Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37201.[MT7]-QQLVVSK[MT7].2b3_1.heavy 545.347 / 514.311 4976.0 23.311850547790527 35 9 10 6 10 1.2116271213365748 48.028810736379285 0.034999847412109375 3 0.816771957883796 2.837921833962403 4976.0 7.278590739009406 0.0 - - - - - - - 715.0714285714286 9 14 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 3 1 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37201.[MT7]-QQLVVSK[MT7].2y4_1.heavy 545.347 / 576.384 3732.0 23.311850547790527 35 9 10 6 10 1.2116271213365748 48.028810736379285 0.034999847412109375 3 0.816771957883796 2.837921833962403 3732.0 22.37453464595147 0.0 - - - - - - - 275.07142857142856 7 14 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 5 1 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37201.[MT7]-QQLVVSK[MT7].2b4_1.heavy 545.347 / 613.379 5805.0 23.311850547790527 35 9 10 6 10 1.2116271213365748 48.028810736379285 0.034999847412109375 3 0.816771957883796 2.837921833962403 5805.0 21.474461225182424 0.0 - - - - - - - 213.25 11 20 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 7 1 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37201.[MT7]-QQLVVSK[MT7].2y6_1.heavy 545.347 / 817.526 7464.0 23.311850547790527 35 9 10 6 10 1.2116271213365748 48.028810736379285 0.034999847412109375 3 0.816771957883796 2.837921833962403 7464.0 31.307370297735783 0.0 - - - - - - - 246.1578947368421 14 19 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 9 2 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23749.[MT7]-VIGRGSYAK[MT7].3y3_1.heavy 413.587 / 525.315 1662.0 20.737699508666992 43 13 10 10 10 2.1809486088203864 45.851607688311 0.0 3 0.9118901072364514 4.126752582211835 1662.0 5.672804532577904 0.0 - - - - - - - 242.6818181818182 3 22 PRKCI;PRKCZ protein kinase C, iota;protein kinase C, zeta 11 2 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23749.[MT7]-VIGRGSYAK[MT7].3y4_1.heavy 413.587 / 612.347 554.0 20.737699508666992 43 13 10 10 10 2.1809486088203864 45.851607688311 0.0 3 0.9118901072364514 4.126752582211835 554.0 3.3753642384105964 2.0 - - - - - - - 0.0 1 0 PRKCI;PRKCZ protein kinase C, iota;protein kinase C, zeta 13 2 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23749.[MT7]-VIGRGSYAK[MT7].3y8_2.heavy 413.587 / 498.291 8110.0 20.737699508666992 43 13 10 10 10 2.1809486088203864 45.851607688311 0.0 3 0.9118901072364514 4.126752582211835 8110.0 32.182539682539684 0.0 - - - - - - - 246.22222222222223 16 18 PRKCI;PRKCZ protein kinase C, iota;protein kinase C, zeta 15 2 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23749.[MT7]-VIGRGSYAK[MT7].3y5_1.heavy 413.587 / 669.369 1864.0 20.737699508666992 43 13 10 10 10 2.1809486088203864 45.851607688311 0.0 3 0.9118901072364514 4.126752582211835 1864.0 24.397915373626915 0.0 - - - - - - - 134.1904761904762 3 21 PRKCI;PRKCZ protein kinase C, iota;protein kinase C, zeta 17 3 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24005.[MT7]-NFPALLSTGEFLK[MT7].3y3_1.heavy 575.666 / 551.367 61667.0 43.43000030517578 46 16 10 10 10 2.3123220825656605 37.07230108663441 0.0 3 0.9650046126812508 6.577823818910436 61667.0 202.48494945019536 0.0 - - - - - - - 279.5833333333333 123 12 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 19 3 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24005.[MT7]-NFPALLSTGEFLK[MT7].3b4_1.heavy 575.666 / 574.311 87433.0 43.43000030517578 46 16 10 10 10 2.3123220825656605 37.07230108663441 0.0 3 0.9650046126812508 6.577823818910436 87433.0 216.10775966228616 0.0 - - - - - - - 283.2142857142857 174 14 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 21 3 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24005.[MT7]-NFPALLSTGEFLK[MT7].3b5_1.heavy 575.666 / 687.395 94638.0 43.43000030517578 46 16 10 10 10 2.3123220825656605 37.07230108663441 0.0 3 0.9650046126812508 6.577823818910436 94638.0 327.405211409078 0.0 - - - - - - - 252.71428571428572 189 14 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 23 3 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24005.[MT7]-NFPALLSTGEFLK[MT7].3y5_1.heavy 575.666 / 737.431 39687.0 43.43000030517578 46 16 10 10 10 2.3123220825656605 37.07230108663441 0.0 3 0.9650046126812508 6.577823818910436 39687.0 159.57191223423294 0.0 - - - - - - - 158.6 79 15 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 25 4 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42731.[MT7]-EYYEALPELK[MT7].3b4_1.heavy 514.948 / 729.321 15766.0 35.454898834228516 44 14 10 10 10 2.8779049317077745 27.459023719686535 0.0 3 0.9399015612088932 5.008773234672591 15766.0 90.11754202898551 0.0 - - - - - - - 287.2 31 15 PYGL phosphorylase, glycogen, liver 27 4 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42731.[MT7]-EYYEALPELK[MT7].3b5_1.heavy 514.948 / 800.358 21710.0 35.454898834228516 44 14 10 10 10 2.8779049317077745 27.459023719686535 0.0 3 0.9399015612088932 5.008773234672591 21710.0 135.2971151991978 0.0 - - - - - - - 239.85714285714286 43 14 PYGL phosphorylase, glycogen, liver 29 4 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42731.[MT7]-EYYEALPELK[MT7].3b3_1.heavy 514.948 / 600.279 8443.0 35.454898834228516 44 14 10 10 10 2.8779049317077745 27.459023719686535 0.0 3 0.9399015612088932 5.008773234672591 8443.0 11.043862229102166 0.0 - - - - - - - 1130.75 16 8 PYGL phosphorylase, glycogen, liver 31 4 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42731.[MT7]-EYYEALPELK[MT7].3y4_1.heavy 514.948 / 630.394 32824.0 35.454898834228516 44 14 10 10 10 2.8779049317077745 27.459023719686535 0.0 3 0.9399015612088932 5.008773234672591 32824.0 135.49403001330663 0.0 - - - - - - - 248.77777777777777 65 9 PYGL phosphorylase, glycogen, liver 33 5 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42778.[MT7]-LNISFPATGC[CAM]QK[MT7].3y7_1.heavy 541.964 / 905.463 3701.0 34.27276738484701 40 15 10 5 10 2.4758074391263314 31.781200556642908 0.043003082275390625 3 0.9597935748579551 6.134069242115616 3701.0 17.204838934686112 0.0 - - - - - - - 190.0 7 9 RPS6 ribosomal protein S6 35 5 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42778.[MT7]-LNISFPATGC[CAM]QK[MT7].3b5_1.heavy 541.964 / 719.421 7213.0 34.27276738484701 40 15 10 5 10 2.4758074391263314 31.781200556642908 0.043003082275390625 3 0.9597935748579551 6.134069242115616 7213.0 25.3673101325495 0.0 - - - - - - - 299.61538461538464 14 13 RPS6 ribosomal protein S6 37 5 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42778.[MT7]-LNISFPATGC[CAM]QK[MT7].3b3_1.heavy 541.964 / 485.32 N/A 34.27276738484701 40 15 10 5 10 2.4758074391263314 31.781200556642908 0.043003082275390625 3 0.9597935748579551 6.134069242115616 7307.0 1.8864648095690304 2.0 - - - - - - - 285.0 15 1 RPS6 ribosomal protein S6 39 5 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42778.[MT7]-LNISFPATGC[CAM]QK[MT7].3y5_1.heavy 541.964 / 737.373 6453.0 34.27276738484701 40 15 10 5 10 2.4758074391263314 31.781200556642908 0.043003082275390625 3 0.9597935748579551 6.134069242115616 6453.0 42.79357894736842 0.0 - - - - - - - 292.9166666666667 12 12 RPS6 ribosomal protein S6 41 6 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542542.[MT7]-LVTIEC[CAM]GR.2y4_1.heavy 546.304 / 521.214 7043.0 28.684324741363525 46 20 10 6 10 6.987336077195281 14.311605867416645 0.030099868774414062 3 0.9965269164287379 20.93528983225014 7043.0 7.093241937068411 0.0 - - - - - - - 750.8888888888889 14 9 PRKCI protein kinase C, iota 43 6 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542542.[MT7]-LVTIEC[CAM]GR.2y5_1.heavy 546.304 / 634.298 5834.0 28.684324741363525 46 20 10 6 10 6.987336077195281 14.311605867416645 0.030099868774414062 3 0.9965269164287379 20.93528983225014 5834.0 12.487605228471 1.0 - - - - - - - 750.2727272727273 26 11 PRKCI protein kinase C, iota 45 6 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542542.[MT7]-LVTIEC[CAM]GR.2y6_1.heavy 546.304 / 735.345 17359.0 28.684324741363525 46 20 10 6 10 6.987336077195281 14.311605867416645 0.030099868774414062 3 0.9965269164287379 20.93528983225014 17359.0 33.26146694055917 0.0 - - - - - - - 782.6 34 10 PRKCI protein kinase C, iota 47 6 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542542.[MT7]-LVTIEC[CAM]GR.2y7_1.heavy 546.304 / 834.414 21912.0 28.684324741363525 46 20 10 6 10 6.987336077195281 14.311605867416645 0.030099868774414062 3 0.9965269164287379 20.93528983225014 21912.0 73.57454332552693 0.0 - - - - - - - 711.4 43 10 PRKCI protein kinase C, iota 49 7 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24003.[MT7]-SAWGSATREEGFDR.2b8_1.heavy 856.909 / 961.497 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDIT4 DNA-damage-inducible transcript 4 51 7 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24003.[MT7]-SAWGSATREEGFDR.2y5_1.heavy 856.909 / 623.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDIT4 DNA-damage-inducible transcript 4 53 7 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24003.[MT7]-SAWGSATREEGFDR.2b4_1.heavy 856.909 / 546.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDIT4 DNA-damage-inducible transcript 4 55 7 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24003.[MT7]-SAWGSATREEGFDR.2b6_1.heavy 856.909 / 704.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDIT4 DNA-damage-inducible transcript 4 57 8 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37661.[MT7]-LVSPAPGPGPQPHLVITEQPK[MT7].3b9_1.heavy 817.472 / 920.532 N/A N/A - - - - - - - - - 0.0 - - - - - - - RELB v-rel reticuloendotheliosis viral oncogene homolog B 59 8 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37661.[MT7]-LVSPAPGPGPQPHLVITEQPK[MT7].3y6_1.heavy 817.472 / 859.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - RELB v-rel reticuloendotheliosis viral oncogene homolog B 61 8 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37661.[MT7]-LVSPAPGPGPQPHLVITEQPK[MT7].3b5_1.heavy 817.472 / 612.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - RELB v-rel reticuloendotheliosis viral oncogene homolog B 63 8 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37661.[MT7]-LVSPAPGPGPQPHLVITEQPK[MT7].3y5_1.heavy 817.472 / 746.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - RELB v-rel reticuloendotheliosis viral oncogene homolog B 65 9 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24002.[MT7]-SAGSILGESSTEASK[MT7].3b6_1.heavy 571.303 / 673.4 37237.0 26.83562469482422 43 17 10 6 10 4.27706289893547 23.38053060311301 0.0363006591796875 3 0.9785724124028855 8.415834286855636 37237.0 82.24566631754168 0.0 - - - - - - - 715.4285714285714 74 7 RELB v-rel reticuloendotheliosis viral oncogene homolog B 67 9 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24002.[MT7]-SAGSILGESSTEASK[MT7].3b5_1.heavy 571.303 / 560.316 54004.0 26.83562469482422 43 17 10 6 10 4.27706289893547 23.38053060311301 0.0363006591796875 3 0.9785724124028855 8.415834286855636 54004.0 71.18454471893514 0.0 - - - - - - - 351.0 108 6 RELB v-rel reticuloendotheliosis viral oncogene homolog B 69 9 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24002.[MT7]-SAGSILGESSTEASK[MT7].3y4_1.heavy 571.303 / 578.327 28454.0 26.83562469482422 43 17 10 6 10 4.27706289893547 23.38053060311301 0.0363006591796875 3 0.9785724124028855 8.415834286855636 28454.0 59.93096029269926 0.0 - - - - - - - 303.72727272727275 56 11 RELB v-rel reticuloendotheliosis viral oncogene homolog B 71 9 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24002.[MT7]-SAGSILGESSTEASK[MT7].3b7_1.heavy 571.303 / 730.422 24825.0 26.83562469482422 43 17 10 6 10 4.27706289893547 23.38053060311301 0.0363006591796875 3 0.9785724124028855 8.415834286855636 24825.0 25.465731489693955 0.0 - - - - - - - 1203.142857142857 49 7 RELB v-rel reticuloendotheliosis viral oncogene homolog B 73 10 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24010.[MT7]-ATLGSQTSAWSILK[MT7].3y3_1.heavy 584.336 / 517.383 21920.0 38.1952018737793 47 17 10 10 10 21.52347593200754 4.64608970762432 0.0 3 0.9773283844487546 8.180826656055945 21920.0 32.052830188679245 0.0 - - - - - - - 1282.4285714285713 43 7 IL20RB interleukin 20 receptor beta 75 10 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24010.[MT7]-ATLGSQTSAWSILK[MT7].3b6_1.heavy 584.336 / 702.39 10698.0 38.1952018737793 47 17 10 10 10 21.52347593200754 4.64608970762432 0.0 3 0.9773283844487546 8.180826656055945 10698.0 68.70510063335679 0.0 - - - - - - - 707.9230769230769 21 13 IL20RB interleukin 20 receptor beta 77 10 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24010.[MT7]-ATLGSQTSAWSILK[MT7].3y4_1.heavy 584.336 / 604.415 47357.0 38.1952018737793 47 17 10 10 10 21.52347593200754 4.64608970762432 0.0 3 0.9773283844487546 8.180826656055945 47357.0 57.21148480604363 0.0 - - - - - - - 718.2 94 10 IL20RB interleukin 20 receptor beta 79 10 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24010.[MT7]-ATLGSQTSAWSILK[MT7].3y5_1.heavy 584.336 / 790.494 20050.0 38.1952018737793 47 17 10 10 10 21.52347593200754 4.64608970762432 0.0 3 0.9773283844487546 8.180826656055945 20050.0 77.25278396436526 0.0 - - - - - - - 293.85714285714283 40 14 IL20RB interleukin 20 receptor beta 81 11 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544043.[MT7]-IQLGIDPYNAGSLK[MT7].3b6_1.heavy 593.008 / 784.469 38941.0 36.894500732421875 45 15 10 10 10 1.5600341758951999 50.86264326995021 0.0 3 0.9524330181892384 5.636024247768608 38941.0 40.821407306234974 0.0 - - - - - - - 750.5714285714286 77 7 RELB v-rel reticuloendotheliosis viral oncogene homolog B 83 11 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544043.[MT7]-IQLGIDPYNAGSLK[MT7].3b4_1.heavy 593.008 / 556.357 17620.0 36.894500732421875 45 15 10 10 10 1.5600341758951999 50.86264326995021 0.0 3 0.9524330181892384 5.636024247768608 17620.0 21.442991045072088 0.0 - - - - - - - 1163.142857142857 35 7 RELB v-rel reticuloendotheliosis viral oncogene homolog B 85 11 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544043.[MT7]-IQLGIDPYNAGSLK[MT7].3y4_1.heavy 593.008 / 548.352 32944.0 36.894500732421875 45 15 10 10 10 1.5600341758951999 50.86264326995021 0.0 3 0.9524330181892384 5.636024247768608 32944.0 42.31031800631801 0.0 - - - - - - - 1237.5714285714287 65 7 RELB v-rel reticuloendotheliosis viral oncogene homolog B 87 11 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544043.[MT7]-IQLGIDPYNAGSLK[MT7].3y5_1.heavy 593.008 / 619.39 14658.0 36.894500732421875 45 15 10 10 10 1.5600341758951999 50.86264326995021 0.0 3 0.9524330181892384 5.636024247768608 14658.0 68.3641162709671 0.0 - - - - - - - 266.4 29 15 RELB v-rel reticuloendotheliosis viral oncogene homolog B 89 12 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42341.[MT7]-AASVLK[MT7].2y4_1.heavy 438.791 / 590.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - DNTT;POLM;PRKCI deoxynucleotidyltransferase, terminal;polymerase (DNA directed), mu;protein kinase C, iota 91 12 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42341.[MT7]-AASVLK[MT7].2y5_1.heavy 438.791 / 661.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - DNTT;POLM;PRKCI deoxynucleotidyltransferase, terminal;polymerase (DNA directed), mu;protein kinase C, iota 93 12 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42341.[MT7]-AASVLK[MT7].2y3_1.heavy 438.791 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - DNTT;POLM;PRKCI deoxynucleotidyltransferase, terminal;polymerase (DNA directed), mu;protein kinase C, iota 95 12 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42341.[MT7]-AASVLK[MT7].2b5_1.heavy 438.791 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - DNTT;POLM;PRKCI deoxynucleotidyltransferase, terminal;polymerase (DNA directed), mu;protein kinase C, iota 97 13 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23885.[MT7]-HC[CAM]TELELFK[MT7].3y3_1.heavy 488.93 / 551.367 14053.0 32.48429870605469 47 17 10 10 10 4.166027663515793 24.00368122270413 0.0 3 0.9749348105714428 7.778852509437513 14053.0 27.741578488244173 0.0 - - - - - - - 859.75 28 8 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 99 13 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23885.[MT7]-HC[CAM]TELELFK[MT7].3b4_1.heavy 488.93 / 672.289 14053.0 32.48429870605469 47 17 10 10 10 4.166027663515793 24.00368122270413 0.0 3 0.9749348105714428 7.778852509437513 14053.0 19.299223990208077 0.0 - - - - - - - 265.2 28 10 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 101 13 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23885.[MT7]-HC[CAM]TELELFK[MT7].3b5_1.heavy 488.93 / 785.373 4619.0 32.48429870605469 47 17 10 10 10 4.166027663515793 24.00368122270413 0.0 3 0.9749348105714428 7.778852509437513 4619.0 34.025159711189474 0.0 - - - - - - - 211.6153846153846 9 13 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 103 13 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23885.[MT7]-HC[CAM]TELELFK[MT7].3y4_1.heavy 488.93 / 680.41 5307.0 32.48429870605469 47 17 10 10 10 4.166027663515793 24.00368122270413 0.0 3 0.9749348105714428 7.778852509437513 5307.0 16.377612110234182 0.0 - - - - - - - 264.61538461538464 10 13 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 105 14 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541811.[MT7]-SAWGSATR.2b4_1.heavy 490.258 / 546.279 1109.0 22.122249603271484 42 20 10 6 6 5.524123787988611 18.10241838125264 0.03179931640625 5 0.9936253014017948 15.449042352032219 1109.0 2.3839360085700854 2.0 - - - - - - - 674.375 6 8 DDIT4 DNA-damage-inducible transcript 4 107 14 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541811.[MT7]-SAWGSATR.2b6_1.heavy 490.258 / 704.348 1109.0 22.122249603271484 42 20 10 6 6 5.524123787988611 18.10241838125264 0.03179931640625 5 0.9936253014017948 15.449042352032219 1109.0 13.13331220374162 3.0 - - - - - - - 210.125 2 24 DDIT4 DNA-damage-inducible transcript 4 109 14 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541811.[MT7]-SAWGSATR.2y6_1.heavy 490.258 / 677.337 3933.0 22.122249603271484 42 20 10 6 6 5.524123787988611 18.10241838125264 0.03179931640625 5 0.9936253014017948 15.449042352032219 3933.0 20.352230224321133 1.0 - - - - - - - 225.71428571428572 8 21 DDIT4 DNA-damage-inducible transcript 4 111 14 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541811.[MT7]-SAWGSATR.2y7_1.heavy 490.258 / 748.374 6051.0 22.122249603271484 42 20 10 6 6 5.524123787988611 18.10241838125264 0.03179931640625 5 0.9936253014017948 15.449042352032219 6051.0 24.375869513671365 0.0 - - - - - - - 254.57142857142858 12 21 DDIT4 DNA-damage-inducible transcript 4 113 15 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542546.[MT7]-DLSQLTK[MT7].2y5_1.heavy 546.829 / 720.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 115 15 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542546.[MT7]-DLSQLTK[MT7].2b4_1.heavy 546.829 / 588.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 117 15 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542546.[MT7]-DLSQLTK[MT7].2y3_1.heavy 546.829 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 119 15 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542546.[MT7]-DLSQLTK[MT7].2y6_1.heavy 546.829 / 833.521 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 121 16 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544045.[MT7]-SAAGELATVEC[CAM]YNPR.3b6_1.heavy 594.625 / 673.364 17460.0 31.425899505615234 47 17 10 10 10 3.8436875785341824 26.016682666528194 0.0 3 0.9753722116988913 7.847915217105201 17460.0 54.81859517601043 0.0 - - - - - - - 248.0 34 12 KLHL9 kelch-like 9 (Drosophila) 123 16 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544045.[MT7]-SAAGELATVEC[CAM]YNPR.3y6_1.heavy 594.625 / 838.351 26381.0 31.425899505615234 47 17 10 10 10 3.8436875785341824 26.016682666528194 0.0 3 0.9753722116988913 7.847915217105201 26381.0 154.576171875 0.0 - - - - - - - 216.0 52 12 KLHL9 kelch-like 9 (Drosophila) 125 16 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544045.[MT7]-SAAGELATVEC[CAM]YNPR.3b5_1.heavy 594.625 / 560.28 32617.0 31.425899505615234 47 17 10 10 10 3.8436875785341824 26.016682666528194 0.0 3 0.9753722116988913 7.847915217105201 32617.0 51.83793432830751 0.0 - - - - - - - 753.7142857142857 65 7 KLHL9 kelch-like 9 (Drosophila) 127 16 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544045.[MT7]-SAAGELATVEC[CAM]YNPR.3y5_1.heavy 594.625 / 709.309 15445.0 31.425899505615234 47 17 10 10 10 3.8436875785341824 26.016682666528194 0.0 3 0.9753722116988913 7.847915217105201 15445.0 58.033668154761905 0.0 - - - - - - - 219.42857142857142 30 14 KLHL9 kelch-like 9 (Drosophila) 129 17 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543977.[MT7]-IANTYNLIEVDK[MT7].3y3_1.heavy 560.985 / 505.31 45899.0 34.9370002746582 44 14 10 10 10 2.1008258606783174 37.99863618195866 0.0 3 0.9428423990922142 5.137297858476601 45899.0 50.94564788125176 0.0 - - - - - - - 761.125 91 8 KLHL9 kelch-like 9 (Drosophila) 131 17 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543977.[MT7]-IANTYNLIEVDK[MT7].3b6_1.heavy 560.985 / 821.427 50395.0 34.9370002746582 44 14 10 10 10 2.1008258606783174 37.99863618195866 0.0 3 0.9428423990922142 5.137297858476601 50395.0 145.9611280487805 0.0 - - - - - - - 281.07142857142856 100 14 KLHL9 kelch-like 9 (Drosophila) 133 17 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543977.[MT7]-IANTYNLIEVDK[MT7].3b4_1.heavy 560.985 / 544.321 34002.0 34.9370002746582 44 14 10 10 10 2.1008258606783174 37.99863618195866 0.0 3 0.9428423990922142 5.137297858476601 34002.0 22.98132021132186 0.0 - - - - - - - 812.0 68 9 KLHL9 kelch-like 9 (Drosophila) 135 17 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543977.[MT7]-IANTYNLIEVDK[MT7].3y4_1.heavy 560.985 / 634.353 92921.0 34.9370002746582 44 14 10 10 10 2.1008258606783174 37.99863618195866 0.0 3 0.9428423990922142 5.137297858476601 92921.0 151.67176275207592 0.0 - - - - - - - 737.75 185 8 KLHL9 kelch-like 9 (Drosophila) 137 18 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42485.[MT7]-SQC[CAM]PPIK[MT7].2y4_1.heavy 559.318 / 598.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA6 ubiquitin-like modifier activating enzyme 6 139 18 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42485.[MT7]-SQC[CAM]PPIK[MT7].2y5_1.heavy 559.318 / 758.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA6 ubiquitin-like modifier activating enzyme 6 141 18 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42485.[MT7]-SQC[CAM]PPIK[MT7].2b6_1.heavy 559.318 / 827.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA6 ubiquitin-like modifier activating enzyme 6 143 18 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42485.[MT7]-SQC[CAM]PPIK[MT7].2y3_1.heavy 559.318 / 501.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA6 ubiquitin-like modifier activating enzyme 6 145 19 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23887.[MT7]-LAFVLSSNSLK[MT7].3y6_1.heavy 489.632 / 779.438 14894.0 38.98849868774414 50 20 10 10 10 14.410742882002289 6.939267518601761 0.0 3 0.9989562102643872 38.196016794377265 14894.0 30.674878265938535 0.0 - - - - - - - 195.15384615384616 29 13 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 147 19 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23887.[MT7]-LAFVLSSNSLK[MT7].3y3_1.heavy 489.632 / 491.331 55352.0 38.98849868774414 50 20 10 10 10 14.410742882002289 6.939267518601761 0.0 3 0.9989562102643872 38.196016794377265 55352.0 32.84426071728282 0.0 - - - - - - - 345.5 110 2 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 149 19 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23887.[MT7]-LAFVLSSNSLK[MT7].3b4_1.heavy 489.632 / 575.367 113084.0 38.98849868774414 50 20 10 10 10 14.410742882002289 6.939267518601761 0.0 3 0.9989562102643872 38.196016794377265 113084.0 35.65472728374113 0.0 - - - - - - - 333.0 226 3 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 151 19 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23887.[MT7]-LAFVLSSNSLK[MT7].3b5_1.heavy 489.632 / 688.451 25027.0 38.98849868774414 50 20 10 10 10 14.410742882002289 6.939267518601761 0.0 3 0.9989562102643872 38.196016794377265 25027.0 24.688787026633058 0.0 - - - - - - - 701.8571428571429 50 7 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 153 20 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543974.[MT7]-YDPTIEDSYRK[MT7].3y6_1.heavy 558.957 / 941.481 N/A N/A - - - - - - - - - 0.0 - - - - - - - RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 155 20 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543974.[MT7]-YDPTIEDSYRK[MT7].3y4_1.heavy 558.957 / 697.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 157 20 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543974.[MT7]-YDPTIEDSYRK[MT7].3y8_1.heavy 558.957 / 1155.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 159 20 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543974.[MT7]-YDPTIEDSYRK[MT7].3y9_2.heavy 558.957 / 626.836 N/A N/A - - - - - - - - - 0.0 - - - - - - - RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 161 21 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24095.[MT7]-SASASSASSIASASTFFGGSR.3y6_1.heavy 694.007 / 670.331 4171.0 35.64490032196045 43 17 10 6 10 3.0288445997391653 26.393554192059053 0.034801483154296875 3 0.97134217670329 7.272740901358399 4171.0 12.242876648847254 0.0 - - - - - - - 723.5 8 8 PTGER1 prostaglandin E receptor 1 (subtype EP1), 42kDa 163 21 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24095.[MT7]-SASASSASSIASASTFFGGSR.3y11_1.heavy 694.007 / 1087.52 2639.0 35.64490032196045 43 17 10 6 10 3.0288445997391653 26.393554192059053 0.034801483154296875 3 0.97134217670329 7.272740901358399 2639.0 0.0 1.0 - - - - - - - 200.1764705882353 5 17 PTGER1 prostaglandin E receptor 1 (subtype EP1), 42kDa 165 21 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24095.[MT7]-SASASSASSIASASTFFGGSR.3y8_1.heavy 694.007 / 858.41 5959.0 35.64490032196045 43 17 10 6 10 3.0288445997391653 26.393554192059053 0.034801483154296875 3 0.97134217670329 7.272740901358399 5959.0 24.772313462297674 0.0 - - - - - - - 224.71428571428572 11 14 PTGER1 prostaglandin E receptor 1 (subtype EP1), 42kDa 167 21 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24095.[MT7]-SASASSASSIASASTFFGGSR.3y10_1.heavy 694.007 / 1016.48 4426.0 35.64490032196045 43 17 10 6 10 3.0288445997391653 26.393554192059053 0.034801483154296875 3 0.97134217670329 7.272740901358399 4426.0 19.24900524716929 0.0 - - - - - - - 241.08333333333334 8 12 PTGER1 prostaglandin E receptor 1 (subtype EP1), 42kDa 169 22 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37146.[MT7]-TDDLGSLR.2y5_1.heavy 510.776 / 545.341 7701.0 26.003300348917644 38 18 8 6 6 2.366967554867427 32.09814233833298 0.03660011291503906 5 0.9865383100175488 10.624883474334224 7701.0 19.014814814814816 1.0 - - - - - - - 669.6 19 10 RASA2 RAS p21 protein activator 2 171 22 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37146.[MT7]-TDDLGSLR.2y6_1.heavy 510.776 / 660.367 3167.0 26.003300348917644 38 18 8 6 6 2.366967554867427 32.09814233833298 0.03660011291503906 5 0.9865383100175488 10.624883474334224 3167.0 12.865937500000001 1.0 - - - - - - - 624.0 6 9 RASA2 RAS p21 protein activator 2 173 22 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37146.[MT7]-TDDLGSLR.2b5_1.heavy 510.776 / 646.316 N/A 26.003300348917644 38 18 8 6 6 2.366967554867427 32.09814233833298 0.03660011291503906 5 0.9865383100175488 10.624883474334224 1511.0 2.570798611111111 2.0 - - - - - - - 288.0 3 18 RASA2 RAS p21 protein activator 2 175 22 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37146.[MT7]-TDDLGSLR.2y7_1.heavy 510.776 / 775.394 2231.0 26.003300348917644 38 18 8 6 6 2.366967554867427 32.09814233833298 0.03660011291503906 5 0.9865383100175488 10.624883474334224 2231.0 9.929640151515152 2.0 - - - - - - - 740.5714285714286 6 7 RASA2 RAS p21 protein activator 2 177 23 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544287.[MT7]-NFEVEADDLVTISELGR.3y7_1.heavy 684.352 / 775.431 18015.0 43.88779830932617 42 12 10 10 10 1.9828425895996442 40.137449942047176 0.0 3 0.8954736570088344 3.7834839988266427 18015.0 175.13302128327967 0.0 - - - - - - - 178.13333333333333 36 15 MAP2K3 mitogen-activated protein kinase kinase 3 179 23 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544287.[MT7]-NFEVEADDLVTISELGR.3b3_1.heavy 684.352 / 535.263 5708.0 43.88779830932617 42 12 10 10 10 1.9828425895996442 40.137449942047176 0.0 3 0.8954736570088344 3.7834839988266427 5708.0 47.03774439068557 0.0 - - - - - - - 174.7058823529412 11 17 MAP2K3 mitogen-activated protein kinase kinase 3 181 23 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544287.[MT7]-NFEVEADDLVTISELGR.3b8_1.heavy 684.352 / 1064.47 9632.0 43.88779830932617 42 12 10 10 10 1.9828425895996442 40.137449942047176 0.0 3 0.8954736570088344 3.7834839988266427 9632.0 93.08235294117647 0.0 - - - - - - - 129.45454545454547 19 11 MAP2K3 mitogen-activated protein kinase kinase 3 183 23 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544287.[MT7]-NFEVEADDLVTISELGR.3y5_1.heavy 684.352 / 561.299 15101.0 43.88779830932617 42 12 10 10 10 1.9828425895996442 40.137449942047176 0.0 3 0.8954736570088344 3.7834839988266427 15101.0 137.75738133785623 0.0 - - - - - - - 231.22222222222223 30 18 MAP2K3 mitogen-activated protein kinase kinase 3 185 24 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23499.[MT7]-TVTIK[MT7].2b3_1.heavy 425.286 / 446.273 N/A 22.335899353027344 35 13 2 10 10 2.8259913816337314 23.590541393698825 0.0 3 0.9164288125679668 4.238987184204871 1699.0 0.0 3.0 - - - - - - - 694.4444444444445 4 9 ALDH1B1;ALDH1A3;POLK aldehyde dehydrogenase 1 family, member B1;aldehyde dehydrogenase 1 family, member A3;polymerase (DNA directed) kappa 187 24 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23499.[MT7]-TVTIK[MT7].2y4_1.heavy 425.286 / 604.415 6578.0 22.335899353027344 35 13 2 10 10 2.8259913816337314 23.590541393698825 0.0 3 0.9164288125679668 4.238987184204871 6578.0 36.89194569609098 0.0 - - - - - - - 282.7368421052632 13 19 ALDH1B1;ALDH1A3;POLK aldehyde dehydrogenase 1 family, member B1;aldehyde dehydrogenase 1 family, member A3;polymerase (DNA directed) kappa 189 24 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23499.[MT7]-TVTIK[MT7].2y3_1.heavy 425.286 / 505.347 4824.0 22.335899353027344 35 13 2 10 10 2.8259913816337314 23.590541393698825 0.0 3 0.9164288125679668 4.238987184204871 4824.0 10.62682160453658 1.0 - - - - - - - 662.1538461538462 38 13 ALDH1B1;ALDH1A3;POLK aldehyde dehydrogenase 1 family, member B1;aldehyde dehydrogenase 1 family, member A3;polymerase (DNA directed) kappa 191 25 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24019.[MT7]-LVPFATAVAELDLK[MT7].2y4_1.heavy 888.031 / 632.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASA2 RAS p21 protein activator 2 193 25 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24019.[MT7]-LVPFATAVAELDLK[MT7].2y3_1.heavy 888.031 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASA2 RAS p21 protein activator 2 195 25 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24019.[MT7]-LVPFATAVAELDLK[MT7].2y6_1.heavy 888.031 / 832.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASA2 RAS p21 protein activator 2 197 25 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24019.[MT7]-LVPFATAVAELDLK[MT7].2y7_1.heavy 888.031 / 931.558 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASA2 RAS p21 protein activator 2 199 26 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24015.[MT7]-DFNVGDYIQAVLDR.3y6_1.heavy 590.304 / 701.394 12169.0 48.58720016479492 41 11 10 10 10 1.0321952405926902 67.31413376833366 0.0 3 0.8799070268065424 3.5249931018508707 12169.0 106.66555482456141 0.0 - - - - - - - 172.91666666666666 24 12 PYGL phosphorylase, glycogen, liver 201 26 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24015.[MT7]-DFNVGDYIQAVLDR.3b6_1.heavy 590.304 / 792.364 9178.0 48.58720016479492 41 11 10 10 10 1.0321952405926902 67.31413376833366 0.0 3 0.8799070268065424 3.5249931018508707 9178.0 212.56648700859654 0.0 - - - - - - - 106.6 18 10 PYGL phosphorylase, glycogen, liver 203 26 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24015.[MT7]-DFNVGDYIQAVLDR.3b3_1.heavy 590.304 / 521.248 8113.0 48.58720016479492 41 11 10 10 10 1.0321952405926902 67.31413376833366 0.0 3 0.8799070268065424 3.5249931018508707 8113.0 83.74945597139381 0.0 - - - - - - - 163.76923076923077 16 13 PYGL phosphorylase, glycogen, liver 205 26 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24015.[MT7]-DFNVGDYIQAVLDR.3y5_1.heavy 590.304 / 573.336 14755.0 48.58720016479492 41 11 10 10 10 1.0321952405926902 67.31413376833366 0.0 3 0.8799070268065424 3.5249931018508707 14755.0 29.942610508101307 0.0 - - - - - - - 223.91666666666666 29 12 PYGL phosphorylase, glycogen, liver 207 27 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB540568.[MT7]-LPFER.2b3_1.heavy 403.238 / 502.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 209 27 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB540568.[MT7]-LPFER.2y4_1.heavy 403.238 / 548.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 211 27 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB540568.[MT7]-LPFER.2b4_1.heavy 403.238 / 631.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 213 27 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB540568.[MT7]-LPFER.2y3_1.heavy 403.238 / 451.23 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 215 28 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543800.[MT7]-FVAPDAFHFTPR.3b6_1.heavy 516.941 / 745.4 16485.0 36.170050621032715 44 18 10 6 10 5.048352830889997 19.80844115888995 0.034999847412109375 3 0.9851458736619216 10.11345984123336 16485.0 48.293254862292514 0.0 - - - - - - - 332.70588235294116 32 17 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 217 28 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543800.