSK[MT7].3b7_2.heavy 613.691 / 542.816 9609.0 29.3072247505188 36 13 10 3 10 1.3430854052296637 54.45036220415528 0.07349967956542969 3 0.9121058702172273 4.131891444328159 9609.0 16.510181972395714 0.0 - - - - - - - 194.84615384615384 19 13 MAPKAPK3;MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 3;mitogen-activated protein kinase-activated protein kinase 2 1565 202 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42142.[MT7]-K[MT7]LQTARPSDSQSK[MT7].4y4_1.heavy 470.275 / 593.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 1567 202 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42142.[MT7]-K[MT7]LQTARPSDSQSK[MT7].4y7_1.heavy 470.275 / 892.449 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 1569 202 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42142.[MT7]-K[MT7]LQTARPSDSQSK[MT7].4y6_1.heavy 470.275 / 795.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 1571 202 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42142.[MT7]-K[MT7]LQTARPSDSQSK[MT7].4b9_2.heavy 470.275 / 643.377 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 1573 203 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533450.[MT7]-LSHPNIIK[MT7].3y3_1.heavy 403.923 / 517.383 15799.0 24.65410041809082 46 16 10 10 10 2.3976403591554134 36.20429818319576 0.0 3 0.9613714560482421 6.258931227810322 15799.0 41.82724323219941 0.0 - - - - - - - 652.3 31 10 CAMK4 calcium/calmodulin-dependent protein kinase IV 1575 203 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533450.[MT7]-LSHPNIIK[MT7].3y4_1.heavy 403.923 / 631.426 11201.0 24.65410041809082 46 16 10 10 10 2.3976403591554134 36.20429818319576 0.0 3 0.9613714560482421 6.258931227810322 11201.0 92.22380239520957 0.0 - - - - - - - 215.57894736842104 22 19 CAMK4 calcium/calmodulin-dependent protein kinase IV 1577 203 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533450.[MT7]-LSHPNIIK[MT7].3b3_1.heavy 403.923 / 482.284 22403.0 24.65410041809082 46 16 10 10 10 2.3976403591554134 36.20429818319576 0.0 3 0.9613714560482421 6.258931227810322 22403.0 61.76048457701313 0.0 - - - - - - - 265.5882352941176 44 17 CAMK4 calcium/calmodulin-dependent protein kinase IV 1579 203 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533450.[MT7]-LSHPNIIK[MT7].3y5_1.heavy 403.923 / 728.479 1505.0 24.65410041809082 46 16 10 10 10 2.3976403591554134 36.20429818319576 0.0 3 0.9613714560482421 6.258931227810322 1505.0 7.351402772144953 0.0 - - - - - - - 167.33333333333334 3 12 CAMK4 calcium/calmodulin-dependent protein kinase IV 1581 204 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533203.[MT7]-FATIK[MT7].2b3_1.heavy 434.281 / 464.263 1984.0 26.159099578857422 38 20 2 10 6 5.614478085734971 17.811094543956948 0.0 5 0.9946099361385132 16.80235469746166 1984.0 4.666666666666666 3.0 - - - - - - - 708.7142857142857 5 7 TAOK3;FAT4 TAO kinase 3;FAT tumor suppressor homolog 4 (Drosophila) 1583 204 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533203.[MT7]-FATIK[MT7].2y4_1.heavy 434.281 / 576.384 7274.0 26.159099578857422 38 20 2 10 6 5.614478085734971 17.811094543956948 0.0 5 0.9946099361385132 16.80235469746166 7274.0 13.518977044016374 1.0 - - - - - - - 755.7142857142857 44 7 TAOK3;FAT4 TAO kinase 3;FAT tumor suppressor homolog 4 (Drosophila) 1585 204 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533203.[MT7]-FATIK[MT7].2y3_1.heavy 434.281 / 505.347 3968.0 26.159099578857422 38 20 2 10 6 5.614478085734971 17.811094543956948 0.0 5 0.9946099361385132 16.80235469746166 3968.0 4.427489248492697 0.0 - - - - - - - 727.3 7 10 TAOK3;FAT4 TAO kinase 3;FAT tumor suppressor homolog 4 (Drosophila) 1587 205 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18892.[MT7]-HRLPVSLSSAK[MT7].3y3_1.heavy 494.971 / 449.284 9081.0 23.724199295043945 50 20 10 10 10 5.339212585138237 18.72935351522642 0.0 3 0.9944000909111698 16.484242910323385 9081.0 11.291452933253517 0.0 - - - - - - - 1223.7142857142858 18 7 FGF19 fibroblast growth factor 19 1589 205 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18892.[MT7]-HRLPVSLSSAK[MT7].3y6_1.heavy 494.971 / 736.432 3427.0 23.724199295043945 50 20 10 10 10 5.339212585138237 18.72935351522642 0.0 3 0.9944000909111698 16.484242910323385 3427.0 27.46741342843089 1.0 - - - - - - - 238.64285714285714 6 14 FGF19 fibroblast growth factor 19 1591 205 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18892.[MT7]-HRLPVSLSSAK[MT7].3y4_1.heavy 494.971 / 536.316 12508.0 23.724199295043945 50 20 10 10 10 5.339212585138237 18.72935351522642 0.0 3 0.9944000909111698 16.484242910323385 12508.0 26.141458179781246 0.0 - - - - - - - 323.6666666666667 25 9 FGF19 fibroblast growth factor 19 1593 205 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18892.[MT7]-HRLPVSLSSAK[MT7].3y5_1.heavy 494.971 / 649.4 2313.0 23.724199295043945 50 20 10 10 10 5.339212585138237 18.72935351522642 0.0 3 0.9944000909111698 16.484242910323385 2313.0 3.15 0.0 - - - - - - - 289.0625 4 16 FGF19 fibroblast growth factor 19 1595 206 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533200.[MT7]-TDPTER.2b3_1.heavy 431.723 / 458.237 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 1597 206 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533200.[MT7]-TDPTER.2y4_1.heavy 431.723 / 502.262 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 1599 206 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533200.[MT7]-TDPTER.2y5_1.heavy 431.723 / 617.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 1601 206 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533200.[MT7]-TDPTER.2b5_1.heavy 431.723 / 688.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 1603 207 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18688.[MT7]-VVSSIEQK[MT7].2y5_1.heavy 589.355 / 748.432 4509.0 24.180350303649902 46 20 10 6 10 8.12139093594142 12.313161721774467 0.036998748779296875 3 0.995454188841962 18.297511084739387 4509.0 36.248823529411766 0.0 - - - - - - - 139.64285714285714 9 14 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1605 207 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18688.[MT7]-VVSSIEQK[MT7].2y3_1.heavy 589.355 / 548.316 3828.0 24.180350303649902 46 20 10 6 10 8.12139093594142 12.313161721774467 0.036998748779296875 3 0.995454188841962 18.297511084739387 3828.0 4.662115459941546 0.0 - - - - - - - 765.7142857142857 7 7 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1607 207 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18688.[MT7]-VVSSIEQK[MT7].2y6_1.heavy 589.355 / 835.464 7401.0 24.180350303649902 46 20 10 6 10 8.12139093594142 12.313161721774467 0.036998748779296875 3 0.995454188841962 18.297511084739387 7401.0 66.17364705882353 0.0 - - - - - - - 154.54545454545453 14 11 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1609 207 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18688.[MT7]-VVSSIEQK[MT7].2y7_1.heavy 589.355 / 934.533 7656.0 24.180350303649902 46 20 10 6 10 8.12139093594142 12.313161721774467 0.036998748779296875 3 0.995454188841962 18.297511084739387 7656.0 71.15576470588235 0.0 - - - - - - - 179.44444444444446 15 18 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1611 208 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36331.[MT7]-AEEEQR.2y4_1.heavy 453.226 / 561.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYLK3 myosin light chain kinase 3 1613 208 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36331.[MT7]-AEEEQR.2b3_1.heavy 453.226 / 474.232 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYLK3 myosin light chain kinase 3 1615 208 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36331.[MT7]-AEEEQR.2y5_1.heavy 453.226 / 690.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYLK3 myosin light chain kinase 3 1617 208 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36331.[MT7]-AEEEQR.2b4_1.heavy 453.226 / 603.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYLK3 myosin light chain kinase 3 1619 209 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533558.[MT7]-AIALVGATFQK[MT7].3y3_1.heavy 469.625 / 566.342 25909.0 35.4463996887207 47 17 10 10 10 3.0624970962831477 26.64085865726507 0.0 3 0.9788495932759229 8.470997699796365 25909.0 41.300838714614066 0.0 - - - - - - - 249.0 51 11 MYLK3 myosin light chain kinase 3 1621 209 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533558.[MT7]-AIALVGATFQK[MT7].3b6_1.heavy 469.625 / 669.442 17190.0 35.4463996887207 47 17 10 10 10 3.0624970962831477 26.64085865726507 0.0 3 0.9788495932759229 8.470997699796365 17190.0 50.741566265060236 0.0 - - - - - - - 237.93333333333334 34 15 MYLK3 myosin light chain kinase 3 1623 209 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533558.[MT7]-AIALVGATFQK[MT7].3b4_1.heavy 469.625 / 513.352 41936.0 35.4463996887207 47 17 10 10 10 3.0624970962831477 26.64085865726507 0.0 3 0.9788495932759229 8.470997699796365 41936.0 110.4338726333907 0.0 - - - - - - - 240.7 83 10 MYLK3 myosin light chain kinase 3 1625 209 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533558.[MT7]-AIALVGATFQK[MT7].3b5_1.heavy 469.625 / 612.42 12124.0 35.4463996887207 47 17 10 10 10 3.0624970962831477 26.64085865726507 0.0 3 0.9788495932759229 8.470997699796365 12124.0 30.8185052263229 0.0 - - - - - - - 217.875 24 16 MYLK3 myosin light chain kinase 3 1627 210 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533346.[MT7]-TSSSGTAQR.2y8_1.heavy 519.768 / 793.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 1629 210 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533346.[MT7]-TSSSGTAQR.2y6_1.heavy 519.768 / 619.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 1631 210 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533346.[MT7]-TSSSGTAQR.2b7_1.heavy 519.768 / 736.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 1633 210 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533346.[MT7]-TSSSGTAQR.2y7_1.heavy 519.768 / 706.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 1635 211 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533586.[MT7]-IQYVC[CAM]EQNK[MT7].3b4_1.heavy 490.594 / 648.384 21020.0 24.171100616455078 50 20 10 10 10 8.70286900161256 11.490463659911569 0.0 3 0.9966210173449093 21.224966977976568 21020.0 65.02982075909321 0.0 - - - - - - - 210.15384615384616 42 13 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1637 211 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533586.[MT7]-IQYVC[CAM]EQNK[MT7].3y4_1.heavy 490.594 / 662.359 11023.0 24.171100616455078 50 20 10 10 10 8.70286900161256 11.490463659911569 0.0 3 0.9966210173449093 21.224966977976568 11023.0 39.54896739673967 1.0 - - - - - - - 715.625 22 8 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1639 211 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533586.[MT7]-IQYVC[CAM]EQNK[MT7].3b3_1.heavy 490.594 / 549.315 46568.0 24.171100616455078 50 20 10 10 10 8.70286900161256 11.490463659911569 0.0 3 0.9966210173449093 21.224966977976568 46568.0 153.4453770491803 0.0 - - - - - - - 659.2857142857143 93 7 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1641 211 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533586.