[MT7]-FVAPDAFHFTPR.3b5_1.heavy 516.941 / 674.363 21820.0 36.170050621032715 44 18 10 6 10 5.048352830889997 19.80844115888995 0.034999847412109375 3 0.9851458736619216 10.11345984123336 21820.0 39.826626858140074 0.0 - - - - - - - 739.4285714285714 43 7 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 219 28 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543800.[MT7]-FVAPDAFHFTPR.3y4_1.heavy 516.941 / 520.288 58453.0 36.170050621032715 44 18 10 6 10 5.048352830889997 19.80844115888995 0.034999847412109375 3 0.9851458736619216 10.11345984123336 58453.0 80.378579758163 0.0 - - - - - - - 844.3 116 10 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 221 28 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543800.[MT7]-FVAPDAFHFTPR.3y5_1.heavy 516.941 / 657.347 24369.0 36.170050621032715 44 18 10 6 10 5.048352830889997 19.80844115888995 0.034999847412109375 3 0.9851458736619216 10.11345984123336 24369.0 43.32739931541767 0.0 - - - - - - - 731.0909090909091 48 11 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 223 29 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24020.[MT7]-LVPFATAVAELDLK[MT7].3y3_1.heavy 592.357 / 519.326 10717.0 47.428850173950195 35 11 10 6 8 2.087030500600153 40.83665299206182 0.035900115966796875 4 0.875685046164425 3.4633419455740433 10717.0 78.69626168224299 0.0 - - - - - - - 168.95 21 20 RASA2 RAS p21 protein activator 2 225 29 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24020.[MT7]-LVPFATAVAELDLK[MT7].3b4_1.heavy 592.357 / 601.383 3376.0 47.428850173950195 35 11 10 6 8 2.087030500600153 40.83665299206182 0.035900115966796875 4 0.875685046164425 3.4633419455740433 3376.0 12.69140855721393 0.0 - - - - - - - 217.47058823529412 6 17 RASA2 RAS p21 protein activator 2 227 29 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24020.[MT7]-LVPFATAVAELDLK[MT7].3b5_1.heavy 592.357 / 672.42 3912.0 47.428850173950195 35 11 10 6 8 2.087030500600153 40.83665299206182 0.035900115966796875 4 0.875685046164425 3.4633419455740433 3912.0 47.7963565350816 1.0 - - - - - - - 163.83333333333334 9 18 RASA2 RAS p21 protein activator 2 229 29 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24020.[MT7]-LVPFATAVAELDLK[MT7].3y4_1.heavy 592.357 / 632.41 5948.0 47.428850173950195 35 11 10 6 8 2.087030500600153 40.83665299206182 0.035900115966796875 4 0.875685046164425 3.4633419455740433 5948.0 56.96296743484066 0.0 - - - - - - - 123.11764705882354 11 17 RASA2 RAS p21 protein activator 2 231 30 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24021.[MT7]-IQLGIDPYNAGSLK[MT7].2y4_1.heavy 889.009 / 548.352 667.0 36.894500732421875 43 13 10 10 10 2.328963386978786 42.93755778175782 0.0 3 0.9292379087116645 4.611765198228813 667.0 4.098144144144144 3.0 - - - - - - - 0.0 1 0 RELB v-rel reticuloendotheliosis viral oncogene homolog B 233 30 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24021.[MT7]-IQLGIDPYNAGSLK[MT7].2y8_1.heavy 889.009 / 993.549 8146.0 36.894500732421875 43 13 10 10 10 2.328963386978786 42.93755778175782 0.0 3 0.9292379087116645 4.611765198228813 8146.0 41.81892621366306 0.0 - - - - - - - 202.52631578947367 16 19 RELB v-rel reticuloendotheliosis viral oncogene homolog B 235 30 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24021.[MT7]-IQLGIDPYNAGSLK[MT7].2b4_1.heavy 889.009 / 556.357 2962.0 36.894500732421875 43 13 10 10 10 2.328963386978786 42.93755778175782 0.0 3 0.9292379087116645 4.611765198228813 2962.0 17.345045045045044 0.0 - - - - - - - 222.0 5 20 RELB v-rel reticuloendotheliosis viral oncogene homolog B 237 30 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24021.[MT7]-IQLGIDPYNAGSLK[MT7].2b6_1.heavy 889.009 / 784.469 5851.0 36.894500732421875 43 13 10 10 10 2.328963386978786 42.93755778175782 0.0 3 0.9292379087116645 4.611765198228813 5851.0 14.48781791536664 0.0 - - - - - - - 259.0 11 16 RELB v-rel reticuloendotheliosis viral oncogene homolog B 239 31 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23874.[MT7]-IRNLPWVEK[MT7].3y3_1.heavy 481.629 / 519.326 70572.0 33.18899917602539 43 13 10 10 10 2.9999330038464924 33.33407775166336 0.0 3 0.9251364612681744 4.482082218502937 70572.0 112.6786679878155 0.0 - - - - - - - 704.6 141 10 RFC5 replication factor C (activator 1) 5, 36.5kDa 241 31 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23874.[MT7]-IRNLPWVEK[MT7].3b4_1.heavy 481.629 / 641.422 27484.0 33.18899917602539 43 13 10 10 10 2.9999330038464924 33.33407775166336 0.0 3 0.9251364612681744 4.482082218502937 27484.0 140.11650814251723 0.0 - - - - - - - 591.125 54 8 RFC5 replication factor C (activator 1) 5, 36.5kDa 243 31 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23874.[MT7]-IRNLPWVEK[MT7].3y4_1.heavy 481.629 / 705.405 27484.0 33.18899917602539 43 13 10 10 10 2.9999330038464924 33.33407775166336 0.0 3 0.9251364612681744 4.482082218502937 27484.0 78.79808468338904 0.0 - - - - - - - 276.875 54 8 RFC5 replication factor C (activator 1) 5, 36.5kDa 245 31 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23874.[MT7]-IRNLPWVEK[MT7].3b3_1.heavy 481.629 / 528.337 8859.0 33.18899917602539 43 13 10 10 10 2.9999330038464924 33.33407775166336 0.0 3 0.9251364612681744 4.482082218502937 8859.0 20.802016744254967 0.0 - - - - - - - 578.625 17 8 RFC5 replication factor C (activator 1) 5, 36.5kDa 247 32 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544428.[MT7]-LFC[CAM]DFGDEFEVLDTTGEEPK[MT7].3b4_1.heavy 879.415 / 680.319 2548.0 45.5921516418457 43 17 10 6 10 3.626072751429822 27.57804568608512 0.0326995849609375 3 0.9761485703767787 7.9751369676263035 2548.0 6.049773865765607 0.0 - - - - - - - 194.5909090909091 5 22 UBA6 ubiquitin-like modifier activating enzyme 6 249 32 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544428.[MT7]-LFC[CAM]DFGDEFEVLDTTGEEPK[MT7].3b5_1.heavy 879.415 / 827.388 1464.0 45.5921516418457 43 17 10 6 10 3.626072751429822 27.57804568608512 0.0326995849609375 3 0.9761485703767787 7.9751369676263035 1464.0 22.13935042735043 0.0 - - - - - - - 193.94736842105263 2 19 UBA6 ubiquitin-like modifier activating enzyme 6 251 32 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544428.[MT7]-LFC[CAM]DFGDEFEVLDTTGEEPK[MT7].3b8_1.heavy 879.415 / 1128.48 4337.0 45.5921516418457 43 17 10 6 10 3.626072751429822 27.57804568608512 0.0326995849609375 3 0.9761485703767787 7.9751369676263035 4337.0 34.704215176274346 0.0 - - - - - - - 170.38095238095238 8 21 UBA6 ubiquitin-like modifier activating enzyme 6 253 32 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544428.[MT7]-LFC[CAM]DFGDEFEVLDTTGEEPK[MT7].3b7_1.heavy 879.415 / 999.436 1843.0 45.5921516418457 43 17 10 6 10 3.626072751429822 27.57804568608512 0.0326995849609375 3 0.9761485703767787 7.9751369676263035 1843.0 6.517464728819567 0.0 - - - - - - - 136.56521739130434 3 23 UBA6 ubiquitin-like modifier activating enzyme 6 255 33 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1539610.0 29.912099838256836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1539610.0 840.2028211613447 0.0 - - - - - - - 328.0 3079 4 257 33 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 538994.0 29.912099838256836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 538994.0 1109.2032237089404 0.0 - - - - - - - 684.625 1077 8 259 33 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 361196.0 29.912099838256836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 361196.0 365.37106377985094 0.0 - - - - - - - 1285.6666666666667 722 9 261 34 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37340.[MT7]-ADFSQADVHR.3b4_1.heavy 430.55 / 565.274 13279.0 21.7052001953125 50 20 10 10 10 5.21108202068991 15.332628257722718 0.0 3 0.9927224784150023 14.457955518047582 13279.0 26.45745912069733 1.0 - - - - - - - 666.4285714285714 61 7 RELB v-rel reticuloendotheliosis viral oncogene homolog B 263 34 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37340.[MT7]-ADFSQADVHR.3y4_1.heavy 430.55 / 526.273 29143.0 21.7052001953125 50 20 10 10 10 5.21108202068991 15.332628257722718 0.0 3 0.9927224784150023 14.457955518047582 29143.0 97.05270334775848 0.0 - - - - - - - 287.94736842105266 58 19 RELB v-rel reticuloendotheliosis viral oncogene homolog B 265 34 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37340.[MT7]-ADFSQADVHR.3b3_1.heavy 430.55 / 478.242 22655.0 21.7052001953125 50 20 10 10 10 5.21108202068991 15.332628257722718 0.0 3 0.9927224784150023 14.457955518047582 22655.0 41.80693284532184 0.0 - - - - - - - 718.0833333333334 45 12 RELB v-rel reticuloendotheliosis viral oncogene homolog B 267 34 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37340.[MT7]-ADFSQADVHR.3y5_1.heavy 430.55 / 597.31 20932.0 21.7052001953125 50 20 10 10 10 5.21108202068991 15.332628257722718 0.0 3 0.9927224784150023 14.457955518047582 20932.0 44.05211491865697 0.0 - - - - - - - 202.58823529411765 41 17 RELB v-rel reticuloendotheliosis viral oncogene homolog B 269 35 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543695.[MT7]-VFDLPESLGGIR.3y7_1.heavy 482.941 / 731.405 8946.0 41.28215026855469 40 14 10 6 10 3.483304410430401 28.70837234338755 0.03769683837890625 3 0.9423013087555937 5.11291715956348 8946.0 56.114396230119766 0.0 - - - - - - - 214.0 17 9 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 271 35 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543695.[MT7]-VFDLPESLGGIR.3b4_1.heavy 482.941 / 619.357 34626.0 41.28215026855469 40 14 10 6 10 3.483304410430401 28.70837234338755 0.03769683837890625 3 0.9423013087555937 5.11291715956348 34626.0 152.92983880253308 0.0 - - - - - - - 250.625 69 8 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 273 35 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543695.[MT7]-VFDLPESLGGIR.3b3_1.heavy 482.941 / 506.273 41876.0 41.28215026855469 40 14 10 6 10 3.483304410430401 28.70837234338755 0.03769683837890625 3 0.9423013087555937 5.11291715956348 41876.0 23.936193282262817 1.0 - - - - - - - 285.3 83 10 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 275 35 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543695.[MT7]-VFDLPESLGGIR.3y5_1.heavy 482.941 / 515.33 9948.0 41.28215026855469 40 14 10 6 10 3.483304410430401 28.70837234338755 0.03769683837890625 3 0.9423013087555937 5.11291715956348 9948.0 31.329740259740255 1.0 - - - - - - - 198.07142857142858 19 14 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 277 36 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43301.[MT7]-ALVTLSSGDMR.2b3_1.heavy 647.351 / 428.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 279 36 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43301.[MT7]-ALVTLSSGDMR.2y8_1.heavy 647.351 / 866.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 281 36 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43301.[MT7]-ALVTLSSGDMR.2y10_1.heavy 647.351 / 1078.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 283 36 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43301.[MT7]-ALVTLSSGDMR.2y7_1.heavy 647.351 / 765.356 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 285 37 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543950.[MT7]-K[MT7]IIDFIYTAK[MT7].3b4_1.heavy 548.675 / 758.501 7406.0 37.331499099731445 39 13 10 6 10 3.253042065898347 30.740457078099418 0.03440093994140625 3 0.9131450760845375 4.1569086086417055 7406.0 23.282666224506713 0.0 - - - - - - - 197.33333333333334 14 21 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 287 37 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543950.[MT7]-K[MT7]IIDFIYTAK[MT7].3b5_1.heavy 548.675 / 905.57 8517.0 37.331499099731445 39 13 10 6 10 3.253042065898347 30.740457078099418 0.03440093994140625 3 0.9131450760845375 4.1569086086417055 8517.0 68.64570463320463 0.0 - - - - - - - 137.42857142857142 17 14 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 289 37 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543950.[MT7]-K[MT7]IIDFIYTAK[MT7].3y4_1.heavy 548.675 / 626.363 33918.0 37.331499099731445 39 13 10 6 10 3.253042065898347 30.740457078099418 0.03440093994140625 3 0.9131450760845375 4.1569086086417055 33918.0 68.2698099835034 0.0 - - - - - - - 722.25 67 8 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 291 37 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543950.[MT7]-K[MT7]IIDFIYTAK[MT7].3b4_2.heavy 548.675 / 379.754 40584.0 37.331499099731445 39 13 10 6 10 3.253042065898347 30.740457078099418 0.03440093994140625 3 0.9131450760845375 4.1569086086417055 40584.0 126.92293436293437 0.0 - - - - - - - 550.8888888888889 81 9 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 293 38 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23628.[MT7]-DTIINAK[MT7].2y4_1.heavy 531.823 / 589.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - DET1 de-etiolated homolog 1 (Arabidopsis) 295 38 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23628.[MT7]-DTIINAK[MT7].2b4_1.heavy 531.823 / 587.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - DET1 de-etiolated homolog 1 (Arabidopsis) 297 38 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23628.[MT7]-DTIINAK[MT7].2y3_1.heavy 531.823 / 476.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - DET1 de-etiolated homolog 1 (Arabidopsis) 299 38 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23628.[MT7]-DTIINAK[MT7].2y6_1.heavy 531.823 / 803.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - DET1 de-etiolated homolog 1 (Arabidopsis) 301 39 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23627.[MT7]-QLVC[CAM]LER.2y4_1.heavy 531.298 / 577.276 5341.0 28.946199417114258 48 18 10 10 10 5.060781349336824 19.759794604266833 0.0 3 0.98175481727578 9.122749002084666 5341.0 6.16804825539673 0.0 - - - - - - - 702.2 10 10 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 303 39 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23627.[MT7]-QLVC[CAM]LER.2y5_1.heavy 531.298 / 676.345 9804.0 28.946199417114258 48 18 10 10 10 5.060781349336824 19.759794604266833 0.0 3 0.98175481727578 9.122749002084666 9804.0 12.924887459807072 0.0 - - - - - - - 1163.909090909091 19 11 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 305 39 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23627.[MT7]-QLVC[CAM]LER.2b4_1.heavy 531.298 / 645.351 3439.0 28.946199417114258 48 18 10 10 10 5.060781349336824 19.759794604266833 0.0 3 0.98175481727578 9.122749002084666 3439.0 9.403515625 0.0 - - - - - - - 668.8571428571429 6 14 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 307 39 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23627.[MT7]-QLVC[CAM]LER.2y6_1.heavy 531.298 / 789.429 14632.0 28.946199417114258 48 18 10 10 10 5.060781349336824 19.759794604266833 0.0 3 0.98175481727578 9.122749002084666 14632.0 25.570743771594834 0.0 - - - - - - - 630.875 29 8 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 309 40 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23626.[MT7]-NLAENISR.2y5_1.heavy 530.797 / 618.321 4164.0 23.961549758911133 43 17 10 6 10 2.657430386233613 32.2252736143514 0.0345001220703125 3 0.9727706260785691 7.461963514349346 4164.0 3.8377880184331796 0.0 - - - - - - - 645.5833333333334 8 12 PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 311 40 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23626.[MT7]-NLAENISR.2y6_1.heavy 530.797 / 689.358 6962.0 23.961549758911133 43 17 10 6 10 2.657430386233613 32.2252736143514 0.0345001220703125 3 0.9727706260785691 7.461963514349346 6962.0 16.769690928789522 0.0 - - - - - - - 237.05882352941177 13 17 PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 313 40 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23626.[MT7]-NLAENISR.2b5_1.heavy 530.797 / 686.359 2212.0 23.961549758911133 43 17 10 6 10 2.657430386233613 32.2252736143514 0.0345001220703125 3 0.9727706260785691 7.461963514349346 2212.0 4.373783669678291 1.0 - - - - - - - 238.33333333333334 10 18 PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 315 40 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23626.[MT7]-NLAENISR.2y7_1.heavy 530.797 / 802.442 6442.0 23.961549758911133 43 17 10 6 10 2.657430386233613 32.2252736143514 0.0345001220703125 3 0.9727706260785691 7.461963514349346 6442.0 22.93635164835165 0.0 - - - - - - - 285.27777777777777 12 18 PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 317 41 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23720.[MT7]-EDISVVFSR.2y8_1.heavy 598.326 / 922.499 5577.0 34.02349853515625 48 18 10 10 10 2.9396674393107163 27.26271932159581 0.0 3 0.9802484558681259 8.76686680022947 5577.0 27.979556145912632 1.0 - - - - - - - 239.33333333333334 11 9 RELB v-rel reticuloendotheliosis viral oncogene homolog B 319 41 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23720.[MT7]-EDISVVFSR.2b4_1.heavy 598.326 / 589.295 N/A 34.02349853515625 48 18 10 10 10 2.9396674393107163 27.26271932159581 0.0 3 0.9802484558681259 8.76686680022947 7045.0 4.4955747592596 1.0 - - - - - - - 294.0 14 1 RELB v-rel reticuloendotheliosis viral oncogene homolog B 321 41 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23720.[MT7]-EDISVVFSR.2y6_1.heavy 598.326 / 694.388 8611.0 34.02349853515625 48 18 10 10 10 2.9396674393107163 27.26271932159581 0.0 3 0.9802484558681259 8.76686680022947 8611.0 37.95410341990289 0.0 - - - - - - - 269.25 17 12 RELB v-rel reticuloendotheliosis viral oncogene homolog B 323 41 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23720.[MT7]-EDISVVFSR.2y7_1.heavy 598.326 / 807.472 6458.0 34.02349853515625 48 18 10 10 10 2.9396674393107163 27.26271932159581 0.0 3 0.9802484558681259 8.76686680022947 6458.0 46.66199097030116 0.0 - - - - - - - 263.53846153846155 12 13 RELB v-rel reticuloendotheliosis viral oncogene homolog B 325 42 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23485.[MT7]-EQILR.2b3_1.heavy 401.749 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100508643;LOC100510068;RALA;RALB;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;v-ral simian leukemia viral oncogene homolog A (ras related);v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein);RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 327 42 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23485.[MT7]-EQILR.2y4_1.heavy 401.749 / 529.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100508643;LOC100510068;RALA;RALB;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;v-ral simian leukemia viral oncogene homolog A (ras related);v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein);RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 329 42 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23485.[MT7]-EQILR.2b3_2.heavy 401.749 / 258.151 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100508643;LOC100510068;RALA;RALB;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;v-ral simian leukemia viral oncogene homolog A (ras related);v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein);RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 331 42 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23485.[MT7]-EQILR.2y3_1.heavy 401.749 / 401.287 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100508643;LOC100510068;RALA;RALB;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;v-ral simian leukemia viral oncogene homolog A (ras related);v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein);RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 333 43 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 631281.0 15.61769962310791 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 631281.0 7850.527441848597 0.0 - - - - - - - 667.3333333333334 1262 9 335 43 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 1252490.0 15.61769962310791 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1252490.0 4633.784656640564 0.0 - - - - - - - 437.0 2504 1 337 43 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 487916.0 15.61769962310791 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 487916.0 2296.031516410683 0.0 - - - - - - - 327.55555555555554 975 9 339 44 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23623.[MT7]-TLPAIELR.2y5_1.heavy 528.83 / 601.367 5724.0 34.02349853515625 50 20 10 10 10 9.732018328601036 10.275360837136326 0.0 3 0.9974286772300107 24.33273737354074 5724.0 10.235567153723967 0.0 - - - - - - - 668.8888888888889 11 9 RELB v-rel reticuloendotheliosis viral oncogene homolog B 341 44 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23623.[MT7]-TLPAIELR.2b4_1.heavy 528.83 / 527.331 8685.0 34.02349853515625 50 20 10 10 10 9.732018328601036 10.275360837136326 0.0 3 0.9974286772300107 24.33273737354074 8685.0 11.11713252951351 1.0 - - - - - - - 345.3333333333333 17 6 RELB v-rel reticuloendotheliosis viral oncogene homolog B 343 44 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23623.[MT7]-TLPAIELR.2y6_1.heavy 528.83 / 698.42 78856.0 34.02349853515625 50 20 10 10 10 9.732018328601036 10.275360837136326 0.0 3 0.9974286772300107 24.33273737354074 78856.0 107.48099370536636 0.0 - - - - - - - 369.875 157 8 RELB v-rel reticuloendotheliosis viral oncogene homolog B 345 44 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23623.[MT7]-TLPAIELR.2y7_1.heavy 528.83 / 811.504 22798.0 34.02349853515625 50 20 10 10 10 9.732018328601036 10.275360837136326 0.0 3 0.9974286772300107 24.33273737354074 22798.0 64.4100426220248 0.0 - - - - - - - 217.1 45 10 RELB v-rel reticuloendotheliosis viral oncogene homolog B 347 45 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24023.[MT7]-SAAGELATVEC[CAM]YNPR.2y5_1.heavy 891.434 / 709.309 1151.0 31.359749794006348 42 16 10 6 10 2.434966282880689 32.28558652771068 0.037799835205078125 3 0.9625107828870589 6.3539381267103545 1151.0 5.695052083333334 0.0 - - - - - - - 235.63636363636363 2 11 KLHL9 kelch-like 9 (Drosophila) 349 45 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24023.[MT7]-SAAGELATVEC[CAM]YNPR.2y9_1.heavy 891.434 / 1109.5 1055.0 31.359749794006348 42 16 10 6 10 2.434966282880689 32.28558652771068 0.037799835205078125 3 0.9625107828870589 6.3539381267103545 1055.0 10.2203125 1.0 - - - - - - - 211.2 2 10 KLHL9 kelch-like 9 (Drosophila) 351 45 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24023.[MT7]-SAAGELATVEC[CAM]YNPR.2y10_1.heavy 891.434 / 1222.59 863.0 31.359749794006348 42 16 10 6 10 2.434966282880689 32.28558652771068 0.037799835205078125 3 0.9625107828870589 6.3539381267103545 863.0 4.494791666666667 1.0 - - - - - - - 164.57142857142858 3 7 KLHL9 kelch-like 9 (Drosophila) 353 45 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24023.[MT7]-SAAGELATVEC[CAM]YNPR.2b5_1.heavy 891.434 / 560.28 2686.0 31.359749794006348 42 16 10 6 10 2.434966282880689 32.28558652771068 0.037799835205078125 3 0.9625107828870589 6.3539381267103545 2686.0 35.44027777777778 0.0 - - - - - - - 200.0 5 12 KLHL9 kelch-like 9 (Drosophila) 355 46 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23723.[MT7]-VIFLENYR.2b3_1.heavy 599.341 / 504.33 4765.0 38.162498474121094 46 18 10 10 8 4.347011940175883 23.00430764309194 0.0 4 0.9883475134002946 11.421691937042116 4765.0 11.865587386987631 1.0 - - - - - - - 723.5714285714286 10 7 PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 357 46 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23723.[MT7]-VIFLENYR.2y5_1.heavy 599.341 / 694.352 4765.0 38.162498474121094 46 18 10 10 8 4.347011940175883 23.00430764309194 0.0 4 0.9883475134002946 11.421691937042116 4765.0 24.320172115176444 0.0 - - - - - - - 271.65 9 20 PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 359 46 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23723.[MT7]-VIFLENYR.2y6_1.heavy 599.341 / 841.42 11317.0 38.162498474121094 46 18 10 10 8 4.347011940175883 23.00430764309194 0.0 4 0.9883475134002946 11.421691937042116 11317.0 17.14181092339736 0.0 - - - - - - - 272.75 22 12 PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 361 46 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23723.[MT7]-VIFLENYR.2y7_1.heavy 599.341 / 954.504 12211.0 38.162498474121094 46 18 10 10 8 4.347011940175883 23.00430764309194 0.0 4 0.9883475134002946 11.421691937042116 12211.0 42.94799666791191 0.0 - - - - - - - 232.05882352941177 24 17 PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 363 47 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24028.[MT7]-FRFGPLTPELMVPR.3y7_1.heavy 602.007 / 841.46 2874.0 41.68600082397461 48 18 10 10 10 4.662492859012303 21.447754028557135 0.0 3 0.9870509572048046 10.833624501219823 2874.0 17.986938775510204 1.0 - - - - - - - 162.06666666666666 5 15 RFC5 replication factor C (activator 1) 5, 36.5kDa 365 47 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24028.[MT7]-FRFGPLTPELMVPR.3y6_1.heavy 602.007 / 744.407 1253.0 41.68600082397461 48 18 10 10 10 4.662492859012303 21.447754028557135 0.0 3 0.9870509572048046 10.833624501219823 1253.0 2.7608474576271185 0.0 - - - - - - - 206.4 2 15 RFC5 replication factor C (activator 1) 5, 36.5kDa 367 47 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24028.[MT7]-FRFGPLTPELMVPR.3y4_1.heavy 602.007 / 502.281 1400.0 41.68600082397461 48 18 10 10 10 4.662492859012303 21.447754028557135 0.0 3 0.9870509572048046 10.833624501219823 1400.0 10.09213671900239 1.0 - - - - - - - 187.0 2 13 RFC5 replication factor C (activator 1) 5, 36.5kDa 369 47 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24028.[MT7]-FRFGPLTPELMVPR.3y5_1.heavy 602.007 / 615.365 1842.0 41.68600082397461 48 18 10 10 10 4.662492859012303 21.447754028557135 0.0 3 0.9870509572048046 10.833624501219823 1842.0 3.227532566905034 0.0 - - - - - - - 727.75 3 8 RFC5 replication factor C (activator 1) 5, 36.5kDa 371 48 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542833.[MT7]-FFTTGENAR.2y8_1.heavy 593.802 / 895.427 12745.0 29.41189956665039 48 20 10 10 8 19.291583443661562 5.183607674923957 0.0 4 0.9994171540918698 51.11688701212597 12745.0 55.39759871359657 0.0 - - - - - - - 176.4375 25 16 CACNG6 calcium channel, voltage-dependent, gamma subunit 6 373 48 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542833.[MT7]-FFTTGENAR.2y5_1.heavy 593.802 / 546.263 3186.0 29.41189956665039 48 20 10 10 8 19.291583443661562 5.183607674923957 0.0 4 0.9994171540918698 51.11688701212597 3186.0 10.310196263515985 1.0 - - - - - - - 651.7 6 10 CACNG6 calcium channel, voltage-dependent, gamma subunit 6 375 48 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542833.[MT7]-FFTTGENAR.2y6_1.heavy 593.802 / 647.311 4055.0 29.41189956665039 48 20 10 10 8 19.291583443661562 5.183607674923957 0.0 4 0.9994171540918698 51.11688701212597 4055.0 6.784292708084765 0.0 - - - - - - - 641.5714285714286 8 7 CACNG6 calcium channel, voltage-dependent, gamma subunit 6 377 48 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542833.[MT7]-FFTTGENAR.2y7_1.heavy 593.802 / 748.358 6662.0 29.41189956665039 48 20 10 10 8 19.291583443661562 5.183607674923957 0.0 4 0.9994171540918698 51.11688701212597 6662.0 20.107527215665762 1.0 - - - - - - - 672.2857142857143 21 7 CACNG6 calcium channel, voltage-dependent, gamma subunit 6 379 49 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544067.[MT7]-STDELEIIDEYIK[MT7].3b6_1.heavy 619.331 / 819.385 40492.0 42.02139854431152 41 15 10 6 10 1.2648807793371764 51.365391376690425 0.03639984130859375 3 0.9541658211823132 5.742417052091209 40492.0 573.0498260869565 0.0 - - - - - - - 186.0 80 12 RELB v-rel reticuloendotheliosis viral oncogene homolog B 381 49 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544067.[MT7]-STDELEIIDEYIK[MT7].3b4_1.heavy 619.331 / 577.259 15823.0 42.02139854431152 41 15 10 6 10 1.2648807793371764 51.365391376690425 0.03639984130859375 3 0.9541658211823132 5.742417052091209 15823.0 48.79879412227127 0.0 - - - - - - - 216.0 31 13 RELB v-rel reticuloendotheliosis viral oncogene homolog B 383 49 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544067.[MT7]-STDELEIIDEYIK[MT7].3b5_1.heavy 619.331 / 690.343 14025.0 42.02139854431152 41 15 10 6 10 1.2648807793371764 51.365391376690425 0.03639984130859375 3 0.9541658211823132 5.742417052091209 14025.0 88.95486111111111 0.0 - - - - - - - 207.52941176470588 28 17 RELB v-rel reticuloendotheliosis viral oncogene homolog B 385 49 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544067.[MT7]-STDELEIIDEYIK[MT7].3y5_1.heavy 619.331 / 811.432 17981.0 42.02139854431152 41 15 10 6 10 1.2648807793371764 51.365391376690425 0.03639984130859375 3 0.9541658211823132 5.742417052091209 17981.0 263.4715972222222 0.0 - - - - - - - 169.71428571428572 35 14 RELB v-rel reticuloendotheliosis viral oncogene homolog B 387 50 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541029.[MT7]-YVNNFILK[MT7].3y3_1.heavy 433.595 / 517.383 18784.0 35.99369812011719 43 16 9 10 8 1.8148949573862097 42.97986657813766 0.0 4 0.9687036638262129 6.957871648697055 18784.0 76.92443787063287 0.0 - - - - - - - 266.9375 37 16 KLHL9 kelch-like 9 (Drosophila) 389 50 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541029.[MT7]-YVNNFILK[MT7].3b4_1.heavy 433.595 / 635.327 29883.0 35.99369812011719 43 16 9 10 8 1.8148949573862097 42.97986657813766 0.0 4 0.9687036638262129 6.957871648697055 29883.0 223.7510957722174 0.0 - - - - - - - 186.8125 59 16 KLHL9 kelch-like 9 (Drosophila) 391 50 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541029.[MT7]-YVNNFILK[MT7].3b5_1.heavy 433.595 / 782.395 5208.0 35.99369812011719 43 16 9 10 8 1.8148949573862097 42.97986657813766 0.0 4 0.9687036638262129 6.957871648697055 5208.0 86.83941382868937 0.0 - - - - - - - 178.36363636363637 10 11 KLHL9 kelch-like 9 (Drosophila) 393 50 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541029.[MT7]-YVNNFILK[MT7].3b3_1.heavy 433.595 / 521.284 10587.0 35.99369812011719 43 16 9 10 8 1.8148949573862097 42.97986657813766 0.0 4 0.9687036638262129 6.957871648697055 10587.0 24.264912280701754 2.0 - - - - - - - 260.7368421052632 71 19 KLHL9 kelch-like 9 (Drosophila) 395 51 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24030.[MT7]-LQALAQAPPVYLDVLG.3b6_1.heavy 604.684 / 769.469 2760.0 47.96739959716797 48 18 10 10 10 2.398023565826531 28.962125165945793 0.0 3 0.9804249682965261 8.806434969860527 2760.0 25.450921602359305 0.0 - - - - - - - 176.30769230769232 5 13 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 397 51 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24030.[MT7]-LQALAQAPPVYLDVLG.3b4_1.heavy 604.684 / 570.373 5000.0 47.96739959716797 48 18 10 10 10 2.398023565826531 28.962125165945793 0.0 3 0.9804249682965261 8.806434969860527 5000.0 38.243765367053044 0.0 - - - - - - - 169.1875 10 16 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 399 51 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24030.[MT7]-LQALAQAPPVYLDVLG.3b5_1.heavy 604.684 / 641.41 3125.0 47.96739959716797 48 18 10 10 10 2.398023565826531 28.962125165945793 0.0 3 0.9804249682965261 8.806434969860527 3125.0 22.83653846153846 0.0 - - - - - - - 122.47058823529412 6 17 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 401 51 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24030.[MT7]-LQALAQAPPVYLDVLG.3b7_1.heavy 604.684 / 840.506 5260.0 47.96739959716797 48 18 10 10 10 2.398023565826531 28.962125165945793 0.0 3 0.9804249682965261 8.806434969860527 5260.0 193.40615384615387 0.0 - - - - - - - 130.125 10 8 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 403 52 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543958.[MT7]-FADALGLELAQVK[MT7].2y8_1.heavy 831.987 / 1001.61 4487.0 42.066898345947266 38 12 10 6 10 1.3656665869133489 58.233859417315905 0.03639984130859375 3 0.8923375678739104 3.7269586066420777 4487.0 34.04541386111678 0.0 - - - - - - - 153.11764705882354 8 17 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 405 52 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543958.[MT7]-FADALGLELAQVK[MT7].2b4_1.heavy 831.987 / 549.279 7020.0 42.066898345947266 38 12 10 6 10 1.3656665869133489 58.233859417315905 0.03639984130859375 3 0.8923375678739104 3.7269586066420777 7020.0 47.45778801843317 0.0 - - - - - - - 225.58823529411765 14 17 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 407 52 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543958.[MT7]-FADALGLELAQVK[MT7].2b6_1.heavy 831.987 / 719.385 12809.0 42.066898345947266 38 12 10 6 10 1.3656665869133489 58.233859417315905 0.03639984130859375 3 0.8923375678739104 3.7269586066420777 12809.0 35.19077596841846 0.0 - - - - - - - 665.9 25 10 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 409 52 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543958.[MT7]-FADALGLELAQVK[MT7].2b5_1.heavy 831.987 / 662.363 6730.0 42.066898345947266 38 12 10 6 10 1.3656665869133489 58.233859417315905 0.03639984130859375 3 0.8923375678739104 3.7269586066420777 6730.0 30.026407539547364 0.0 - - - - - - - 262.25 13 16 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 411 53 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23493.[MT7]-AQEWR.2y4_1.heavy 417.223 / 618.299 7967.0 20.868374347686768 41 15 10 6 10 3.6685191899703753 27.258955131922736 0.03529930114746094 3 0.9571969255282546 5.943790464481306 7967.0 94.9121695229013 1.0 - - - - - - - 194.93333333333334 15 15 KLHL9 kelch-like 9 (Drosophila) 413 53 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23493.[MT7]-AQEWR.2b3_1.heavy 417.223 / 473.248 17144.0 20.868374347686768 41 15 10 6 10 3.6685191899703753 27.258955131922736 0.03529930114746094 3 0.9571969255282546 5.943790464481306 17144.0 20.51529293483228 0.0 - - - - - - - 701.5833333333334 34 12 KLHL9 kelch-like 9 (Drosophila) 415 53 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23493.[MT7]-AQEWR.2b4_1.heavy 417.223 / 659.327 2723.0 20.868374347686768 41 15 10 6 10 3.6685191899703753 27.258955131922736 0.03529930114746094 3 0.9571969255282546 5.943790464481306 2723.0 8.507990817263543 0.0 - - - - - - - 598.875 5 8 KLHL9 kelch-like 9 (Drosophila) 417 53 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23493.[MT7]-AQEWR.2y3_1.heavy 417.223 / 490.241 1765.0 20.868374347686768 41 15 10 6 10 3.6685191899703753 27.258955131922736 0.03529930114746094 3 0.9571969255282546 5.943790464481306 1765.0 4.660066006600661 4.0 - - - - - - - 706.0 5 9 KLHL9 kelch-like 9 (Drosophila) 419 54 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543954.[MT7]-FSSSSTSSSPSSLPR.3y7_1.heavy 553.276 / 743.405 18436.0 25.022225379943848 44 18 10 6 10 4.321280321679541 23.14128974653819 0.038700103759765625 3 0.9844611311758824 9.887549941962257 18436.0 12.715036970615657 0.0 - - - - - - - 265.125 36 8 DDIT4 DNA-damage-inducible transcript 4 421 54 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543954.[MT7]-FSSSSTSSSPSSLPR.3y6_1.heavy 553.276 / 656.373 91402.0 25.022225379943848 44 18 10 6 10 4.321280321679541 23.14128974653819 0.038700103759765625 3 0.9844611311758824 9.887549941962257 91402.0 13.713335386293714 0.0 - - - - - - - 741.5 182 2 DDIT4 DNA-damage-inducible transcript 4 423 54 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543954.[MT7]-FSSSSTSSSPSSLPR.3y8_1.heavy 553.276 / 830.437 12291.0 25.022225379943848 44 18 10 6 10 4.321280321679541 23.14128974653819 0.038700103759765625 3 0.9844611311758824 9.887549941962257 12291.0 9.70845221042388 0.0 - - - - - - - 263.3636363636364 24 11 DDIT4 DNA-damage-inducible transcript 4 425 54 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543954.[MT7]-FSSSSTSSSPSSLPR.3y5_1.heavy 553.276 / 559.32 33340.0 25.022225379943848 44 18 10 6 10 4.321280321679541 23.14128974653819 0.038700103759765625 3 0.9844611311758824 9.887549941962257 33340.0 32.01588151903084 0.0 - - - - - - - 325.0 66 5 DDIT4 DNA-damage-inducible transcript 4 427 55 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37316.[MT7]-IDDVAALDK[MT7].2y4_1.heavy 624.358 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 429 55 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37316.[MT7]-IDDVAALDK[MT7].2y8_1.heavy 624.358 / 990.522 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 431 55 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37316.[MT7]-IDDVAALDK[MT7].2y5_1.heavy 624.358 / 661.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 433 55 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37316.[MT7]-IDDVAALDK[MT7].2y3_1.heavy 624.358 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 435 56 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541578.[MT7]-RAHGQGR.2y5_1.heavy 463.263 / 554.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNG6 calcium channel, voltage-dependent, gamma subunit 6 437 56 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541578.[MT7]-RAHGQGR.2b4_1.heavy 463.263 / 566.328 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNG6 calcium channel, voltage-dependent, gamma subunit 6 439 56 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541578.[MT7]-RAHGQGR.2b6_1.heavy 463.263 / 751.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNG6 calcium channel, voltage-dependent, gamma subunit 6 441 56 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541578.[MT7]-RAHGQGR.2y6_1.heavy 463.263 / 625.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNG6 calcium channel, voltage-dependent, gamma subunit 6 443 57 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23712.[MT7]-IC[CAM]FQASYR.2b3_1.heavy 594.801 / 565.292 N/A 30.492533365885418 44 18 10 6 10 3.5207648427650398 28.402919384262198 0.03859901428222656 3 0.9850039028054078 10.0653532495375 984.0 1.7333333333333334 23.0 - - - - - - - 313.09090909090907 2 11 RELB v-rel reticuloendotheliosis viral oncogene homolog B 445 57 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23712.[MT7]-IC[CAM]FQASYR.2y5_1.heavy 594.801 / 624.31 1312.0 30.492533365885418 44 18 10 6 10 3.5207648427650398 28.402919384262198 0.03859901428222656 3 0.9850039028054078 10.0653532495375 1312.0 2.8800000000000003 2.0 - - - - - - - 259.6666666666667 2 18 RELB v-rel reticuloendotheliosis viral oncogene homolog B 447 57 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23712.[MT7]-IC[CAM]FQASYR.2y6_1.heavy 594.801 / 771.378 1804.0 30.492533365885418 44 18 10 6 10 3.5207648427650398 28.402919384262198 0.03859901428222656 3 0.9850039028054078 10.0653532495375 1804.0 3.1533333333333333 0.0 - - - - - - - 221.88235294117646 3 17 RELB v-rel reticuloendotheliosis viral oncogene homolog B 449 57 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23712.[MT7]-IC[CAM]FQASYR.2y7_1.heavy 594.801 / 931.409 5002.0 30.492533365885418 44 18 10 6 10 3.5207648427650398 28.402919384262198 0.03859901428222656 3 0.9850039028054078 10.0653532495375 5002.0 14.639999999999997 0.0 - - - - - - - 246.0 10 17 RELB v-rel reticuloendotheliosis viral oncogene homolog B 451 58 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37217.[MT7]-K[MT7]AELLSR.2b4_1.heavy 552.853 / 730.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 453 58 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37217.[MT7]-K[MT7]AELLSR.2b4_2.heavy 552.853 / 365.739 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 455 58 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37217.[MT7]-K[MT7]AELLSR.2y6_1.heavy 552.853 / 688.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 457 58 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37217.[MT7]-K[MT7]AELLSR.2b5_1.heavy 552.853 / 843.554 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 459 59 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23610.[MT7]-IIPALQSR.2y5_1.heavy 521.331 / 574.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 461 59 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23610.[MT7]-IIPALQSR.2b4_1.heavy 521.331 / 539.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 463 59 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23610.[MT7]-IIPALQSR.2y6_1.heavy 521.331 / 671.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 465 59 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23610.[MT7]-IIPALQSR.2y7_1.heavy 521.331 / 784.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 467 60 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541010.[MT7]-TPVEK[MT7].2b3_1.heavy 431.268 / 442.278 766.0 17.287599563598633 48 18 10 10 10 0.9486730435613732 48.331198127073144 0.0 3 0.9896622222552521 12.127573811880131 766.0 1.2661157024793388 7.0 - - - - - - - 710.375 9 8 RAP1A;KIAA0528 RAP1A, member of RAS oncogene family;KIAA0528 469 60 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541010.[MT7]-TPVEK[MT7].2y4_1.heavy 431.268 / 616.379 45790.0 17.287599563598633 48 18 10 10 10 0.9486730435613732 48.331198127073144 0.0 3 0.9896622222552521 12.127573811880131 45790.0 192.68381542699726 0.0 - - - - - - - 235.22222222222223 91 18 RAP1A;KIAA0528 RAP1A, member of RAS oncogene family;KIAA0528 471 60 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541010.[MT7]-TPVEK[MT7].2y4_2.heavy 431.268 / 308.693 3668.0 17.287599563598633 48 18 10 10 10 0.9486730435613732 48.331198127073144 0.0 3 0.9896622222552521 12.127573811880131 3668.0 48.58602254428341 1.0 - - - - - - - 166.05882352941177 7 17 RAP1A;KIAA0528 RAP1A, member of RAS oncogene family;KIAA0528 473 60 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541010.[MT7]-TPVEK[MT7].2y3_1.heavy 431.268 / 519.326 3305.0 17.287599563598633 48 18 10 10 10 0.9486730435613732 48.331198127073144 0.0 3 0.9896622222552521 12.127573811880131 3305.0 9.396893501896049 0.0 - - - - - - - 273.39130434782606 6 23 RAP1A;KIAA0528 RAP1A, member of RAS oncogene family;KIAA0528 475 61 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 828799.0 18.37649917602539 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 828799.0 2186.346263499966 0.0 - - - - - - - 658.0 1657 7 477 61 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 445886.0 18.37649917602539 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 445886.0 1359.6185212690111 0.0 - - - - - - - 720.2222222222222 891 9 479 61 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 498973.0 18.37649917602539 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 498973.0 3172.4978580243105 0.0 - - - - - - - 799.5 997 8 481 62 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23894.[MT7]-VFADYEAYVK[MT7].3y3_1.heavy 498.269 / 553.347 21467.0 35.85459899902344 47 17 10 10 10 2.2338508644605173 34.953954535413764 0.0 3 0.9713041776662098 7.267900761385037 21467.0 81.83478047320583 0.0 - - - - - - - 276.44444444444446 42 9 PYGL phosphorylase, glycogen, liver 483 62 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23894.[MT7]-VFADYEAYVK[MT7].3b6_1.heavy 498.269 / 869.416 8289.0 35.85459899902344 47 17 10 10 10 2.2338508644605173 34.953954535413764 0.0 3 0.9713041776662098 7.267900761385037 8289.0 142.81048192771084 0.0 - - - - - - - 166.0 16 14 PYGL phosphorylase, glycogen, liver 485 62 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23894.[MT7]-VFADYEAYVK[MT7].3b4_1.heavy 498.269 / 577.31 42603.0 35.85459899902344 47 17 10 10 10 2.2338508644605173 34.953954535413764 0.0 3 0.9713041776662098 7.267900761385037 42603.0 62.119262002963204 0.0 - - - - - - - 753.5454545454545 85 11 PYGL phosphorylase, glycogen, liver 487 62 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23894.[MT7]-VFADYEAYVK[MT7].3b5_1.heavy 498.269 / 740.374 11107.0 35.85459899902344 47 17 10 10 10 2.2338508644605173 34.953954535413764 0.0 3 0.9713041776662098 7.267900761385037 11107.0 72.70847389558233 0.0 - - - - - - - 205.21052631578948 22 19 PYGL phosphorylase, glycogen, liver 489 63 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24041.[MT7]-DNVDLLGSLADLYFR.3y6_1.heavy 618.995 / 784.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 491 63 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24041.[MT7]-DNVDLLGSLADLYFR.3b4_1.heavy 618.995 / 588.275 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 493 63 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24041.[MT7]-DNVDLLGSLADLYFR.3b5_1.heavy 618.995 / 701.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 495 63 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24041.[MT7]-DNVDLLGSLADLYFR.3y5_1.heavy 618.995 / 713.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 497 64 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24042.[MT7]-DNVDLLGSLADLYFR.2y4_1.heavy 927.99 / 598.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 499 64 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24042.[MT7]-DNVDLLGSLADLYFR.2y9_1.heavy 927.99 / 1041.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 501 64 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24042.[MT7]-DNVDLLGSLADLYFR.2b4_1.heavy 927.99 / 588.275 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 503 64 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24042.[MT7]-DNVDLLGSLADLYFR.2b5_1.heavy 927.99 / 701.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 505 65 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543967.[MT7]-ASSSLGLQDFDLLR.2b8_1.heavy 833.45 / 888.491 2135.0 42.94537353515625 39 13 10 6 10 1.0796639295575898 53.171833469732064 0.0363006591796875 3 0.9253402546814762 4.488273639723244 2135.0 7.4725 0.0 - - - - - - - 177.9047619047619 4 21 PRKCI protein kinase C, iota 507 65 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543967.[MT7]-ASSSLGLQDFDLLR.2y5_1.heavy 833.45 / 663.382 3936.0 42.94537353515625 39 13 10 6 10 1.0796639295575898 53.171833469732064 0.0363006591796875 3 0.9253402546814762 4.488273639723244 3936.0 13.773639580209895 0.0 - - - - - - - 676.4285714285714 7 7 PRKCI protein kinase C, iota 509 65 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543967.[MT7]-ASSSLGLQDFDLLR.2y9_1.heavy 833.45 / 1076.57 4336.0 42.94537353515625 39 13 10 6 10 1.0796639295575898 53.171833469732064 0.0363006591796875 3 0.9253402546814762 4.488273639723244 4336.0 17.214179640718562 0.0 - - - - - - - 178.0 8 12 PRKCI protein kinase C, iota 511 65 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543967.[MT7]-ASSSLGLQDFDLLR.2b6_1.heavy 833.45 / 647.348 3202.0 42.94537353515625 39 13 10 6 10 1.0796639295575898 53.171833469732064 0.0363006591796875 3 0.9253402546814762 4.488273639723244 3202.0 5.234877384196186 0.0 - - - - - - - 252.78947368421052 6 19 PRKCI protein kinase C, iota 513 66 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37112.[MT7]-NLTIVK[MT7].2y4_1.heavy 488.326 / 604.415 6974.0 27.317050457000732 32 16 2 6 8 1.9546181234620228 40.38505596880252 0.03740119934082031 4 0.9645993301731083 6.53983874414029 6974.0 16.233877794901645 0.0 - - - - - - - 701.5555555555555 13 9 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 515 66 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37112.[MT7]-NLTIVK[MT7].2y5_1.heavy 488.326 / 717.499 5139.0 27.317050457000732 32 16 2 6 8 1.9546181234620228 40.38505596880252 0.03740119934082031 4 0.9645993301731083 6.53983874414029 5139.0 7.302422650451577 1.0 - - - - - - - 778.2 45 10 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 517 66 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37112.[MT7]-NLTIVK[MT7].2b4_1.heavy 488.326 / 586.368 1762.0 27.317050457000732 32 16 2 6 8 1.9546181234620228 40.38505596880252 0.03740119934082031 4 0.9645993301731083 6.53983874414029 1762.0 2.9426070038910503 9.0 - - - - - - - 709.6666666666666 6 15 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 519 66 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37112.[MT7]-NLTIVK[MT7].2y3_1.heavy 488.326 / 503.367 3817.0 27.317050457000732 32 16 2 6 8 1.9546181234620228 40.38505596880252 0.03740119934082031 4 0.9645993301731083 6.53983874414029 3817.0 5.49812638413821 0.0 - - - - - - - 1204.0 7 10 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 521 67 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23992.[MT7]-LLMPSQLVSQVGK[MT7].3b6_1.heavy 563.339 / 814.461 24102.0 39.63890075683594 43 13 10 10 10 1.1778242169602775 48.71283588954886 0.0 3 0.925348904554464 4.488536988674074 24102.0 179.16683870967742 0.0 - - - - - - - 233.23076923076923 48 13 DDIT4 DNA-damage-inducible transcript 4 523 67 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23992.[MT7]-LLMPSQLVSQVGK[MT7].3b3_1.heavy 563.339 / 502.318 35609.0 39.63890075683594 43 13 10 10 10 1.1778242169602775 48.71283588954886 0.0 3 0.925348904554464 4.488536988674074 35609.0 147.4793347639485 0.0 - - - - - - - 610.7142857142857 71 7 DDIT4 DNA-damage-inducible transcript 4 525 67 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23992.[MT7]-LLMPSQLVSQVGK[MT7].3b7_1.heavy 563.339 / 927.545 9952.0 39.63890075683594 43 13 10 10 10 1.1778242169602775 48.71283588954886 0.0 3 0.925348904554464 4.488536988674074 9952.0 139.39097488629622 0.0 - - - - - - - 216.11111111111111 19 9 DDIT4 DNA-damage-inducible transcript 4 527 67 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23992.[MT7]-LLMPSQLVSQVGK[MT7].3y5_1.heavy 563.339 / 662.395 42528.0 39.63890075683594 43 13 10 10 10 1.1778242169602775 48.71283588954886 0.0 3 0.925348904554464 4.488536988674074 42528.0 143.62282134985998 0.0 - - - - - - - 304.5 85 12 DDIT4 DNA-damage-inducible transcript 4 529 68 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542439.[MT7]-STNTSELR.2y4_1.heavy 526.279 / 504.278 N/A 17.50200080871582 43 13 10 10 10 1.5703935714406132 52.652713255563214 0.0 3 0.915047651069804 4.203887720030741 3451.0 2.7292499099058514 2.0 - - - - - - - 742.375 6 16 RELB v-rel reticuloendotheliosis viral oncogene homolog B 531 68 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542439.[MT7]-STNTSELR.2b6_1.heavy 526.279 / 764.354 8467.0 17.50200080871582 43 13 10 10 10 1.5703935714406132 52.652713255563214 0.0 3 0.915047651069804 4.203887720030741 8467.0 55.142816868040754 0.0 - - - - - - - 186.58823529411765 16 17 RELB v-rel reticuloendotheliosis viral oncogene homolog B 533 68 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542439.[MT7]-STNTSELR.2y6_1.heavy 526.279 / 719.368 1886.0 17.50200080871582 43 13 10 10 10 1.5703935714406132 52.652713255563214 0.0 3 0.915047651069804 4.203887720030741 1886.0 25.50785714285714 0.0 - - - - - - - 80.125 3 16 RELB v-rel reticuloendotheliosis viral oncogene homolog B 535 68 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542439.[MT7]-STNTSELR.2y7_1.heavy 526.279 / 820.416 6099.0 17.50200080871582 43 13 10 10 10 1.5703935714406132 52.652713255563214 0.0 3 0.915047651069804 4.203887720030741 6099.0 93.51800000000001 0.0 - - - - - - - 134.4 12 20 RELB v-rel reticuloendotheliosis viral oncogene homolog B 537 69 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37113.[MT7]-ISGGNDK[MT7].2y6_1.heavy 489.777 / 721.36 4046.0 15.932999610900879 46 16 10 10 10 6.2784356181642575 15.927534513643522 0.0 2 0.96160953871951 6.278435308079127 4046.0 92.08137931034483 0.0 - - - - - - - 116.33333333333333 8 21 RPS6 ribosomal protein S6 539 69 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37113.[MT7]-ISGGNDK[MT7].2y4_1.heavy 489.777 / 577.306 N/A 15.932999610900879 46 16 10 10 10 6.2784356181642575 15.927534513643522 0.0 2 0.96160953871951 6.278435308079127 495.0 2.9870689655172415 0.0 - - - - - - - 0.0 0 0 RPS6 ribosomal protein S6 541 69 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37113.[MT7]-ISGGNDK[MT7].2y5_1.heavy 489.777 / 634.328 N/A 15.932999610900879 46 16 10 10 10 6.2784356181642575 15.927534513643522 0.0 2 0.96160953871951 6.278435308079127 378.0 -0.12941176470588234 3.0 - - - - - - - 0.0 0 0 RPS6 ribosomal protein S6 543 69 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37113.[MT7]-ISGGNDK[MT7].2b6_1.heavy 489.777 / 688.338 2270.0 15.932999610900879 46 16 10 10 10 6.2784356181642575 15.927534513643522 0.0 2 0.96160953871951 6.278435308079127 2270.0 18.434776444929117 0.0 - - - - - - - 160.69565217391303 4 23 RPS6 ribosomal protein S6 545 70 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23993.[MT7]-IQLSSLIAAFQVTR.2y8_1.heavy 846.002 / 905.52 2068.0 48.82889938354492 43 13 10 10 10 2.149256675149668 46.52771404934047 0.0 3 0.9135323417776854 4.166345940327683 2068.0 25.32105610561056 0.0 - - - - - - - 124.07692307692308 4 13 RFC5 replication factor C (activator 1) 5, 36.5kDa 547 70 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23993.[MT7]-IQLSSLIAAFQVTR.2y6_1.heavy 846.002 / 721.399 958.0 48.82889938354492 43 13 10 10 10 2.149256675149668 46.52771404934047 0.0 3 0.9135323417776854 4.166345940327683 958.0 15.365940594059406 0.0 - - - - - - - 0.0 1 0 RFC5 replication factor C (activator 1) 5, 36.5kDa 549 70 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23993.[MT7]-IQLSSLIAAFQVTR.2y10_1.heavy 846.002 / 1105.64 1160.0 48.82889938354492 43 13 10 10 10 2.149256675149668 46.52771404934047 0.0 3 0.9135323417776854 4.166345940327683 1160.0 24.256633663366337 0.0 - - - - - - - 106.22222222222223 2 9 RFC5 replication factor C (activator 1) 5, 36.5kDa 551 70 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23993.[MT7]-IQLSSLIAAFQVTR.2y11_1.heavy 846.002 / 1192.67 2472.0 48.82889938354492 43 13 10 10 10 2.149256675149668 46.52771404934047 0.0 3 0.9135323417776854 4.166345940327683 2472.0 66.52323326732673 0.0 - - - - - - - 131.0 4 10 RFC5 replication factor C (activator 1) 5, 36.5kDa 553 71 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37411.[MT7]-K[MT7]PNVDADDVR.2b8_1.heavy 708.888 / 1143.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 555 71 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37411.[MT7]-K[MT7]PNVDADDVR.2y5_1.heavy 708.888 / 575.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 557 71 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37411.[MT7]-K[MT7]PNVDADDVR.2y9_1.heavy 708.888 / 1000.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 559 71 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37411.[MT7]-K[MT7]PNVDADDVR.2b5_1.heavy 708.888 / 842.497 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 561 72 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 1721810.0 37.117801666259766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1721810.0 2234.656761730111 0.0 - - - - - - - 238.33333333333334 3443 9 563 72 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 787221.0 37.117801666259766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 787221.0 1756.9498594483332 0.0 - - - - - - - 251.6 1574 10 565 72 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1179960.0 37.117801666259766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1179960.0 326.36275842067744 0.0 - - - - - - - 295.6666666666667 2359 3 567 73 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24047.[MT7]-TFQYLSFYVYDK[MT7].3y3_1.heavy 621.325 / 569.305 11619.0 42.57270050048828 42 12 10 10 10 0.9025276090553837 55.72251327573615 0.0 3 0.8914029261315923 3.710584883394867 11619.0 37.22478363766944 0.0 - - - - - - - 216.53333333333333 23 15 RASA2 RAS p21 protein activator 2 569 73 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24047.[MT7]-TFQYLSFYVYDK[MT7].3b4_1.heavy 621.325 / 684.347 4479.0 42.57270050048828 42 12 10 10 10 0.9025276090553837 55.72251327573615 0.0 3 0.8914029261315923 3.710584883394867 4479.0 17.163930381197325 0.0 - - - - - - - 178.58333333333334 8 12 RASA2 RAS p21 protein activator 2 571 73 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24047.[MT7]-TFQYLSFYVYDK[MT7].3y4_1.heavy 621.325 / 668.374 5972.0 42.57270050048828 42 12 10 10 10 0.9025276090553837 55.72251327573615 0.0 3 0.8914029261315923 3.710584883394867 5972.0 38.309606486058925 0.0 - - - - - - - 162.4 11 20 RASA2 RAS p21 protein activator 2 573 73 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24047.[MT7]-TFQYLSFYVYDK[MT7].3b3_1.heavy 621.325 / 521.284 5777.0 42.57270050048828 42 12 10 10 10 0.9025276090553837 55.72251327573615 0.0 3 0.8914029261315923 3.710584883394867 5777.0 20.359471365638765 0.0 - - - - - - - 205.05263157894737 11 19 RASA2 RAS p21 protein activator 2 575 74 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37518.[MT7]-INVNEIFYDLVR.2y8_1.heavy 819.952 / 1054.56 2868.0 49.507198333740234 46 18 10 10 8 2.5816061962176047 30.507497556026244 0.0 4 0.982057831172779 9.199694485103834 2868.0 41.79957446808511 0.0 - - - - - - - 135.125 5 8 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 577 74 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37518.[MT7]-INVNEIFYDLVR.2y9_1.heavy 819.952 / 1168.6 8933.0 49.507198333740234 46 18 10 10 8 2.5816061962176047 30.507497556026244 0.0 4 0.982057831172779 9.199694485103834 8933.0 256.586170212766 0.0 - - - - - - - 122.2 17 5 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 579 74 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37518.[MT7]-INVNEIFYDLVR.2b5_1.heavy 819.952 / 714.39 6206.0 49.507198333740234 46 18 10 10 8 2.5816061962176047 30.507497556026244 0.0 4 0.982057831172779 9.199694485103834 6206.0 93.31007092198581 0.0 - - - - - - - 152.75 12 16 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 581 74 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37518.[MT7]-INVNEIFYDLVR.2y7_1.heavy 819.952 / 925.514 3620.0 49.507198333740234 46 18 10 10 8 2.5816061962176047 30.507497556026244 0.0 4 0.982057831172779 9.199694485103834 3620.0 96.27659574468086 1.0 - - - - - - - 131.6 11 15 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 583 75 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37517.[MT7]-GQSDVGVAVFENK[MT7].2y4_1.heavy 819.44 / 681.369 1822.0 31.4825496673584 40 14 10 6 10 2.3911775756153433 41.82039887784833 0.037700653076171875 3 0.9455954367665402 5.266908823826523 1822.0 6.657307692307692 0.0 - - - - - - - 195.16666666666666 3 12 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 585 75 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37517.[MT7]-GQSDVGVAVFENK[MT7].2b4_1.heavy 819.44 / 532.248 2516.0 31.4825496673584 40 14 10 6 10 2.3911775756153433 41.82039887784833 0.037700653076171875 3 0.9455954367665402 5.266908823826523 2516.0 2.31889400921659 1.0 - - - - - - - 260.2 5 15 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 587 75 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37517.[MT7]-GQSDVGVAVFENK[MT7].2b6_1.heavy 819.44 / 688.338 781.0 31.4825496673584 40 14 10 6 10 2.3911775756153433 41.82039887784833 0.037700653076171875 3 0.9455954367665402 5.266908823826523 781.0 5.016423076923076 7.0 - - - - - - - 0.0 1 0 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 589 75 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37517.[MT7]-GQSDVGVAVFENK[MT7].2y6_1.heavy 819.44 / 851.474 1041.0 31.4825496673584 40 14 10 6 10 2.3911775756153433 41.82039887784833 0.037700653076171875 3 0.9455954367665402 5.266908823826523 1041.0 3.6034615384615383 0.0 - - - - - - - 161.86666666666667 2 15 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 591 76 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23560.[MT7]-LHGVNK[MT7].2y4_1.heavy 478.3 / 561.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9 kelch-like 9 (Drosophila) 593 76 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23560.[MT7]-LHGVNK[MT7].2y5_1.heavy 478.3 / 698.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9 kelch-like 9 (Drosophila) 595 76 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23560.[MT7]-LHGVNK[MT7].2b4_1.heavy 478.3 / 551.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9 kelch-like 9 (Drosophila) 597 76 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23560.[MT7]-LHGVNK[MT7].2y3_1.heavy 478.3 / 504.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9 kelch-like 9 (Drosophila) 599 77 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23788.[MT7]-YVNNFILK[MT7].2b3_1.heavy 649.889 / 521.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9 kelch-like 9 (Drosophila) 601 77 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23788.[MT7]-YVNNFILK[MT7].2b4_1.heavy 649.889 / 635.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9 kelch-like 9 (Drosophila) 603 77 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23788.[MT7]-YVNNFILK[MT7].2y3_1.heavy 649.889 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9 kelch-like 9 (Drosophila) 605 77 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23788.[MT7]-YVNNFILK[MT7].2y6_1.heavy 649.889 / 892.537 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9 kelch-like 9 (Drosophila) 607 78 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24044.[MT7]-GIDIIRGPILSFASTR.3y6_1.heavy 620.699 / 668.336 4192.0 41.347450256347656 34 8 10 6 10 0.8808674169269488 66.30211428515908 0.035400390625 3 0.7819308779400777 2.5932067429566987 4192.0 5.037116154873164 1.0 - - - - - - - 172.84615384615384 8 13 RFC5 replication factor C (activator 1) 5, 36.5kDa 609 78 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24044.[MT7]-GIDIIRGPILSFASTR.3b4_1.heavy 620.699 / 543.326 3219.0 41.347450256347656 34 8 10 6 10 0.8808674169269488 66.30211428515908 0.035400390625 3 0.7819308779400777 2.5932067429566987 3219.0 8.746503340757238 0.0 - - - - - - - 252.75 6 16 RFC5 replication factor C (activator 1) 5, 36.5kDa 611 78 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24044.[MT7]-GIDIIRGPILSFASTR.3y13_2.heavy 620.699 / 715.927 8609.0 41.347450256347656 34 8 10 6 10 0.8808674169269488 66.30211428515908 0.035400390625 3 0.7819308779400777 2.5932067429566987 8609.0 43.200844165139216 0.0 - - - - - - - 218.0 17 11 RFC5 replication factor C (activator 1) 5, 36.5kDa 613 78 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24044.[MT7]-GIDIIRGPILSFASTR.3y10_1.heavy 620.699 / 1048.58 2695.0 41.347450256347656 34 8 10 6 10 0.8808674169269488 66.30211428515908 0.035400390625 3 0.7819308779400777 2.5932067429566987 2695.0 24.992882352941177 0.0 - - - - - - - 224.71428571428572 5 7 RFC5 replication factor C (activator 1) 5, 36.5kDa 615 79 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37413.[MT7]-K[MT7]TDIAAFVK[MT7].2b3_1.heavy 712.945 / 633.381 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K3 mitogen-activated protein kinase kinase 3 617 79 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37413.[MT7]-K[MT7]TDIAAFVK[MT7].2y8_1.heavy 712.945 / 1008.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K3 mitogen-activated protein kinase kinase 3 619 79 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37413.[MT7]-K[MT7]TDIAAFVK[MT7].2b4_1.heavy 712.945 / 746.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K3 mitogen-activated protein kinase kinase 3 621 79 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37413.[MT7]-K[MT7]TDIAAFVK[MT7].2b5_1.heavy 712.945 / 817.502 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K3 mitogen-activated protein kinase kinase 3 623 80 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23648.[MT7]-FQLLFK[MT7].2b3_1.heavy 542.344 / 533.32 4939.0 40.7599983215332 34 14 2 10 8 1.9212073977194062 41.28482722885847 0.0 4 0.9370947100483139 4.894580176742509 4939.0 8.397874601487779 1.0 - - - - - - - 766.5555555555555 16 9 UBE2W ubiquitin-conjugating enzyme E2W (putative) 625 80 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23648.[MT7]-FQLLFK[MT7].2y4_1.heavy 542.344 / 664.451 3450.0 40.7599983215332 34 14 2 10 8 1.9212073977194062 41.28482722885847 0.0 4 0.9370947100483139 4.894580176742509 3450.0 12.951559291357766 0.0 - - - - - - - 239.55555555555554 6 18 UBE2W ubiquitin-conjugating enzyme E2W (putative) 627 80 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23648.[MT7]-FQLLFK[MT7].2y5_1.heavy 542.344 / 792.51 2979.0 40.7599983215332 34 14 2 10 8 1.9212073977194062 41.28482722885847 0.0 4 0.9370947100483139 4.894580176742509 2979.0 40.37237578211263 1.0 - - - - - - - 249.36363636363637 5 11 UBE2W ubiquitin-conjugating enzyme E2W (putative) 629 80 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23648.[MT7]-FQLLFK[MT7].2y3_1.heavy 542.344 / 551.367 N/A 40.7599983215332 34 14 2 10 8 1.9212073977194062 41.28482722885847 0.0 4 0.9370947100483139 4.894580176742509 4626.0 9.694325680596325 3.0 - - - - - - - 306.45454545454544 25 11 UBE2W ubiquitin-conjugating enzyme E2W (putative) 631 81 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB540718.[MT7]-MAPPK[MT7].2b3_1.heavy 416.254 / 444.24 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 633 81 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB540718.[MT7]-MAPPK[MT7].2y4_1.heavy 416.254 / 556.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 635 81 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB540718.[MT7]-MAPPK[MT7].2y3_1.heavy 416.254 / 485.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 637 82 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23785.[MT7]-ATVNSQEQK[MT7].2y6_1.heavy 646.856 / 877.45 950.0 15.23330020904541 48 18 10 10 10 3.6398990824596833 21.965259758784768 0.0 3 0.9862946273830319 10.52978929799437 950.0 12.992647058823529 0.0 - - - - - - - 0.0 1 0 MAP2K3;MAP2K6 mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 639 82 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23785.[MT7]-ATVNSQEQK[MT7].2y8_1.heavy 646.856 / 1077.57 713.0 15.23330020904541 48 18 10 10 10 3.6398990824596833 21.965259758784768 0.0 3 0.9862946273830319 10.52978929799437 713.0 15.93764705882353 0.0 - - - - - - - 0.0 1 0 MAP2K3;MAP2K6 mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 641 82 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23785.[MT7]-ATVNSQEQK[MT7].2y5_1.heavy 646.856 / 763.407 679.0 15.23330020904541 48 18 10 10 10 3.6398990824596833 21.965259758784768 0.0 3 0.9862946273830319 10.52978929799437 679.0 6.914785471384127 0.0 - - - - - - - 0.0 1 0 MAP2K3;MAP2K6 mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 643 82 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23785.[MT7]-ATVNSQEQK[MT7].2b4_1.heavy 646.856 / 530.305 N/A 15.23330020904541 48 18 10 10 10 3.6398990824596833 21.965259758784768 0.0 3 0.9862946273830319 10.52978929799437 441.0 4.928823529411764 0.0 - - - - - - - 0.0 0 0 MAP2K3;MAP2K6 mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 645 83 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542484.[MT7]-TFITIGDR.2b3_1.heavy 533.804 / 506.31 N/A 32.8296012878418 50 20 10 10 10 13.968796183589106 7.158813020515148 0.0 3 0.9990853251836028 40.80335746635364 9625.0 5.463023947039551 0.0 - - - - - - - 401.0 19 1 MAP2K3 mitogen-activated protein kinase kinase 3 647 83 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542484.[MT7]-TFITIGDR.2y5_1.heavy 533.804 / 561.299 15439.0 32.8296012878418 50 20 10 10 10 13.968796183589106 7.158813020515148 0.0 3 0.9990853251836028 40.80335746635364 15439.0 27.342733555918514 0.0 - - - - - - - 686.4615384615385 30 13 MAP2K3 mitogen-activated protein kinase kinase 3 649 83 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542484.[MT7]-TFITIGDR.2y6_1.heavy 533.804 / 674.383 11529.0 32.8296012878418 50 20 10 10 10 13.968796183589106 7.158813020515148 0.0 3 0.9990853251836028 40.80335746635364 11529.0 24.515779637830693 0.0 - - - - - - - 218.72727272727272 23 11 MAP2K3 mitogen-activated protein kinase kinase 3 651 83 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542484.[MT7]-TFITIGDR.2y7_1.heavy 533.804 / 821.452 23460.0 32.8296012878418 50 20 10 10 10 13.968796183589106 7.158813020515148 0.0 3 0.9990853251836028 40.80335746635364 23460.0 186.48259037040708 0.0 - - - - - - - 164.1818181818182 46 11 MAP2K3 mitogen-activated protein kinase kinase 3 653 84 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23985.