[MT7]-IQYVC[CAM]EQNK[MT7].3y5_1.heavy 490.594 / 822.39 7348.0 24.171100616455078 50 20 10 10 10 8.70286900161256 11.490463659911569 0.0 3 0.9966210173449093 21.224966977976568 7348.0 117.76515995872035 0.0 - - - - - - - 192.08333333333334 14 12 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1643 212 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19049.[MT7]-LLDFQEFTLYLSTR.2y8_1.heavy 945.51 / 1000.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 1645 212 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19049.[MT7]-LLDFQEFTLYLSTR.2b6_1.heavy 945.51 / 890.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 1647 212 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19049.[MT7]-LLDFQEFTLYLSTR.2b5_1.heavy 945.51 / 761.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 1649 212 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19049.[MT7]-LLDFQEFTLYLSTR.2y7_1.heavy 945.51 / 853.478 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOG endo/exonuclease (5'-3'), endonuclease G-like 1651 213 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36843.[MT7]-IIQSFLWYLNPR.2b4_1.heavy 847.481 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGKZ diacylglycerol kinase, zeta 1653 213 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36843.[MT7]-IIQSFLWYLNPR.2b6_1.heavy 847.481 / 846.521 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGKZ diacylglycerol kinase, zeta 1655 213 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36843.[MT7]-IIQSFLWYLNPR.2y7_1.heavy 847.481 / 961.525 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGKZ diacylglycerol kinase, zeta 1657 214 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41560.[MT7]-LQQDK[MT7].2y4_1.heavy 460.276 / 662.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16;ProSAPiP1 dual specificity phosphatase 16;ProSAPiP1 protein 1659 214 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41560.[MT7]-LQQDK[MT7].2b4_1.heavy 460.276 / 629.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16;ProSAPiP1 dual specificity phosphatase 16;ProSAPiP1 protein 1661 214 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41560.[MT7]-LQQDK[MT7].2y3_1.heavy 460.276 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16;ProSAPiP1 dual specificity phosphatase 16;ProSAPiP1 protein 1663 215 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19045.[MT7]-AVLEQFGFPLTGTEAR.2y8_1.heavy 940.505 / 844.452 9373.0 41.86600112915039 43 13 10 10 10 1.532277467444658 43.50822098679364 0.0 3 0.9114505474127713 4.116341378226061 9373.0 32.280612 0.0 - - - - - - - 212.68421052631578 18 19 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1665 215 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19045.[MT7]-AVLEQFGFPLTGTEAR.2b4_1.heavy 940.505 / 557.341 9873.0 41.86600112915039 43 13 10 10 10 1.532277467444658 43.50822098679364 0.0 3 0.9114505474127713 4.116341378226061 9873.0 36.68900166756903 0.0 - - - - - - - 157.94736842105263 19 19 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1667 215 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19045.[MT7]-AVLEQFGFPLTGTEAR.2y10_1.heavy 940.505 / 1048.54 5832.0 41.86600112915039 43 13 10 10 10 1.532277467444658 43.50822098679364 0.0 3 0.9114505474127713 4.116341378226061 5832.0 32.32017345028087 0.0 - - - - - - - 137.04761904761904 11 21 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1669 215 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19045.[MT7]-AVLEQFGFPLTGTEAR.2y11_1.heavy 940.505 / 1195.61 3499.0 41.86600112915039 43 13 10 10 10 1.532277467444658 43.50822098679364 0.0 3 0.9114505474127713 4.116341378226061 3499.0 26.83233142857143 0.0 - - - - - - - 127.33333333333333 6 18 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1671 216 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42275.[MT7]-DLK[MT7]PENLLYATPAPDAPLK[MT7].3b6_1.heavy 833.479 / 985.556 851.0 35.369300842285156 24 8 0 10 6 0.6710344006802483 85.43992592874395 0.0 6 0.790058276974238 2.6448699688595543 851.0 6.657823529411765 1.0 - - - - - - - 0.0 1 0 CAMK4 calcium/calmodulin-dependent protein kinase IV 1673 216 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42275.[MT7]-DLK[MT7]PENLLYATPAPDAPLK[MT7].3y3_1.heavy 833.479 / 501.352 2553.0 35.369300842285156 24 8 0 10 6 0.6710344006802483 85.43992592874395 0.0 6 0.790058276974238 2.6448699688595543 2553.0 3.7981766987433843 2.0 - - - - - - - 691.625 52 8 CAMK4 calcium/calmodulin-dependent protein kinase IV 1675 216 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42275.[MT7]-DLK[MT7]PENLLYATPAPDAPLK[MT7].3y4_1.heavy 833.479 / 572.389 3149.0 35.369300842285156 24 8 0 10 6 0.6710344006802483 85.43992592874395 0.0 6 0.790058276974238 2.6448699688595543 3149.0 8.502061867851403 1.0 - - - - - - - 279.57142857142856 24 14 CAMK4 calcium/calmodulin-dependent protein kinase IV 1677 216 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42275.[MT7]-DLK[MT7]PENLLYATPAPDAPLK[MT7].3b7_2.heavy 833.479 / 549.823 5788.0 35.369300842285156 24 8 0 10 6 0.6710344006802483 85.43992592874395 0.0 6 0.790058276974238 2.6448699688595543 5788.0 25.399425573046116 0.0 - - - - - - - 239.72727272727272 11 11 CAMK4 calcium/calmodulin-dependent protein kinase IV 1679 217 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36708.[MT7]-NFVDSC[CAM]LQK[MT7].2b3_1.heavy 699.868 / 505.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAOK1;TAOK2 TAO kinase 1;TAO kinase 2 1681 217 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36708.[MT7]-NFVDSC[CAM]LQK[MT7].2y5_1.heavy 699.868 / 779.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAOK1;TAOK2 TAO kinase 1;TAO kinase 2 1683 217 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36708.[MT7]-NFVDSC[CAM]LQK[MT7].2b4_1.heavy 699.868 / 620.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAOK1;TAOK2 TAO kinase 1;TAO kinase 2 1685 217 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36708.[MT7]-NFVDSC[CAM]LQK[MT7].2y6_1.heavy 699.868 / 894.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAOK1;TAOK2 TAO kinase 1;TAO kinase 2 1687 218 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533440.[MT7]-LTDFGFAK[MT7].2y4_1.heavy 593.839 / 566.342 7202.0 35.69499969482422 44 18 10 6 10 6.38178753841637 15.669590909761755 0.0355987548828125 3 0.9837196550167712 9.659165251705346 7202.0 10.236922933903505 0.0 - - - - - - - 701.9090909090909 14 11 PRKX;MAPKAPK3;TSSK3;MAPKAPK2 protein kinase, X-linked;mitogen-activated protein kinase-activated protein kinase 3;testis-specific serine kinase 3;mitogen-activated protein kinase-activated protein kinase 2 1689 218 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533440.[MT7]-LTDFGFAK[MT7].2y5_1.heavy 593.839 / 713.41 11020.0 35.69499969482422 44 18 10 6 10 6.38178753841637 15.669590909761755 0.0355987548828125 3 0.9837196550167712 9.659165251705346 11020.0 27.454647745562102 0.0 - - - - - - - 642.0 22 10 PRKX;MAPKAPK3;TSSK3;MAPKAPK2 protein kinase, X-linked;mitogen-activated protein kinase-activated protein kinase 3;testis-specific serine kinase 3;mitogen-activated protein kinase-activated protein kinase 2 1691 218 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533440.[MT7]-LTDFGFAK[MT7].2b6_1.heavy 593.839 / 825.426 2690.0 35.69499969482422 44 18 10 6 10 6.38178753841637 15.669590909761755 0.0355987548828125 3 0.9837196550167712 9.659165251705346 2690.0 3.3649122329074377 1.0 - - - - - - - 770.0 13 8 PRKX;MAPKAPK3;TSSK3;MAPKAPK2 protein kinase, X-linked;mitogen-activated protein kinase-activated protein kinase 3;testis-specific serine kinase 3;mitogen-activated protein kinase-activated protein kinase 2 1693 218 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533440.[MT7]-LTDFGFAK[MT7].2y7_1.heavy 593.839 / 929.485 5987.0 35.69499969482422 44 18 10 6 10 6.38178753841637 15.669590909761755 0.0355987548828125 3 0.9837196550167712 9.659165251705346 5987.0 24.162800088587034 0.0 - - - - - - - 192.0 11 19 PRKX;MAPKAPK3;TSSK3;MAPKAPK2 protein kinase, X-linked;mitogen-activated protein kinase-activated protein kinase 3;testis-specific serine kinase 3;mitogen-activated protein kinase-activated protein kinase 2 1695 219 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42279.[MT7]-IVSYQVIGEDNVAVPSHLYK[MT7].3b6_1.heavy 840.463 / 834.484 3850.0 35.12244987487793 44 18 10 6 10 3.983211170274334 19.92529609221044 0.037899017333984375 3 0.985716839571838 10.314114038121916 3850.0 15.419592875318065 0.0 - - - - - - - 670.6666666666666 7 9 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1697 219 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42279.[MT7]-IVSYQVIGEDNVAVPSHLYK[MT7].3y6_1.heavy 840.463 / 888.506 7000.0 35.12244987487793 44 18 10 6 10 3.983211170274334 19.92529609221044 0.037899017333984375 3 0.985716839571838 10.314114038121916 7000.0 14.0 0.0 - - - - - - - 295.9230769230769 14 13 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1699 219 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42279.[MT7]-IVSYQVIGEDNVAVPSHLYK[MT7].3b5_1.heavy 840.463 / 735.416 5075.0 35.12244987487793 44 18 10 6 10 3.983211170274334 19.92529609221044 0.037899017333984375 3 0.985716839571838 10.314114038121916 5075.0 11.813235294117646 0.0 - - - - - - - 349.5833333333333 10 12 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1701 219 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42279.[MT7]-IVSYQVIGEDNVAVPSHLYK[MT7].3y8_1.heavy 840.463 / 1058.61 1750.0 35.12244987487793 44 18 10 6 10 3.983211170274334 19.92529609221044 0.037899017333984375 3 0.985716839571838 10.314114038121916 1750.0 15.011450381679388 0.0 - - - - - - - 215.88235294117646 3 17 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1703 220 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19180.[MT7]-VRVPTTGIIEYPFDLENIIFR.3y7_1.heavy 879.49 / 904.525 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA11;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), alpha 14 1705 220 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19180.[MT7]-VRVPTTGIIEYPFDLENIIFR.3b10_1.heavy 879.49 / 1210.73 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA11;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), alpha 14 1707 220 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19180.[MT7]-VRVPTTGIIEYPFDLENIIFR.3b8_1.heavy 879.49 / 968.601 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA11;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), alpha 14 1709 220 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19180.[MT7]-VRVPTTGIIEYPFDLENIIFR.3b7_1.heavy 879.49 / 855.517 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA11;GNA14 guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein), alpha 14 1711 221 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 284157.0 38.66569900512695 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 284157.0 599.9458479744824 0.0 - - - - - - - 351.875 568 8 1713 221 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 468194.0 38.66569900512695 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 468194.0 223.60524365841675 0.0 - - - - - - - 749.5555555555555 936 9 1715 221 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 605464.0 38.66569900512695 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 605464.0 319.3192629602779 0.0 - - - - - - - 738.8181818181819 1210 11 1717 222 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533448.[MT7]-YYLTDIDR.2y5_1.heavy 601.812 / 619.305 11234.0 32.79209899902344 47 17 10 10 10 4.305809351314786 23.224437461325323 0.0 3 0.97701113104299 8.123964997780472 11234.0 15.563770833333333 0.0 - - - - - - - 273.2307692307692 22 13 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1719 222 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533448.[MT7]-YYLTDIDR.2y6_1.heavy 601.812 / 732.389 6625.0 32.79209899902344 47 17 10 10 10 4.305809351314786 23.224437461325323 0.0 3 0.97701113104299 8.123964997780472 6625.0 8.052712738857421 1.0 - - - - - - - 245.33333333333334 18 9 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1721 222 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533448.[MT7]-YYLTDIDR.2b5_1.heavy 601.812 / 800.395 12290.0 32.79209899902344 47 17 10 10 10 4.305809351314786 23.224437461325323 0.0 3 0.97701113104299 8.123964997780472 12290.0 56.32916666666667 0.0 - - - - - - - 306.0 24 16 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1723 222 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533448.[MT7]-YYLTDIDR.2y7_1.heavy 601.812 / 895.452 20163.0 32.79209899902344 47 17 10 10 10 4.305809351314786 23.224437461325323 0.0 3 0.97701113104299 8.123964997780472 20163.0 238.38546874999997 0.0 - - - - - - - 221.53846153846155 40 13 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1725 223 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533211.[MT7]-ATC[CAM]QPR.2b3_1.heavy 438.728 / 477.225 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFB vascular endothelial growth factor B 1727 223 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533211.[MT7]-ATC[CAM]QPR.2y4_1.heavy 438.728 / 560.261 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFB vascular endothelial growth factor B 1729 223 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533211.[MT7]-ATC[CAM]QPR.2y5_1.heavy 438.728 / 661.309 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFB vascular endothelial growth factor B 1731 223 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533211.[MT7]-ATC[CAM]QPR.2b4_1.heavy 438.728 / 605.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFB vascular endothelial growth factor B 1733 224 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 336607.0 33.91859817504883 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 336607.0 58.85099114666706 1.0 - - - - - - - 804.4444444444445 792 9 1735 224 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 65083.0 33.91859817504883 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 65083.0 129.91736809071935 0.0 - - - - - - - 733.2 130 10 1737 224 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 44862.0 33.91859817504883 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 44862.0 76.09214433502791 0.0 - - - - - - - 720.8333333333334 89 12 1739 225 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533575.[MT7]-YLAEVAAGDDK[MT7].3b4_1.heavy 480.592 / 621.336 58260.0 30.34480094909668 43 13 10 10 10 2.6096918893484804 38.3186997699431 0.0 3 0.9232562124648924 4.426121986385389 58260.0 67.68993182163914 0.0 - - - - - - - 647.4545454545455 116 11 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1741 225 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533575.[MT7]-YLAEVAAGDDK[MT7].3b3_1.heavy 480.592 / 492.294 N/A 30.34480094909668 43 13 10 10 10 2.6096918893484804 38.3186997699431 0.0 3 0.9232562124648924 4.426121986385389 17226.0 25.380461798648867 1.0 - - - - - - - 734.2857142857143 38 7 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1743 225 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533575.[MT7]-YLAEVAAGDDK[MT7].3y4_1.heavy 480.592 / 578.29 57809.0 30.34480094909668 43 13 10 10 10 2.6096918893484804 38.3186997699431 0.0 3 0.9232562124648924 4.426121986385389 57809.0 40.56047662928228 0.0 - - - - - - - 1185.142857142857 115 7 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1745 225 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533575.[MT7]-YLAEVAAGDDK[MT7].3y5_1.heavy 480.592 / 649.327 28138.0 30.34480094909668 43 13 10 10 10 2.6096918893484804 38.3186997699431 0.0 3 0.9232562124648924 4.426121986385389 28138.0 38.742880693686786 0.0 - - - - - - - 707.5384615384615 56 13 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1747 226 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36852.[MT7]-YLAEVAAGDDK[MT7]K[MT7].3y7_1.heavy 571.325 / 992.562 2768.0 27.697649478912354 43 18 10 5 10 5.037870347652951 19.84965731533526 0.04020118713378906 3 0.9855871258960373 10.267484835426044 2768.0 29.657142857142855 0.0 - - - - - - - 112.0 5 6 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1749 226 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36852.[MT7]-YLAEVAAGDDK[MT7]K[MT7].3y3_1.heavy 571.325 / 678.439 1594.0 27.697649478912354 43 18 10 5 10 5.037870347652951 19.84965731533526 0.04020118713378906 3 0.9855871258960373 10.267484835426044 1594.0 2.900563046640749 1.0 - - - - - - - 209.88888888888889 3 18 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1751 226 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36852.[MT7]-YLAEVAAGDDK[MT7]K[MT7].3b4_1.heavy 571.325 / 621.336 4697.0 27.697649478912354 43 18 10 5 10 5.037870347652951 19.84965731533526 0.04020118713378906 3 0.9855871258960373 10.267484835426044 4697.0 7.029229478015351 1.0 - - - - - - - 744.5 10 8 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1753 226 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36852.[MT7]-YLAEVAAGDDK[MT7]K[MT7].3y5_1.heavy 571.325 / 850.487 3104.0 27.697649478912354 43 18 10 5 10 5.037870347652951 19.84965731533526 0.04020118713378906 3 0.9855871258960373 10.267484835426044 3104.0 29.783619047619045 0.0 - - - - - - - 223.83333333333334 6 12 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1755 227 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42267.[MT7]-TAFDEAIAELDTLSEESYK[MT7].4b4_1.heavy 605.804 / 579.289 2185.0 48.98922634124756 35 9 10 6 10 6.290775566858846 15.896291154753865 0.036098480224609375 3 0.8126276238432766 2.8053211694778746 2185.0 74.7586719731881 0.0 - - - - - - - 61.5 4 4 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1757 227 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42267.[MT7]-TAFDEAIAELDTLSEESYK[MT7].4b5_1.heavy 605.804 / 708.332 6646.0 48.98922634124756 35 9 10 6 10 6.290775566858846 15.896291154753865 0.036098480224609375 3 0.8126276238432766 2.8053211694778746 6646.0 145.05988722790454 0.0 - - - - - - - 75.44444444444444 13 9 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1759 227 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42267.[MT7]-TAFDEAIAELDTLSEESYK[MT7].4y3_1.heavy 605.804 / 541.31 5692.0 48.98922634124756 35 9 10 6 10 6.290775566858846 15.896291154753865 0.036098480224609375 3 0.8126276238432766 2.8053211694778746 5692.0 36.63367295470594 0.0 - - - - - - - 163.30769230769232 11 13 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1761 227 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42267.[MT7]-TAFDEAIAELDTLSEESYK[MT7].4b6_1.heavy 605.804 / 779.369 6800.0 48.98922634124756 35 9 10 6 10 6.290775566858846 15.896291154753865 0.036098480224609375 3 0.8126276238432766 2.8053211694778746 6800.0 112.0209261223047 0.0 - - - - - - - 109.07692307692308 13 13 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1763 228 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19193.[MT7]-TIITYPWFLNSSVILFLNK[MT7]K[MT7].4y5_1.heavy 708.172 / 937.607 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 1765 228 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19193.[MT7]-TIITYPWFLNSSVILFLNK[MT7]K[MT7].4b4_1.heavy 708.172 / 573.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 1767 228 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19193.[MT7]-TIITYPWFLNSSVILFLNK[MT7]K[MT7].4b5_1.heavy 708.172 / 736.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 1769 228 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19193.[MT7]-TIITYPWFLNSSVILFLNK[MT7]K[MT7].4y6_1.heavy 708.172 / 1050.69 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 1771 229 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36858.[MT7]-GYYSERDAADAVK[MT7].3y6_1.heavy 578.296 / 718.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1773 229 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36858.[MT7]-GYYSERDAADAVK[MT7].3b10_2.heavy 578.296 / 636.784 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1775 229 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36858.[MT7]-GYYSERDAADAVK[MT7].3b3_1.heavy 578.296 / 528.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1777 229 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36858.[MT7]-GYYSERDAADAVK[MT7].3b7_2.heavy 578.296 / 508.234 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1779 230 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36857.[MT7]-LQLVGITALLLASK[MT7].2y5_1.heavy 864.565 / 675.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1781 230 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36857.[MT7]-LQLVGITALLLASK[MT7].2y6_1.heavy 864.565 / 788.536 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1783 230 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36857.[MT7]-LQLVGITALLLASK[MT7].2y10_1.heavy 864.565 / 1130.73 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1785 230 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36857.[MT7]-LQLVGITALLLASK[MT7].2b5_1.heavy 864.565 / 655.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1787 231 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41931.[MT7]-GADINAEEAPK[MT7].2b8_1.heavy 701.874 / 944.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1789 231 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41931.[MT7]-GADINAEEAPK[MT7].2b4_1.heavy 701.874 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1791 231 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41931.[MT7]-GADINAEEAPK[MT7].2b7_1.heavy 701.874 / 815.402 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1793 231 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41931.[MT7]-GADINAEEAPK[MT7].2b5_1.heavy 701.874 / 615.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK4 calcium/calmodulin-dependent protein kinase IV 1795 232 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41697.