[MT7]-YDPTIEDSYRK[MT7].4y5_1.heavy 419.47 / 812.438 1300.0 25.538999557495117 50 20 10 10 10 5.171458034262018 19.336906407724584 0.0 3 0.9908021447772637 12.858361781023373 1300.0 15.035202252944188 0.0 - - - - - - - 114.08333333333333 2 12 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 655 84 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23985.[MT7]-YDPTIEDSYRK[MT7].4b4_1.heavy 419.47 / 621.3 6575.0 25.538999557495117 50 20 10 10 10 5.171458034262018 19.336906407724584 0.0 3 0.9908021447772637 12.858361781023373 6575.0 44.5705381875742 0.0 - - - - - - - 173.26666666666668 13 15 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 657 84 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23985.[MT7]-YDPTIEDSYRK[MT7].4y6_2.heavy 419.47 / 471.244 48841.0 25.538999557495117 50 20 10 10 10 5.171458034262018 19.336906407724584 0.0 3 0.9908021447772637 12.858361781023373 48841.0 92.7355 0.0 - - - - - - - 758.5 97 8 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 659 84 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23985.[MT7]-YDPTIEDSYRK[MT7].4y7_2.heavy 419.47 / 527.786 34463.0 25.538999557495117 50 20 10 10 10 5.171458034262018 19.336906407724584 0.0 3 0.9908021447772637 12.858361781023373 34463.0 188.898341018244 0.0 - - - - - - - 226.85714285714286 68 14 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 661 85 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543933.[MT7]-GLGPSPAGDGPSGSGK[MT7].3y7_1.heavy 543.621 / 733.396 13816.0 21.771099090576172 48 18 10 10 10 4.503142801801161 22.206713044943218 0.0 3 0.9832004134624628 9.508306976729855 13816.0 32.799604050990915 0.0 - - - - - - - 277.7142857142857 27 14 BAD BCL2-associated agonist of cell death 663 85 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543933.[MT7]-GLGPSPAGDGPSGSGK[MT7].3y6_1.heavy 543.621 / 676.375 23369.0 21.771099090576172 48 18 10 10 10 4.503142801801161 22.206713044943218 0.0 3 0.9832004134624628 9.508306976729855 23369.0 27.717123795404003 0.0 - - - - - - - 1248.7142857142858 46 7 BAD BCL2-associated agonist of cell death 665 85 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543933.[MT7]-GLGPSPAGDGPSGSGK[MT7].3b5_1.heavy 543.621 / 556.321 62336.0 21.771099090576172 48 18 10 10 10 4.503142801801161 22.206713044943218 0.0 3 0.9832004134624628 9.508306976729855 62336.0 30.124400486581976 0.0 - - - - - - - 297.0 124 6 BAD BCL2-associated agonist of cell death 667 85 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543933.[MT7]-GLGPSPAGDGPSGSGK[MT7].3y5_1.heavy 543.621 / 579.322 35890.0 21.771099090576172 48 18 10 10 10 4.503142801801161 22.206713044943218 0.0 3 0.9832004134624628 9.508306976729855 35890.0 34.86378412604653 0.0 - - - - - - - 1200.5 71 8 BAD BCL2-associated agonist of cell death 669 86 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23844.[MT7]-LEHVVEEEK[MT7].3y3_1.heavy 467.261 / 549.3 25691.0 24.795499801635742 48 18 10 10 10 5.392669719368828 18.543690825497887 0.0 3 0.984710536282951 9.96807602568826 25691.0 53.81219350597859 0.0 - - - - - - - 363.5 51 8 RFC5 replication factor C (activator 1) 5, 36.5kDa 671 86 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23844.[MT7]-LEHVVEEEK[MT7].3y4_1.heavy 467.261 / 678.343 34001.0 24.795499801635742 48 18 10 10 10 5.392669719368828 18.543690825497887 0.0 3 0.984710536282951 9.96807602568826 34001.0 93.71745924865706 0.0 - - - - - - - 276.6875 68 16 RFC5 replication factor C (activator 1) 5, 36.5kDa 673 86 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23844.[MT7]-LEHVVEEEK[MT7].3b3_1.heavy 467.261 / 524.295 54568.0 24.795499801635742 48 18 10 10 10 5.392669719368828 18.543690825497887 0.0 3 0.984710536282951 9.96807602568826 54568.0 91.93164861612514 0.0 - - - - - - - 684.7777777777778 109 9 RFC5 replication factor C (activator 1) 5, 36.5kDa 675 86 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23844.[MT7]-LEHVVEEEK[MT7].3y5_1.heavy 467.261 / 777.411 15165.0 24.795499801635742 48 18 10 10 10 5.392669719368828 18.543690825497887 0.0 3 0.984710536282951 9.96807602568826 15165.0 82.69056363598423 0.0 - - - - - - - 207.69230769230768 30 13 RFC5 replication factor C (activator 1) 5, 36.5kDa 677 87 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23982.[MT7]-ASSSLGLQDFDLLR.3y7_1.heavy 555.969 / 906.468 23638.0 42.93629837036133 47 17 10 10 10 4.495295294475972 22.245479651333397 0.0 3 0.9761347205825376 7.97281323358401 23638.0 167.17961824418586 0.0 - - - - - - - 163.78571428571428 47 14 PRKCI protein kinase C, iota 679 87 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23982.[MT7]-ASSSLGLQDFDLLR.3y6_1.heavy 555.969 / 778.409 45682.0 42.93629837036133 47 17 10 10 10 4.495295294475972 22.245479651333397 0.0 3 0.9761347205825376 7.97281323358401 45682.0 158.67183069988027 0.0 - - - - - - - 240.66666666666666 91 9 PRKCI protein kinase C, iota 681 87 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23982.[MT7]-ASSSLGLQDFDLLR.3b6_1.heavy 555.969 / 647.348 89198.0 42.93629837036133 47 17 10 10 10 4.495295294475972 22.245479651333397 0.0 3 0.9761347205825376 7.97281323358401 89198.0 240.21276403008318 0.0 - - - - - - - 785.7777777777778 178 9 PRKCI protein kinase C, iota 683 87 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23982.[MT7]-ASSSLGLQDFDLLR.3y5_1.heavy 555.969 / 663.382 27333.0 42.93629837036133 47 17 10 10 10 4.495295294475972 22.245479651333397 0.0 3 0.9761347205825376 7.97281323358401 27333.0 247.62373624108506 0.0 - - - - - - - 249.0 54 11 PRKCI protein kinase C, iota 685 88 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543731.[MT7]-LAFVLSSNSLK[MT7].2y8_1.heavy 733.945 / 991.59 1762.0 38.98849868774414 47 17 10 10 10 2.8552104268905936 29.142740889780583 0.0 3 0.9724550129751545 7.418893293116669 1762.0 14.23419607843137 0.0 - - - - - - - 201.68421052631578 3 19 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 687 88 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543731.[MT7]-LAFVLSSNSLK[MT7].2b4_1.heavy 733.945 / 575.367 4136.0 38.98849868774414 47 17 10 10 10 2.8552104268905936 29.142740889780583 0.0 3 0.9724550129751545 7.418893293116669 4136.0 13.237585440941507 0.0 - - - - - - - 221.38888888888889 8 18 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 689 88 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543731.[MT7]-LAFVLSSNSLK[MT7].2y6_1.heavy 733.945 / 779.438 N/A 38.98849868774414 47 17 10 10 10 2.8552104268905936 29.142740889780583 0.0 3 0.9724550129751545 7.418893293116669 2911.0 4.264351709479978 1.0 - - - - - - - 278.1578947368421 7 19 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 691 88 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543731.[MT7]-LAFVLSSNSLK[MT7].2y7_1.heavy 733.945 / 892.522 2758.0 38.98849868774414 47 17 10 10 10 2.8552104268905936 29.142740889780583 0.0 3 0.9724550129751545 7.418893293116669 2758.0 11.379024044258458 0.0 - - - - - - - 237.6 5 20 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 693 89 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23849.[MT7]-GMDVYGYLLAR.2y8_1.heavy 701.37 / 954.541 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 695 89 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23849.[MT7]-GMDVYGYLLAR.2b4_1.heavy 701.37 / 547.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 697 89 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23849.[MT7]-GMDVYGYLLAR.2y6_1.heavy 701.37 / 692.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 699 89 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23849.[MT7]-GMDVYGYLLAR.2y7_1.heavy 701.37 / 855.472 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 701 90 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43520.[MT7]-IQLSSLIAAFQVTR.3y7_1.heavy 564.337 / 792.436 25387.0 48.82889938354492 42 12 10 10 10 1.9458094465629312 51.39249384190191 0.0 3 0.8869967292364861 3.636132242534433 25387.0 63.92410071942446 0.0 - - - - - - - 129.8181818181818 50 11 RFC5 replication factor C (activator 1) 5, 36.5kDa 703 90 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43520.[MT7]-IQLSSLIAAFQVTR.3y6_1.heavy 564.337 / 721.399 23613.0 48.82889938354492 42 12 10 10 10 1.9458094465629312 51.39249384190191 0.0 3 0.8869967292364861 3.636132242534433 23613.0 599.1829085303186 0.0 - - - - - - - 96.66666666666667 47 9 RFC5 replication factor C (activator 1) 5, 36.5kDa 705 90 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43520.[MT7]-IQLSSLIAAFQVTR.3b3_1.heavy 564.337 / 499.336 7025.0 48.82889938354492 42 12 10 10 10 1.9458094465629312 51.39249384190191 0.0 3 0.8869967292364861 3.636132242534433 7025.0 186.6642857142857 0.0 - - - - - - - 107.63636363636364 14 11 RFC5 replication factor C (activator 1) 5, 36.5kDa 707 90 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43520.[MT7]-IQLSSLIAAFQVTR.3y8_1.heavy 564.337 / 905.52 3652.0 48.82889938354492 42 12 10 10 10 1.9458094465629312 51.39249384190191 0.0 3 0.8869967292364861 3.636132242534433 3652.0 46.95428571428572 0.0 - - - - - - - 99.57142857142857 7 7 RFC5 replication factor C (activator 1) 5, 36.5kDa 709 91 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43690.[MT7]-TLGANAQTLTLLATVC[CAM]LEDPVTQEK[MT7].4y4_1.heavy 744.406 / 649.364 2041.0 45.840850830078125 26 10 4 6 6 0.7713040571373279 77.16181395568492 0.03150177001953125 5 0.823913013890491 2.8967406270398297 2041.0 11.768525633267053 1.0 - - - - - - - 201.5 8 20 ANAPC7 anaphase promoting complex subunit 7 711 91 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43690.[MT7]-TLGANAQTLTLLATVC[CAM]LEDPVTQEK[MT7].4b5_1.heavy 744.406 / 601.343 967.0 45.840850830078125 26 10 4 6 6 0.7713040571373279 77.16181395568492 0.03150177001953125 5 0.823913013890491 2.8967406270398297 967.0 8.761030270844397 3.0 - - - - - - - 190.29166666666666 4 24 ANAPC7 anaphase promoting complex subunit 7 713 91 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43690.[MT7]-TLGANAQTLTLLATVC[CAM]LEDPVTQEK[MT7].4y6_1.heavy 744.406 / 845.485 2149.0 45.840850830078125 26 10 4 6 6 0.7713040571373279 77.16181395568492 0.03150177001953125 5 0.823913013890491 2.8967406270398297 2149.0 16.585590732255554 0.0 - - - - - - - 153.52380952380952 4 21 ANAPC7 anaphase promoting complex subunit 7 715 91 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43690.[MT7]-TLGANAQTLTLLATVC[CAM]LEDPVTQEK[MT7].4b6_1.heavy 744.406 / 672.38 1235.0 45.840850830078125 26 10 4 6 6 0.7713040571373279 77.16181395568492 0.03150177001953125 5 0.823913013890491 2.8967406270398297 1235.0 4.315613382899628 1.0 - - - - - - - 192.5 5 24 ANAPC7 anaphase promoting complex subunit 7 717 92 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24053.[MT7]-K[MT7]LYSSEQLLIEEC[CAM].2b8_1.heavy 950.502 / 1237.7 1098.0 34.772850036621094 33 7 10 6 10 0.5393136281177285 94.94335822512491 0.0364990234375 3 0.710757301402099 2.2369645593338183 1098.0 9.959999999999999 0.0 - - - - - - - 159.75 2 8 DDIT4 DNA-damage-inducible transcript 4 719 92 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24053.[MT7]-K[MT7]LYSSEQLLIEEC[CAM].2b8_2.heavy 950.502 / 619.355 4299.0 34.772850036621094 33 7 10 6 10 0.5393136281177285 94.94335822512491 0.0364990234375 3 0.710757301402099 2.2369645593338183 4299.0 29.81058394160584 0.0 - - - - - - - 274.25 8 8 DDIT4 DNA-damage-inducible transcript 4 721 92 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24053.[MT7]-K[MT7]LYSSEQLLIEEC[CAM].2b7_2.heavy 950.502 / 562.813 1463.0 34.772850036621094 33 7 10 6 10 0.5393136281177285 94.94335822512491 0.0364990234375 3 0.710757301402099 2.2369645593338183 1463.0 7.914590163934426 0.0 - - - - - - - 167.5 2 6 DDIT4 DNA-damage-inducible transcript 4 723 92 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24053.[MT7]-K[MT7]LYSSEQLLIEEC[CAM].2b7_1.heavy 950.502 / 1124.62 1189.0 34.772850036621094 33 7 10 6 10 0.5393136281177285 94.94335822512491 0.0364990234375 3 0.710757301402099 2.2369645593338183 1189.0 15.972865966150637 0.0 - - - - - - - 156.57142857142858 2 7 DDIT4 DNA-damage-inducible transcript 4 725 93 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541006.[MT7]-VLQSLR.2y4_1.heavy 430.278 / 503.294 6096.0 28.37565040588379 42 20 10 6 6 26.80796630455852 3.730234470751168 0.03369903564453125 5 0.999167576127378 42.772041096317814 6096.0 5.220171265461466 2.0 - - - - - - - 785.0 12 10 RASA2 RAS p21 protein activator 2 727 93 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541006.[MT7]-VLQSLR.2y5_1.heavy 430.278 / 616.378 22070.0 28.37565040588379 42 20 10 6 6 26.80796630455852 3.730234470751168 0.03369903564453125 5 0.999167576127378 42.772041096317814 22070.0 86.17099724817395 0.0 - - - - - - - 311.1111111111111 44 9 RASA2 RAS p21 protein activator 2 729 93 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541006.[MT7]-VLQSLR.2b4_1.heavy 430.278 / 572.352 4204.0 28.37565040588379 42 20 10 6 6 26.80796630455852 3.730234470751168 0.03369903564453125 5 0.999167576127378 42.772041096317814 4204.0 8.115736018234717 2.0 - - - - - - - 749.4615384615385 28 13 RASA2 RAS p21 protein activator 2 731 93 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541006.[MT7]-VLQSLR.2b5_1.heavy 430.278 / 685.437 911.0 28.37565040588379 42 20 10 6 6 26.80796630455852 3.730234470751168 0.03369903564453125 5 0.999167576127378 42.772041096317814 911.0 2.167672628480869 3.0 - - - - - - - 252.6086956521739 7 23 RASA2 RAS p21 protein activator 2 733 94 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43523.[MT7]-AQEGQLSWEWGK[MT7].3y3_1.heavy 569.63 / 534.316 24256.0 35.21609878540039 41 11 10 10 10 1.9067328409386488 40.59948319172381 0.0 3 0.8716140643697099 3.4067777110842514 24256.0 33.51714654574553 0.0 - - - - - - - 1164.142857142857 48 7 NODAL nodal homolog (mouse) 735 94 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43523.[MT7]-AQEGQLSWEWGK[MT7].3b4_1.heavy 569.63 / 530.269 3643.0 35.21609878540039 41 11 10 10 10 1.9067328409386488 40.59948319172381 0.0 3 0.8716140643697099 3.4067777110842514 3643.0 6.213100117362815 0.0 - - - - - - - 776.6 7 10 NODAL nodal homolog (mouse) 737 94 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43523.[MT7]-AQEGQLSWEWGK[MT7].3b5_1.heavy 569.63 / 658.328 16586.0 35.21609878540039 41 11 10 10 10 1.9067328409386488 40.59948319172381 0.0 3 0.8716140643697099 3.4067777110842514 16586.0 9.447275097783573 1.0 - - - - - - - 767.0 33 8 NODAL nodal homolog (mouse) 739 94 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43523.[MT7]-AQEGQLSWEWGK[MT7].3y4_1.heavy 569.63 / 663.358 7766.0 35.21609878540039 41 11 10 10 10 1.9067328409386488 40.59948319172381 0.0 3 0.8716140643697099 3.4067777110842514 7766.0 18.92262731297537 0.0 - - - - - - - 278.90909090909093 15 11 NODAL nodal homolog (mouse) 741 95 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23841.[MT7]-DALVMAQILK[MT7].2y5_1.heavy 695.423 / 716.479 931.0 39.598201751708984 48 18 10 10 10 5.037841097248626 19.849772565199437 0.0 3 0.9839782799014637 9.737024067600164 931.0 8.962760071992248 3.0 - - - - - - - 0.0 1 0 TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 743 95 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23841.[MT7]-DALVMAQILK[MT7].2b4_1.heavy 695.423 / 543.326 2017.0 39.598201751708984 48 18 10 10 10 5.037841097248626 19.849772565199437 0.0 3 0.9839782799014637 9.737024067600164 2017.0 6.470492789210061 0.0 - - - - - - - 241.05263157894737 4 19 TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 745 95 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23841.[MT7]-DALVMAQILK[MT7].2y6_1.heavy 695.423 / 847.519 1396.0 39.598201751708984 48 18 10 10 10 5.037841097248626 19.849772565199437 0.0 3 0.9839782799014637 9.737024067600164 1396.0 25.46747394540943 0.0 - - - - - - - 179.07692307692307 2 13 TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 747 95 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23841.[MT7]-DALVMAQILK[MT7].2y7_1.heavy 695.423 / 946.588 1396.0 39.598201751708984 48 18 10 10 10 5.037841097248626 19.849772565199437 0.0 3 0.9839782799014637 9.737024067600164 1396.0 21.26446319272126 0.0 - - - - - - - 134.1818181818182 2 11 TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 749 96 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23988.[MT7]-IANTYNLIEVDK[MT7].2y4_1.heavy 840.974 / 634.353 3589.0 34.9370002746582 47 17 10 10 10 3.9191984229162045 25.515421575821062 0.0 3 0.9775885288564597 8.228349600260113 3589.0 27.04753623188406 0.0 - - - - - - - 158.9090909090909 7 11 KLHL9 kelch-like 9 (Drosophila) 751 96 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23988.[MT7]-IANTYNLIEVDK[MT7].2b6_1.heavy 840.974 / 821.427 N/A 34.9370002746582 47 17 10 10 10 3.9191984229162045 25.515421575821062 0.0 3 0.9775885288564597 8.228349600260113 2025.0 0.0 0.0 - - - - - - - 266.3157894736842 4 19 KLHL9 kelch-like 9 (Drosophila) 753 96 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23988.[MT7]-IANTYNLIEVDK[MT7].2y3_1.heavy 840.974 / 505.31 1656.0 34.9370002746582 47 17 10 10 10 3.9191984229162045 25.515421575821062 0.0 3 0.9775885288564597 8.228349600260113 1656.0 5.4 0.0 - - - - - - - 222.73684210526315 3 19 KLHL9 kelch-like 9 (Drosophila) 755 96 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23988.[MT7]-IANTYNLIEVDK[MT7].2b7_1.heavy 840.974 / 934.511 1380.0 34.9370002746582 47 17 10 10 10 3.9191984229162045 25.515421575821062 0.0 3 0.9775885288564597 8.228349600260113 1380.0 11.25 0.0 - - - - - - - 192.36363636363637 2 11 KLHL9 kelch-like 9 (Drosophila) 757 97 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543312.[MT7]-K[MT7]STNTSELR.3b8_2.heavy 441.921 / 575.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - RELB v-rel reticuloendotheliosis viral oncogene homolog B 759 97 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543312.[MT7]-K[MT7]STNTSELR.3b7_2.heavy 441.921 / 518.779 N/A N/A - - - - - - - - - 0.0 - - - - - - - RELB v-rel reticuloendotheliosis viral oncogene homolog B 761 98 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37239.[MT7]-DC[CAM]TDGIC[CAM]R.2y4_1.heavy 570.748 / 505.255 3508.0 18.639700412750244 45 18 10 7 10 5.39326197025413 18.54165448508484 0.029600143432617188 3 0.9845312557388063 9.909994490479129 3508.0 24.460434930521025 0.0 - - - - - - - 179.96 7 25 RELB v-rel reticuloendotheliosis viral oncogene homolog B 763 98 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37239.[MT7]-DC[CAM]TDGIC[CAM]R.2b4_1.heavy 570.748 / 636.242 3426.0 18.639700412750244 45 18 10 7 10 5.39326197025413 18.54165448508484 0.029600143432617188 3 0.9845312557388063 9.909994490479129 3426.0 30.001438658428945 0.0 - - - - - - - 126.29411764705883 6 17 RELB v-rel reticuloendotheliosis viral oncogene homolog B 765 98 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37239.[MT7]-DC[CAM]TDGIC[CAM]R.2b5_1.heavy 570.748 / 693.263 619.0 18.639700412750244 45 18 10 7 10 5.39326197025413 18.54165448508484 0.029600143432617188 3 0.9845312557388063 9.909994490479129 619.0 5.970784958013874 0.0 - - - - - - - 0.0 1 0 RELB v-rel reticuloendotheliosis viral oncogene homolog B 767 98 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37239.[MT7]-DC[CAM]TDGIC[CAM]R.2y7_1.heavy 570.748 / 881.36 1568.0 18.639700412750244 45 18 10 7 10 5.39326197025413 18.54165448508484 0.029600143432617188 3 0.9845312557388063 9.909994490479129 1568.0 7.228306730661904 0.0 - - - - - - - 134.93333333333334 3 15 RELB v-rel reticuloendotheliosis viral oncogene homolog B 769 99 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24055.[MT7]-QEYFVVAATLQDIIR.3b4_1.heavy 637.355 / 712.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 771 99 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24055.[MT7]-QEYFVVAATLQDIIR.3b5_1.heavy 637.355 / 811.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 773 99 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24055.[MT7]-QEYFVVAATLQDIIR.3b3_1.heavy 637.355 / 565.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 775 99 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24055.[MT7]-QEYFVVAATLQDIIR.3y5_1.heavy 637.355 / 644.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 777 100 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24056.[MT7]-LNLSFNALESLSWK[MT7].3b6_1.heavy 637.359 / 833.464 1013.0 46.768174171447754 39 13 10 6 10 2.4410669163697363 40.9656938650073 0.036701202392578125 3 0.9088128818381942 4.055448140510973 1013.0 2.990486891385768 1.0 - - - - - - - 184.86666666666667 2 15 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 779 100 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24056.[MT7]-LNLSFNALESLSWK[MT7].3y3_1.heavy 637.359 / 564.326 4799.0 46.768174171447754 39 13 10 6 10 2.4410669163697363 40.9656938650073 0.036701202392578125 3 0.9088128818381942 4.055448140510973 4799.0 36.2943062694704 0.0 - - - - - - - 138.0 9 17 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 781 100 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24056.[MT7]-LNLSFNALESLSWK[MT7].3b4_1.heavy 637.359 / 572.352 1866.0 46.768174171447754 39 13 10 6 10 2.4410669163697363 40.9656938650073 0.036701202392578125 3 0.9088128818381942 4.055448140510973 1866.0 19.777202102803738 0.0 - - - - - - - 180.66666666666666 3 18 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 783 100 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24056.[MT7]-LNLSFNALESLSWK[MT7].3b7_1.heavy 637.359 / 904.501 2239.0 46.768174171447754 39 13 10 6 10 2.4410669163697363 40.9656938650073 0.036701202392578125 3 0.9088128818381942 4.055448140510973 2239.0 33.30972196329272 0.0 - - - - - - - 151.0 4 12 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 785 101 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23633.[MT7]-LYELNK[MT7].2b3_1.heavy 534.321 / 550.299 4532.0 28.849225521087646 45 18 10 7 10 5.402731425500156 18.50915622568496 0.029901504516601562 3 0.9888346115337134 11.668647821384962 4532.0 7.5112093957856505 0.0 - - - - - - - 701.8 9 15 PRKCI protein kinase C, iota 787 101 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23633.[MT7]-LYELNK[MT7].2y4_1.heavy 534.321 / 647.385 4678.0 28.849225521087646 45 18 10 7 10 5.402731425500156 18.50915622568496 0.029901504516601562 3 0.9888346115337134 11.668647821384962 4678.0 5.121063624907867 0.0 - - - - - - - 703.625 9 8 PRKCI protein kinase C, iota 789 101 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23633.[MT7]-LYELNK[MT7].2y5_1.heavy 534.321 / 810.448 11037.0 28.849225521087646 45 18 10 7 10 5.402731425500156 18.50915622568496 0.029901504516601562 3 0.9888346115337134 11.668647821384962 11037.0 24.533122326775022 0.0 - - - - - - - 647.5714285714286 22 7 PRKCI protein kinase C, iota 791 101 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23633.[MT7]-LYELNK[MT7].2y3_1.heavy 534.321 / 518.342 6140.0 28.849225521087646 45 18 10 7 10 5.402731425500156 18.50915622568496 0.029901504516601562 3 0.9888346115337134 11.668647821384962 6140.0 3.298846471156229 0.0 - - - - - - - 1122.357142857143 12 14 PRKCI protein kinase C, iota 793 102 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543512.[MT7]-DALVMAQILK[MT7].3b6_1.heavy 463.951 / 745.404 5204.0 39.598201751708984 48 18 10 10 10 3.223384178437187 24.655498281879915 0.0 3 0.9857145314384272 10.31327877368385 5204.0 77.59082216708022 0.0 - - - - - - - 132.0 10 10 TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 795 102 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543512.[MT7]-DALVMAQILK[MT7].3y3_1.heavy 463.951 / 517.383 20271.0 39.598201751708984 48 18 10 10 10 3.223384178437187 24.655498281879915 0.0 3 0.9857145314384272 10.31327877368385 20271.0 56.75827272727273 0.0 - - - - - - - 284.6666666666667 40 12 TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 797 102 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543512.[MT7]-DALVMAQILK[MT7].3b4_1.heavy 463.951 / 543.326 40853.0 39.598201751708984 48 18 10 10 10 3.223384178437187 24.655498281879915 0.0 3 0.9857145314384272 10.31327877368385 40853.0 227.31121595377797 0.0 - - - - - - - 243.33333333333334 81 15 TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 799 102 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543512.[MT7]-DALVMAQILK[MT7].3b5_1.heavy 463.951 / 674.366 15844.0 39.598201751708984 48 18 10 10 10 3.223384178437187 24.655498281879915 0.0 3 0.9857145314384272 10.31327877368385 15844.0 111.29916398713826 0.0 - - - - - - - 204.9090909090909 31 11 TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 801 103 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37426.[MT7]-VFDLPESLGGIR.2b3_1.heavy 723.907 / 506.273 10955.0 41.263301849365234 46 16 10 10 10 4.00044133512019 19.442287837340327 0.0 3 0.9667235304050631 6.746554246185656 10955.0 79.11117021276596 0.0 - - - - - - - 266.1 21 10 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 803 103 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37426.[MT7]-VFDLPESLGGIR.2y8_1.heavy 723.907 / 828.457 7982.0 41.263301849365234 46 16 10 10 10 4.00044133512019 19.442287837340327 0.0 3 0.9667235304050631 6.746554246185656 7982.0 52.289726114649675 0.0 - - - - - - - 234.84615384615384 15 13 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 805 103 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37426.[MT7]-VFDLPESLGGIR.2y9_1.heavy 723.907 / 941.542 4226.0 41.263301849365234 46 16 10 10 10 4.00044133512019 19.442287837340327 0.0 3 0.9667235304050631 6.746554246185656 4226.0 3.9174216027874564 1.0 - - - - - - - 198.69230769230768 8 13 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 807 103 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37426.[MT7]-VFDLPESLGGIR.2y11_1.heavy 723.907 / 1203.64 3287.0 41.263301849365234 46 16 10 10 10 4.00044133512019 19.442287837340327 0.0 3 0.9667235304050631 6.746554246185656 3287.0 42.71457442451052 0.0 - - - - - - - 117.25 6 8 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 809 104 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37523.[MT7]-FSSSSTSSSPSSLPR.2y12_1.heavy 829.411 / 1192.58 682.0 25.012550354003906 41 15 10 6 10 1.6444787157130585 48.509435541840276 0.038700103759765625 3 0.9528261733895881 5.659650048109487 682.0 3.067237163814181 0.0 - - - - - - - 0.0 1 0 DDIT4 DNA-damage-inducible transcript 4 811 104 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37523.[MT7]-FSSSSTSSSPSSLPR.2y9_1.heavy 829.411 / 917.469 2250.0 25.012550354003906 41 15 10 6 10 1.6444787157130585 48.509435541840276 0.038700103759765625 3 0.9528261733895881 5.659650048109487 2250.0 25.594960545193686 0.0 - - - - - - - 193.92307692307693 4 13 DDIT4 DNA-damage-inducible transcript 4 813 104 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37523.[MT7]-FSSSSTSSSPSSLPR.2y6_1.heavy 829.411 / 656.373 1977.0 25.012550354003906 41 15 10 6 10 1.6444787157130585 48.509435541840276 0.038700103759765625 3 0.9528261733895881 5.659650048109487 1977.0 9.648614443473425 0.0 - - - - - - - 186.4 3 15 DDIT4 DNA-damage-inducible transcript 4 815 104 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37523.[MT7]-FSSSSTSSSPSSLPR.2y11_1.heavy 829.411 / 1105.55 1500.0 25.012550354003906 41 15 10 6 10 1.6444787157130585 48.509435541840276 0.038700103759765625 3 0.9528261733895881 5.659650048109487 1500.0 5.040695523492416 0.0 - - - - - - - 173.36363636363637 3 11 DDIT4 DNA-damage-inducible transcript 4 817 105 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23636.[MT7]-GHLYAVGGR.2y5_1.heavy 537.302 / 459.267 1165.0 21.507200241088867 43 17 10 10 6 2.5074344567600755 31.10334870753389 0.0 5 0.9754678226724344 7.863256681593775 1165.0 3.6635220125786163 13.0 - - - - - - - 312.42105263157896 2 19 KLHL9 kelch-like 9 (Drosophila) 819 105 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23636.[MT7]-GHLYAVGGR.2b4_1.heavy 537.302 / 615.337 1112.0 21.507200241088867 43 17 10 10 6 2.5074344567600755 31.10334870753389 0.0 5 0.9754678226724344 7.863256681593775 1112.0 5.455094339622642 0.0 - - - - - - - 209.96153846153845 2 26 KLHL9 kelch-like 9 (Drosophila) 821 105 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23636.[MT7]-GHLYAVGGR.2y6_1.heavy 537.302 / 622.331 3284.0 21.507200241088867 43 17 10 10 6 2.5074344567600755 31.10334870753389 0.0 5 0.9754678226724344 7.863256681593775 3284.0 19.982830188679248 0.0 - - - - - - - 178.27272727272728 6 22 KLHL9 kelch-like 9 (Drosophila) 823 105 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23636.[MT7]-GHLYAVGGR.2y7_1.heavy 537.302 / 735.415 1854.0 21.507200241088867 43 17 10 10 6 2.5074344567600755 31.10334870753389 0.0 5 0.9754678226724344 7.863256681593775 1854.0 22.91264150943396 1.0 - - - - - - - 150.16666666666666 4 18 KLHL9 kelch-like 9 (Drosophila) 825 106 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37525.[MT7]-DVK[MT7]PSNVLINK[MT7].3b6_1.heavy 553.677 / 929.529 1690.0 26.56209945678711 41 11 10 10 10 0.5605438545775017 95.75790714653081 0.0 3 0.8799141796669682 3.5251002812210035 1690.0 11.522727272727273 0.0 - - - - - - - 198.47058823529412 3 17 LOC100133591;MAP2K3 dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3 827 106 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37525.[MT7]-DVK[MT7]PSNVLINK[MT7].3y3_1.heavy 553.677 / 518.342 14326.0 26.56209945678711 41 11 10 10 10 0.5605438545775017 95.75790714653081 0.0 3 0.8799141796669682 3.5251002812210035 14326.0 10.290537447610832 0.0 - - - - - - - 1285.625 28 8 LOC100133591;MAP2K3 dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3 829 106 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37525.[MT7]-DVK[MT7]PSNVLINK[MT7].3y5_1.heavy 553.677 / 730.494 1469.0 26.56209945678711 41 11 10 10 10 0.5605438545775017 95.75790714653081 0.0 3 0.8799141796669682 3.5251002812210035 1469.0 4.000734943517957 3.0 - - - - - - - 215.88235294117646 3 17 LOC100133591;MAP2K3 dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3 831 106 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37525.[MT7]-DVK[MT7]PSNVLINK[MT7].3b8_2.heavy 553.677 / 571.345 9257.0 26.56209945678711 41 11 10 10 10 0.5605438545775017 95.75790714653081 0.0 3 0.8799141796669682 3.5251002812210035 9257.0 23.614795918367346 0.0 - - - - - - - 307.6875 18 16 LOC100133591;MAP2K3 dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3 833 107 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23638.[MT7]-ITNSPQK[MT7].2y4_1.heavy 538.321 / 603.358 2781.0 17.9596004486084 50 20 10 10 10 7.718770582825286 12.955431040081152 0.0 3 0.9932088842747572 14.967377725450255 2781.0 23.047228469671055 0.0 - - - - - - - 132.65 5 20 IL20RB interleukin 20 receptor beta 835 107 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23638.[MT7]-ITNSPQK[MT7].2y5_1.heavy 538.321 / 717.401 2022.0 17.9596004486084 50 20 10 10 10 7.718770582825286 12.955431040081152 0.0 3 0.9932088842747572 14.967377725450255 2022.0 23.675942225231324 0.0 - - - - - - - 136.85 4 20 IL20RB interleukin 20 receptor beta 837 107 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23638.[MT7]-ITNSPQK[MT7].2y3_1.heavy 538.321 / 516.326 N/A 17.9596004486084 50 20 10 10 10 7.718770582825286 12.955431040081152 0.0 3 0.9932088842747572 14.967377725450255 5561.0 5.295855659936024 0.0 - - - - - - - 1217.909090909091 11 11 IL20RB interleukin 20 receptor beta 839 107 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23638.[MT7]-ITNSPQK[MT7].2y6_1.heavy 538.321 / 818.449 7584.0 17.9596004486084 50 20 10 10 10 7.718770582825286 12.955431040081152 0.0 3 0.9932088842747572 14.967377725450255 7584.0 38.06988142292491 0.0 - - - - - - - 198.23529411764707 15 17 IL20RB interleukin 20 receptor beta 841 108 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23832.[MT7]-IIDFIYTAK[MT7].2y4_1.heavy 686.41 / 626.363 3421.0 41.50362491607666 41 15 10 6 10 1.3333424559625975 43.46620895458036 0.034297943115234375 3 0.9516049384311844 5.587205179172166 3421.0 21.487460554725132 0.0 - - - - - - - 198.13333333333333 6 15 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 843 108 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23832.[MT7]-IIDFIYTAK[MT7].2y8_1.heavy 686.41 / 1114.63 2008.0 41.50362491607666 41 15 10 6 10 1.3333424559625975 43.46620895458036 0.034297943115234375 3 0.9516049384311844 5.587205179172166 2008.0 48.84324324324325 0.0 - - - - - - - 237.8 4 5 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 845 108 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23832.[MT7]-IIDFIYTAK[MT7].2b4_1.heavy 686.41 / 633.373 2454.0 41.50362491607666 41 15 10 6 10 1.3333424559625975 43.46620895458036 0.034297943115234375 3 0.9516049384311844 5.587205179172166 2454.0 2.638709677419355 1.0 - - - - - - - 196.35714285714286 4 14 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 847 108 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23832.[MT7]-IIDFIYTAK[MT7].2y6_1.heavy 686.41 / 886.516 3495.0 41.50362491607666 41 15 10 6 10 1.3333424559625975 43.46620895458036 0.034297943115234375 3 0.9516049384311844 5.587205179172166 3495.0 27.972358735657068 0.0 - - - - - - - 163.5 6 10 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 849 109 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23971.[MT7]-K[MT7]IIDFIYTAK[MT7].2y4_1.heavy 822.508 / 626.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 851 109 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23971.[MT7]-K[MT7]IIDFIYTAK[MT7].2y9_1.heavy 822.508 / 1227.71 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 853 109 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23971.[MT7]-K[MT7]IIDFIYTAK[MT7].2b4_1.heavy 822.508 / 758.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 855 109 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23971.[MT7]-K[MT7]IIDFIYTAK[MT7].2b5_1.heavy 822.508 / 905.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 857 110 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23970.[MT7]-INVNEIFYDLVR.3y6_1.heavy 546.971 / 812.43 72375.0 49.507198333740234 46 16 10 10 10 3.8592687636289518 25.9116444395979 0.0 3 0.9683905040513935 6.923136761045826 72375.0 115.09835657370517 0.0 - - - - - - - 238.71428571428572 144 7 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 859 110 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23970.[MT7]-INVNEIFYDLVR.3b4_1.heavy 546.971 / 585.348 36164.0 49.507198333740234 46 16 10 10 10 3.8592687636289518 25.9116444395979 0.0 3 0.9683905040513935 6.923136761045826 36164.0 689.500852922821 0.0 - - - - - - - 223.5 72 16 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 861 110 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23970.[MT7]-INVNEIFYDLVR.3b5_1.heavy 546.971 / 714.39 64845.0 49.507198333740234 46 16 10 10 10 3.8592687636289518 25.9116444395979 0.0 3 0.9683905040513935 6.923136761045826 64845.0 156.55103686635942 0.0 - - - - - - - 202.5 129 14 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 863 110 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23970.[MT7]-INVNEIFYDLVR.3y5_1.heavy 546.971 / 665.362 56617.0 49.507198333740234 46 16 10 10 10 3.8592687636289518 25.9116444395979 0.0 3 0.9683905040513935 6.923136761045826 56617.0 83.92053932180261 0.0 - - - - - - - 289.0 113 9 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 865 111 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543948.[MT7]-GQSDVGVAVFENK[MT7].3b6_1.heavy 546.629 / 688.338 53559.0 31.501399993896484 44 14 10 10 10 1.340333680402908 59.32173947221834 0.0 3 0.9353943168302351 4.829038331099776 53559.0 36.878988765332124 0.0 - - - - - - - 376.75 107 4 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 867 111 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543948.[MT7]-GQSDVGVAVFENK[MT7].3b4_1.heavy 546.629 / 532.248 20802.0 31.501399993896484 44 14 10 10 10 1.340333680402908 59.32173947221834 0.0 3 0.9353943168302351 4.829038331099776 20802.0 23.79626263051195 0.0 - - - - - - - 1237.2857142857142 41 7 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 869 111 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543948.[MT7]-GQSDVGVAVFENK[MT7].3y4_1.heavy 546.629 / 681.369 46123.0 31.501399993896484 44 14 10 10 10 1.340333680402908 59.32173947221834 0.0 3 0.9353943168302351 4.829038331099776 46123.0 60.83931308755007 0.0 - - - - - - - 732.1111111111111 92 9 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 871 111 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543948.[MT7]-GQSDVGVAVFENK[MT7].3b7_1.heavy 546.629 / 787.407 16943.0 31.501399993896484 44 14 10 10 10 1.340333680402908 59.32173947221834 0.0 3 0.9353943168302351 4.829038331099776 16943.0 57.364786445395936 0.0 - - - - - - - 238.84615384615384 33 13 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 873 112 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 636748.0 34.20109939575195 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 636748.0 189.51113986441547 0.0 - - - - - - - 241.5 1273 4 875 112 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 173757.0 34.20109939575195 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 173757.0 583.7741597501497 0.0 - - - - - - - 208.15384615384616 347 13 877 112 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 237214.0 34.20109939575195 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 237214.0 163.6661681046957 0.0 - - - - - - - 265.75 474 8 879 113 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543840.[MT7]-GALLDVC[CAM]VEQGK[MT7].3b6_1.heavy 526.292 / 713.431 29025.0 32.40330123901367 44 14 10 10 10 2.533019129268485 39.478580656782945 0.0 3 0.9303699897911605 4.649554529939085 29025.0 46.69724201639949 0.0 - - - - - - - 740.625 58 8 DDIT4 DNA-damage-inducible transcript 4 881 113 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543840.[MT7]-GALLDVC[CAM]VEQGK[MT7].3b5_1.heavy 526.292 / 614.363 68094.0 32.40330123901367 44 14 10 10 10 2.533019129268485 39.478580656782945 0.0 3 0.9303699897911605 4.649554529939085 68094.0 72.88219041692595 0.0 - - - - - - - 658.3333333333334 136 9 DDIT4 DNA-damage-inducible transcript 4 883 113 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543840.[MT7]-GALLDVC[CAM]VEQGK[MT7].3y4_1.heavy 526.292 / 605.338 48509.0 32.40330123901367 44 14 10 10 10 2.533019129268485 39.478580656782945 0.0 3 0.9303699897911605 4.649554529939085 48509.0 80.28227103384998 0.0 - - - - - - - 680.7777777777778 97 9 DDIT4 DNA-damage-inducible transcript 4 885 113 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543840.[MT7]-GALLDVC[CAM]VEQGK[MT7].3y5_1.heavy 526.292 / 704.406 17777.0 32.40330123901367 44 14 10 10 10 2.533019129268485 39.478580656782945 0.0 3 0.9303699897911605 4.649554529939085 17777.0 30.683989733071115 1.0 - - - - - - - 817.5714285714286 37 7 DDIT4 DNA-damage-inducible transcript 4 887 114 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23977.[MT7]-FADALGLELAQVK[MT7].3b6_1.heavy 554.994 / 719.385 120727.0 42.05779838562012 39 13 10 6 10 1.21594328669291 65.29110960022706 0.03639984130859375 3 0.9194410847914545 4.3186300158099975 120727.0 344.5923177737882 0.0 - - - - - - - 249.25 241 12 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 889 114 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23977.[MT7]-FADALGLELAQVK[MT7].3b4_1.heavy 554.994 / 549.279 57893.0 42.05779838562012 39 13 10 6 10 1.21594328669291 65.29110960022706 0.03639984130859375 3 0.9194410847914545 4.3186300158099975 57893.0 94.57636968150851 0.0 - - - - - - - 825.1428571428571 115 7 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 891 114 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23977.[MT7]-FADALGLELAQVK[MT7].3b5_1.heavy 554.994 / 662.363 36601.0 42.05779838562012 39 13 10 6 10 1.21594328669291 65.29110960022706 0.03639984130859375 3 0.9194410847914545 4.3186300158099975 36601.0 85.92787374683266 0.0 - - - - - - - 278.38461538461536 73 13 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 893 114 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23977.[MT7]-FADALGLELAQVK[MT7].3y4_1.heavy 554.994 / 589.379 108271.0 42.05779838562012 39 13 10 6 10 1.21594328669291 65.29110960022706 0.03639984130859375 3 0.9194410847914545 4.3186300158099975 108271.0 221.73525431381668 0.0 - - - - - - - 719.0 216 9 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 895 115 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24068.[MT7]-QLGGSTLLWEAESSWR.2y4_1.heavy 982.503 / 535.262 N/A N/A - - - - - - - - - 0.0 - - - - - - - NODAL nodal homolog (mouse) 897 115 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24068.[MT7]-QLGGSTLLWEAESSWR.2y8_1.heavy 982.503 / 1050.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - NODAL nodal homolog (mouse) 899 115 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24068.[MT7]-QLGGSTLLWEAESSWR.2b4_1.heavy 982.503 / 500.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - NODAL nodal homolog (mouse) 901 115 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24068.[MT7]-QLGGSTLLWEAESSWR.2y9_1.heavy 982.503 / 1163.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - NODAL nodal homolog (mouse) 903 116 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23589.[MT7]-NITELK[MT7].2y4_1.heavy 503.313 / 634.389 12102.0 26.082600593566895 44 18 10 6 10 2.6723979103130544 29.579293934860747 0.03660011291503906 3 0.9826326391656127 9.351147326235724 12102.0 9.557744339303818 0.0 - - - - - - - 712.4285714285714 24 7 RFC5 replication factor C (activator 1) 5, 36.5kDa 905 116 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23589.[MT7]-NITELK[MT7].2y5_1.heavy 503.313 / 747.473 8948.0 26.082600593566895 44 18 10 6 10 2.6723979103130544 29.579293934860747 0.03660011291503906 3 0.9826326391656127 9.351147326235724 8948.0 56.12836363636363 0.0 - - - - - - - 265.9375 17 16 RFC5 replication factor C (activator 1) 5, 36.5kDa 907 116 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23589.[MT7]-NITELK[MT7].2b4_1.heavy 503.313 / 602.327 3667.0 26.082600593566895 44 18 10 6 10 2.6723979103130544 29.579293934860747 0.03660011291503906 3 0.9826326391656127 9.351147326235724 3667.0 4.546989112153669 1.0 - - - - - - - 1194.5714285714287 11 7 RFC5 replication factor C (activator 1) 5, 36.5kDa 909 116 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23589.[MT7]-NITELK[MT7].2y3_1.heavy 503.313 / 533.341 5207.0 26.082600593566895 44 18 10 6 10 2.6723979103130544 29.579293934860747 0.03660011291503906 3 0.9826326391656127 9.351147326235724 5207.0 4.516604708798017 0.0 - - - - - - - 712.3571428571429 10 14 RFC5 replication factor C (activator 1) 5, 36.5kDa 911 117 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23760.[MT7]-VQEAIIHFR.3y7_1.heavy 419.579 / 885.494 N/A 31.890899658203125 41 15 10 10 6 2.963807386062058 24.730333824144132 0.0 5 0.9500744649567154 5.500185931232179 0.0 0.0 1.0 - - - - - - - 0.0 0 0 ANAPC7 anaphase promoting complex subunit 7 913 117 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23760.[MT7]-VQEAIIHFR.3y6_1.heavy 419.579 / 756.451 571.0 31.890899658203125 41 15 10 10 6 2.963807386062058 24.730333824144132 0.0 5 0.9500744649567154 5.500185931232179 571.0 4.909473684210526 4.0 - - - - - - - 0.0 1 0 ANAPC7 anaphase promoting complex subunit 7 915 117 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23760.[MT7]-VQEAIIHFR.3y3_1.heavy 419.579 / 459.246 26067.0 31.890899658203125 41 15 10 10 6 2.963807386062058 24.730333824144132 0.0 5 0.9500744649567154 5.500185931232179 26067.0 93.5682884957836 0.0 - - - - - - - 285.38461538461536 52 13 ANAPC7 anaphase promoting complex subunit 7 917 117 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23760.[MT7]-VQEAIIHFR.3b3_1.heavy 419.579 / 501.279 13985.0 31.890899658203125 41 15 10 10 6 2.963807386062058 24.730333824144132 0.0 5 0.9500744649567154 5.500185931232179 13985.0 80.94644512068609 0.0 - - - - - - - 237.75 27 16 ANAPC7 anaphase promoting complex subunit 7 919 118 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543443.[MT7]-IIDFIYTAK[MT7].3y3_1.heavy 457.942 / 463.3 95825.0 41.48647594451904 39 13 10 6 10 1.320024506363548 50.852996210373355 0.034297943115234375 3 0.9186618798859144 4.29760673735639 95825.0 668.9672316253724 0.0 - - - - - - - 239.41666666666666 191 12 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 921 118 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543443.[MT7]-IIDFIYTAK[MT7].3b4_1.heavy 457.942 / 633.373 83023.0 41.48647594451904 39 13 10 6 10 1.320024506363548 50.852996210373355 0.034297943115234375 3 0.9186618798859144 4.29760673735639 83023.0 312.23446208607805 0.0 - - - - - - - 220.76923076923077 166 13 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 923 118 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543443.[MT7]-IIDFIYTAK[MT7].3y4_1.heavy 457.942 / 626.363 46555.0 41.48647594451904 39 13 10 6 10 1.320024506363548 50.852996210373355 0.034297943115234375 3 0.9186618798859144 4.29760673735639 46555.0 230.61969129091665 0.0 - - - - - - - 238.84615384615384 93 13 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 925 118 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543443.[MT7]-IIDFIYTAK[MT7].3b3_1.heavy 457.942 / 486.304 87523.0 41.48647594451904 39 13 10 6 10 1.320024506363548 50.852996210373355 0.034297943115234375 3 0.9186618798859144 4.29760673735639 87523.0 373.0224044723124 0.0 - - - - - - - 255.14285714285714 175 14 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 927 119 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543025.[MT7]-TSTILAC[CAM]AK[MT7].3y3_1.heavy 418.244 / 522.283 33324.0 26.738100051879883 46 16 10 10 10 5.005089610166604 19.979662261565643 0.0 3 0.9620259905923925 6.312990683189828 33324.0 57.04871936202173 0.0 - - - - - - - 685.1818181818181 66 11 RFC5 replication factor C (activator 1) 5, 36.5kDa 929 119 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543025.[MT7]-TSTILAC[CAM]AK[MT7].3b4_1.heavy 418.244 / 547.321 27265.0 26.738100051879883 46 16 10 10 10 5.005089610166604 19.979662261565643 0.0 3 0.9620259905923925 6.312990683189828 27265.0 49.8762466278238 0.0 - - - - - - - 1256.0 54 7 RFC5 replication factor C (activator 1) 5, 36.5kDa 931 119 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543025.[MT7]-TSTILAC[CAM]AK[MT7].3y4_1.heavy 418.244 / 593.32 21206.0 26.738100051879883 46 16 10 10 10 5.005089610166604 19.979662261565643 0.0 3 0.9620259905923925 6.312990683189828 21206.0 40.1047889266313 0.0 - - - - - - - 205.92857142857142 42 14 RFC5 replication factor C (activator 1) 5, 36.5kDa 933 119 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543025.[MT7]-TSTILAC[CAM]AK[MT7].3b3_1.heavy 418.244 / 434.237 17660.0 26.738100051879883 46 16 10 10 10 5.005089610166604 19.979662261565643 0.0 3 0.9620259905923925 6.312990683189828 17660.0 32.81511672582471 0.0 - - - - - - - 646.5 35 8 RFC5 replication factor C (activator 1) 5, 36.5kDa 935 120 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24116.[MT7]-LVILDEADAMTQDAQNALR.3y7_1.heavy 744.387 / 787.406 2149.0 47.22809982299805 50 20 10 10 10 6.175288547710763 16.19357528435994 0.0 3 0.9935686607396206 15.3807894489648 2149.0 17.605236786811055 0.0 - - - - - - - 176.05555555555554 4 18 RFC5 replication factor C (activator 1) 5, 36.5kDa 937 120 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24116.[MT7]-LVILDEADAMTQDAQNALR.3y6_1.heavy 744.387 / 672.379 1826.0 47.22809982299805 50 20 10 10 10 6.175288547710763 16.19357528435994 0.0 3 0.9935686607396206 15.3807894489648 1826.0 13.588837209302326 0.0 - - - - - - - 196.85714285714286 3 21 RFC5 replication factor C (activator 1) 5, 36.5kDa 939 120 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24116.[MT7]-LVILDEADAMTQDAQNALR.3b6_1.heavy 744.387 / 827.5 1987.0 47.22809982299805 50 20 10 10 10 6.175288547710763 16.19357528435994 0.0 3 0.9935686607396206 15.3807894489648 1987.0 39.58596899224806 0.0 - - - - - - - 128.38888888888889 3 18 RFC5 replication factor C (activator 1) 5, 36.5kDa 941 120 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24116.[MT7]-LVILDEADAMTQDAQNALR.3b5_1.heavy 744.387 / 698.457 1934.0 47.22809982299805 50 20 10 10 10 6.175288547710763 16.19357528435994 0.0 3 0.9935686607396206 15.3807894489648 1934.0 6.686702127659574 0.0 - - - - - - - 174.6 3 20 RFC5 replication factor C (activator 1) 5, 36.5kDa 943 121 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542460.[MT7]-TAVDTVFR.2y4_1.heavy 526.796 / 522.304 35294.0 30.127899169921875 46 16 10 10 10 1.9570222479766362 34.529483714475845 0.0 3 0.9661285284303115 6.686699455661937 35294.0 31.260047877706214 0.0 - - - - - - - 1688.0 70 7 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 945 121 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542460.[MT7]-TAVDTVFR.2y5_1.heavy 526.796 / 637.33 13721.0 30.127899169921875 46 16 10 10 10 1.9570222479766362 34.529483714475845 0.0 3 0.9661285284303115 6.686699455661937 13721.0 33.397428330383285 0.0 - - - - - - - 732.0 27 10 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 947 121 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542460.[MT7]-TAVDTVFR.2b4_1.heavy 526.796 / 531.289 36361.0 30.127899169921875 46 16 10 10 10 1.9570222479766362 34.529483714475845 0.0 3 0.9661285284303115 6.686699455661937 36361.0 98.6391711143336 0.0 - - - - - - - 675.4285714285714 72 7 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 949 121 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542460.[MT7]-TAVDTVFR.2y7_1.heavy 526.796 / 807.436 26604.0 30.127899169921875 46 16 10 10 10 1.9570222479766362 34.529483714475845 0.0 3 0.9661285284303115 6.686699455661937 26604.0 90.5205139035724 0.0 - - - - - - - 262.3888888888889 53 18 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 951 122 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23762.[MT7]-FRYEC[CAM]EGR.3b6_2.heavy 420.869 / 515.233 N/A 21.991833368937176 46 20 10 6 10 4.458599417230753 16.7953351666033 0.03350067138671875 3 0.9971598383626998 23.151972547528786 8113.0 3.9602946904886416 0.0 - - - - - - - 1730.75 16 8 RELB v-rel reticuloendotheliosis viral oncogene homolog B 953 122 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23762.[MT7]-FRYEC[CAM]EGR.3y6_1.heavy 420.869 / 813.32 3516.0 21.991833368937176 46 20 10 6 10 4.458599417230753 16.7953351666033 0.03350067138671875 3 0.9971598383626998 23.151972547528786 3516.0 71.62222222222223 0.0 - - - - - - - 144.16666666666666 7 12 RELB v-rel reticuloendotheliosis viral oncogene homolog B 955 122 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23762.[MT7]-FRYEC[CAM]EGR.3y4_1.heavy 420.869 / 521.214 12981.0 21.991833368937176 46 20 10 6 10 4.458599417230753 16.7953351666033 0.03350067138671875 3 0.9971598383626998 23.151972547528786 12981.0 63.25140086698608 1.0 - - - - - - - 237.27777777777777 25 18 RELB v-rel reticuloendotheliosis viral oncogene homolog B 957 122 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23762.[MT7]-FRYEC[CAM]EGR.3y5_1.heavy 420.869 / 650.256 3786.0 21.991833368937176 46 20 10 6 10 4.458599417230753 16.7953351666033 0.03350067138671875 3 0.9971598383626998 23.151972547528786 3786.0 62.00650233426705 0.0 - - - - - - - 178.11764705882354 7 17 RELB v-rel reticuloendotheliosis viral oncogene homolog B 959 123 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB540875.[MT7]-ASWEGR.2y4_1.heavy 425.22 / 547.262 3195.0 21.311399459838867 40 14 10 10 6 2.504044976900007 39.93538491620842 0.0 5 0.9469300824845539 5.333330949828965 3195.0 6.667316686607517 2.0 - - - - - - - 780.2857142857143 21 7 RELB v-rel reticuloendotheliosis viral oncogene homolog B 961 123 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB540875.[MT7]-ASWEGR.2b3_1.heavy 425.22 / 489.258 3056.0 21.311399459838867 40 14 10 10 6 2.504044976900007 39.93538491620842 0.0 5 0.9469300824845539 5.333330949828965 3056.0 8.20755683637528 1.0 - - - - - - - 625.0 7 8 RELB v-rel reticuloendotheliosis viral oncogene homolog B 963 123 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB540875.[MT7]-ASWEGR.2y5_1.heavy 425.22 / 634.294 13565.0 21.311399459838867 40 14 10 10 6 2.504044976900007 39.93538491620842 0.0 5 0.9469300824845539 5.333330949828965 13565.0 19.36639035122181 0.0 - - - - - - - 793.7142857142857 27 7 RELB v-rel reticuloendotheliosis viral oncogene homolog B 965 123 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB540875.[MT7]-ASWEGR.2b4_1.heavy 425.22 / 618.3 10093.0 21.311399459838867 40 14 10 10 6 2.504044976900007 39.93538491620842 0.0 5 0.9469300824845539 5.333330949828965 10093.0 60.79725222232198 0.0 - - - - - - - 228.58823529411765 20 17 RELB v-rel reticuloendotheliosis viral oncogene homolog B 967 124 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542468.[MT7]-EQGQNLAR.2b4_1.heavy 530.287 / 587.291 1865.0 16.22510051727295 43 17 10 6 10 2.459688930063719 31.559658267696523 0.03980064392089844 3 0.9720007196774868 7.358179288190348 1865.0 11.881427556818181 0.0 - - - - - - - 148.25 3 20 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 969 124 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542468.[MT7]-EQGQNLAR.2y6_1.heavy 530.287 / 658.363 6289.0 16.22510051727295 43 17 10 6 10 2.459688930063719 31.559658267696523 0.03980064392089844 3 0.9720007196774868 7.358179288190348 6289.0 65.83936634478628 0.0 - - - - - - - 166.5 12 20 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 971 124 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542468.[MT7]-EQGQNLAR.2b5_1.heavy 530.287 / 701.333 4095.0 16.22510051727295 43 17 10 6 10 2.459688930063719 31.559658267696523 0.03980064392089844 3 0.9720007196774868 7.358179288190348 4095.0 32.49270154951718 0.0 - - - - - - - 138.9 8 20 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 973 124 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542468.[MT7]-EQGQNLAR.2y7_1.heavy 530.287 / 786.422 13639.0 16.22510051727295 43 17 10 6 10 2.459688930063719 31.559658267696523 0.03980064392089844 3 0.9720007196774868 7.358179288190348 13639.0 101.33862653943399 0.0 - - - - - - - 149.0 27 14 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 975 125 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541997.[MT7]-QSSSWTR.2y4_1.heavy 498.255 / 549.278 1104.0 19.721500396728516 43 20 10 3 10 21.120199033269166 4.734803864417993 0.06789970397949219 3 0.9966296731229586 21.25222015880675 1104.0 -0.5780104712041885 1.0 - - - - - - - 215.83333333333334 3 12 BAD BCL2-associated agonist of cell death 977 125 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541997.[MT7]-QSSSWTR.2y5_1.heavy 498.255 / 636.31 2207.0 19.721500396728516 43 20 10 3 10 21.120199033269166 4.734803864417993 0.06789970397949219 3 0.9966296731229586 21.25222015880675 2207.0 -1.7309803921568623 0.0 - - - - - - - 265.25 4 12 BAD BCL2-associated agonist of cell death 979 125 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541997.[MT7]-QSSSWTR.2b4_1.heavy 498.255 / 534.264 2886.0 19.721500396728516 43 20 10 3 10 21.120199033269166 4.734803864417993 0.06789970397949219 3 0.9966296731229586 21.25222015880675 2886.0 -1.5109947643979051 0.0 - - - - - - - 180.25 5 12 BAD BCL2-associated agonist of cell death 981 125 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541997.[MT7]-QSSSWTR.2y6_1.heavy 498.255 / 723.342 15493.0 19.721500396728516 43 20 10 3 10 21.120199033269166 4.734803864417993 0.06789970397949219 3 0.9966296731229586 21.25222015880675 15493.0 -0.6552930513595179 0.0 - - - - - - - 254.75 30 8 BAD BCL2-associated agonist of cell death 983 126 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23864.[MT7]-EALPDGVNISK[MT7].2b8_1.heavy 715.908 / 940.486 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLE3 polymerase (DNA directed), epsilon 3 (p17 subunit) 985 126 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23864.[MT7]-EALPDGVNISK[MT7].2y4_1.heavy 715.908 / 605.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLE3 polymerase (DNA directed), epsilon 3 (p17 subunit) 987 126 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23864.[MT7]-EALPDGVNISK[MT7].2y8_1.heavy 715.908 / 973.544 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLE3 polymerase (DNA directed), epsilon 3 (p17 subunit) 989 126 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23864.[MT7]-EALPDGVNISK[MT7].2y6_1.heavy 715.908 / 761.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLE3 polymerase (DNA directed), epsilon 3 (p17 subunit) 991 127 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23862.[MT7]-DIPGLTDTTVPR.2y5_1.heavy 714.894 / 573.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6 ribosomal protein S6 993 127 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23862.[MT7]-DIPGLTDTTVPR.2y9_1.heavy 714.894 / 959.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6 ribosomal protein S6 995 127 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23862.[MT7]-DIPGLTDTTVPR.2y10_1.heavy 714.894 / 1056.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6 ribosomal protein S6 997 127 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23862.[MT7]-DIPGLTDTTVPR.2y7_1.heavy 714.894 / 789.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6 ribosomal protein S6 999 128 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43282.[MT7]-TVFFESLER.2y4_1.heavy 636.341 / 504.278 1199.0 38.724074363708496 38 20 4 6 8 11.332802980902752 8.823942335229248 0.034900665283203125 4 0.9970383622548038 22.671964770869618 1199.0 4.84396 3.0 - - - - - - - 276.3157894736842 2 19 UBA6 ubiquitin-like modifier activating enzyme 6 1001 128 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43282.[MT7]-TVFFESLER.2y8_1.heavy 636.341 / 1026.53 1799.0 38.724074363708496 38 20 4 6 8 11.332802980902752 8.823942335229248 0.034900665283203125 4 0.9970383622548038 22.671964770869618 1799.0 4.7973333333333334 0.0 - - - - - - - 135.0 3 10 UBA6 ubiquitin-like modifier activating enzyme 6 1003 128 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43282.[MT7]-TVFFESLER.2y5_1.heavy 636.341 / 633.32 1349.0 38.724074363708496 38 20 4 6 8 11.332802980902752 8.823942335229248 0.034900665283203125 4 0.9970383622548038 22.671964770869618 1349.0 3.5973333333333337 1.0 - - - - - - - 287.5 2 18 UBA6 ubiquitin-like modifier activating enzyme 6 1005 128 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43282.[MT7]-TVFFESLER.2y7_1.heavy 636.341 / 927.457 3148.0 38.724074363708496 38 20 4 6 8 11.332802980902752 8.823942335229248 0.034900665283203125 4 0.9970383622548038 22.671964770869618 3148.0 22.840488888888892 1.0 - - - - - - - 177.27272727272728 11 11 UBA6 ubiquitin-like modifier activating enzyme 6 1007 129 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23965.[MT7]-GLGPSPAGDGPSGSGK[MT7].2y9_1.heavy 814.928 / 905.445 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAD BCL2-associated agonist of cell death 1009 129 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23965.[MT7]-GLGPSPAGDGPSGSGK[MT7].2y6_1.heavy 814.928 / 676.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAD BCL2-associated agonist of cell death 1011 129 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23965.[MT7]-GLGPSPAGDGPSGSGK[MT7].2y11_1.heavy 814.928 / 1073.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAD BCL2-associated agonist of cell death 1013 129 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23965.[MT7]-GLGPSPAGDGPSGSGK[MT7].2y7_1.heavy 814.928 / 733.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAD BCL2-associated agonist of cell death 1015 130 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43676.[MT7]-LLSSLLLTMSNNNPELFSPPQK[MT7].4y5_1.heavy 683.629 / 700.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 1017 130 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43676.[MT7]-LLSSLLLTMSNNNPELFSPPQK[MT7].4y4_1.heavy 683.629 / 613.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 1019 130 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43676.[MT7]-LLSSLLLTMSNNNPELFSPPQK[MT7].4y3_1.heavy 683.629 / 516.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 1021 130 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43676.[MT7]-LLSSLLLTMSNNNPELFSPPQK[MT7].4b6_1.heavy 683.629 / 771.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 1023 131 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 294176.0 22.78969955444336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 294176.0 337.4360626531271 0.0 - - - - - - - 280.14285714285717 588 7 1025 131 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 539214.0 22.78969955444336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 539214.0 1458.0800057231158 0.0 - - - - - - - 249.77777777777777 1078 9 1027 131 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 1837470.0 22.78969955444336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1837470.0 4530.2474600003725 0.0 - - - - - - - 692.0 3674 2 1029 132 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43400.[MT7]-IRNLPWVEK[MT7].2b8_1.heavy 721.94 / 1152.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1031 132 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43400.[MT7]-IRNLPWVEK[MT7].2b3_1.heavy 721.94 / 528.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1033 132 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43400.[MT7]-IRNLPWVEK[MT7].2y5_1.heavy 721.94 / 802.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1035 132 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43400.[MT7]-IRNLPWVEK[MT7].2y3_1.heavy 721.94 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1037 133 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23755.[MT7]-TSTILAC[CAM]AK[MT7].2y4_1.heavy 626.862 / 593.32 1681.0 26.746874809265137 38 12 10 6 10 0.8490614979165689 73.64532725535825 0.035099029541015625 3 0.8850590011830899 3.6047445056852117 1681.0 4.796301369863014 2.0 - - - - - - - 170.33333333333334 3 18 RFC5 replication factor C (activator 1) 5, 36.5kDa 1039 133 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23755.[MT7]-TSTILAC[CAM]AK[MT7].2y5_1.heavy 626.862 / 706.404 2412.0 26.746874809265137 38 12 10 6 10 0.8490614979165689 73.64532725535825 0.035099029541015625 3 0.8850590011830899 3.6047445056852117 2412.0 8.805941273754174 0.0 - - - - - - - 229.5 4 14 RFC5 replication factor C (activator 1) 5, 36.5kDa 1041 133 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23755.[MT7]-TSTILAC[CAM]AK[MT7].2b4_1.heavy 626.862 / 547.321 2339.0 26.746874809265137 38 12 10 6 10 0.8490614979165689 73.64532725535825 0.035099029541015625 3 0.8850590011830899 3.6047445056852117 2339.0 11.534794520547944 0.0 - - - - - - - 237.3125 4 16 RFC5 replication factor C (activator 1) 5, 36.5kDa 1043 133 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23755.[MT7]-TSTILAC[CAM]AK[MT7].2y3_1.heavy 626.862 / 522.283 1243.0 26.746874809265137 38 12 10 6 10 0.8490614979165689 73.64532725535825 0.035099029541015625 3 0.8850590011830899 3.6047445056852117 1243.0 16.601712328767125 0.0 - - - - - - - 180.06666666666666 2 15 RFC5 replication factor C (activator 1) 5, 36.5kDa 1045 134 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23571.[MT7]-EASEQK[MT7].2y4_1.heavy 490.269 / 635.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLE3 polymerase (DNA directed), epsilon 3 (p17 subunit) 1047 134 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23571.[MT7]-EASEQK[MT7].2y5_1.heavy 490.269 / 706.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLE3 polymerase (DNA directed), epsilon 3 (p17 subunit) 1049 134 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23571.[MT7]-EASEQK[MT7].2b4_1.heavy 490.269 / 561.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLE3 polymerase (DNA directed), epsilon 3 (p17 subunit) 1051 134 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23571.[MT7]-EASEQK[MT7].2b5_1.heavy 490.269 / 689.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLE3 polymerase (DNA directed), epsilon 3 (p17 subunit) 1053 135 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23756.[MT7]-VC[CAM]NVAFEK[MT7].2b3_1.heavy 627.841 / 518.251 1753.0 27.53897523880005 42 16 10 6 10 4.641749969873637 21.543598998013742 0.03610038757324219 3 0.9683524424718498 6.918950179440783 1753.0 11.269285714285715 0.0 - - - - - - - 191.1818181818182 3 22 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1055 135 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23756.[MT7]-VC[CAM]NVAFEK[MT7].2y4_1.heavy 627.841 / 638.363 1823.0 27.53897523880005 42 16 10 6 10 4.641749969873637 21.543598998013742 0.03610038757324219 3 0.9683524424718498 6.918950179440783 1823.0 10.150778591778591 0.0 - - - - - - - 223.0 3 11 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1057 135 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23756.[MT7]-VC[CAM]NVAFEK[MT7].2y5_1.heavy 627.841 / 737.431 912.0 27.53897523880005 42 16 10 6 10 4.641749969873637 21.543598998013742 0.03610038757324219 3 0.9683524424718498 6.918950179440783 912.0 6.509649211997967 2.0 - - - - - - - 0.0 1 0 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1059 135 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23756.[MT7]-VC[CAM]NVAFEK[MT7].2b4_1.heavy 627.841 / 617.32 1823.0 27.53897523880005 42 16 10 6 10 4.641749969873637 21.543598998013742 0.03610038757324219 3 0.9683524424718498 6.918950179440783 1823.0 4.82661603533775 0.0 - - - - - - - 255.76470588235293 3 17 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1061 136 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23574.[MT7]-AQTFVK[MT7].2y4_1.heavy 491.302 / 638.399 8605.0 23.125250339508057 43 17 10 6 10 2.6876140220543268 30.288168467524848 0.03380012512207031 3 0.9762732395519039 7.996145480895441 8605.0 31.67983564458141 0.0 - - - - - - - 263.94736842105266 17 19 IL20RB interleukin 20 receptor beta 1063 136 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23574.[MT7]-AQTFVK[MT7].2y5_1.heavy 491.302 / 766.458 7013.0 23.125250339508057 43 17 10 6 10 2.6876140220543268 30.288168467524848 0.03380012512207031 3 0.9762732395519039 7.996145480895441 7013.0 18.45905507553556 0.0 - - - - - - - 269.0625 14 16 IL20RB interleukin 20 receptor beta 1065 136 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23574.[MT7]-AQTFVK[MT7].2b4_1.heavy 491.302 / 592.321 3124.0 23.125250339508057 43 17 10 6 10 2.6876140220543268 30.288168467524848 0.03380012512207031 3 0.9762732395519039 7.996145480895441 3124.0 15.604757062146891 1.0 - - - - - - - 680.1818181818181 6 11 IL20RB interleukin 20 receptor beta 1067 136 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23574.[MT7]-AQTFVK[MT7].2y3_1.heavy 491.302 / 537.352 6247.0 23.125250339508057 43 17 10 6 10 2.6876140220543268 30.288168467524848 0.03380012512207031 3 0.9762732395519039 7.996145480895441 6247.0 8.239818631107795 1.0 - - - - - - - 634.8888888888889 12 9 IL20RB interleukin 20 receptor beta 1069 137 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543113.[MT7]-LVVLGSGGVGK[MT7].3b4_1.heavy 425.274 / 569.414 48455.0 32.737998962402344 48 18 10 10 10 6.2862595978211715 15.907710848381154 0.0 3 0.9871521743912182 10.876307453486357 48455.0 527.2693984472888 0.0 - - - - - - - 662.0 96 7 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1071 137 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543113.[MT7]-LVVLGSGGVGK[MT7].3b5_1.heavy 425.274 / 626.436 33143.0 32.737998962402344 48 18 10 10 10 6.2862595978211715 15.907710848381154 0.0 3 0.9871521743912182 10.876307453486357 33143.0 590.6673267326732 0.0 - - - - - - - 174.0909090909091 66 11 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1073 137 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543113.