[MT7]-DLASPLIGR.2y8_1.heavy 543.325 / 826.515 2256.0 31.780000686645508 36 16 0 10 10 2.167178965689567 31.98808605671398 0.0 3 0.9685147314504787 6.9368538369291635 2256.0 7.405714285714286 1.0 - - - - - - - 711.7142857142857 4 7 CCNB2 cyclin B2 1797 232 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41697.[MT7]-DLASPLIGR.2y5_1.heavy 543.325 / 555.361 2726.0 31.780000686645508 36 16 0 10 10 2.167178965689567 31.98808605671398 0.0 3 0.9685147314504787 6.9368538369291635 2726.0 3.7260606060606056 0.0 - - - - - - - 742.6 5 10 CCNB2 cyclin B2 1799 232 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41697.[MT7]-DLASPLIGR.2y6_1.heavy 543.325 / 642.393 N/A 31.780000686645508 36 16 0 10 10 2.167178965689567 31.98808605671398 0.0 3 0.9685147314504787 6.9368538369291635 3855.0 2.864530947775629 2.0 - - - - - - - 805.7142857142857 59 7 CCNB2 cyclin B2 1801 232 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41697.[MT7]-DLASPLIGR.2y7_1.heavy 543.325 / 713.43 2350.0 31.780000686645508 36 16 0 10 10 2.167178965689567 31.98808605671398 0.0 3 0.9685147314504787 6.9368538369291635 2350.0 4.927083333333334 2.0 - - - - - - - 822.5 4 8 CCNB2 cyclin B2 1803 233 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18641.[MT7]-SVDFIEK[MT7].2y4_1.heavy 563.323 / 680.41 11340.0 29.3439998626709 36 16 2 10 8 3.3367745074704884 29.96906137232722 0.0 4 0.9676574427117989 6.843805720797791 11340.0 30.13841400231426 0.0 - - - - - - - 665.125 22 8 DUSP16 dual specificity phosphatase 16 1805 233 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18641.[MT7]-SVDFIEK[MT7].2y5_1.heavy 563.323 / 795.437 4013.0 29.3439998626709 36 16 2 10 8 3.3367745074704884 29.96906137232722 0.0 4 0.9676574427117989 6.843805720797791 4013.0 8.395800254988039 0.0 - - - - - - - 207.84615384615384 8 13 DUSP16 dual specificity phosphatase 16 1807 233 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18641.[MT7]-SVDFIEK[MT7].2b4_1.heavy 563.323 / 593.305 2791.0 29.3439998626709 36 16 2 10 8 3.3367745074704884 29.96906137232722 0.0 4 0.9676574427117989 6.843805720797791 2791.0 6.669121006755164 1.0 - - - - - - - 586.6363636363636 6 11 DUSP16 dual specificity phosphatase 16 1809 233 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18641.[MT7]-SVDFIEK[MT7].2y3_1.heavy 563.323 / 533.341 N/A 29.3439998626709 36 16 2 10 8 3.3367745074704884 29.96906137232722 0.0 4 0.9676574427117989 6.843805720797791 4100.0 3.0160002803992185 4.0 - - - - - - - 793.0909090909091 45 11 DUSP16 dual specificity phosphatase 16 1811 234 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18640.[MT7]-QRQLYK[MT7].2y4_1.heavy 562.345 / 695.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - DZIP3;FGF19 DAZ interacting protein 3, zinc finger;fibroblast growth factor 19 1813 234 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18640.[MT7]-QRQLYK[MT7].2y5_1.heavy 562.345 / 851.522 N/A N/A - - - - - - - - - 0.0 - - - - - - - DZIP3;FGF19 DAZ interacting protein 3, zinc finger;fibroblast growth factor 19 1815 234 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18640.[MT7]-QRQLYK[MT7].2y3_1.heavy 562.345 / 567.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - DZIP3;FGF19 DAZ interacting protein 3, zinc finger;fibroblast growth factor 19 1817 234 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18640.[MT7]-QRQLYK[MT7].2b5_1.heavy 562.345 / 833.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - DZIP3;FGF19 DAZ interacting protein 3, zinc finger;fibroblast growth factor 19 1819 235 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42301.[MT7]-TIITYPWFLNSSVILFLNK[MT7]K[MT7].3y6_1.heavy 943.893 / 1050.69 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 1821 235 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42301.[MT7]-TIITYPWFLNSSVILFLNK[MT7]K[MT7].3b4_1.heavy 943.893 / 573.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 1823 235 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42301.[MT7]-TIITYPWFLNSSVILFLNK[MT7]K[MT7].3b5_1.heavy 943.893 / 736.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 1825 235 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42301.[MT7]-TIITYPWFLNSSVILFLNK[MT7]K[MT7].3y5_1.heavy 943.893 / 937.607 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA14 guanine nucleotide binding protein (G protein), alpha 14 1827 236 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41783.[MT7]-DSAVK[MT7]PDR.2y4_1.heavy 588.335 / 659.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFB vascular endothelial growth factor B 1829 236 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41783.[MT7]-DSAVK[MT7]PDR.2y5_1.heavy 588.335 / 758.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFB vascular endothelial growth factor B 1831 236 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41783.[MT7]-DSAVK[MT7]PDR.2b7_1.heavy 588.335 / 1001.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFB vascular endothelial growth factor B 1833 236 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41783.[MT7]-DSAVK[MT7]PDR.2y7_1.heavy 588.335 / 916.533 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFB vascular endothelial growth factor B 1835 237 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18638.[MT7]-K[MT7]AQNTK[MT7].2b3_1.heavy 561.354 / 616.402 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1837 237 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18638.[MT7]-K[MT7]AQNTK[MT7].2y5_1.heavy 561.354 / 705.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1839 237 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18638.[MT7]-K[MT7]AQNTK[MT7].2b4_1.heavy 561.354 / 730.445 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1841 237 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18638.[MT7]-K[MT7]AQNTK[MT7].2y3_1.heavy 561.354 / 506.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNB2 cyclin B2 1843 238 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18639.[MT7]-LLYDSPK[MT7].2y4_1.heavy 562.334 / 590.327 3675.0 28.482450008392334 39 13 10 6 10 1.1126929021005338 52.67996811131101 0.03420066833496094 3 0.9021130014967113 3.9119371333883493 3675.0 6.115917231309744 0.0 - - - - - - - 677.1538461538462 7 13 MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 1845 238 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18639.[MT7]-LLYDSPK[MT7].2y5_1.heavy 562.334 / 753.39 5640.0 28.482450008392334 39 13 10 6 10 1.1126929021005338 52.67996811131101 0.03420066833496094 3 0.9021130014967113 3.9119371333883493 5640.0 19.678353293178667 0.0 - - - - - - - 201.28571428571428 11 14 MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 1847 238 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18639.[MT7]-LLYDSPK[MT7].2b4_1.heavy 562.334 / 649.368 13161.0 28.482450008392334 39 13 10 6 10 1.1126929021005338 52.67996811131101 0.03420066833496094 3 0.9021130014967113 3.9119371333883493 13161.0 42.04780039163974 0.0 - - - - - - - 289.0769230769231 26 13 MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 1849 238 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18639.[MT7]-LLYDSPK[MT7].2y6_1.heavy 562.334 / 866.474 5982.0 28.482450008392334 39 13 10 6 10 1.1126929021005338 52.67996811131101 0.03420066833496094 3 0.9021130014967113 3.9119371333883493 5982.0 30.73049015982579 0.0 - - - - - - - 200.8235294117647 11 17 MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 1851 239 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18654.[MT7]-IADFGLSK[MT7].2y4_1.heavy 569.839 / 548.352 3892.0 32.94620132446289 48 18 10 10 10 4.387563810286656 22.79169131752562 0.0 3 0.988370528651418 11.433010395715343 3892.0 9.645925959480426 0.0 - - - - - - - 778.375 7 8 CAMK4;RIPK2 calcium/calmodulin-dependent protein kinase IV;receptor-interacting serine-threonine kinase 2 1853 239 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18654.[MT7]-IADFGLSK[MT7].2y5_1.heavy 569.839 / 695.421 5546.0 32.94620132446289 48 18 10 10 10 4.387563810286656 22.79169131752562 0.0 3 0.988370528651418 11.433010395715343 5546.0 14.135696773780566 0.0 - - - - - - - 371.3636363636364 11 11 CAMK4;RIPK2 calcium/calmodulin-dependent protein kinase IV;receptor-interacting serine-threonine kinase 2 1855 239 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18654.[MT7]-IADFGLSK[MT7].2y6_1.heavy 569.839 / 810.448 1459.0 32.94620132446289 48 18 10 10 10 4.387563810286656 22.79169131752562 0.0 3 0.988370528651418 11.433010395715343 1459.0 1.8753213367609254 1.0 - - - - - - - 250.21428571428572 3 14 CAMK4;RIPK2 calcium/calmodulin-dependent protein kinase IV;receptor-interacting serine-threonine kinase 2 1857 239 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18654.[MT7]-IADFGLSK[MT7].2y7_1.heavy 569.839 / 881.485 3892.0 32.94620132446289 48 18 10 10 10 4.387563810286656 22.79169131752562 0.0 3 0.988370528651418 11.433010395715343 3892.0 7.335209989289138 0.0 - - - - - - - 286.95 7 20 CAMK4;RIPK2 calcium/calmodulin-dependent protein kinase IV;receptor-interacting serine-threonine kinase 2 1859 240 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41575.[MT7]-AC[CAM]SLAK[MT7].2y4_1.heavy 469.273 / 562.368 1484.0 18.483633041381836 43 16 10 7 10 2.206730166850144 45.31591650951082 0.029600143432617188 3 0.9626442955756886 6.365354583684921 1484.0 5.786666666666666 0.0 - - - - - - - 249.85714285714286 2 28 YWHAB;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1861 240 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41575.[MT7]-AC[CAM]SLAK[MT7].2b5_1.heavy 469.273 / 647.33 1378.0 18.483633041381836 43 16 10 7 10 2.206730166850144 45.31591650951082 0.029600143432617188 3 0.9626442955756886 6.365354583684921 1378.0 3.6833333333333327 0.0 - - - - - - - 196.1 2 30 YWHAB;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1863 240 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41575.[MT7]-AC[CAM]SLAK[MT7].2y5_1.heavy 469.273 / 722.399 2968.0 18.483633041381836 43 16 10 7 10 2.206730166850144 45.31591650951082 0.029600143432617188 3 0.9626442955756886 6.365354583684921 2968.0 19.040000000000003 0.0 - - - - - - - 168.46428571428572 5 28 YWHAB;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1865 240 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41575.[MT7]-AC[CAM]SLAK[MT7].2y3_1.heavy 469.273 / 475.336 N/A 18.483633041381836 43 16 10 7 10 2.206730166850144 45.31591650951082 0.029600143432617188 3 0.9626442955756886 6.365354583684921 1007.0 0.5299999999999998 3.0 - - - - - - - 217.67857142857142 2 28 YWHAB;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1867 241 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 164449.0 42.064300537109375 24 -3 10 7 10 null 0.0 0.026996612548828125 3 0.0 0.0 164449.0 419.3303981274236 0.0 - - - - - - - 291.3333333333333 328 9 1869 241 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 343212.0 42.064300537109375 24 -3 10 7 10 null 0.0 0.026996612548828125 3 0.0 0.0 343212.0 847.7949303583817 0.0 - - - - - - - 384.75 686 4 1871 241 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 257492.0 42.064300537109375 24 -3 10 7 10 null 0.0 0.026996612548828125 3 0.0 0.0 257492.0 91.68963839987036 1.0 - - - - - - - 305.0 514 6 1873 242 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533591.