[MT7]-LVVLGSGGVGK[MT7].3b3_1.heavy 425.274 / 456.33 132672.0 32.737998962402344 48 18 10 10 10 6.2862595978211715 15.907710848381154 0.0 3 0.9871521743912182 10.876307453486357 132672.0 549.5498368039783 0.0 - - - - - - - 705.25 265 8 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1075 137 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543113.[MT7]-LVVLGSGGVGK[MT7].3b8_1.heavy 425.274 / 827.511 19442.0 32.737998962402344 48 18 10 10 10 6.2862595978211715 15.907710848381154 0.0 3 0.9871521743912182 10.876307453486357 19442.0 121.02966887417219 0.0 - - - - - - - 221.4 38 5 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1077 138 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43286.[MT7]-LVVLGSGGVGK[MT7].2y8_1.heavy 637.408 / 818.485 9718.0 32.737998962402344 46 16 10 10 10 2.2684937242390415 34.70521214257077 0.0 3 0.9678390919429009 6.863211020380954 9718.0 25.82925604733711 0.0 - - - - - - - 214.57142857142858 19 14 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1079 138 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43286.[MT7]-LVVLGSGGVGK[MT7].2y9_1.heavy 637.408 / 917.554 10319.0 32.737998962402344 46 16 10 10 10 2.2684937242390415 34.70521214257077 0.0 3 0.9678390919429009 6.863211020380954 10319.0 113.48428383233532 0.0 - - - - - - - 200.33333333333334 20 3 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1081 138 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43286.[MT7]-LVVLGSGGVGK[MT7].2y6_1.heavy 637.408 / 648.38 4509.0 32.737998962402344 46 16 10 10 10 2.2684937242390415 34.70521214257077 0.0 3 0.9678390919429009 6.863211020380954 4509.0 11.253743760399335 0.0 - - - - - - - 200.22222222222223 9 9 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1083 138 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43286.[MT7]-LVVLGSGGVGK[MT7].2y7_1.heavy 637.408 / 705.401 24346.0 32.737998962402344 46 16 10 10 10 2.2684937242390415 34.70521214257077 0.0 3 0.9678390919429009 6.863211020380954 24346.0 213.02750000000003 0.0 - - - - - - - 246.6153846153846 48 13 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1085 139 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23577.[MT7]-TQVVEK[MT7].2y4_1.heavy 496.305 / 618.394 1496.0 18.254074573516846 34 16 2 6 10 1.9185143543332313 41.130627192607896 0.03190040588378906 3 0.9670452613267755 6.779590930290265 1496.0 17.58234113712375 0.0 - - - - - - - 142.47619047619048 2 21 RASA2 RAS p21 protein activator 2 1087 139 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23577.[MT7]-TQVVEK[MT7].2y5_1.heavy 496.305 / 746.453 1753.0 18.254074573516846 34 16 2 6 10 1.9185143543332313 41.130627192607896 0.03190040588378906 3 0.9670452613267755 6.779590930290265 1753.0 21.29312452253629 0.0 - - - - - - - 137.34782608695653 3 23 RASA2 RAS p21 protein activator 2 1089 139 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23577.[MT7]-TQVVEK[MT7].2b4_1.heavy 496.305 / 572.352 812.0 18.254074573516846 34 16 2 6 10 1.9185143543332313 41.130627192607896 0.03190040588378906 3 0.9670452613267755 6.779590930290265 812.0 1.1409836065573769 16.0 - - - - - - - 234.96153846153845 12 26 RASA2 RAS p21 protein activator 2 1091 139 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23577.[MT7]-TQVVEK[MT7].2y3_1.heavy 496.305 / 519.326 2479.0 18.254074573516846 34 16 2 6 10 1.9185143543332313 41.130627192607896 0.03190040588378906 3 0.9670452613267755 6.779590930290265 2479.0 12.02444389790676 0.0 - - - - - - - 251.28 4 25 RASA2 RAS p21 protein activator 2 1093 140 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23578.[MT7]-FVTPLK[MT7].2b3_1.heavy 496.823 / 492.294 7513.0 31.11312484741211 37 13 10 6 8 1.578451186965111 63.353241979101085 0.038299560546875 4 0.9133655783215974 4.1622743412121395 7513.0 5.225 2.0 - - - - - - - 1263.6 17 10 IGSF22;POLE3 immunoglobulin superfamily, member 22;polymerase (DNA directed), epsilon 3 (p17 subunit) 1095 140 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23578.[MT7]-FVTPLK[MT7].2y4_1.heavy 496.823 / 602.399 7940.0 31.11312484741211 37 13 10 6 8 1.578451186965111 63.353241979101085 0.038299560546875 4 0.9133655783215974 4.1622743412121395 7940.0 10.833444477489019 0.0 - - - - - - - 661.6666666666666 15 12 IGSF22;POLE3 immunoglobulin superfamily, member 22;polymerase (DNA directed), epsilon 3 (p17 subunit) 1097 140 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23578.[MT7]-FVTPLK[MT7].2y5_1.heavy 496.823 / 701.468 5720.0 31.11312484741211 37 13 10 6 8 1.578451186965111 63.353241979101085 0.038299560546875 4 0.9133655783215974 4.1622743412121395 5720.0 13.334342247225647 0.0 - - - - - - - 304.7142857142857 11 7 IGSF22;POLE3 immunoglobulin superfamily, member 22;polymerase (DNA directed), epsilon 3 (p17 subunit) 1099 140 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23578.[MT7]-FVTPLK[MT7].2y3_1.heavy 496.823 / 501.352 13745.0 31.11312484741211 37 13 10 6 8 1.578451186965111 63.353241979101085 0.038299560546875 4 0.9133655783215974 4.1622743412121395 13745.0 16.523175412517762 0.0 - - - - - - - 1134.0 27 7 IGSF22;POLE3 immunoglobulin superfamily, member 22;polymerase (DNA directed), epsilon 3 (p17 subunit) 1101 141 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23651.[MT7]-APNDFNLR.2y4_1.heavy 545.792 / 549.314 13677.0 28.392499923706055 46 16 10 10 10 2.573635482596392 38.855541383473536 0.0 3 0.9644233364241396 6.523545826906828 13677.0 36.73089239283057 0.0 - - - - - - - 712.3333333333334 27 9 PYGL phosphorylase, glycogen, liver 1103 141 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23651.[MT7]-APNDFNLR.2b4_1.heavy 545.792 / 542.269 10472.0 28.392499923706055 46 16 10 10 10 2.573635482596392 38.855541383473536 0.0 3 0.9644233364241396 6.523545826906828 10472.0 10.415035098915123 0.0 - - - - - - - 1298.3333333333333 20 9 PYGL phosphorylase, glycogen, liver 1105 141 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23651.[MT7]-APNDFNLR.2y6_1.heavy 545.792 / 778.384 2280.0 28.392499923706055 46 16 10 10 10 2.573635482596392 38.855541383473536 0.0 3 0.9644233364241396 6.523545826906828 2280.0 22.291830985915496 0.0 - - - - - - - 216.95238095238096 4 21 PYGL phosphorylase, glycogen, liver 1107 141 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23651.[MT7]-APNDFNLR.2y7_1.heavy 545.792 / 875.437 22796.0 28.392499923706055 46 16 10 10 10 2.573635482596392 38.855541383473536 0.0 3 0.9644233364241396 6.523545826906828 22796.0 108.16191977133846 0.0 - - - - - - - 249.25 45 16 PYGL phosphorylase, glycogen, liver 1109 142 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43007.[MT7]-SIIEK[MT7].2y4_1.heavy 439.283 / 646.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASA2 RAS p21 protein activator 2 1111 142 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43007.[MT7]-SIIEK[MT7].2y3_1.heavy 439.283 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASA2 RAS p21 protein activator 2 1113 143 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24105.[MT7]-SLSPFFSEEFYFEIPR.2b3_1.heavy 1070.03 / 432.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASA2 RAS p21 protein activator 2 1115 143 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24105.[MT7]-SLSPFFSEEFYFEIPR.2y8_1.heavy 1070.03 / 1100.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASA2 RAS p21 protein activator 2 1117 143 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24105.[MT7]-SLSPFFSEEFYFEIPR.2y3_1.heavy 1070.03 / 385.256 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASA2 RAS p21 protein activator 2 1119 143 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24105.[MT7]-SLSPFFSEEFYFEIPR.2y6_1.heavy 1070.03 / 824.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASA2 RAS p21 protein activator 2 1121 144 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543016.[MT7]-LRTFYEK[MT7].3y3_1.heavy 415.58 / 583.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6 ribosomal protein S6 1123 144 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543016.[MT7]-LRTFYEK[MT7].3b4_1.heavy 415.58 / 662.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6 ribosomal protein S6 1125 144 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543016.[MT7]-LRTFYEK[MT7].3y4_1.heavy 415.58 / 730.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6 ribosomal protein S6 1127 144 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543016.[MT7]-LRTFYEK[MT7].3y5_1.heavy 415.58 / 831.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6 ribosomal protein S6 1129 145 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543638.[MT7]-DIPGLTDTTVPR.3y6_1.heavy 476.932 / 688.362 18014.0 32.26154899597168 42 20 6 6 10 17.351642887432078 5.763143043499975 0.039699554443359375 3 0.9971396753696414 23.07018801525388 18014.0 47.96774282560706 0.0 - - - - - - - 589.4285714285714 46 7 RPS6 ribosomal protein S6 1131 145 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543638.[MT7]-DIPGLTDTTVPR.3b4_1.heavy 476.932 / 527.295 45890.0 32.26154899597168 42 20 6 6 10 17.351642887432078 5.763143043499975 0.039699554443359375 3 0.9971396753696414 23.07018801525388 45890.0 39.736441816362 0.0 - - - - - - - 906.0 138 1 RPS6 ribosomal protein S6 1133 145 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543638.[MT7]-DIPGLTDTTVPR.3b5_1.heavy 476.932 / 640.379 15397.0 32.26154899597168 42 20 6 6 10 17.351642887432078 5.763143043499975 0.039699554443359375 3 0.9971396753696414 23.07018801525388 15397.0 31.89248627328329 0.0 - - - - - - - 666.625 30 8 RPS6 ribosomal protein S6 1135 145 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543638.[MT7]-DIPGLTDTTVPR.3y5_1.heavy 476.932 / 573.336 25058.0 32.26154899597168 42 20 6 6 10 17.351642887432078 5.763143043499975 0.039699554443359375 3 0.9971396753696414 23.07018801525388 25058.0 33.02611794728291 0.0 - - - - - - - 1132.0 50 8 RPS6 ribosomal protein S6 1137 146 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24104.[MT7]-WLLLC[CAM]NPGLAELIAEK[MT7].3b6_1.heavy 710.074 / 944.514 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1139 146 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24104.[MT7]-WLLLC[CAM]NPGLAELIAEK[MT7].3b4_1.heavy 710.074 / 670.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1141 146 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24104.[MT7]-WLLLC[CAM]NPGLAELIAEK[MT7].3y4_1.heavy 710.074 / 604.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1143 146 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24104.[MT7]-WLLLC[CAM]NPGLAELIAEK[MT7].3b3_1.heavy 710.074 / 557.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1145 147 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24103.[MT7]-LTDGVC[CAM]SEPLPFTYLPR.3y7_1.heavy 703.698 / 893.488 7698.0 43.0088996887207 46 16 10 10 10 2.2149905584522935 38.246418869495486 0.0 3 0.9601209719987709 6.159367936533936 7698.0 40.93987920696748 0.0 - - - - - - - 239.0 15 11 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1147 147 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24103.[MT7]-LTDGVC[CAM]SEPLPFTYLPR.3y6_1.heavy 703.698 / 796.435 1064.0 43.0088996887207 46 16 10 10 10 2.2149905584522935 38.246418869495486 0.0 3 0.9601209719987709 6.159367936533936 1064.0 3.077436673231997 2.0 - - - - - - - 187.8181818181818 2 11 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1149 147 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24103.[MT7]-LTDGVC[CAM]SEPLPFTYLPR.3b4_1.heavy 703.698 / 531.289 5070.0 43.0088996887207 46 16 10 10 10 2.2149905584522935 38.246418869495486 0.0 3 0.9601209719987709 6.159367936533936 5070.0 6.779651162790699 1.0 - - - - - - - 281.75 10 16 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1151 147 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24103.[MT7]-LTDGVC[CAM]SEPLPFTYLPR.3b5_1.heavy 703.698 / 630.358 5132.0 43.0088996887207 46 16 10 10 10 2.2149905584522935 38.246418869495486 0.0 3 0.9601209719987709 6.159367936533936 5132.0 6.792362344582594 1.0 - - - - - - - 208.75 10 12 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1153 148 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37407.[MT7]-FFQYFDQLR.2y4_1.heavy 704.362 / 531.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - DET1 de-etiolated homolog 1 (Arabidopsis) 1155 148 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37407.[MT7]-FFQYFDQLR.2b4_1.heavy 704.362 / 730.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - DET1 de-etiolated homolog 1 (Arabidopsis) 1157 148 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37407.[MT7]-FFQYFDQLR.2y6_1.heavy 704.362 / 841.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - DET1 de-etiolated homolog 1 (Arabidopsis) 1159 148 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37407.[MT7]-FFQYFDQLR.2y7_1.heavy 704.362 / 969.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - DET1 de-etiolated homolog 1 (Arabidopsis) 1161 149 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37545.[MT7]-LLMPSQLVSQVGK[MT7].2b3_1.heavy 844.505 / 502.318 6651.0 39.60837650299072 33 8 10 5 10 0.5752607645720681 88.95627049935032 0.040699005126953125 3 0.7695348394612469 2.519661942698181 6651.0 27.736245969995274 0.0 - - - - - - - 348.0 13 12 DDIT4 DNA-damage-inducible transcript 4 1163 149 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37545.[MT7]-LLMPSQLVSQVGK[MT7].2y5_1.heavy 844.505 / 662.395 2165.0 39.60837650299072 33 8 10 5 10 0.5752607645720681 88.95627049935032 0.040699005126953125 3 0.7695348394612469 2.519661942698181 2165.0 7.494496143795016 0.0 - - - - - - - 246.5 4 16 DDIT4 DNA-damage-inducible transcript 4 1165 149 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37545.[MT7]-LLMPSQLVSQVGK[MT7].2y6_1.heavy 844.505 / 761.464 851.0 39.60837650299072 33 8 10 5 10 0.5752607645720681 88.95627049935032 0.040699005126953125 3 0.7695348394612469 2.519661942698181 851.0 3.710376681814132 7.0 - - - - - - - 0.0 1 0 DDIT4 DNA-damage-inducible transcript 4 1167 149 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37545.[MT7]-LLMPSQLVSQVGK[MT7].2y10_1.heavy 844.505 / 1186.69 6342.0 39.60837650299072 33 8 10 5 10 0.5752607645720681 88.95627049935032 0.040699005126953125 3 0.7695348394612469 2.519661942698181 6342.0 90.96517210944396 0.0 - - - - - - - 206.22222222222223 12 9 DDIT4 DNA-damage-inducible transcript 4 1169 150 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23752.[MT7]-INPELNQK[MT7].2y4_1.heavy 622.366 / 646.4 1133.0 24.27630043029785 46 20 10 6 10 6.6795023221659395 14.971175272766928 0.037799835205078125 3 0.9917381190438906 13.568237654747126 1133.0 4.532 0.0 - - - - - - - 177.94444444444446 2 18 LOC100133591;LOC100509916;LOC100510195;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1171 150 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23752.[MT7]-INPELNQK[MT7].2y3_1.heavy 622.366 / 533.316 N/A 24.27630043029785 46 20 10 6 10 6.6795023221659395 14.971175272766928 0.037799835205078125 3 0.9917381190438906 13.568237654747126 533.0 0.7995 10.0 - - - - - - - 0.0 1 0 LOC100133591;LOC100509916;LOC100510195;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1173 150 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23752.[MT7]-INPELNQK[MT7].2y6_1.heavy 622.366 / 872.496 2934.0 24.27630043029785 46 20 10 6 10 6.6795023221659395 14.971175272766928 0.037799835205078125 3 0.9917381190438906 13.568237654747126 2934.0 20.691748648648648 0.0 - - - - - - - 163.72727272727272 5 11 LOC100133591;LOC100509916;LOC100510195;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1175 150 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23752.[MT7]-INPELNQK[MT7].2y7_1.heavy 622.366 / 986.539 1467.0 24.27630043029785 46 20 10 6 10 6.6795023221659395 14.971175272766928 0.037799835205078125 3 0.9917381190438906 13.568237654747126 1467.0 27.99498933901919 1.0 - - - - - - - 174.3846153846154 2 13 LOC100133591;LOC100509916;LOC100510195;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1177 151 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23659.[MT7]-SLAPMDAPR.2y3_1.heavy 551.296 / 343.209 8567.0 26.19184970855713 42 18 10 6 8 3.5938545107254742 27.825277762792208 0.03529930114746094 4 0.9850380062815561 10.076846699430035 8567.0 12.09274870801707 1.0 - - - - - - - 664.8181818181819 17 11 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1179 151 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23659.[MT7]-SLAPMDAPR.2b6_1.heavy 551.296 / 759.383 3323.0 26.19184970855713 42 18 10 6 8 3.5938545107254742 27.825277762792208 0.03529930114746094 4 0.9850380062815561 10.076846699430035 3323.0 45.660586602403754 0.0 - - - - - - - 240.0625 6 16 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1181 151 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23659.[MT7]-SLAPMDAPR.2y6_1.heavy 551.296 / 686.329 6647.0 26.19184970855713 42 18 10 6 8 3.5938545107254742 27.825277762792208 0.03529930114746094 4 0.9850380062815561 10.076846699430035 6647.0 10.558825504965018 1.0 - - - - - - - 681.1111111111111 13 9 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1183 151 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23659.[MT7]-SLAPMDAPR.2y7_1.heavy 551.296 / 757.366 2511.0 26.19184970855713 42 18 10 6 8 3.5938545107254742 27.825277762792208 0.03529930114746094 4 0.9850380062815561 10.076846699430035 2511.0 6.605887289774776 1.0 - - - - - - - 655.5 5 8 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1185 152 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23950.[MT7]-FC[CAM]LIC[CAM]NYLSK[MT7].3b6_1.heavy 535.951 / 952.45 7135.0 40.2494010925293 47 17 10 10 10 3.7669663333362915 26.546560587769555 0.0 3 0.9745187873048669 7.714819842754959 7135.0 41.25225879287885 0.0 - - - - - - - 209.0 14 6 RFC5 replication factor C (activator 1) 5, 36.5kDa 1187 152 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23950.[MT7]-FC[CAM]LIC[CAM]NYLSK[MT7].3b4_1.heavy 535.951 / 678.377 18269.0 40.2494010925293 47 17 10 10 10 3.7669663333362915 26.546560587769555 0.0 3 0.9745187873048669 7.714819842754959 18269.0 46.119730283705024 0.0 - - - - - - - 208.75 36 12 RFC5 replication factor C (activator 1) 5, 36.5kDa 1189 152 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23950.[MT7]-FC[CAM]LIC[CAM]NYLSK[MT7].3y4_1.heavy 535.951 / 654.394 4940.0 40.2494010925293 47 17 10 10 10 3.7669663333362915 26.546560587769555 0.0 3 0.9745187873048669 7.714819842754959 4940.0 23.246822827839846 0.0 - - - - - - - 209.13333333333333 9 15 RFC5 replication factor C (activator 1) 5, 36.5kDa 1191 152 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23950.[MT7]-FC[CAM]LIC[CAM]NYLSK[MT7].3b3_1.heavy 535.951 / 565.292 22346.0 40.2494010925293 47 17 10 10 10 3.7669663333362915 26.546560587769555 0.0 3 0.9745187873048669 7.714819842754959 22346.0 133.0862943986105 0.0 - - - - - - - 207.58823529411765 44 17 RFC5 replication factor C (activator 1) 5, 36.5kDa 1193 153 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23856.[MT7]-K[MT7]PNVDADDVR.3y6_1.heavy 472.928 / 690.305 14117.0 19.80970064798991 34 8 10 6 10 0.6857373405750887 76.4580884581656 0.0345001220703125 3 0.7767836875957339 2.5619366693354473 14117.0 25.177286645612696 0.0 - - - - - - - 216.21428571428572 28 14 TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 1195 153 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23856.[MT7]-K[MT7]PNVDADDVR.3y5_1.heavy 472.928 / 575.278 12605.0 19.80970064798991 34 8 10 6 10 0.6857373405750887 76.4580884581656 0.0345001220703125 3 0.7767836875957339 2.5619366693354473 12605.0 6.136976776749172 0.0 - - - - - - - 305.77777777777777 25 9 TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 1197 153 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23856.[MT7]-K[MT7]PNVDADDVR.3b8_2.heavy 472.928 / 572.298 53857.0 19.80970064798991 34 8 10 6 10 0.6857373405750887 76.4580884581656 0.0345001220703125 3 0.7767836875957339 2.5619366693354473 53857.0 50.7395176101292 0.0 - - - - - - - 1140.6666666666667 107 9 TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 1199 153 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23856.[MT7]-K[MT7]PNVDADDVR.3y9_1.heavy 472.928 / 1000.47 N/A 19.80970064798991 34 8 10 6 10 0.6857373405750887 76.4580884581656 0.0345001220703125 3 0.7767836875957339 2.5619366693354473 0.0 0.0 2.0 - - - - - - - 0.0 0 0 TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 1201 154 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 664351.0 31.707732518513996 23 -3 10 6 10 null 0.0 0.03940010070800781 3 0.0 0.0 664351.0 2257.3966408487668 0.0 - - - - - - - 204.5 1328 6 1203 154 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 633922.0 31.707732518513996 23 -3 10 6 10 null 0.0 0.03940010070800781 3 0.0 0.0 633922.0 2107.110698456895 0.0 - - - - - - - 283.3333333333333 1267 6 1205 154 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1142780.0 31.707732518513996 23 -3 10 6 10 null 0.0 0.03940010070800781 3 0.0 0.0 1142780.0 491.95673099740884 0.0 - - - - - - - 1673.7142857142858 2285 7 1207 155 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543117.[MT7]-VEHTNTGTK[MT7].3y3_1.heavy 425.57 / 449.284 11287.0 14.000800132751465 50 20 10 10 10 10.278703685518456 9.728853273675824 0.0 3 0.9923610789187224 14.111380694507293 11287.0 52.064291918072676 0.0 - - - - - - - 190.8 22 20 PYGL phosphorylase, glycogen, liver 1209 155 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543117.[MT7]-VEHTNTGTK[MT7].3b3_1.heavy 425.57 / 510.279 4586.0 14.000800132751465 50 20 10 10 10 10.278703685518456 9.728853273675824 0.0 3 0.9923610789187224 14.111380694507293 4586.0 56.60966239316239 0.0 - - - - - - - 154.2608695652174 9 23 PYGL phosphorylase, glycogen, liver 1211 155 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543117.[MT7]-VEHTNTGTK[MT7].3y4_1.heavy 425.57 / 550.332 6521.0 14.000800132751465 50 20 10 10 10 10.278703685518456 9.728853273675824 0.0 3 0.9923610789187224 14.111380694507293 6521.0 45.35812542753167 0.0 - - - - - - - 171.0 13 22 PYGL phosphorylase, glycogen, liver 1213 155 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543117.[MT7]-VEHTNTGTK[MT7].3y5_1.heavy 425.57 / 664.375 2204.0 14.000800132751465 50 20 10 10 10 10.278703685518456 9.728853273675824 0.0 3 0.9923610789187224 14.111380694507293 2204.0 40.81073333333333 0.0 - - - - - - - 71.66666666666667 4 18 PYGL phosphorylase, glycogen, liver 1215 156 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42985.[MT7]-NAVSK[MT7].2b3_1.heavy 403.752 / 429.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - USP43;ANAPC7 ubiquitin specific peptidase 43;anaphase promoting complex subunit 7 1217 156 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42985.[MT7]-NAVSK[MT7].2y4_1.heavy 403.752 / 548.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - USP43;ANAPC7 ubiquitin specific peptidase 43;anaphase promoting complex subunit 7 1219 156 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42985.[MT7]-NAVSK[MT7].2b4_1.heavy 403.752 / 516.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - USP43;ANAPC7 ubiquitin specific peptidase 43;anaphase promoting complex subunit 7 1221 156 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42985.[MT7]-NAVSK[MT7].2y3_1.heavy 403.752 / 477.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - USP43;ANAPC7 ubiquitin specific peptidase 43;anaphase promoting complex subunit 7 1223 157 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24085.[MT7]-QEYFVVAATLQDIIRR.3b4_1.heavy 689.389 / 712.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 1225 157 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24085.[MT7]-QEYFVVAATLQDIIRR.3b5_1.heavy 689.389 / 811.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 1227 157 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24085.[MT7]-QEYFVVAATLQDIIRR.3y4_1.heavy 689.389 / 557.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 1229 157 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24085.[MT7]-QEYFVVAATLQDIIRR.3b3_1.heavy 689.389 / 565.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 1231 158 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543928.[MT7]-LYSSEQLLIEEC[CAM].2b8_1.heavy 814.404 / 1078.59 26476.0 38.58437633514404 36 10 10 6 10 0.6527293742343185 85.32465846868969 0.034900665283203125 3 0.8244779059819417 2.9015443322917087 26476.0 331.2724499737921 0.0 - - - - - - - 202.5 52 6 DDIT4 DNA-damage-inducible transcript 4 1233 158 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543928.[MT7]-LYSSEQLLIEEC[CAM].2b6_1.heavy 814.404 / 852.422 25034.0 38.58437633514404 36 10 10 6 10 0.6527293742343185 85.32465846868969 0.034900665283203125 3 0.8244779059819417 2.9015443322917087 25034.0 67.8921251301688 0.0 - - - - - - - 227.66666666666666 50 12 DDIT4 DNA-damage-inducible transcript 4 1235 158 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543928.[MT7]-LYSSEQLLIEEC[CAM].2b7_1.heavy 814.404 / 965.506 28448.0 38.58437633514404 36 10 10 6 10 0.6527293742343185 85.32465846868969 0.034900665283203125 3 0.8244779059819417 2.9015443322917087 28448.0 125.07511001227297 0.0 - - - - - - - 265.6 56 10 DDIT4 DNA-damage-inducible transcript 4 1237 158 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543928.[MT7]-LYSSEQLLIEEC[CAM].2b5_1.heavy 814.404 / 724.363 8117.0 38.58437633514404 36 10 10 6 10 0.6527293742343185 85.32465846868969 0.034900665283203125 3 0.8244779059819417 2.9015443322917087 8117.0 11.354003215010408 0.0 - - - - - - - 697.8 16 10 DDIT4 DNA-damage-inducible transcript 4 1239 159 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543530.[MT7]-LIEVDDERK[MT7].3y7_1.heavy 468.936 / 1034.52 N/A 26.064300537109375 50 20 10 10 10 7.166065494703179 13.954658951123921 0.0 3 0.9954195282331844 18.228097893626664 72.0 0.0 1.0 - - - - - - - 0.0 0 0 RPS6 ribosomal protein S6 1241 159 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543530.[MT7]-LIEVDDERK[MT7].3b6_1.heavy 468.936 / 829.442 11011.0 26.064300537109375 50 20 10 10 10 7.166065494703179 13.954658951123921 0.0 3 0.9954195282331844 18.228097893626664 11011.0 69.96787986651836 0.0 - - - - - - - 159.13333333333333 22 15 RPS6 ribosomal protein S6 1243 159 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543530.[MT7]-LIEVDDERK[MT7].3b5_1.heavy 468.936 / 714.415 8113.0 26.064300537109375 50 20 10 10 10 7.166065494703179 13.954658951123921 0.0 3 0.9954195282331844 18.228097893626664 8113.0 43.73300790675229 0.0 - - - - - - - 202.66666666666666 16 15 RPS6 ribosomal protein S6 1245 159 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543530.[MT7]-LIEVDDERK[MT7].3b3_1.heavy 468.936 / 500.32 13981.0 26.064300537109375 50 20 10 10 10 7.166065494703179 13.954658951123921 0.0 3 0.9954195282331844 18.228097893626664 13981.0 26.69909610704179 0.0 - - - - - - - 738.8 27 10 RPS6 ribosomal protein S6 1247 160 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43658.[MT7]-FINEDRLPHLLLYGPPGTGK[MT7].4y4_1.heavy 632.108 / 506.306 4070.0 38.60185146331787 41 15 10 6 10 6.2604521814687395 15.973287088751377 0.034999847412109375 3 0.9551673660344021 5.806697361921397 4070.0 12.437564759870668 0.0 - - - - - - - 240.125 8 16 RFC5 replication factor C (activator 1) 5, 36.5kDa 1249 160 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43658.[MT7]-FINEDRLPHLLLYGPPGTGK[MT7].4y5_1.heavy 632.108 / 603.358 12287.0 38.60185146331787 41 15 10 6 10 6.2604521814687395 15.973287088751377 0.034999847412109375 3 0.9551673660344021 5.806697361921397 12287.0 34.569694625407166 0.0 - - - - - - - 684.8333333333334 24 12 RFC5 replication factor C (activator 1) 5, 36.5kDa 1251 160 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43658.[MT7]-FINEDRLPHLLLYGPPGTGK[MT7].4b5_1.heavy 632.108 / 763.374 691.0 38.60185146331787 41 15 10 6 10 6.2604521814687395 15.973287088751377 0.034999847412109375 3 0.9551673660344021 5.806697361921397 691.0 5.660359575278142 6.0 - - - - - - - 179.1904761904762 2 21 RFC5 replication factor C (activator 1) 5, 36.5kDa 1253 160 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43658.[MT7]-FINEDRLPHLLLYGPPGTGK[MT7].4b9_2.heavy 632.108 / 633.839 8755.0 38.60185146331787 41 15 10 6 10 6.2604521814687395 15.973287088751377 0.034999847412109375 3 0.9551673660344021 5.806697361921397 8755.0 44.517313024615675 0.0 - - - - - - - 212.53846153846155 17 13 RFC5 replication factor C (activator 1) 5, 36.5kDa 1255 161 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43464.[MT7]-GALLDVC[CAM]VEQGK[MT7].2y5_1.heavy 788.934 / 704.406 906.0 32.40330123901367 46 16 10 10 10 3.5550751160352174 21.212680061086363 0.0 3 0.9690153861283842 6.992967825923425 906.0 0.8999999999999998 5.0 - - - - - - - 0.0 1 0 DDIT4 DNA-damage-inducible transcript 4 1257 161 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43464.[MT7]-GALLDVC[CAM]VEQGK[MT7].2y6_1.heavy 788.934 / 864.437 906.0 32.40330123901367 46 16 10 10 10 3.5550751160352174 21.212680061086363 0.0 3 0.9690153861283842 6.992967825923425 906.0 1.2202815294094858 1.0 - - - - - - - 223.77777777777777 2 9 DDIT4 DNA-damage-inducible transcript 4 1259 161 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43464.[MT7]-GALLDVC[CAM]VEQGK[MT7].2b5_1.heavy 788.934 / 614.363 3322.0 32.40330123901367 46 16 10 10 10 3.5550751160352174 21.212680061086363 0.0 3 0.9690153861283842 6.992967825923425 3322.0 17.582571756601606 0.0 - - - - - - - 188.06666666666666 6 15 DDIT4 DNA-damage-inducible transcript 4 1261 161 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43464.[MT7]-GALLDVC[CAM]VEQGK[MT7].2y7_1.heavy 788.934 / 963.505 1107.0 32.40330123901367 46 16 10 10 10 3.5550751160352174 21.212680061086363 0.0 3 0.9690153861283842 6.992967825923425 1107.0 14.927950347273534 0.0 - - - - - - - 164.8181818181818 2 11 DDIT4 DNA-damage-inducible transcript 4 1263 162 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543215.[MT7]-QQEQPAATK[MT7].3y3_1.heavy 430.241 / 463.3 24047.0 14.80620002746582 46 16 10 10 10 2.4613743844631206 34.253698741138024 0.0 3 0.9662778497076135 6.701571854156087 24047.0 136.8645798538622 0.0 - - - - - - - 219.6875 48 16 RFC5 replication factor C (activator 1) 5, 36.5kDa 1265 162 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543215.[MT7]-QQEQPAATK[MT7].3b4_1.heavy 430.241 / 658.328 15658.0 14.80620002746582 46 16 10 10 10 2.4613743844631206 34.253698741138024 0.0 3 0.9662778497076135 6.701571854156087 15658.0 330.26031969244775 0.0 - - - - - - - 133.33333333333334 31 18 RFC5 replication factor C (activator 1) 5, 36.5kDa 1267 162 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543215.[MT7]-QQEQPAATK[MT7].3b3_1.heavy 430.241 / 530.269 9880.0 14.80620002746582 46 16 10 10 10 2.4613743844631206 34.253698741138024 0.0 3 0.9662778497076135 6.701571854156087 9880.0 82.17622292897167 0.0 - - - - - - - 177.89473684210526 19 19 RFC5 replication factor C (activator 1) 5, 36.5kDa 1269 162 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543215.[MT7]-QQEQPAATK[MT7].3y5_1.heavy 430.241 / 631.39 7696.0 14.80620002746582 46 16 10 10 10 2.4613743844631206 34.253698741138024 0.0 3 0.9662778497076135 6.701571854156087 7696.0 74.63258064516128 0.0 - - - - - - - 142.05555555555554 15 18 RFC5 replication factor C (activator 1) 5, 36.5kDa 1271 163 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37463.[MT7]-FISADVHGIWSR.2y5_1.heavy 766.411 / 618.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA6 ubiquitin-like modifier activating enzyme 6 1273 163 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37463.[MT7]-FISADVHGIWSR.2y6_1.heavy 766.411 / 755.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA6 ubiquitin-like modifier activating enzyme 6 1275 163 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37463.[MT7]-FISADVHGIWSR.2y10_1.heavy 766.411 / 1127.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA6 ubiquitin-like modifier activating enzyme 6 1277 163 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37463.[MT7]-FISADVHGIWSR.2b5_1.heavy 766.411 / 678.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA6 ubiquitin-like modifier activating enzyme 6 1279 164 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43656.[MT7]-GLEQAGWILTELEQSATVMK[MT7].3b6_1.heavy 831.448 / 700.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - NTRK1 neurotrophic tyrosine kinase, receptor, type 1 1281 164 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43656.[MT7]-GLEQAGWILTELEQSATVMK[MT7].3b4_1.heavy 831.448 / 572.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - NTRK1 neurotrophic tyrosine kinase, receptor, type 1 1283 164 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43656.[MT7]-GLEQAGWILTELEQSATVMK[MT7].3b5_1.heavy 831.448 / 643.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - NTRK1 neurotrophic tyrosine kinase, receptor, type 1 1285 164 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43656.[MT7]-GLEQAGWILTELEQSATVMK[MT7].3b7_1.heavy 831.448 / 886.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - NTRK1 neurotrophic tyrosine kinase, receptor, type 1 1287 165 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23944.[MT7]-IYSLFTLSLLK[MT7].3y3_1.heavy 529.332 / 517.383 3354.0 49.61450004577637 42 15 10 7 10 2.524744451832689 31.36398704393058 0.029796600341796875 3 0.957567892400914 5.969903495675901 3354.0 9.16878306878307 0.0 - - - - - - - 164.0 6 19 RASA2 RAS p21 protein activator 2 1289 165 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23944.[MT7]-IYSLFTLSLLK[MT7].3b4_1.heavy 529.332 / 621.373 1937.0 49.61450004577637 42 15 10 7 10 2.524744451832689 31.36398704393058 0.029796600341796875 3 0.957567892400914 5.969903495675901 1937.0 1.9281690140845067 1.0 - - - - - - - 79.61538461538461 3 13 RASA2 RAS p21 protein activator 2 1291 165 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23944.[MT7]-IYSLFTLSLLK[MT7].3b3_1.heavy 529.332 / 508.289 1701.0 49.61450004577637 42 15 10 7 10 2.524744451832689 31.36398704393058 0.029796600341796875 3 0.957567892400914 5.969903495675901 1701.0 21.663919688342823 0.0 - - - - - - - 188.85714285714286 3 14 RASA2 RAS p21 protein activator 2 1293 165 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23944.[MT7]-IYSLFTLSLLK[MT7].3y4_1.heavy 529.332 / 604.415 4299.0 49.61450004577637 42 15 10 7 10 2.524744451832689 31.36398704393058 0.029796600341796875 3 0.957567892400914 5.969903495675901 4299.0 84.15063829787233 0.0 - - - - - - - 124.57142857142857 8 14 RASA2 RAS p21 protein activator 2 1295 166 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 376569.0 26.41629981994629 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 376569.0 509.00119604486724 0.0 - - - - - - - 1629.0 753 2 1297 166 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 492271.0 26.41629981994629 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 492271.0 946.0017689227813 0.0 - - - - - - - 2295.0 984 1 1299 166 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 587738.0 26.41629981994629 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 587738.0 2512.2916340640018 0.0 - - - - - - - 3294.0 1175 2 1301 167 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23940.[MT7]-FSQFLETEYK[MT7].2b3_1.heavy 790.416 / 507.268 1994.0 36.66067409515381 46 20 10 6 10 6.5472301923227505 15.273634355679064 0.032299041748046875 3 0.994553419540311 16.714873436151336 1994.0 3.4705272838548566 0.0 - - - - - - - 218.27272727272728 3 22 PYGL phosphorylase, glycogen, liver 1303 167 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23940.[MT7]-FSQFLETEYK[MT7].2y5_1.heavy 790.416 / 813.411 1403.0 36.66067409515381 46 20 10 6 10 6.5472301923227505 15.273634355679064 0.032299041748046875 3 0.994553419540311 16.714873436151336 1403.0 2.688329446197466 0.0 - - - - - - - 211.86666666666667 2 15 PYGL phosphorylase, glycogen, liver 1305 167 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23940.[MT7]-FSQFLETEYK[MT7].2b4_1.heavy 790.416 / 654.337 1772.0 36.66067409515381 46 20 10 6 10 6.5472301923227505 15.273634355679064 0.032299041748046875 3 0.994553419540311 16.714873436151336 1772.0 0.0 1.0 - - - - - - - 200.52380952380952 3 21 PYGL phosphorylase, glycogen, liver 1307 167 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23940.[MT7]-FSQFLETEYK[MT7].2y6_1.heavy 790.416 / 926.495 1698.0 36.66067409515381 46 20 10 6 10 6.5472301923227505 15.273634355679064 0.032299041748046875 3 0.994553419540311 16.714873436151336 1698.0 5.353016949152543 0.0 - - - - - - - 190.0 3 21 PYGL phosphorylase, glycogen, liver 1309 168 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43562.[MT7]-EDFTLLDFINAVK[MT7].3b5_1.heavy 605.004 / 750.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA6 ubiquitin-like modifier activating enzyme 6 1311 168 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43562.[MT7]-EDFTLLDFINAVK[MT7].3b3_1.heavy 605.004 / 536.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA6 ubiquitin-like modifier activating enzyme 6 1313 168 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43562.[MT7]-EDFTLLDFINAVK[MT7].3y4_1.heavy 605.004 / 575.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA6 ubiquitin-like modifier activating enzyme 6 1315 168 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43562.[MT7]-EDFTLLDFINAVK[MT7].3b7_1.heavy 605.004 / 978.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA6 ubiquitin-like modifier activating enzyme 6 1317 169 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23803.[MT7]-VATPMSVTSQR.2y8_1.heavy 660.857 / 905.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 1319 169 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23803.[MT7]-VATPMSVTSQR.2y9_1.heavy 660.857 / 1006.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 1321 169 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23803.[MT7]-VATPMSVTSQR.2y6_1.heavy 660.857 / 677.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 1323 169 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23803.[MT7]-VATPMSVTSQR.2y10_1.heavy 660.857 / 1077.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 1325 170 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24135.[MT7]-NFPALLSTGEFLK[MT7]LPFER.4y4_1.heavy 592.588 / 548.283 2867.0 47.829750061035156 41 18 10 3 10 4.002442731123118 24.984742248126857 0.0673980712890625 3 0.9860731240140488 10.445523085667324 2867.0 3.594984326018809 1.0 - - - - - - - 190.41176470588235 5 17 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1327 170 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24135.[MT7]-NFPALLSTGEFLK[MT7]LPFER.4y12_2.heavy 592.588 / 784.434 3822.0 47.829750061035156 41 18 10 3 10 4.002442731123118 24.984742248126857 0.0673980712890625 3 0.9860731240140488 10.445523085667324 3822.0 29.90746814650388 0.0 - - - - - - - 163.23076923076923 7 13 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1329 170 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24135.[MT7]-NFPALLSTGEFLK[MT7]LPFER.4b4_1.heavy 592.588 / 574.311 8812.0 47.829750061035156 41 18 10 3 10 4.002442731123118 24.984742248126857 0.0673980712890625 3 0.9860731240140488 10.445523085667324 8812.0 33.82465962933118 0.0 - - - - - - - 614.2857142857143 17 7 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1331 170 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24135.[MT7]-NFPALLSTGEFLK[MT7]LPFER.4b5_1.heavy 592.588 / 687.395 5255.0 47.829750061035156 41 18 10 3 10 4.002442731123118 24.984742248126857 0.0673980712890625 3 0.9860731240140488 10.445523085667324 5255.0 70.06666666666666 0.0 - - - - - - - 193.35714285714286 10 14 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1333 171 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543778.[MT7]-RWLLLC[CAM]NPGLAELIAEK[MT7].3b4_1.heavy 762.108 / 713.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1335 171 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543778.[MT7]-RWLLLC[CAM]NPGLAELIAEK[MT7].3y4_1.heavy 762.108 / 604.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1337 171 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543778.[MT7]-RWLLLC[CAM]NPGLAELIAEK[MT7].3b7_1.heavy 762.108 / 1100.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1339 171 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543778.[MT7]-RWLLLC[CAM]NPGLAELIAEK[MT7].3b7_2.heavy 762.108 / 550.811 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1341 172 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24138.[MT7]-LVILDEADAMTQDAQNALRR.3y18_2.heavy 796.42 / 1016 1909.0 45.840850830078125 39 13 10 6 10 1.5959303025887708 42.063760134052664 0.03150177001953125 3 0.9206143452652897 4.350864294223922 1909.0 23.952547169811318 0.0 - - - - - - - 125.27272727272727 3 11 RFC5 replication factor C (activator 1) 5, 36.5kDa 1343 172 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24138.[MT7]-LVILDEADAMTQDAQNALRR.3y7_1.heavy 796.42 / 828.48 689.0 45.840850830078125 39 13 10 6 10 1.5959303025887708 42.063760134052664 0.03150177001953125 3 0.9206143452652897 4.350864294223922 689.0 3.575 4.0 - - - - - - - 0.0 1 0 RFC5 replication factor C (activator 1) 5, 36.5kDa 1345 172 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24138.[MT7]-LVILDEADAMTQDAQNALRR.3y15_2.heavy 796.42 / 845.402 1803.0 45.840850830078125 39 13 10 6 10 1.5959303025887708 42.063760134052664 0.03150177001953125 3 0.9206143452652897 4.350864294223922 1803.0 17.190867924528302 1.0 - - - - - - - 163.24 3 25 RFC5 replication factor C (activator 1) 5, 36.5kDa 1347 172 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24138.[MT7]-LVILDEADAMTQDAQNALRR.3y19_2.heavy 796.42 / 1065.53 1166.0 45.840850830078125 39 13 10 6 10 1.5959303025887708 42.063760134052664 0.03150177001953125 3 0.9206143452652897 4.350864294223922 1166.0 6.416666666666667 0.0 - - - - - - - 155.88235294117646 2 17 RFC5 replication factor C (activator 1) 5, 36.5kDa 1349 173 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24139.[MT7]-LVSPAPGPGPQPHLVITEQPK[MT7].4y5_1.heavy 613.356 / 746.417 4362.0 31.50142478942871 39 16 10 3 10 1.6542188503472108 46.6777629193053 0.07550048828125 3 0.9608369140684481 6.215789090246666 4362.0 4.598493975903614 0.0 - - - - - - - 234.06666666666666 8 15 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1351 173 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24139.[MT7]-LVSPAPGPGPQPHLVITEQPK[MT7].4b5_1.heavy 613.356 / 612.384 16975.0 31.50142478942871 39 16 10 3 10 1.6542188503472108 46.6777629193053 0.07550048828125 3 0.9608369140684481 6.215789090246666 16975.0 39.66097300594784 0.0 - - - - - - - 758.75 33 8 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1353 173 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24139.[MT7]-LVSPAPGPGPQPHLVITEQPK[MT7].4y7_1.heavy 613.356 / 958.569 1233.0 31.50142478942871 39 16 10 3 10 1.6542188503472108 46.6777629193053 0.07550048828125 3 0.9608369140684481 6.215789090246666 1233.0 4.542631578947368 2.0 - - - - - - - 166.125 2 8 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1355 173 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24139.[MT7]-LVSPAPGPGPQPHLVITEQPK[MT7].4y6_1.heavy 613.356 / 859.5 2086.0 31.50142478942871 39 16 10 3 10 1.6542188503472108 46.6777629193053 0.07550048828125 3 0.9608369140684481 6.215789090246666 2086.0 1.2098360655737703 1.0 - - - - - - - 154.25 4 8 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1357 174 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43369.[MT7]-LEHVVEEEK[MT7].2y4_1.heavy 700.387 / 678.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1359 174 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43369.[MT7]-LEHVVEEEK[MT7].2b3_1.heavy 700.387 / 524.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1361 174 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43369.[MT7]-LEHVVEEEK[MT7].2y5_1.heavy 700.387 / 777.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1363 174 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43369.[MT7]-LEHVVEEEK[MT7].2y7_1.heavy 700.387 / 1013.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1365 175 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23672.[MT7]-GAYGVVEK[MT7].2y5_1.heavy 555.823 / 675.416 7142.0 23.77519989013672 48 18 10 10 10 5.277398117182803 15.125274363720735 0.0 3 0.9851841145742302 10.126535676861899 7142.0 26.623159456714788 0.0 - - - - - - - 199.47368421052633 14 19 LOC100133591;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1367 175 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23672.[MT7]-GAYGVVEK[MT7].2y3_1.heavy 555.823 / 519.326 5625.0 23.77519989013672 48 18 10 10 10 5.277398117182803 15.125274363720735 0.0 3 0.9851841145742302 10.126535676861899 5625.0 8.532992618398694 0.0 - - - - - - - 292.90909090909093 11 11 LOC100133591;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1369 175 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23672.[MT7]-GAYGVVEK[MT7].2y6_1.heavy 555.823 / 838.479 4551.0 23.77519989013672 48 18 10 10 10 5.277398117182803 15.125274363720735 0.0 3 0.9851841145742302 10.126535676861899 4551.0 18.685709456482925 0.0 - - - - - - - 214.7 9 20 LOC100133591;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1371 175 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23672.[MT7]-GAYGVVEK[MT7].2b5_1.heavy 555.823 / 592.321 4930.0 23.77519989013672 48 18 10 10 10 5.277398117182803 15.125274363720735 0.0 3 0.9851841145742302 10.126535676861899 4930.0 17.336648102721526 0.0 - - - - - - - 646.1111111111111 9 9 LOC100133591;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1373 176 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23691.[MT7]-TDIAAFVK[MT7].2y4_1.heavy 576.847 / 608.389 2915.0 33.01139831542969 42 12 10 10 10 1.410169086003706 63.00401243214051 0.0 3 0.8827733020416235 3.5687184386150173 2915.0 8.4432356446932 0.0 - - - - - - - 560.2857142857143 5 7 MAP2K3 mitogen-activated protein kinase kinase 3 1375 176 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23691.[MT7]-TDIAAFVK[MT7].2y5_1.heavy 576.847 / 679.426 13067.0 33.01139831542969 42 12 10 10 10 1.410169086003706 63.00401243214051 0.0 3 0.8827733020416235 3.5687184386150173 13067.0 3.9704074566060665 1.0 - - - - - - - 289.125 26 8 MAP2K3 mitogen-activated protein kinase kinase 3 1377 176 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23691.[MT7]-TDIAAFVK[MT7].2b4_1.heavy 576.847 / 545.305 N/A 33.01139831542969 42 12 10 10 10 1.410169086003706 63.00401243214051 0.0 3 0.8827733020416235 3.5687184386150173 14374.0 23.122354892205635 0.0 - - - - - - - 1163.142857142857 28 7 MAP2K3 mitogen-activated protein kinase kinase 3 1379 176 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23691.[MT7]-TDIAAFVK[MT7].2y3_1.heavy 576.847 / 537.352 4825.0 33.01139831542969 42 12 10 10 10 1.410169086003706 63.00401243214051 0.0 3 0.8827733020416235 3.5687184386150173 4825.0 6.812548511215862 0.0 - - - - - - - 681.4444444444445 9 9 MAP2K3 mitogen-activated protein kinase kinase 3 1381 177 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23933.[MT7]-IYVVGGYSWNNR.2b3_1.heavy 786.408 / 520.325 6364.0 35.916199684143066 39 13 10 6 10 1.1698884245890895 56.985491321604115 0.035198211669921875 3 0.924758747426618 4.470673236923569 6364.0 22.16150441426818 0.0 - - - - - - - 607.0 12 8 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1383 177 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23933.[MT7]-IYVVGGYSWNNR.2y8_1.heavy 786.408 / 953.422 5443.0 35.916199684143066 39 13 10 6 10 1.1698884245890895 56.985491321604115 0.035198211669921875 3 0.924758747426618 4.470673236923569 5443.0 27.146269794628246 0.0 - - - - - - - 199.94444444444446 10 18 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1385 177 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23933.[MT7]-IYVVGGYSWNNR.2y9_1.heavy 786.408 / 1052.49 4103.0 35.916199684143066 39 13 10 6 10 1.1698884245890895 56.985491321604115 0.035198211669921875 3 0.924758747426618 4.470673236923569 4103.0 28.833576727142727 0.0 - - - - - - - 179.35714285714286 8 14 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1387 177 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23933.[MT7]-IYVVGGYSWNNR.2y10_1.heavy 786.408 / 1151.56 1507.0 35.916199684143066 39 13 10 6 10 1.1698884245890895 56.985491321604115 0.035198211669921875 3 0.924758747426618 4.470673236923569 1507.0 14.396259512846814 0.0 - - - - - - - 181.41666666666666 3 12 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1389 178 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37573.[MT7]-LQALAQAPPVYLDVLG.2y9_1.heavy 906.523 / 972.54 1776.0 47.96739959716797 43 13 10 10 10 2.090208289388106 47.8421220065462 0.0 3 0.9069759793961291 4.014571807586884 1776.0 33.687567169672434 0.0 - - - - - - - 147.1818181818182 3 11 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 1391 178 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37573.[MT7]-LQALAQAPPVYLDVLG.2b4_1.heavy 906.523 / 570.373 3865.0 47.96739959716797 43 13 10 10 10 2.090208289388106 47.8421220065462 0.0 3 0.9069759793961291 4.014571807586884 3865.0 35.10816053511706 0.0 - - - - - - - 139.0 7 12 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 1393 178 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37573.[MT7]-LQALAQAPPVYLDVLG.2b6_1.heavy 906.523 / 769.469 4126.0 47.96739959716797 43 13 10 10 10 2.090208289388106 47.8421220065462 0.0 3 0.9069759793961291 4.014571807586884 4126.0 19.075504469987226 0.0 - - - - - - - 153.9 8 20 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 1395 178 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37573.[MT7]-LQALAQAPPVYLDVLG.2b7_1.heavy 906.523 / 840.506 14782.0 47.96739959716797 43 13 10 10 10 2.090208289388106 47.8421220065462 0.0 3 0.9069759793961291 4.014571807586884 14782.0 45.24577391304348 0.0 - - - - - - - 191.41666666666666 29 12 NTRK1 neurotrophic tyrosine kinase, receptor, type 1 1397 179 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 128138.0 36.05939865112305 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 128138.0 99.6512091878589 0.0 - - - - - - - 252.2941176470588 256 17 1399 179 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 319788.0 36.05939865112305 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 319788.0 186.97016715927396 0.0 - - - - - - - 243.25 639 16 1401 179 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 271061.0 36.05939865112305 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 271061.0 61.650997391908234 0.0 - - - - - - - 261.5882352941176 542 17 1403 180 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24131.[MT7]-FFTSNTHSSVVLQGFDQLR.3y6_1.heavy 776.402 / 735.378 8654.0 38.830801010131836 39 13 10 6 10 14.083844267109416 7.100334120672871 0.03600311279296875 3 0.9294338774501463 4.618241842311608 8654.0 28.136471095334684 0.0 - - - - - - - 260.9375 17 16 KLHL9 kelch-like 9 (Drosophila) 1405 180 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24131.[MT7]-FFTSNTHSSVVLQGFDQLR.3b6_1.heavy 776.402 / 842.417 3168.0 38.830801010131836 39 13 10 6 10 14.083844267109416 7.100334120672871 0.03600311279296875 3 0.9294338774501463 4.618241842311608 3168.0 20.49159691998661 0.0 - - - - - - - 195.26315789473685 6 19 KLHL9 kelch-like 9 (Drosophila) 1407 180 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24131.[MT7]-FFTSNTHSSVVLQGFDQLR.3y8_1.heavy 776.402 / 976.521 11281.0 38.830801010131836 39 13 10 6 10 14.083844267109416 7.100334120672871 0.03600311279296875 3 0.9294338774501463 4.618241842311608 11281.0 40.906085986887334 0.0 - - - - - - - 200.05882352941177 22 17 KLHL9 kelch-like 9 (Drosophila) 1409 180 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24131.[MT7]-FFTSNTHSSVVLQGFDQLR.3y9_1.heavy 776.402 / 1075.59 7263.0 38.830801010131836 39 13 10 6 10 14.083844267109416 7.100334120672871 0.03600311279296875 3 0.9294338774501463 4.618241842311608 7263.0 45.254949782390355 0.0 - - - - - - - 178.3846153846154 14 13 KLHL9 kelch-like 9 (Drosophila) 1411 181 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24130.[MT7]-SLLRDNVDLLGSLADLYFR.4y4_1.heavy 581.824 / 598.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 1413 181 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24130.[MT7]-SLLRDNVDLLGSLADLYFR.4b8_1.heavy 581.824 / 1057.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 1415 181 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24130.[MT7]-SLLRDNVDLLGSLADLYFR.4b8_2.heavy 581.824 / 529.292 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 1417 181 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24130.[MT7]-SLLRDNVDLLGSLADLYFR.4b9_2.heavy 581.824 / 585.834 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 1419 182 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24121.[MT7]-RWLLLC[CAM]NPGLAELIAEK[MT7].4b7_1.heavy 571.833 / 1100.62 1143.0 45.05759906768799 33 7 10 6 10 0.427035788658114 110.82334127517447 0.030399322509765625 3 0.7075037398317686 2.22381219784736 1143.0 20.44816513761468 0.0 - - - - - - - 209.85714285714286 2 7 PYGL phosphorylase, glycogen, liver 1421 182 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24121.[MT7]-RWLLLC[CAM]NPGLAELIAEK[MT7].4b7_2.heavy 571.833 / 550.811 7078.0 45.05759906768799 33 7 10 6 10 0.427035788658114 110.82334127517447 0.030399322509765625 3 0.7075037398317686 2.22381219784736 7078.0 19.506299212598424 0.0 - - - - - - - 163.21052631578948 14 19 PYGL phosphorylase, glycogen, liver 1423 182 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24121.[MT7]-RWLLLC[CAM]NPGLAELIAEK[MT7].4b5_1.heavy 571.833 / 826.542 1143.0 45.05759906768799 33 7 10 6 10 0.427035788658114 110.82334127517447 0.030399322509765625 3 0.7075037398317686 2.22381219784736 1143.0 20.521957186544345 0.0 - - - - - - - 93.72727272727273 2 11 PYGL phosphorylase, glycogen, liver 1425 182 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24121.[MT7]-RWLLLC[CAM]NPGLAELIAEK[MT7].4b9_2.heavy 571.833 / 627.849 14374.0 45.05759906768799 33 7 10 6 10 0.427035788658114 110.82334127517447 0.030399322509765625 3 0.7075037398317686 2.22381219784736 14374.0 72.84550775754452 0.0 - - - - - - - 108.61111111111111 28 18 PYGL phosphorylase, glycogen, liver 1427 183 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23684.[MT7]-LSVGTNEK[MT7].2y5_1.heavy 568.332 / 692.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1429 183 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23684.[MT7]-LSVGTNEK[MT7].2y3_1.heavy 568.332 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1431 183 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23684.[MT7]-LSVGTNEK[MT7].2y6_1.heavy 568.332 / 791.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1433 183 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23684.[MT7]-LSVGTNEK[MT7].2y7_1.heavy 568.332 / 878.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1435 184 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541610.[MT7]-VSLAEK[MT7].2y4_1.heavy 467.794 / 604.379 1086.0 23.952924728393555 35 17 8 6 4 3.723863319520771 26.85383200715034 0.0345001220703125 9 0.970482004116461 7.165472197439678 1086.0 2.8334130860205904 11.0 - - - - - - - 631.6666666666666 3 9 PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 1437 184 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541610.[MT7]-VSLAEK[MT7].2y5_1.heavy 467.794 / 691.411 8748.0 23.952924728393555 35 17 8 6 4 3.723863319520771 26.85383200715034 0.0345001220703125 9 0.970482004116461 7.165472197439678 8748.0 45.94302843329112 1.0 - - - - - - - 207.6 24 20 PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 1439 184 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541610.[MT7]-VSLAEK[MT7].2b4_1.heavy 467.794 / 515.331 2043.0 23.952924728393555 35 17 8 6 4 3.723863319520771 26.85383200715034 0.0345001220703125 9 0.970482004116461 7.165472197439678 2043.0 6.409411764705883 4.0 - - - - - - - 1204.142857142857 5 7 PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 1441 184 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541610.[MT7]-VSLAEK[MT7].2y3_1.heavy 467.794 / 491.295 3576.0 23.952924728393555 35 17 8 6 4 3.723863319520771 26.85383200715034 0.0345001220703125 9 0.970482004116461 7.165472197439678 3576.0 3.7171270718232043 1.0 - - - - - - - 1085.75 7 8 PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 1443 185 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43633.[MT7]-SLSPFFSEEFYFEIPR.3y7_1.heavy 713.69 / 971.498 1270.0 48.73799991607666 43 18 10 5 10 4.11797473465496 24.283781820817524 0.040401458740234375 3 0.9834361172703551 9.575908784671592 1270.0 7.828075344961423 0.0 - - - - - - - 113.0 2 13 RASA2 RAS p21 protein activator 2 1445 185 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43633.[MT7]-SLSPFFSEEFYFEIPR.3y6_1.heavy 713.69 / 824.43 2817.0 48.73799991607666 43 18 10 5 10 4.11797473465496 24.283781820817524 0.040401458740234375 3 0.9834361172703551 9.575908784671592 2817.0 14.92079571972674 0.0 - - - - - - - 189.30769230769232 5 13 RASA2 RAS p21 protein activator 2 1447 185 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43633.[MT7]-SLSPFFSEEFYFEIPR.3b5_1.heavy 713.69 / 676.379 2936.0 48.73799991607666 43 18 10 5 10 4.11797473465496 24.283781820817524 0.040401458740234375 3 0.9834361172703551 9.575908784671592 2936.0 22.866896090239937 0.0 - - - - - - - 171.8 5 15 RASA2 RAS p21 protein activator 2 1449 185 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43633.[MT7]-SLSPFFSEEFYFEIPR.3y5_1.heavy 713.69 / 661.367 2976.0 48.73799991607666 43 18 10 5 10 4.11797473465496 24.283781820817524 0.040401458740234375 3 0.9834361172703551 9.575908784671592 2976.0 28.869525443110348 0.0 - - - - - - - 137.0909090909091 5 11 RASA2 RAS p21 protein activator 2 1451 186 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543892.[MT7]-SDSTHLVTLGGVLR.3y7_1.heavy 533.638 / 715.446 78887.0 33.89080047607422 47 17 10 10 10 2.2332201999140526 35.28055797350567 0.0 3 0.9702133714928207 7.1329264437327 78887.0 116.50719995759118 0.0 - - - - - - - 308.57142857142856 157 7 KLHL9 kelch-like 9 (Drosophila) 1453 186 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543892.[MT7]-SDSTHLVTLGGVLR.3b4_1.heavy 533.638 / 535.248 22890.0 33.89080047607422 47 17 10 10 10 2.2332201999140526 35.28055797350567 0.0 3 0.9702133714928207 7.1329264437327 22890.0 25.290212163412377 0.0 - - - - - - - 343.625 45 8 KLHL9 kelch-like 9 (Drosophila) 1455 186 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543892.[MT7]-SDSTHLVTLGGVLR.3y8_1.heavy 533.638 / 814.515 38903.0 33.89080047607422 47 17 10 10 10 2.2332201999140526 35.28055797350567 0.0 3 0.9702133714928207 7.1329264437327 38903.0 424.65623487562965 0.0 - - - - - - - 212.66666666666666 77 6 KLHL9 kelch-like 9 (Drosophila) 1457 186 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543892.[MT7]-SDSTHLVTLGGVLR.3y5_1.heavy 533.638 / 501.314 55309.0 33.89080047607422 47 17 10 10 10 2.2332201999140526 35.28055797350567 0.0 3 0.9702133714928207 7.1329264437327 55309.0 72.59664232419064 0.0 - - - - - - - 1313.75 110 8 KLHL9 kelch-like 9 (Drosophila) 1459 187 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37184.[MT7]-SAGTATQMR.2y8_1.heavy 533.775 / 835.409 2011.0 16.487274646759033 42 16 10 6 10 4.5771351052085745 21.847727388733727 0.03330039978027344 3 0.9664303088560977 6.716858852835838 2011.0 6.974566473988439 0.0 - - - - - - - 102.65384615384616 4 26 BAD BCL2-associated agonist of cell death 1461 187 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37184.[MT7]-SAGTATQMR.2y5_1.heavy 533.775 / 606.303 797.0 16.487274646759033 42 16 10 6 10 4.5771351052085745 21.847727388733727 0.03330039978027344 3 0.9664303088560977 6.716858852835838 797.0 8.836458425967097 0.0 - - - - - - - 0.0 1 0 BAD BCL2-associated agonist of cell death 1463 187 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37184.[MT7]-SAGTATQMR.2b6_1.heavy 533.775 / 633.332 728.0 16.487274646759033 42 16 10 6 10 4.5771351052085745 21.847727388733727 0.03330039978027344 3 0.9664303088560977 6.716858852835838 728.0 5.6000000000000005 0.0 - - - - - - - 0.0 1 0 BAD BCL2-associated agonist of cell death 1465 187 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37184.[MT7]-SAGTATQMR.2y7_1.heavy 533.775 / 764.372 971.0 16.487274646759033 42 16 10 6 10 4.5771351052085745 21.847727388733727 0.03330039978027344 3 0.9664303088560977 6.716858852835838 971.0 4.668269230769231 0.0 - - - - - - - 0.0 1 0 BAD BCL2-associated agonist of cell death 1467 188 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43637.[MT7]-ELVNDDEDIDWVQTEK[MT7].3b6_1.heavy 746.034 / 830.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCI protein kinase C, iota 1469 188 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43637.[MT7]-ELVNDDEDIDWVQTEK[MT7].3y3_1.heavy 746.034 / 521.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCI protein kinase C, iota 1471 188 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43637.[MT7]-ELVNDDEDIDWVQTEK[MT7].3y4_1.heavy 746.034 / 649.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCI protein kinase C, iota 1473 188 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43637.[MT7]-ELVNDDEDIDWVQTEK[MT7].3b8_1.heavy 746.034 / 1074.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKCI protein kinase C, iota 1475 189 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37702.[MT7]-LALLLAAVGATLAVLSVGTEFWVELNTYK[MT7].3b6_1.heavy 1117.65 / 739.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNG6 calcium channel, voltage-dependent, gamma subunit 6 1477 189 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37702.[MT7]-LALLLAAVGATLAVLSVGTEFWVELNTYK[MT7].3b5_1.heavy 1117.65 / 668.483 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNG6 calcium channel, voltage-dependent, gamma subunit 6 1479 189 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37702.[MT7]-LALLLAAVGATLAVLSVGTEFWVELNTYK[MT7].3b3_1.heavy 1117.65 / 442.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNG6 calcium channel, voltage-dependent, gamma subunit 6 1481 189 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37702.[MT7]-LALLLAAVGATLAVLSVGTEFWVELNTYK[MT7].3b7_1.heavy 1117.65 / 810.557 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNG6 calcium channel, voltage-dependent, gamma subunit 6 1483 190 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23826.[MT7]-LETGQFLTFR.2y8_1.heavy 678.376 / 969.515 1157.0 39.02909851074219 27 11 2 10 4 1.2652966298438921 52.082912642960935 0.0 8 0.8697376057615341 3.381595681568688 1157.0 17.73064935064935 0.0 - - - - - - - 175.0909090909091 2 11 UBA6 ubiquitin-like modifier activating enzyme 6 1485 190 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23826.[MT7]-LETGQFLTFR.2y9_1.heavy 678.376 / 1098.56 3547.0 39.02909851074219 27 11 2 10 4 1.2652966298438921 52.082912642960935 0.0 8 0.8697376057615341 3.381595681568688 3547.0 43.531363636363636 1.0 - - - - - - - 145.44444444444446 19 9 UBA6 ubiquitin-like modifier activating enzyme 6 1487 190 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23826.[MT7]-LETGQFLTFR.2b5_1.heavy 678.376 / 673.364 925.0 39.02909851074219 27 11 2 10 4 1.2652966298438921 52.082912642960935 0.0 8 0.8697376057615341 3.381595681568688 925.0 3.9402856862360105 10.0 - - - - - - - 246.65 2 20 UBA6 ubiquitin-like modifier activating enzyme 6 1489 190 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23826.[MT7]-LETGQFLTFR.2y7_1.heavy 678.376 / 868.468 N/A 39.02909851074219 27 11 2 10 4 1.2652966298438921 52.082912642960935 0.0 8 0.8697376057615341 3.381595681568688 463.0 0.9461042839437965 6.0 - - - - - - - 185.88235294117646 4 17 UBA6 ubiquitin-like modifier activating enzyme 6 1491 191 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24161.[MT7]-VARPPAAPELGALGSPDLSSLSLAVSR.3b9_1.heavy 925.854 / 1033.59 4196.0 40.53010177612305 40 10 10 10 10 0.9611353843301076 61.3279700720266 0.0 3 0.8247069842375463 2.903498898176116 4196.0 14.406866952789699 0.0 - - - - - - - 222.6 8 15 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1493 191 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24161.[MT7]-VARPPAAPELGALGSPDLSSLSLAVSR.3b11_2.heavy 925.854 / 602.352 24321.0 40.53010177612305 40 10 10 10 10 0.9611353843301076 61.3279700720266 0.0 3 0.8247069842375463 2.903498898176116 24321.0 47.53622998011095 0.0 - - - - - - - 310.84615384615387 48 13 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1495 191 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24161.[MT7]-VARPPAAPELGALGSPDLSSLSLAVSR.3y12_1.heavy 925.854 / 1244.68 11034.0 40.53010177612305 40 10 10 10 10 0.9611353843301076 61.3279700720266 0.0 3 0.8247069842375463 2.903498898176116 11034.0 48.78376205787781 0.0 - - - - - - - 200.75 22 12 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1497 191 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24161.[MT7]-VARPPAAPELGALGSPDLSSLSLAVSR.3b7_1.heavy 925.854 / 807.496 8703.0 40.53010177612305 40 10 10 10 10 0.9611353843301076 61.3279700720266 0.0 3 0.8247069842375463 2.903498898176116 8703.0 30.78745921600151 0.0 - - - - - - - 179.3846153846154 17 13 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1499 192 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23822.[MT7]-SAPPNLWAAQR.2y8_1.heavy 677.871 / 955.511 4847.0 30.861125469207764 43 20 10 3 10 5.176508634620932 19.318039833101302 0.07729911804199219 3 0.9901625367321312 12.432662213890834 4847.0 52.59498046398046 0.0 - - - - - - - 181.16666666666666 9 6 BAD BCL2-associated agonist of cell death 1501 192 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23822.[MT7]-SAPPNLWAAQR.2y5_1.heavy 677.871 / 631.331 1671.0 30.861125469207764 43 20 10 3 10 5.176508634620932 19.318039833101302 0.07729911804199219 3 0.9901625367321312 12.432662213890834 1671.0 6.96234908028387 0.0 - - - - - - - 643.4 3 10 BAD BCL2-associated agonist of cell death 1503 192 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23822.[MT7]-SAPPNLWAAQR.2y10_1.heavy 677.871 / 1123.6 2674.0 30.861125469207764 43 20 10 3 10 5.176508634620932 19.318039833101302 0.07729911804199219 3 0.9901625367321312 12.432662213890834 2674.0 3.337130044843049 1.0 - - - - - - - 217.5 5 10 BAD BCL2-associated agonist of cell death 1505 192 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23822.[MT7]-SAPPNLWAAQR.2y7_1.heavy 677.871 / 858.458 1337.0 30.861125469207764 43 20 10 3 10 5.176508634620932 19.318039833101302 0.07729911804199219 3 0.9901625367321312 12.432662213890834 1337.0 5.593425997058105 0.0 - - - - - - - 190.0 2 11 BAD BCL2-associated agonist of cell death 1507 193 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37281.[MT7]-YEDGIALLR.2y8_1.heavy 597.336 / 886.499 2470.0 36.27869987487793 37 11 10 6 10 1.5230121475841625 52.103994391214385 0.031597137451171875 3 0.879144237889642 3.5136176450259904 2470.0 14.172131147540984 0.0 - - - - - - - 196.45 4 20 ANAPC7 anaphase promoting complex subunit 7 1509 193 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37281.[MT7]-YEDGIALLR.2b4_1.heavy 597.336 / 609.264 1281.0 36.27869987487793 37 11 10 6 10 1.5230121475841625 52.103994391214385 0.031597137451171875 3 0.879144237889642 3.5136176450259904 1281.0 0.0 2.0 - - - - - - - 293.4736842105263 2 19 ANAPC7 anaphase promoting complex subunit 7 1511 193 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37281.[MT7]-YEDGIALLR.2b6_1.heavy 597.336 / 793.385 1646.0 36.27869987487793 37 11 10 6 10 1.5230121475841625 52.103994391214385 0.031597137451171875 3 0.879144237889642 3.5136176450259904 1646.0 5.586788321167883 1.0 - - - - - - - 254.71428571428572 3 14 ANAPC7 anaphase promoting complex subunit 7 1513 193 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37281.