[MT7]-EAAENSLVAYK[MT7].3b6_1.heavy 494.94 / 746.344 21746.0 27.7475004196167 40 14 10 6 10 2.3792211842483515 42.03056053050074 0.03940010070800781 3 0.9345599594579658 4.797812793882616 21746.0 39.01505613070162 0.0 - - - - - - - 677.1 43 10 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1875 242 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533591.[MT7]-EAAENSLVAYK[MT7].3y3_1.heavy 494.94 / 525.315 47214.0 27.7475004196167 40 14 10 6 10 2.3792211842483515 42.03056053050074 0.03940010070800781 3 0.9345599594579658 4.797812793882616 47214.0 36.833617021276595 0.0 - - - - - - - 666.375 94 8 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1877 242 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533591.[MT7]-EAAENSLVAYK[MT7].3b4_1.heavy 494.94 / 545.269 14215.0 27.7475004196167 40 14 10 6 10 2.3792211842483515 42.03056053050074 0.03940010070800781 3 0.9345599594579658 4.797812793882616 14215.0 21.61761216444142 0.0 - - - - - - - 623.1818181818181 28 11 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1879 242 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533591.[MT7]-EAAENSLVAYK[MT7].3b5_1.heavy 494.94 / 659.312 13030.0 27.7475004196167 40 14 10 6 10 2.3792211842483515 42.03056053050074 0.03940010070800781 3 0.9345599594579658 4.797812793882616 13030.0 41.371769375758745 0.0 - - - - - - - 695.6666666666666 26 9 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1881 243 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533495.[MT7]-SQGAEGALTGK[MT7].3b6_1.heavy 436.245 / 674.323 18699.0 21.07200050354004 47 17 10 10 10 3.842036615512071 26.027862305177923 0.0 3 0.9724995824843835 7.424930561713219 18699.0 97.44814595869893 0.0 - - - - - - - 224.33333333333334 37 12 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1883 243 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533495.[MT7]-SQGAEGALTGK[MT7].3y3_1.heavy 436.245 / 449.284 35655.0 21.07200050354004 47 17 10 10 10 3.842036615512071 26.027862305177923 0.0 3 0.9724995824843835 7.424930561713219 35655.0 103.49558602961672 0.0 - - - - - - - 634.0 71 7 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1885 243 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533495.[MT7]-SQGAEGALTGK[MT7].3b5_1.heavy 436.245 / 617.301 4675.0 21.07200050354004 47 17 10 10 10 3.842036615512071 26.027862305177923 0.0 3 0.9724995824843835 7.424930561713219 4675.0 59.56066362490457 0.0 - - - - - - - 198.0 9 12 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1887 243 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533495.[MT7]-SQGAEGALTGK[MT7].3b7_1.heavy 436.245 / 745.36 15292.0 21.07200050354004 47 17 10 10 10 3.842036615512071 26.027862305177923 0.0 3 0.9724995824843835 7.424930561713219 15292.0 92.5866009730208 0.0 - - - - - - - 188.84615384615384 30 13 EXOG endo/exonuclease (5'-3'), endonuclease G-like 1889 244 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18792.[MT7]-RTVLEEIGNR.3y6_1.heavy 444.257 / 717.353 10963.0 28.340700149536133 37 13 10 6 8 7.382899778323384 13.544813420548621 0.03639984130859375 4 0.9051224267202883 3.974527559585042 10963.0 58.44089494163424 1.0 - - - - - - - 197.76923076923077 32 13 CCNB2 cyclin B2 1891 244 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18792.[MT7]-RTVLEEIGNR.3b5_1.heavy 444.257 / 743.453 8821.0 28.340700149536133 37 13 10 6 8 7.382899778323384 13.544813420548621 0.03639984130859375 4 0.9051224267202883 3.974527559585042 8821.0 16.34195955181552 1.0 - - - - - - - 753.5 36 10 CCNB2 cyclin B2 1893 244 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18792.[MT7]-RTVLEEIGNR.3y4_1.heavy 444.257 / 459.267 22182.0 28.340700149536133 37 13 10 6 8 7.382899778323384 13.544813420548621 0.03639984130859375 4 0.9051224267202883 3.974527559585042 22182.0 35.9034784009517 0.0 - - - - - - - 711.0 44 10 CCNB2 cyclin B2 1895 244 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18792.[MT7]-RTVLEEIGNR.3y5_1.heavy 444.257 / 588.31 19099.0 28.340700149536133 37 13 10 6 8 7.382899778323384 13.544813420548621 0.03639984130859375 4 0.9051224267202883 3.974527559585042 19099.0 35.33994250167291 0.0 - - - - - - - 742.2222222222222 38 9 CCNB2 cyclin B2 1897 245 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533593.[MT7]-FLQVQPVSRK[MT7].3y7_1.heavy 497.308 / 957.596 1456.0 28.167499542236328 42 16 10 6 10 4.402410887325011 22.714826616459217 0.037200927734375 3 0.9697143633346201 7.073621294783847 1456.0 12.139793842583112 0.0 - - - - - - - 178.58333333333334 2 12 CCNB2 cyclin B2 1899 245 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533593.[MT7]-FLQVQPVSRK[MT7].3y6_1.heavy 497.308 / 858.528 2655.0 28.167499542236328 42 16 10 6 10 4.402410887325011 22.714826616459217 0.037200927734375 3 0.9697143633346201 7.073621294783847 2655.0 21.736842105263158 0.0 - - - - - - - 137.06666666666666 5 15 CCNB2 cyclin B2 1901 245 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533593.[MT7]-FLQVQPVSRK[MT7].3b3_1.heavy 497.308 / 533.32 6337.0 28.167499542236328 42 16 10 6 10 4.402410887325011 22.714826616459217 0.037200927734375 3 0.9697143633346201 7.073621294783847 6337.0 16.02846016297628 0.0 - - - - - - - 645.6153846153846 12 13 CCNB2 cyclin B2 1903 245 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533593.[MT7]-FLQVQPVSRK[MT7].3y5_1.heavy 497.308 / 730.469 6422.0 28.167499542236328 42 16 10 6 10 4.402410887325011 22.714826616459217 0.037200927734375 3 0.9697143633346201 7.073621294783847 6422.0 14.36406297600624 0.0 - - - - - - - 247.38888888888889 12 18 CCNB2 cyclin B2 1905 246 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533690.[MT7]-AILVDWLVQVHSK[MT7].3b6_1.heavy 599.361 / 842.489 1383.0 43.538774490356445 33 17 2 6 8 3.0040809858689603 33.288050645237185 0.03569793701171875 4 0.9717368404242666 7.323586152246823 1383.0 2.5611111111111113 1.0 - - - - - - - 131.78947368421052 3 19 CCNB2 cyclin B2 1907 246 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533690.[MT7]-AILVDWLVQVHSK[MT7].3y3_1.heavy 599.361 / 515.306 4364.0 43.538774490356445 33 17 2 6 8 3.0040809858689603 33.288050645237185 0.03569793701171875 4 0.9717368404242666 7.323586152246823 4364.0 15.266319253137434 0.0 - - - - - - - 198.8 8 20 CCNB2 cyclin B2 1909 246 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533690.[MT7]-AILVDWLVQVHSK[MT7].3b5_1.heavy 599.361 / 656.41 5012.0 43.538774490356445 33 17 2 6 8 3.0040809858689603 33.288050645237185 0.03569793701171875 4 0.9717368404242666 7.323586152246823 5012.0 63.30294142980189 0.0 - - - - - - - 144.6 10 20 CCNB2 cyclin B2 1911 246 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533690.[MT7]-AILVDWLVQVHSK[MT7].3b7_1.heavy 599.361 / 955.573 1210.0 43.538774490356445 33 17 2 6 8 3.0040809858689603 33.288050645237185 0.03569793701171875 4 0.9717368404242666 7.323586152246823 1210.0 5.22983697983698 1.0 - - - - - - - 129.41176470588235 29 17 CCNB2 cyclin B2 1913 247 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533389.[MT7]-EQVEAIK[MT7].2b3_1.heavy 552.829 / 501.279 2109.0 21.95789909362793 48 20 10 10 8 10.646032198804974 9.393170914063653 0.0 4 0.9954863831436183 18.36269986524316 2109.0 3.657308131109124 4.0 - - - - - - - 263.875 5 8 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1915 247 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533389.[MT7]-EQVEAIK[MT7].2y4_1.heavy 552.829 / 604.379 2900.0 21.95789909362793 48 20 10 10 8 10.646032198804974 9.393170914063653 0.0 4 0.9954863831436183 18.36269986524316 2900.0 7.442072119631968 3.0 - - - - - - - 205.33333333333334 8 12 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1917 247 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533389.[MT7]-EQVEAIK[MT7].2b4_1.heavy 552.829 / 630.321 2549.0 21.95789909362793 48 20 10 10 8 10.646032198804974 9.393170914063653 0.0 4 0.9954863831436183 18.36269986524316 2549.0 15.54503787878788 0.0 - - - - - - - 196.23076923076923 5 13 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1919 247 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533389.[MT7]-EQVEAIK[MT7].2b5_1.heavy 552.829 / 701.359 1670.0 21.95789909362793 48 20 10 10 8 10.646032198804974 9.393170914063653 0.0 4 0.9954863831436183 18.36269986524316 1670.0 4.423717791483274 1.0 - - - - - - - 205.33333333333334 3 9 GNA14 guanine nucleotide binding protein (G protein), alpha 14 1921 248 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41670.[MT7]-K[MT7]QQMAR.2b3_1.heavy 525.31 / 673.424 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1923 248 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41670.[MT7]-K[MT7]QQMAR.2y5_1.heavy 525.31 / 633.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1925 248 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41670.[MT7]-K[MT7]QQMAR.2b4_1.heavy 525.31 / 804.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1927 248 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41670.[MT7]-K[MT7]QQMAR.2b5_1.heavy 525.31 / 875.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1929 249 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41998.[MT7]-IVSGLRDNTIK[MT7].2b8_1.heavy 752.458 / 999.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 1931 249 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41998.[MT7]-IVSGLRDNTIK[MT7].2b7_1.heavy 752.458 / 885.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 1933 249 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41998.[MT7]-IVSGLRDNTIK[MT7].2y10_1.heavy 752.458 / 1246.72 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 1935 249 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41998.[MT7]-IVSGLRDNTIK[MT7].2b10_1.heavy 752.458 / 1213.7 N/A N/A - - - - - - - - - 0.0 - - - - - - - BTRC beta-transducin repeat containing 1937 250 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36808.[MT7]-FLIPNASQAESK[MT7].2b3_1.heavy 796.948 / 518.346 N/A 32.355767567952476 42 17 10 5 10 1.9702242564718921 39.48781443654382 0.04219818115234375 3 0.977241303548013 8.165100882859551 23849.0 41.13815797477131 0.0 - - - - - - - 762.75 47 8 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1939 250 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36808.[MT7]-FLIPNASQAESK[MT7].2y4_1.heavy 796.948 / 578.327 1033.0 32.355767567952476 42 17 10 5 10 1.9702242564718921 39.48781443654382 0.04219818115234375 3 0.977241303548013 8.165100882859551 1033.0 4.395744680851064 0.0 - - - - - - - 208.07142857142858 2 14 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1941 250 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36808.[MT7]-FLIPNASQAESK[MT7].2y9_1.heavy 796.948 / 1075.55 21220.0 32.355767567952476 42 17 10 5 10 1.9702242564718921 39.48781443654382 0.04219818115234375 3 0.977241303548013 8.165100882859551 21220.0 45.20905459387484 0.0 - - - - - - - 307.45454545454544 42 11 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1943 250 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36808.[MT7]-FLIPNASQAESK[MT7].2y6_1.heavy 796.948 / 793.417 1878.0 32.355767567952476 42 17 10 5 10 1.9702242564718921 39.48781443654382 0.04219818115234375 3 0.977241303548013 8.165100882859551 1878.0 3.5800565440844165 0.0 - - - - - - - 219.25 3 12 YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1945 251 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18683.[MT7]-TVLEEIGNR.2y8_1.heavy 587.831 / 929.505 6459.0 31.669300079345703 36 14 2 10 10 1.5164850401915098 45.63601621444264 0.0 3 0.942520908602748 5.122770615755875 6459.0 37.898855786248504 0.0 - - - - - - - 181.06666666666666 12 15 CCNB2 cyclin B2 1947 251 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18683.[MT7]-TVLEEIGNR.2b4_1.heavy 587.831 / 587.352 N/A 31.669300079345703 36 14 2 10 10 1.5164850401915098 45.63601621444264 0.0 3 0.942520908602748 5.122770615755875 63377.0 4.935644285094039 4.0 - - - - - - - 14604.0 361 1 CCNB2 cyclin B2 1949 251 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18683.[MT7]-TVLEEIGNR.2y6_1.heavy 587.831 / 717.353 8706.0 31.669300079345703 36 14 2 10 10 1.5164850401915098 45.63601621444264 0.0 3 0.942520908602748 5.122770615755875 8706.0 22.410462633451957 0.0 - - - - - - - 717.7777777777778 17 9 CCNB2 cyclin B2 1951 251 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18683.[MT7]-TVLEEIGNR.2y7_1.heavy 587.831 / 830.437 6179.0 31.669300079345703 36 14 2 10 10 1.5164850401915098 45.63601621444264 0.0 3 0.942520908602748 5.122770615755875 6179.0 27.01600347365053 0.0 - - - - - - - 274.53333333333336 12 15 CCNB2 cyclin B2 1953 252 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533487.[MT7]-K[MT7]LQEFNAR.3y7_1.heavy 431.922 / 877.453 N/A 22.83253351847331 43 17 10 6 10 3.224413823173169 24.29376264614588 0.0391998291015625 3 0.9741094239396384 7.653322639559002 179.0 1.5112359550561796 3.0 - - - - - - - 0.0 0 0 CAMK4 calcium/calmodulin-dependent protein kinase IV 1955 252 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533487.[MT7]-K[MT7]LQEFNAR.3y6_1.heavy 431.922 / 764.369 1877.0 22.83253351847331 43 17 10 6 10 3.224413823173169 24.29376264614588 0.0391998291015625 3 0.9741094239396384 7.653322639559002 1877.0 17.52993817086184 0.0 - - - - - - - 178.63636363636363 3 11 CAMK4 calcium/calmodulin-dependent protein kinase IV 1957 252 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533487.[MT7]-K[MT7]LQEFNAR.3y5_1.heavy 431.922 / 636.31 3397.0 22.83253351847331 43 17 10 6 10 3.224413823173169 24.29376264614588 0.0391998291015625 3 0.9741094239396384 7.653322639559002 3397.0 24.101620111731844 0.0 - - - - - - - 247.6153846153846 6 13 CAMK4 calcium/calmodulin-dependent protein kinase IV 1959 252 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533487.[MT7]-K[MT7]LQEFNAR.3y4_1.heavy 431.922 / 507.267 4649.0 22.83253351847331 43 17 10 6 10 3.224413823173169 24.29376264614588 0.0391998291015625 3 0.9741094239396384 7.653322639559002 4649.0 8.408701136298452 1.0 - - - - - - - 268.15384615384613 9 13 CAMK4 calcium/calmodulin-dependent protein kinase IV 1961 253 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18783.[MT7]-IADLGLASFK[MT7].2y4_1.heavy 661.9 / 596.352 2171.0 38.33440017700195 47 17 10 10 10 2.4165842373464397 33.078040860524325 0.0 3 0.9733702053368718 7.545881077029844 2171.0 3.7896767128279887 1.0 - - - - - - - 641.0 4 9 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1963 253 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18783.[MT7]-IADLGLASFK[MT7].2y9_1.heavy 661.9 / 1065.61 2457.0 38.33440017700195 47 17 10 10 10 2.4165842373464397 33.078040860524325 0.0 3 0.9733702053368718 7.545881077029844 2457.0 20.07814295564238 0.0 - - - - - - - 134.35294117647058 4 17 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1965 253 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18783.[MT7]-IADLGLASFK[MT7].2y3_1.heavy 661.9 / 525.315 2457.0 38.33440017700195 47 17 10 10 10 2.4165842373464397 33.078040860524325 0.0 3 0.9733702053368718 7.545881077029844 2457.0 9.31174319066148 0.0 - - - - - - - 201.47368421052633 4 19 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1967 253 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18783.[MT7]-IADLGLASFK[MT7].2y6_1.heavy 661.9 / 766.458 3485.0 38.33440017700195 47 17 10 10 10 2.4165842373464397 33.078040860524325 0.0 3 0.9733702053368718 7.545881077029844 3485.0 7.036112047990679 0.0 - - - - - - - 661.0 6 7 RIPK1 receptor (TNFRSF)-interacting serine-threonine kinase 1 1969 254 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19002.[MT7]-LIC[CAM]C[CAM]DILDVLDK[MT7].2b8_1.heavy 882.978 / 1147.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1971 254 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19002.[MT7]-LIC[CAM]C[CAM]DILDVLDK[MT7].2y4_1.heavy 882.978 / 618.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1973 254 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19002.[MT7]-LIC[CAM]C[CAM]DILDVLDK[MT7].2y3_1.heavy 882.978 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1975 254 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19002.[MT7]-LIC[CAM]C[CAM]DILDVLDK[MT7].2b5_1.heavy 882.978 / 806.366 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1977 255 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36800.[MT7]-EANAFEEQLLK[MT7].2b4_1.heavy 790.432 / 530.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 1979 255 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36800.[MT7]-EANAFEEQLLK[MT7].2b6_1.heavy 790.432 / 806.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 1981 255 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36800.[MT7]-EANAFEEQLLK[MT7].2y3_1.heavy 790.432 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 1983 255 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB36800.[MT7]-EANAFEEQLLK[MT7].2b7_1.heavy 790.432 / 935.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 1985 256 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19001.[MT7]-LIC[CAM]C[CAM]DILDVLDK[MT7].3b6_1.heavy 588.987 / 919.45 8761.0 45.69809913635254 39 13 10 6 10 2.2846852512241522 43.76970523463537 0.03279876708984375 3 0.9260365681922652 4.509620137089611 8761.0 100.02874022829471 0.0 - - - - - - - 128.6153846153846 17 13 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1987 256 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19001.[MT7]-LIC[CAM]C[CAM]DILDVLDK[MT7].3y3_1.heavy 588.987 / 519.326 28006.0 45.69809913635254 39 13 10 6 10 2.2846852512241522 43.76970523463537 0.03279876708984375 3 0.9260365681922652 4.509620137089611 28006.0 60.282840646254414 0.0 - - - - - - - 192.75 56 12 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1989 256 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19001.[MT7]-LIC[CAM]C[CAM]DILDVLDK[MT7].3b5_1.heavy 588.987 / 806.366 28547.0 45.69809913635254 39 13 10 6 10 2.2846852512241522 43.76970523463537 0.03279876708984375 3 0.9260365681922652 4.509620137089611 28547.0 154.84300713917315 0.0 - - - - - - - 214.8181818181818 57 11 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1991 256 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19001.[MT7]-LIC[CAM]C[CAM]DILDVLDK[MT7].3y5_1.heavy 588.987 / 733.421 16439.0 45.69809913635254 39 13 10 6 10 2.2846852512241522 43.76970523463537 0.03279876708984375 3 0.9260365681922652 4.509620137089611 16439.0 190.88460611784214 0.0 - - - - - - - 209.6315789473684 32 19 YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1993 257 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18781.[MT7]-TLWEIQNK[MT7].2y4_1.heavy 660.382 / 646.4 N/A 33.14400100708008 46 16 10 10 10 2.0258181914455857 35.683874357481756 0.0 3 0.9620386253562645 6.31404792081279 2436.0 4.541994141705187 1.0 - - - - - - - 719.4615384615385 4 13 LDHAL6B lactate dehydrogenase A-like 6B 1995 257 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18781.[MT7]-TLWEIQNK[MT7].2y5_1.heavy 660.382 / 775.443 3118.0 33.14400100708008 46 16 10 10 10 2.0258181914455857 35.683874357481756 0.0 3 0.9620386253562645 6.31404792081279 3118.0 14.941101159114858 0.0 - - - - - - - 186.58333333333334 6 12 LDHAL6B lactate dehydrogenase A-like 6B 1997 257 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18781.[MT7]-TLWEIQNK[MT7].2b4_1.heavy 660.382 / 674.363 2728.0 33.14400100708008 46 16 10 10 10 2.0258181914455857 35.683874357481756 0.0 3 0.9620386253562645 6.31404792081279 2728.0 12.60514225500527 0.0 - - - - - - - 259.72222222222223 5 18 LDHAL6B lactate dehydrogenase A-like 6B 1999 257 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18781.[MT7]-TLWEIQNK[MT7].2y6_1.heavy 660.382 / 961.522 2241.0 33.14400100708008 46 16 10 10 10 2.0258181914455857 35.683874357481756 0.0 3 0.9620386253562645 6.31404792081279 2241.0 7.04631600498594 0.0 - - - - - - - 187.15384615384616 4 13 LDHAL6B lactate dehydrogenase A-like 6B 2001 258 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42035.[MT7]-YAVTDDYQLSK[MT7].3y3_1.heavy 530.947 / 491.331 39778.0 28.86400032043457 45 15 10 10 10 2.3480775351327052 33.89613081750842 0.0 3 0.959373375297837 6.102047675540389 39778.0 38.522463733782004 0.0 - - - - - - - 1245.0 79 11 MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 2003 258 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42035.[MT7]-YAVTDDYQLSK[MT7].3b6_1.heavy 530.947 / 809.38 35067.0 28.86400032043457 45 15 10 10 10 2.3480775351327052 33.89613081750842 0.0 3 0.959373375297837 6.102047675540389 35067.0 122.5379643727963 0.0 - - - - - - - 302.3333333333333 70 15 MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 2005 258 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42035.[MT7]-YAVTDDYQLSK[MT7].3b5_1.heavy 530.947 / 694.353 8200.0 28.86400032043457 45 15 10 10 10 2.3480775351327052 33.89613081750842 0.0 3 0.959373375297837 6.102047675540389 8200.0 30.557890065579336 0.0 - - - - - - - 251.83333333333334 16 18 MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 2007 258 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42035.[MT7]-YAVTDDYQLSK[MT7].3b3_1.heavy 530.947 / 478.278 19453.0 28.86400032043457 45 15 10 10 10 2.3480775351327052 33.89613081750842 0.0 3 0.959373375297837 6.102047675540389 19453.0 16.414639256993993 0.0 - - - - - - - 262.0 38 2 MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 2009 259 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18776.[MT7]-GNDPLGEWER.2y5_1.heavy 658.821 / 676.305 857.0 32.51060104370117 44 20 10 10 4 9.91827916209526 10.082394169965545 0.0 8 0.999755845606975 78.98075149337802 857.0 10.549185799143526 5.0 - - - - - - - 253.73333333333332 6 15 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 2011 259 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18776.[MT7]-GNDPLGEWER.2y6_1.heavy 658.821 / 789.389 762.0 32.51060104370117 44 20 10 10 4 9.91827916209526 10.082394169965545 0.0 8 0.999755845606975 78.98075149337802 762.0 1.4943045519433693 8.0 - - - - - - - 323.6666666666667 2 15 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 2013 259 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18776.[MT7]-GNDPLGEWER.2b7_1.heavy 658.821 / 827.402 571.0 32.51060104370117 44 20 10 10 4 9.91827916209526 10.082394169965545 0.0 8 0.999755845606975 78.98075149337802 571.0 1.030633791686423 12.0 - - - - - - - 0.0 1 0 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 2015 259 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18776.[MT7]-GNDPLGEWER.2y7_1.heavy 658.821 / 886.442 12566.0 32.51060104370117 44 20 10 10 4 9.91827916209526 10.082394169965545 0.0 8 0.999755845606975 78.98075149337802 12566.0 54.23642739613328 0.0 - - - - - - - 278.3076923076923 25 13 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 2017 260 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42034.[MT7]-YAVTDDYQLSK[MT7].2y8_1.heavy 795.916 / 1113.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 2019 260 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42034.[MT7]-YAVTDDYQLSK[MT7].2y5_1.heavy 795.916 / 782.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 2021 260 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42034.[MT7]-YAVTDDYQLSK[MT7].2y6_1.heavy 795.916 / 897.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 2023 260 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB42034.[MT7]-YAVTDDYQLSK[MT7].2y7_1.heavy 795.916 / 1012.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 2025 261 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19209.[MT7]-FK[MT7]PDPNIPPTFSAFNEDYVGSGWSR.4b7_1.heavy 779.889 / 1100.63 9241.0 39.05609893798828 46 16 10 10 10 2.949024434199123 28.47028899835057 0.0 3 0.9637666419866335 6.46380058160938 9241.0 25.72851260486264 0.0 - - - - - - - 667.125 18 8 EXOG endo/exonuclease (5'-3'), endonuclease G-like 2027 261 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19209.[MT7]-FK[MT7]PDPNIPPTFSAFNEDYVGSGWSR.4b4_1.heavy 779.889 / 776.455 9093.0 39.05609893798828 46 16 10 10 10 2.949024434199123 28.47028899835057 0.0 3 0.9637666419866335 6.46380058160938 9093.0 22.416333283585274 0.0 - - - - - - - 809.125 18 8 EXOG endo/exonuclease (5'-3'), endonuclease G-like 2029 261 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19209.[MT7]-FK[MT7]PDPNIPPTFSAFNEDYVGSGWSR.4y6_1.heavy 779.889 / 649.305 20952.0 39.05609893798828 46 16 10 10 10 2.949024434199123 28.47028899835057 0.0 3 0.9637666419866335 6.46380058160938 20952.0 38.752977134818835 0.0 - - - - - - - 804.7142857142857 41 7 EXOG endo/exonuclease (5'-3'), endonuclease G-like 2031 261 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19209.[MT7]-FK[MT7]PDPNIPPTFSAFNEDYVGSGWSR.4b6_1.heavy 779.889 / 987.55 3459.0 39.05609893798828 46 16 10 10 10 2.949024434199123 28.47028899835057 0.0 3 0.9637666419866335 6.46380058160938 3459.0 15.762531645569622 0.0 - - - - - - - 209.4 6 25 EXOG endo/exonuclease (5'-3'), endonuclease G-like 2033 262 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18679.[MT7]-DLASPLIGRS.2y8_1.heavy 586.841 / 800.463 11530.0 31.26849937438965 47 17 10 10 10 3.6002498755900345 22.112899701261497 0.0 3 0.9739561222654393 7.63066615580151 11530.0 45.07503840245776 0.0 - - - - - - - 248.0 23 9 CCNB2 cyclin B2 2035 262 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18679.[MT7]-DLASPLIGRS.2y9_1.heavy 586.841 / 913.547 10043.0 31.26849937438965 47 17 10 10 10 3.6002498755900345 22.112899701261497 0.0 3 0.9739561222654393 7.63066615580151 10043.0 58.16693548387096 0.0 - - - - - - - 219.8181818181818 20 11 CCNB2 cyclin B2 2037 262 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18679.[MT7]-DLASPLIGRS.2y6_1.heavy 586.841 / 642.393 19062.0 31.26849937438965 47 17 10 10 10 3.6002498755900345 22.112899701261497 0.0 3 0.9739561222654393 7.63066615580151 19062.0 61.93441935483871 0.0 - - - - - - - 287.45454545454544 38 11 CCNB2 cyclin B2 2039 262 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18679.[MT7]-DLASPLIGRS.2y7_1.heavy 586.841 / 729.425 13576.0 31.26849937438965 47 17 10 10 10 3.6002498755900345 22.112899701261497 0.0 3 0.9739561222654393 7.63066615580151 13576.0 60.21612903225807 0.0 - - - - - - - 273.1875 27 16 CCNB2 cyclin B2 2041 263 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18611.[MT7]-LSASYEK[MT7].2y4_1.heavy 543.308 / 670.353 2860.0 22.72559928894043 46 18 10 10 8 6.86380929202324 14.569169355595989 0.0 4 0.9882469945563584 11.372648755385114 2860.0 4.115230556482762 1.0 - - - - - - - 236.07142857142858 10 14 BTRC beta-transducin repeat containing 2043 263 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18611.[MT7]-LSASYEK[MT7].2y5_1.heavy 543.308 / 741.39 1519.0 22.72559928894043 46 18 10 10 8 6.86380929202324 14.569169355595989 0.0 4 0.9882469945563584 11.372648755385114 1519.0 2.5501633441185683 1.0 - - - - - - - 210.5 3 14 BTRC beta-transducin repeat containing 2045 263 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18611.[MT7]-LSASYEK[MT7].2y3_1.heavy 543.308 / 583.321 1966.0 22.72559928894043 46 18 10 10 8 6.86380929202324 14.569169355595989 0.0 4 0.9882469945563584 11.372648755385114 1966.0 7.691344694302301 1.0 - - - - - - - 178.6 3 15 BTRC beta-transducin repeat containing 2047 263 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18611.[MT7]-LSASYEK[MT7].2y6_1.heavy 543.308 / 828.422 9204.0 22.72559928894043 46 18 10 10 8 6.86380929202324 14.569169355595989 0.0 4 0.9882469945563584 11.372648755385114 9204.0 51.43818060535313 0.0 - - - - - - - 200.91666666666666 18 12 BTRC beta-transducin repeat containing 2049 264 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533684.[MT7]-ADVLEGTAERLPPIR.3b6_1.heavy 594.339 / 729.39 864.0 32.869598388671875 43 13 10 10 10 1.605295215999705 42.320331528246264 0.0 3 0.9076422011400334 4.029256917261647 864.0 0.7200000000000001 8.0 - - - - - - - 237.47368421052633 7 19 MYLK3 myosin light chain kinase 3 2051 264 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533684.[MT7]-ADVLEGTAERLPPIR.3b4_1.heavy 594.339 / 543.326 3841.0 32.869598388671875 43 13 10 10 10 1.605295215999705 42.320331528246264 0.0 3 0.9076422011400334 4.029256917261647 3841.0 6.0015625 0.0 - - - - - - - 320.0 7 9 MYLK3 myosin light chain kinase 3 2053 264 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533684.[MT7]-ADVLEGTAERLPPIR.3y14_2.heavy 594.339 / 783.436 6434.0 32.869598388671875 43 13 10 10 10 1.605295215999705 42.320331528246264 0.0 3 0.9076422011400334 4.029256917261647 6434.0 11.987774966261808 0.0 - - - - - - - 253.71428571428572 12 14 MYLK3 myosin light chain kinase 3 2055 264 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533684.[MT7]-ADVLEGTAERLPPIR.3y13_2.heavy 594.339 / 725.922 6434.0 32.869598388671875 43 13 10 10 10 1.605295215999705 42.320331528246264 0.0 3 0.9076422011400334 4.029256917261647 6434.0 26.249826388888888 0.0 - - - - - - - 301.7142857142857 12 14 MYLK3 myosin light chain kinase 3 2057 265 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533685.[MT7]-RALPNNTSSSPQPK[MT7].3y7_1.heavy 595.667 / 874.475 1540.0 17.2101993560791 38 8 10 10 10 0.9542618068352285 69.14477559607917 0.0 3 0.7967200583145383 2.6894750413472113 1540.0 28.950637064164187 0.0 - - - - - - - 157.33333333333334 3 15 TP53 tumor protein p53 2059 265 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533685.[MT7]-RALPNNTSSSPQPK[MT7].3b6_1.heavy 595.667 / 810.47 1694.0 17.2101993560791 38 8 10 10 10 0.9542618068352285 69.14477559607917 0.0 3 0.7967200583145383 2.6894750413472113 1694.0 20.746786644565475 0.0 - - - - - - - 141.25 3 16 TP53 tumor protein p53 2061 265 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533685.[MT7]-RALPNNTSSSPQPK[MT7].3b5_1.heavy 595.667 / 696.427 1900.0 17.2101993560791 38 8 10 10 10 0.9542618068352285 69.14477559607917 0.0 3 0.7967200583145383 2.6894750413472113 1900.0 39.99868916926102 0.0 - - - - - - - 141.8235294117647 3 17 TP53 tumor protein p53 2063 265 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533685.[MT7]-RALPNNTSSSPQPK[MT7].3y4_1.heavy 595.667 / 613.379 9190.0 17.2101993560791 38 8 10 10 10 0.9542618068352285 69.14477559607917 0.0 3 0.7967200583145383 2.6894750413472113 9190.0 64.97559833589067 0.0 - - - - - - - 242.33333333333334 18 18 TP53 tumor protein p53 2065 266 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18614.[MT7]-TVEEAAAPR.2y8_1.heavy 544.297 / 842.437 4683.0 18.775850296020508 44 18 10 6 10 3.4946172953916324 28.615436697995644 0.031101226806640625 3 0.9850069540229948 10.066379965400726 4683.0 35.019563243773774 0.0 - - - - - - - 124.17647058823529 9 17 CAMK4 calcium/calmodulin-dependent protein kinase IV 2067 266 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18614.[MT7]-TVEEAAAPR.2b4_1.heavy 544.297 / 603.311 3084.0 18.775850296020508 44 18 10 6 10 3.4946172953916324 28.615436697995644 0.031101226806640625 3 0.9850069540229948 10.066379965400726 3084.0 25.700000000000003 0.0 - - - - - - - 138.10526315789474 6 19 CAMK4 calcium/calmodulin-dependent protein kinase IV 2069 266 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18614.[MT7]-TVEEAAAPR.2y6_1.heavy 544.297 / 614.326 3027.0 18.775850296020508 44 18 10 6 10 3.4946172953916324 28.615436697995644 0.031101226806640625 3 0.9850069540229948 10.066379965400726 3027.0 58.681315789473686 0.0 - - - - - - - 190.23809523809524 6 21 CAMK4 calcium/calmodulin-dependent protein kinase IV 2071 266 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18614.[MT7]-TVEEAAAPR.2y7_1.heavy 544.297 / 743.368 4454.0 18.775850296020508 44 18 10 6 10 3.4946172953916324 28.615436697995644 0.031101226806640625 3 0.9850069540229948 10.066379965400726 4454.0 35.1289857296302 0.0 - - - - - - - 182.14285714285714 8 21 CAMK4 calcium/calmodulin-dependent protein kinase IV 2073 267 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533258.[MT7]-SAGLGLK[MT7].2y5_1.heavy 467.302 / 631.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 2075 267 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533258.[MT7]-SAGLGLK[MT7].2b6_1.heavy 467.302 / 643.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 2077 267 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533258.[MT7]-SAGLGLK[MT7].2y6_1.heavy 467.302 / 702.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 2079 267 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533258.[MT7]-SAGLGLK[MT7].2b5_1.heavy 467.302 / 530.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUSP16 dual specificity phosphatase 16 2081 268 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533687.[MT7]-NVTELNEPLSNEER.3y7_1.heavy 596.635 / 844.416 45645.0 28.074600219726562 50 20 10 10 10 16.392862934215202 6.10021570980624 0.0 3 0.9989592563088711 38.25188164334462 45645.0 148.68921301371807 0.0 - - - - - - - 228.44444444444446 91 9 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 2083 268 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533687.[MT7]-NVTELNEPLSNEER.3y6_1.heavy 596.635 / 747.363 15244.0 28.074600219726562 50 20 10 10 10 16.392862934215202 6.10021570980624 0.0 3 0.9989592563088711 38.25188164334462 15244.0 25.076718134278423 0.0 - - - - - - - 694.5555555555555 30 9 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 2085 268 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533687.[MT7]-NVTELNEPLSNEER.3b4_1.heavy 596.635 / 588.311 36140.0 28.074600219726562 50 20 10 10 10 16.392862934215202 6.10021570980624 0.0 3 0.9989592563088711 38.25188164334462 36140.0 30.60867045706938 0.0 - - - - - - - 1231.125 72 8 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 2087 268 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533687.[MT7]-NVTELNEPLSNEER.3y5_1.heavy 596.635 / 634.279 34084.0 28.074600219726562 50 20 10 10 10 16.392862934215202 6.10021570980624 0.0 3 0.9989592563088711 38.25188164334462 34084.0 83.75314441059352 0.0 - - - - - - - 587.1428571428571 68 7 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 2089 269 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533688.[MT7]-RTVLEEIGNRVTTR.4y8_2.heavy 447.761 / 458.77 19174.0 30.66939926147461 45 15 10 10 10 22.320072763882372 4.480272132527131 0.0 3 0.9530594367234547 5.673807197385354 19174.0 24.94378595587439 1.0 - - - - - - - 330.3076923076923 38 13 CCNB2 cyclin B2 2091 269 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533688.[MT7]-RTVLEEIGNRVTTR.4y9_2.heavy 447.761 / 523.291 18809.0 30.66939926147461 45 15 10 10 10 22.320072763882372 4.480272132527131 0.0 3 0.9530594367234547 5.673807197385354 18809.0 44.984748625137485 0.0 - - - - - - - 747.0 37 11 CCNB2 cyclin B2 2093 269 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533688.[MT7]-RTVLEEIGNRVTTR.4y10_2.heavy 447.761 / 587.812 21822.0 30.66939926147461 45 15 10 10 10 22.320072763882372 4.480272132527131 0.0 3 0.9530594367234547 5.673807197385354 21822.0 34.13777115246222 0.0 - - - - - - - 267.0 43 13 CCNB2 cyclin B2 2095 269 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533688.[MT7]-RTVLEEIGNRVTTR.4b5_1.heavy 447.761 / 743.453 6574.0 30.66939926147461 45 15 10 10 10 22.320072763882372 4.480272132527131 0.0 3 0.9530594367234547 5.673807197385354 6574.0 38.748000130625044 0.0 - - - - - - - 223.22222222222223 13 9 CCNB2 cyclin B2 2097 270 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533475.[MT7]-EFLQQQYR.2b3_1.heavy 628.331 / 534.304 2270.0 27.7573504447937 44 18 10 6 10 5.302051228036819 14.723773493067796 0.03940010070800781 3 0.9866597717004373 10.673251784480549 2270.0 10.468212693695607 0.0 - - - - - - - 268.8 4 15 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 2099 270 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533475.[MT7]-EFLQQQYR.2y5_1.heavy 628.331 / 722.358 2859.0 27.7573504447937 44 18 10 6 10 5.302051228036819 14.723773493067796 0.03940010070800781 3 0.9866597717004373 10.673251784480549 2859.0 12.02595238095238 0.0 - - - - - - - 173.25 5 16 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 2101 270 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533475.[MT7]-EFLQQQYR.2y6_1.heavy 628.331 / 835.442 1682.0 27.7573504447937 44 18 10 6 10 5.302051228036819 14.723773493067796 0.03940010070800781 3 0.9866597717004373 10.673251784480549 1682.0 27.933214285714286 0.0 - - - - - - - 154.0 3 12 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 2103 270 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB533475.[MT7]-EFLQQQYR.2y7_1.heavy 628.331 / 982.51 5802.0 27.7573504447937 44 18 10 6 10 5.302051228036819 14.723773493067796 0.03940010070800781 3 0.9866597717004373 10.673251784480549 5802.0 45.58714285714285 0.0 - - - - - - - 148.6153846153846 11 13 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 2105 271 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19013.[MT7]-EYLITLLEHLMK[MT7].3y3_1.heavy 597.682 / 535.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 2107 271 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19013.[MT7]-EYLITLLEHLMK[MT7].3b4_1.heavy 597.682 / 663.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 2109 271 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19013.[MT7]-EYLITLLEHLMK[MT7].3b5_1.heavy 597.682 / 764.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 2111 271 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19013.[MT7]-EYLITLLEHLMK[MT7].3b3_1.heavy 597.682 / 550.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 2113 272 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18919.[MT7]-EVTATAYEIIK[MT7].3y3_1.heavy 509.295 / 517.383 83630.0 33.39080047607422 42 12 10 10 10 0.8331949127604108 68.90461523438753 0.0 3 0.8817014362849548 3.5521824291617143 83630.0 150.84045448183193 0.0 - - - - - - - 729.5714285714286 167 7 LDHAL6B lactate dehydrogenase A-like 6B 2115 272 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18919.[MT7]-EVTATAYEIIK[MT7].3b6_1.heavy 509.295 / 717.39 53570.0 33.39080047607422 42 12 10 10 10 0.8331949127604108 68.90461523438753 0.0 3 0.8817014362849548 3.5521824291617143 53570.0 132.27024198038197 0.0 - - - - - - - 269.8 107 10 LDHAL6B lactate dehydrogenase A-like 6B 2117 272 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18919.[MT7]-EVTATAYEIIK[MT7].3b4_1.heavy 509.295 / 545.305 34011.0 33.39080047607422 42 12 10 10 10 0.8331949127604108 68.90461523438753 0.0 3 0.8817014362849548 3.5521824291617143 34011.0 89.67276645142567 0.0 - - - - - - - 310.44444444444446 68 9 LDHAL6B lactate dehydrogenase A-like 6B 2119 272 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18919.[MT7]-EVTATAYEIIK[MT7].3b8_1.heavy 509.295 / 1009.5 8575.0 33.39080047607422 42 12 10 10 10 0.8331949127604108 68.90461523438753 0.0 3 0.8817014362849548 3.5521824291617143 8575.0 88.81567357512952 0.0 - - - - - - - 269.8 17 5 LDHAL6B lactate dehydrogenase A-like 6B 2121 273 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19010.[MT7]-NVTELNEPLSNEER.2b4_1.heavy 894.448 / 588.311 3416.0 28.074600219726562 45 15 10 10 10 2.040755786313718 38.70780001180465 0.0 3 0.952343308887317 5.63067425907828 3416.0 23.17286549707602 0.0 - - - - - - - 147.36363636363637 6 11 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 2123 273 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19010.[MT7]-NVTELNEPLSNEER.2y9_1.heavy 894.448 / 1087.5 1708.0 28.074600219726562 45 15 10 10 10 2.040755786313718 38.70780001180465 0.0 3 0.952343308887317 5.63067425907828 1708.0 15.981286549707601 0.0 - - - - - - - 147.36363636363637 3 11 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 2125 273 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19010.[MT7]-NVTELNEPLSNEER.2y10_1.heavy 894.448 / 1200.59 769.0 28.074600219726562 45 15 10 10 10 2.040755786313718 38.70780001180465 0.0 3 0.952343308887317 5.63067425907828 769.0 12.641016167870657 0.0 - - - - - - - 0.0 1 0 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 2127 273 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB19010.[MT7]-NVTELNEPLSNEER.2y7_1.heavy 894.448 / 844.416 4441.0 28.074600219726562 45 15 10 10 10 2.040755786313718 38.70780001180465 0.0 3 0.952343308887317 5.63067425907828 4441.0 23.830201480263156 0.0 - - - - - - - 213.5 8 12 YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 2129 274 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41970.[MT7]-DAQAGK[MT7]EPGGSR.3y11_2.heavy 487.595 / 601.324 5388.0 13.65530014038086 37 7 10 10 10 0.4700165440301657 101.33735153595418 0.0 3 0.7416072315683356 2.373521427926684 5388.0 118.68016053511707 0.0 - - - - - - - 132.0 10 13 TP53 tumor protein p53 2131 274 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41970.[MT7]-DAQAGK[MT7]EPGGSR.3b4_1.heavy 487.595 / 530.269 1440.0 13.65530014038086 37 7 10 10 10 0.4700165440301657 101.33735153595418 0.0 3 0.7416072315683356 2.373521427926684 1440.0 10.9974472035275 0.0 - - - - - - - 185.7058823529412 2 17 TP53 tumor protein p53 2133 274 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41970.[MT7]-DAQAGK[MT7]EPGGSR.3y9_2.heavy 487.595 / 501.776 1254.0 13.65530014038086 37 7 10 10 10 0.4700165440301657 101.33735153595418 0.0 3 0.7416072315683356 2.373521427926684 1254.0 39.71762131837307 0.0 - - - - - - - 139.1818181818182 2 11 TP53 tumor protein p53 2135 274 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41970.[MT7]-DAQAGK[MT7]EPGGSR.3b7_2.heavy 487.595 / 494.769 9290.0 13.65530014038086 37 7 10 10 10 0.4700165440301657 101.33735153595418 0.0 3 0.7416072315683356 2.373521427926684 9290.0 136.6873984683221 0.0 - - - - - - - 103.38461538461539 18 13 TP53 tumor protein p53 2137 275 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41791.[MT7]-ARLAEQAER.2y4_1.heavy 594.334 / 503.257 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAG;YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 2139 275 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41791.[MT7]-ARLAEQAER.2y6_1.heavy 594.334 / 703.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAG;YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 2141 275 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41791.[MT7]-ARLAEQAER.2b5_1.heavy 594.334 / 685.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAG;YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 2143 275 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41791.[MT7]-ARLAEQAER.2y7_1.heavy 594.334 / 816.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAG;YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 2145 276 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41975.[MT7]-QVFDLSQGGPK[MT7].2y4_1.heavy 732.408 / 502.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGKZ diacylglycerol kinase, zeta 2147 276 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41975.[MT7]-QVFDLSQGGPK[MT7].2y8_1.heavy 732.408 / 945.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGKZ diacylglycerol kinase, zeta 2149 276 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41975.[MT7]-QVFDLSQGGPK[MT7].2b4_1.heavy 732.408 / 634.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGKZ diacylglycerol kinase, zeta 2151 276 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB41975.[MT7]-QVFDLSQGGPK[MT7].2y6_1.heavy 732.408 / 717.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGKZ diacylglycerol kinase, zeta 2153 277 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18666.[MT7]-VDYDQVK[MT7].2y4_1.heavy 577.818 / 633.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 2155 277 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18666.[MT7]-VDYDQVK[MT7].2y5_1.heavy 577.818 / 796.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 2157 277 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18666.[MT7]-VDYDQVK[MT7].2b4_1.heavy 577.818 / 637.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3 2159 277 B20140221_KEGG1700_set03_05 B20140221_KEGG1700_set03_05 TB18666.[MT7]-VDYDQVK[MT7].2y6_1.heavy 577.818 / 911.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3