[MT7]-YEDGIALLR.2y6_1.heavy 597.336 / 642.43 4939.0 36.27869987487793 37 11 10 6 10 1.5230121475841625 52.103994391214385 0.031597137451171875 3 0.879144237889642 3.5136176450259904 4939.0 8.027901394967177 0.0 - - - - - - - 293.42105263157896 9 19 ANAPC7 anaphase promoting complex subunit 7 1515 194 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37581.[MT7]-AAGAPGAAC[CAM]RPGC[CAM]SQK[MT7].3y15_2.heavy 616.313 / 816.397 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1517 194 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37581.[MT7]-AAGAPGAAC[CAM]RPGC[CAM]SQK[MT7].3y3_1.heavy 616.313 / 506.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1519 194 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37581.[MT7]-AAGAPGAAC[CAM]RPGC[CAM]SQK[MT7].3y6_1.heavy 616.313 / 820.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1521 194 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37581.[MT7]-AAGAPGAAC[CAM]RPGC[CAM]SQK[MT7].3y12_2.heavy 616.313 / 716.849 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1523 195 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542358.[MT7]-ALYLGAK[MT7].2y4_1.heavy 512.326 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 1525 195 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542358.[MT7]-ALYLGAK[MT7].2y5_1.heavy 512.326 / 695.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 1527 195 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542358.[MT7]-ALYLGAK[MT7].2b4_1.heavy 512.326 / 605.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 1529 195 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542358.[MT7]-ALYLGAK[MT7].2y6_1.heavy 512.326 / 808.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 1531 196 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43583.[MT7]-QEYFVVAATLQDIIR.2y9_1.heavy 955.529 / 1000.58 1423.0 49.94490051269531 31 3 10 10 8 0.5670402958287832 83.56434337460854 0.0 4 0.5276787405355471 1.7196535025120072 1423.0 52.366400000000006 0.0 - - - - - - - 43.75 2 8 PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 1533 196 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43583.[MT7]-QEYFVVAATLQDIIR.2b4_1.heavy 955.529 / 712.342 649.0 49.94490051269531 31 3 10 10 8 0.5670402958287832 83.56434337460854 0.0 4 0.5276787405355471 1.7196535025120072 649.0 5.192 0.0 - - - - - - - 0.0 1 0 PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 1535 196 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43583.[MT7]-QEYFVVAATLQDIIR.2y10_1.heavy 955.529 / 1099.65 3820.0 49.94490051269531 31 3 10 10 8 0.5670402958287832 83.56434337460854 0.0 4 0.5276787405355471 1.7196535025120072 3820.0 61.120000000000005 0.0 - - - - - - - 29.166666666666668 7 6 PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 1537 196 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43583.[MT7]-QEYFVVAATLQDIIR.2b5_1.heavy 955.529 / 811.411 699.0 49.94490051269531 31 3 10 10 8 0.5670402958287832 83.56434337460854 0.0 4 0.5276787405355471 1.7196535025120072 699.0 9.32 1.0 - - - - - - - 0.0 1 0 PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 1539 197 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 257051.0 39.069698333740234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 257051.0 178.10989768534048 0.0 - - - - - - - 193.66666666666666 514 6 1541 197 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 474539.0 39.069698333740234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 474539.0 225.67409836178769 0.0 - - - - - - - 674.7142857142857 949 7 1543 197 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 538849.0 39.069698333740234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 538849.0 195.19175758866106 0.0 - - - - - - - 300.125 1077 8 1545 198 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542628.[MT7]-NLVLAGIK[MT7].2y4_1.heavy 558.373 / 532.357 10672.0 33.978599548339844 47 17 10 10 10 2.6183103924731412 31.87200296755171 0.0 3 0.9742911728082078 7.680445062066123 10672.0 10.783616734143049 1.0 - - - - - - - 803.0 21 8 UBA6 ubiquitin-like modifier activating enzyme 6 1547 198 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542628.[MT7]-NLVLAGIK[MT7].2y5_1.heavy 558.373 / 645.442 15711.0 33.978599548339844 47 17 10 10 10 2.6183103924731412 31.87200296755171 0.0 3 0.9742911728082078 7.680445062066123 15711.0 16.25656439470337 0.0 - - - - - - - 790.7142857142857 31 7 UBA6 ubiquitin-like modifier activating enzyme 6 1549 198 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542628.[MT7]-NLVLAGIK[MT7].2b4_1.heavy 558.373 / 584.389 8696.0 33.978599548339844 47 17 10 10 10 2.6183103924731412 31.87200296755171 0.0 3 0.9742911728082078 7.680445062066123 8696.0 19.27141896304672 0.0 - - - - - - - 692.0 17 8 UBA6 ubiquitin-like modifier activating enzyme 6 1551 198 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542628.[MT7]-NLVLAGIK[MT7].2y6_1.heavy 558.373 / 744.51 6522.0 33.978599548339844 47 17 10 10 10 2.6183103924731412 31.87200296755171 0.0 3 0.9742911728082078 7.680445062066123 6522.0 14.08259109311741 0.0 - - - - - - - 278.45454545454544 13 11 UBA6 ubiquitin-like modifier activating enzyme 6 1553 199 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24156.[MT7]-DFNVGDYIQAVLDRNLAENISR.3y18_2.heavy 889.46 / 1024.03 6830.0 48.5015983581543 48 18 10 10 10 4.911538098913571 20.360220767119763 0.0 3 0.9895748624878674 12.07656580428451 6830.0 54.83083170890188 0.0 - - - - - - - 205.47058823529412 13 17 PYGL phosphorylase, glycogen, liver 1555 199 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24156.[MT7]-DFNVGDYIQAVLDRNLAENISR.3b6_1.heavy 889.46 / 792.364 2783.0 48.5015983581543 48 18 10 10 10 4.911538098913571 20.360220767119763 0.0 3 0.9895748624878674 12.07656580428451 2783.0 26.010657894736845 0.0 - - - - - - - 157.7058823529412 5 17 PYGL phosphorylase, glycogen, liver 1557 199 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24156.[MT7]-DFNVGDYIQAVLDRNLAENISR.3b3_1.heavy 889.46 / 521.248 6071.0 48.5015983581543 48 18 10 10 10 4.911538098913571 20.360220767119763 0.0 3 0.9895748624878674 12.07656580428451 6071.0 33.81041338032108 0.0 - - - - - - - 183.5 12 16 PYGL phosphorylase, glycogen, liver 1559 199 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24156.[MT7]-DFNVGDYIQAVLDRNLAENISR.3y21_2.heavy 889.46 / 1204.12 2783.0 48.5015983581543 48 18 10 10 10 4.911538098913571 20.360220767119763 0.0 3 0.9895748624878674 12.07656580428451 2783.0 26.872673267326732 0.0 - - - - - - - 131.6 5 10 PYGL phosphorylase, glycogen, liver 1561 200 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43383.[MT7]-K[MT7]TDIAAFVK[MT7].3y3_1.heavy 475.633 / 537.352 17878.0 29.601166407267254 37 16 10 3 8 2.2897629289607484 43.67264345806615 0.06509971618652344 4 0.9670147819766118 6.776440508939332 17878.0 33.39292401960785 1.0 - - - - - - - 699.7777777777778 35 9 MAP2K3 mitogen-activated protein kinase kinase 3 1563 200 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43383.[MT7]-K[MT7]TDIAAFVK[MT7].3b4_1.heavy 475.633 / 746.465 2565.0 29.601166407267254 37 16 10 3 8 2.2897629289607484 43.67264345806615 0.06509971618652344 4 0.9670147819766118 6.776440508939332 2565.0 4.056755811737179 1.0 - - - - - - - 271.94444444444446 6 18 MAP2K3 mitogen-activated protein kinase kinase 3 1565 200 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43383.[MT7]-K[MT7]TDIAAFVK[MT7].3y4_1.heavy 475.633 / 608.389 14069.0 29.601166407267254 37 16 10 3 8 2.2897629289607484 43.67264345806615 0.06509971618652344 4 0.9670147819766118 6.776440508939332 14069.0 36.324785745182794 0.0 - - - - - - - 691.8 28 10 MAP2K3 mitogen-activated protein kinase kinase 3 1567 200 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43383.[MT7]-K[MT7]TDIAAFVK[MT7].3b3_1.heavy 475.633 / 633.381 N/A 29.601166407267254 37 16 10 3 8 2.2897629289607484 43.67264345806615 0.06509971618652344 4 0.9670147819766118 6.776440508939332 7384.0 6.179514809162218 1.0 - - - - - - - 732.7142857142857 38 7 MAP2K3 mitogen-activated protein kinase kinase 3 1569 201 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42568.[MT7]-NSESVTPNPR.2y5_1.heavy 622.821 / 584.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - DET1 de-etiolated homolog 1 (Arabidopsis) 1571 201 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42568.[MT7]-NSESVTPNPR.2b4_1.heavy 622.821 / 562.259 N/A N/A - - - - - - - - - 0.0 - - - - - - - DET1 de-etiolated homolog 1 (Arabidopsis) 1573 201 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42568.[MT7]-NSESVTPNPR.2y9_1.heavy 622.821 / 986.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - DET1 de-etiolated homolog 1 (Arabidopsis) 1575 201 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42568.[MT7]-NSESVTPNPR.2b5_1.heavy 622.821 / 661.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - DET1 de-etiolated homolog 1 (Arabidopsis) 1577 202 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24157.[MT7]-IEGLLC[CAM]DVTLVPGDGDEIFPVHR.3b4_1.heavy 899.134 / 557.341 5898.0 45.47800064086914 45 15 10 10 10 1.7914292431271122 40.77805525453766 0.0 3 0.9529583727469939 5.66766056009088 5898.0 24.18838379012292 0.0 - - - - - - - 189.91666666666666 11 24 KLHL9 kelch-like 9 (Drosophila) 1579 202 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24157.[MT7]-IEGLLC[CAM]DVTLVPGDGDEIFPVHR.3b5_1.heavy 899.134 / 670.426 9437.0 45.47800064086914 45 15 10 10 10 1.7914292431271122 40.77805525453766 0.0 3 0.9529583727469939 5.66766056009088 9437.0 63.80985782931247 0.0 - - - - - - - 172.56521739130434 18 23 KLHL9 kelch-like 9 (Drosophila) 1581 202 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24157.[MT7]-IEGLLC[CAM]DVTLVPGDGDEIFPVHR.3b7_1.heavy 899.134 / 945.483 5576.0 45.47800064086914 45 15 10 10 10 1.7914292431271122 40.77805525453766 0.0 3 0.9529583727469939 5.66766056009088 5576.0 45.14735966873706 0.0 - - - - - - - 182.86363636363637 11 22 KLHL9 kelch-like 9 (Drosophila) 1583 202 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24157.[MT7]-IEGLLC[CAM]DVTLVPGDGDEIFPVHR.3y9_1.heavy 899.134 / 1069.54 2198.0 45.47800064086914 45 15 10 10 10 1.7914292431271122 40.77805525453766 0.0 3 0.9529583727469939 5.66766056009088 2198.0 46.493520249221184 0.0 - - - - - - - 177.3846153846154 4 13 KLHL9 kelch-like 9 (Drosophila) 1585 203 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23534.[MT7]-FTENTR.2y4_1.heavy 456.239 / 519.252 2896.0 19.49570083618164 50 20 10 10 10 7.963025670714727 12.55804064123084 0.0 3 0.998343406632621 30.317573444443042 2896.0 8.836603144569086 0.0 - - - - - - - 236.2173913043478 5 23 RFC5 replication factor C (activator 1) 5, 36.5kDa 1587 203 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23534.[MT7]-FTENTR.2b3_1.heavy 456.239 / 522.268 4571.0 19.49570083618164 50 20 10 10 10 7.963025670714727 12.55804064123084 0.0 3 0.998343406632621 30.317573444443042 4571.0 27.37196356028599 0.0 - - - - - - - 202.66666666666666 9 21 RFC5 replication factor C (activator 1) 5, 36.5kDa 1589 203 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23534.[MT7]-FTENTR.2y5_1.heavy 456.239 / 620.3 18237.0 19.49570083618164 50 20 10 10 10 7.963025670714727 12.55804064123084 0.0 3 0.998343406632621 30.317573444443042 18237.0 83.06159065744669 0.0 - - - - - - - 238.77272727272728 36 22 RFC5 replication factor C (activator 1) 5, 36.5kDa 1591 203 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23534.[MT7]-FTENTR.2b4_1.heavy 456.239 / 636.311 4028.0 19.49570083618164 50 20 10 10 10 7.963025670714727 12.55804064123084 0.0 3 0.998343406632621 30.317573444443042 4028.0 18.175534587509034 0.0 - - - - - - - 198.95652173913044 8 23 RFC5 replication factor C (activator 1) 5, 36.5kDa 1593 204 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 666719.0 34.20109939575195 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 666719.0 402.3632930286386 0.0 - - - - - - - 209.66666666666666 1333 6 1595 204 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 102034.0 34.20109939575195 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 102034.0 139.04755358685819 0.0 - - - - - - - 373.14285714285717 204 7 1597 204 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 95644.0 34.20109939575195 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 95644.0 116.10700623646733 0.0 - - - - - - - 304.2857142857143 191 7 1599 205 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543257.[MT7]-LAYSEPC[CAM]GLR.2y8_1.heavy 655.338 / 981.446 8174.0 29.090700149536133 44 18 10 6 10 4.94691034652743 20.21463762127744 0.03079986572265625 3 0.98984519664428 12.236533686077365 8174.0 72.95132083602671 0.0 - - - - - - - 131.64285714285714 16 14 DDIT4 DNA-damage-inducible transcript 4 1601 205 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543257.[MT7]-LAYSEPC[CAM]GLR.2y5_1.heavy 655.338 / 602.308 11193.0 29.090700149536133 44 18 10 6 10 4.94691034652743 20.21463762127744 0.03079986572265625 3 0.98984519664428 12.236533686077365 11193.0 31.99724919093851 0.0 - - - - - - - 657.0 22 13 DDIT4 DNA-damage-inducible transcript 4 1603 205 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543257.[MT7]-LAYSEPC[CAM]GLR.2y9_1.heavy 655.338 / 1052.48 15243.0 29.090700149536133 44 18 10 6 10 4.94691034652743 20.21463762127744 0.03079986572265625 3 0.98984519664428 12.236533686077365 15243.0 164.7231203250531 0.0 - - - - - - - 161.0625 30 16 DDIT4 DNA-damage-inducible transcript 4 1605 205 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543257.[MT7]-LAYSEPC[CAM]GLR.2y7_1.heavy 655.338 / 818.383 7879.0 29.090700149536133 44 18 10 6 10 4.94691034652743 20.21463762127744 0.03079986572265625 3 0.98984519664428 12.236533686077365 7879.0 87.37727673325499 0.0 - - - - - - - 225.47058823529412 15 17 DDIT4 DNA-damage-inducible transcript 4 1607 206 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23699.[MT7]-AWELTQK[MT7].2y4_1.heavy 582.337 / 633.405 3496.0 29.601200103759766 48 18 10 10 10 3.140660973656349 25.405698145433778 0.0 3 0.9802587878618192 8.769168270915543 3496.0 7.1090909090909085 0.0 - - - - - - - 692.4444444444445 6 9 PYGL phosphorylase, glycogen, liver 1609 206 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23699.[MT7]-AWELTQK[MT7].2b3_1.heavy 582.337 / 531.268 N/A 29.601200103759766 48 18 10 10 10 3.140660973656349 25.405698145433778 0.0 3 0.9802587878618192 8.769168270915543 3040.0 0.0714285714285714 2.0 - - - - - - - 801.4545454545455 6 11 PYGL phosphorylase, glycogen, liver 1611 206 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23699.[MT7]-AWELTQK[MT7].2y5_1.heavy 582.337 / 762.448 2432.0 29.601200103759766 48 18 10 10 10 3.140660973656349 25.405698145433778 0.0 3 0.9802587878618192 8.769168270915543 2432.0 10.88 0.0 - - - - - - - 192.92307692307693 4 13 PYGL phosphorylase, glycogen, liver 1613 206 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23699.[MT7]-AWELTQK[MT7].2y3_1.heavy 582.337 / 520.321 3116.0 29.601200103759766 48 18 10 10 10 3.140660973656349 25.405698145433778 0.0 3 0.9802587878618192 8.769168270915543 3116.0 5.466666666666667 0.0 - - - - - - - 717.7777777777778 6 9 PYGL phosphorylase, glycogen, liver 1615 207 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541379.[MT7]-EILGEDS.2b3_1.heavy 453.73 / 500.32 24247.0 28.000174522399902 43 17 10 6 10 2.3908462524833034 33.30726359208743 0.035900115966796875 3 0.9742386300031877 7.672574643653405 24247.0 23.414032207305503 0.0 - - - - - - - 459.5 48 4 LOC100509916;LOC100510195;MAP2K3 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3 1617 207 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541379.[MT7]-EILGEDS.2b4_1.heavy 453.73 / 557.341 18521.0 28.000174522399902 43 17 10 6 10 2.3908462524833034 33.30726359208743 0.035900115966796875 3 0.9742386300031877 7.672574643653405 18521.0 7.42012790430424 0.0 - - - - - - - 388.5 37 2 LOC100509916;LOC100510195;MAP2K3 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3 1619 207 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541379.[MT7]-EILGEDS.2b6_1.heavy 453.73 / 801.411 11452.0 28.000174522399902 43 17 10 6 10 2.3908462524833034 33.30726359208743 0.035900115966796875 3 0.9742386300031877 7.672574643653405 11452.0 38.027489972793305 0.0 - - - - - - - 265.0833333333333 22 12 LOC100509916;LOC100510195;MAP2K3 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3 1621 207 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541379.[MT7]-EILGEDS.2b5_1.heavy 453.73 / 686.384 20783.0 28.000174522399902 43 17 10 6 10 2.3908462524833034 33.30726359208743 0.035900115966796875 3 0.9742386300031877 7.672574643653405 20783.0 24.76133170900948 0.0 - - - - - - - 795.375 41 8 LOC100509916;LOC100510195;MAP2K3 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3 1623 208 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23799.[MT7]-SGPASGPSVPTGR.2y8_1.heavy 657.35 / 770.416 1648.0 20.509199619293213 43 17 10 6 10 2.3436713580188493 33.97467915363252 0.03360176086425781 3 0.9785877448133025 8.418857701185683 1648.0 18.116312056737588 0.0 - - - - - - - 124.0909090909091 3 11 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1625 208 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23799.[MT7]-SGPASGPSVPTGR.2y9_1.heavy 657.35 / 857.448 1083.0 20.509199619293213 43 17 10 6 10 2.3436713580188493 33.97467915363252 0.03360176086425781 3 0.9785877448133025 8.418857701185683 1083.0 25.57723404255319 0.0 - - - - - - - 125.5 2 12 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1627 208 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23799.[MT7]-SGPASGPSVPTGR.2b6_1.heavy 657.35 / 601.306 753.0 20.509199619293213 43 17 10 6 10 2.3436713580188493 33.97467915363252 0.03360176086425781 3 0.9785877448133025 8.418857701185683 753.0 7.095217652808058 0.0 - - - - - - - 0.0 1 0 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1629 208 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23799.[MT7]-SGPASGPSVPTGR.2y11_1.heavy 657.35 / 1025.54 1318.0 20.509199619293213 43 17 10 6 10 2.3436713580188493 33.97467915363252 0.03360176086425781 3 0.9785877448133025 8.418857701185683 1318.0 26.36 0.0 - - - - - - - 99.875 2 8 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1631 209 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37452.[MT7]-GIVGVENVAELK[MT7].2y9_1.heavy 758.453 / 1102.62 3396.0 34.709075927734375 41 15 10 6 10 5.5349230896102535 18.06709838257962 0.0364990234375 3 0.9539042245907239 5.725972598532115 3396.0 16.10474226804124 1.0 - - - - - - - 185.91666666666666 6 12 PYGL phosphorylase, glycogen, liver 1633 209 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37452.[MT7]-GIVGVENVAELK[MT7].2b7_1.heavy 758.453 / 813.459 582.0 34.709075927734375 41 15 10 6 10 5.5349230896102535 18.06709838257962 0.0364990234375 3 0.9539042245907239 5.725972598532115 582.0 0.8 6.0 - - - - - - - 0.0 1 0 PYGL phosphorylase, glycogen, liver 1635 209 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37452.[MT7]-GIVGVENVAELK[MT7].2b5_1.heavy 758.453 / 570.373 2134.0 34.709075927734375 41 15 10 6 10 5.5349230896102535 18.06709838257962 0.0364990234375 3 0.9539042245907239 5.725972598532115 2134.0 8.048333333333332 0.0 - - - - - - - 252.2 4 20 PYGL phosphorylase, glycogen, liver 1637 209 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37452.[MT7]-GIVGVENVAELK[MT7].2y7_1.heavy 758.453 / 946.533 1843.0 34.709075927734375 41 15 10 6 10 5.5349230896102535 18.06709838257962 0.0364990234375 3 0.9539042245907239 5.725972598532115 1843.0 12.476666666666667 0.0 - - - - - - - 242.5 3 8 PYGL phosphorylase, glycogen, liver 1639 210 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43649.[MT7]-SLLRDNVDLLGSLADLYFR.3y4_1.heavy 775.429 / 598.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 1641 210 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43649.[MT7]-SLLRDNVDLLGSLADLYFR.3b8_1.heavy 775.429 / 1057.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 1643 210 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43649.[MT7]-SLLRDNVDLLGSLADLYFR.3b8_2.heavy 775.429 / 529.292 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 1645 210 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43649.[MT7]-SLLRDNVDLLGSLADLYFR.3y9_1.heavy 775.429 / 1041.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 1647 211 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543761.[MT7]-FGPLTPELMVPR.3y7_1.heavy 500.95 / 841.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1649 211 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543761.[MT7]-FGPLTPELMVPR.3y6_1.heavy 500.95 / 744.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1651 211 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543761.[MT7]-FGPLTPELMVPR.3b4_1.heavy 500.95 / 559.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1653 211 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543761.[MT7]-FGPLTPELMVPR.3y4_1.heavy 500.95 / 502.281 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1655 212 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37098.[MT7]-NIAASGK[MT7].2y4_1.heavy 474.789 / 506.306 2160.0 17.07005023956299 44 18 10 6 10 4.936851020993945 20.255826958267583 0.03370094299316406 3 0.9890893158025934 11.80431292604959 2160.0 6.81095206294823 0.0 - - - - - - - 223.42105263157896 4 19 PYGL phosphorylase, glycogen, liver 1657 212 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37098.[MT7]-NIAASGK[MT7].2y5_1.heavy 474.789 / 577.343 3259.0 17.07005023956299 44 18 10 6 10 4.936851020993945 20.255826958267583 0.03370094299316406 3 0.9890893158025934 11.80431292604959 3259.0 10.102894184268914 0.0 - - - - - - - 182.91304347826087 6 23 PYGL phosphorylase, glycogen, liver 1659 212 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37098.[MT7]-NIAASGK[MT7].2b4_1.heavy 474.789 / 514.311 720.0 17.07005023956299 44 18 10 6 10 4.936851020993945 20.255826958267583 0.03370094299316406 3 0.9890893158025934 11.80431292604959 720.0 13.353171785769407 2.0 - - - - - - - 0.0 1 0 PYGL phosphorylase, glycogen, liver 1661 212 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37098.[MT7]-NIAASGK[MT7].2y6_1.heavy 474.789 / 690.427 1554.0 17.07005023956299 44 18 10 6 10 4.936851020993945 20.255826958267583 0.03370094299316406 3 0.9890893158025934 11.80431292604959 1554.0 12.483017196456487 0.0 - - - - - - - 141.36363636363637 3 22 PYGL phosphorylase, glycogen, liver 1663 213 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24149.[MT7]-TPPYEDLEIVEPVTVNVFLQR.3b6_1.heavy 868.134 / 847.395 17154.0 47.00399875640869 43 17 10 6 10 2.4121146306067587 33.034778863325506 0.035198211669921875 3 0.9752770570124731 7.832735288506528 17154.0 82.14033392838391 0.0 - - - - - - - 302.8 34 15 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1665 213 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24149.[MT7]-TPPYEDLEIVEPVTVNVFLQR.3y8_1.heavy 868.134 / 976.557 8871.0 47.00399875640869 43 17 10 6 10 2.4121146306067587 33.034778863325506 0.035198211669921875 3 0.9752770570124731 7.832735288506528 8871.0 132.26702453271028 0.0 - - - - - - - 188.52941176470588 17 17 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1667 213 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24149.[MT7]-TPPYEDLEIVEPVTVNVFLQR.3b8_1.heavy 868.134 / 1089.52 19291.0 47.00399875640869 43 17 10 6 10 2.4121146306067587 33.034778863325506 0.035198211669921875 3 0.9752770570124731 7.832735288506528 19291.0 216.34766355140187 0.0 - - - - - - - 290.75 38 16 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1669 213 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24149.[MT7]-TPPYEDLEIVEPVTVNVFLQR.3y10_1.heavy 868.134 / 1172.68 27200.0 47.00399875640869 43 17 10 6 10 2.4121146306067587 33.034778863325506 0.035198211669921875 3 0.9752770570124731 7.832735288506528 27200.0 148.80317190597563 0.0 - - - - - - - 217.84615384615384 54 13 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1671 214 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543768.[MT7]-VTC[CAM]SDLGISGTVR.3y7_1.heavy 503.6 / 689.394 28651.0 29.552849769592285 43 17 10 6 10 3.6626196305103202 21.47837270523022 0.03149986267089844 3 0.9797014394894129 8.647535842909035 28651.0 22.715088929989996 0.0 - - - - - - - 1286.5714285714287 57 7 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1673 214 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543768.[MT7]-VTC[CAM]SDLGISGTVR.3b5_1.heavy 503.6 / 707.315 44336.0 29.552849769592285 43 17 10 6 10 3.6626196305103202 21.47837270523022 0.03149986267089844 3 0.9797014394894129 8.647535842909035 44336.0 85.49181652490887 0.0 - - - - - - - 282.3636363636364 88 11 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1675 214 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543768.[MT7]-VTC[CAM]SDLGISGTVR.3b7_1.heavy 503.6 / 877.421 14908.0 29.552849769592285 43 17 10 6 10 3.6626196305103202 21.47837270523022 0.03149986267089844 3 0.9797014394894129 8.647535842909035 14908.0 56.095045471481995 0.0 - - - - - - - 155.4375 29 16 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1677 214 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543768.[MT7]-VTC[CAM]SDLGISGTVR.3y5_1.heavy 503.6 / 519.289 67163.0 29.552849769592285 43 17 10 6 10 3.6626196305103202 21.47837270523022 0.03149986267089844 3 0.9797014394894129 8.647535842909035 67163.0 24.50744566954819 0.0 - - - - - - - 733.3333333333334 134 9 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1679 215 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23819.[MT7]-EIEAAIERK[MT7].3b4_1.heavy 449.601 / 587.316 11990.0 26.244800567626953 41 11 10 10 10 0.914541746160803 66.81982125883843 0.0 3 0.877590968104236 3.4907809201702333 11990.0 14.64281517542387 0.0 - - - - - - - 713.5714285714286 23 14 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1681 215 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23819.[MT7]-EIEAAIERK[MT7].3b5_1.heavy 449.601 / 658.353 15765.0 26.244800567626953 41 11 10 10 10 0.914541746160803 66.81982125883843 0.0 3 0.877590968104236 3.4907809201702333 15765.0 80.95540540540541 0.0 - - - - - - - 216.71428571428572 31 14 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1683 215 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23819.[MT7]-EIEAAIERK[MT7].3b3_1.heavy 449.601 / 516.279 11324.0 26.244800567626953 41 11 10 10 10 0.914541746160803 66.81982125883843 0.0 3 0.877590968104236 3.4907809201702333 11324.0 34.52917532917533 0.0 - - - - - - - 764.6666666666666 22 12 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1685 215 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23819.[MT7]-EIEAAIERK[MT7].3y8_2.heavy 449.601 / 537.325 30567.0 26.244800567626953 41 11 10 10 10 0.914541746160803 66.81982125883843 0.0 3 0.877590968104236 3.4907809201702333 30567.0 48.38791505791505 0.0 - - - - - - - 779.4666666666667 61 15 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1687 216 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43176.[MT7]-LFNTIVK[MT7].2y4_1.heavy 561.86 / 604.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASA2 RAS p21 protein activator 2 1689 216 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43176.[MT7]-LFNTIVK[MT7].2y5_1.heavy 561.86 / 718.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASA2 RAS p21 protein activator 2 1691 216 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43176.[MT7]-LFNTIVK[MT7].2y3_1.heavy 561.86 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASA2 RAS p21 protein activator 2 1693 216 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43176.[MT7]-LFNTIVK[MT7].2y6_1.heavy 561.86 / 865.526 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASA2 RAS p21 protein activator 2 1695 217 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37443.[MT7]-ALTQRPDYIK[MT7].3y3_1.heavy 498.296 / 567.362 13345.0 25.14889907836914 43 13 10 10 10 1.4718939079413143 54.22273644510603 0.0 3 0.9211047595835784 4.364549590207325 13345.0 32.89281002160328 0.0 - - - - - - - 697.5714285714286 26 7 ANAPC7 anaphase promoting complex subunit 7 1697 217 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37443.[MT7]-ALTQRPDYIK[MT7].3y4_1.heavy 498.296 / 682.389 1995.0 25.14889907836914 43 13 10 10 10 1.4718939079413143 54.22273644510603 0.0 3 0.9211047595835784 4.364549590207325 1995.0 7.397949260042283 0.0 - - - - - - - 264.9 3 20 ANAPC7 anaphase promoting complex subunit 7 1699 217 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37443.[MT7]-ALTQRPDYIK[MT7].3y9_2.heavy 498.296 / 639.37 11763.0 25.14889907836914 43 13 10 10 10 1.4718939079413143 54.22273644510603 0.0 3 0.9211047595835784 4.364549590207325 11763.0 33.62017080334851 0.0 - - - - - - - 254.94117647058823 23 17 ANAPC7 anaphase promoting complex subunit 7 1701 217 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37443.[MT7]-ALTQRPDYIK[MT7].3y5_1.heavy 498.296 / 779.442 7154.0 25.14889907836914 43 13 10 10 10 1.4718939079413143 54.22273644510603 0.0 3 0.9211047595835784 4.364549590207325 7154.0 20.914353715603518 0.0 - - - - - - - 166.0 14 17 ANAPC7 anaphase promoting complex subunit 7 1703 218 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24181.[MT7]-LSVGAVSSK[MT7]PTTPTIATPQTVSVPNK[MT7].4y5_1.heavy 753.938 / 688.411 4389.0 31.11312484741211 46 20 10 6 10 23.579979994720265 4.240885701446344 0.038299560546875 3 0.9929083231623596 14.646400670151296 4389.0 13.156164666129698 0.0 - - - - - - - 280.2142857142857 8 14 TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 1705 218 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24181.[MT7]-LSVGAVSSK[MT7]PTTPTIATPQTVSVPNK[MT7].4b14_2.heavy 753.938 / 807.969 4202.0 31.11312484741211 46 20 10 6 10 23.579979994720265 4.240885701446344 0.038299560546875 3 0.9929083231623596 14.646400670151296 4202.0 15.756214591618232 0.0 - - - - - - - 163.25 8 8 TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 1707 218 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24181.[MT7]-LSVGAVSSK[MT7]PTTPTIATPQTVSVPNK[MT7].4b5_1.heavy 753.938 / 572.352 2895.0 31.11312484741211 46 20 10 6 10 23.579979994720265 4.240885701446344 0.038299560546875 3 0.9929083231623596 14.646400670151296 2895.0 4.8692660550458715 0.0 - - - - - - - 212.0909090909091 5 11 TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 1709 218 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24181.[MT7]-LSVGAVSSK[MT7]PTTPTIATPQTVSVPNK[MT7].4y3_1.heavy 753.938 / 502.311 17742.0 31.11312484741211 46 20 10 6 10 23.579979994720265 4.240885701446344 0.038299560546875 3 0.9929083231623596 14.646400670151296 17742.0 59.79505981097839 0.0 - - - - - - - 254.72727272727272 35 11 TAF9B TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa 1711 219 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42441.[MT7]-YTFSGWR.2y5_1.heavy 530.77 / 652.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1713 219 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42441.[MT7]-YTFSGWR.2b4_1.heavy 530.77 / 643.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1715 219 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42441.[MT7]-YTFSGWR.2y6_1.heavy 530.77 / 753.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1717 219 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42441.[MT7]-YTFSGWR.2b5_1.heavy 530.77 / 700.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1719 220 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23903.[MT7]-RTFFHLSALK[MT7].3b4_1.heavy 503.304 / 696.395 7418.0 32.321998596191406 44 14 10 10 10 1.9871329303955392 50.3237596591462 0.0 3 0.9368522511445515 4.88507360291147 7418.0 13.128149831673745 0.0 - - - - - - - 776.8571428571429 14 7 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1721 220 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23903.[MT7]-RTFFHLSALK[MT7].3b5_1.heavy 503.304 / 833.454 5539.0 32.321998596191406 44 14 10 10 10 1.9871329303955392 50.3237596591462 0.0 3 0.9368522511445515 4.88507360291147 5539.0 41.94813383838384 0.0 - - - - - - - 259.875 11 8 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1723 220 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23903.[MT7]-RTFFHLSALK[MT7].3y4_1.heavy 503.304 / 562.368 27498.0 32.321998596191406 44 14 10 10 10 1.9871329303955392 50.3237596591462 0.0 3 0.9368522511445515 4.88507360291147 27498.0 18.518409001972262 0.0 - - - - - - - 819.2857142857143 54 7 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1725 220 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23903.[MT7]-RTFFHLSALK[MT7].3y5_1.heavy 503.304 / 675.452 6330.0 32.321998596191406 44 14 10 10 10 1.9871329303955392 50.3237596591462 0.0 3 0.9368522511445515 4.88507360291147 6330.0 6.857924302301183 0.0 - - - - - - - 279.0 12 11 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1727 221 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23904.[MT7]-VTC[CAM]SDLGISGTVR.2y8_1.heavy 754.897 / 802.478 3174.0 29.56072473526001 39 13 10 6 10 1.6829365190041123 38.53555903661987 0.03149986267089844 3 0.9260676241308691 4.510579190112242 3174.0 13.94263565891473 0.0 - - - - - - - 195.33333333333334 6 21 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1729 221 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23904.[MT7]-VTC[CAM]SDLGISGTVR.2b5_1.heavy 754.897 / 707.315 3329.0 29.56072473526001 39 13 10 6 10 1.6829365190041123 38.53555903661987 0.03149986267089844 3 0.9260676241308691 4.510579190112242 3329.0 12.9031007751938 0.0 - - - - - - - 206.22222222222223 6 18 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1731 221 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23904.[MT7]-VTC[CAM]SDLGISGTVR.2y11_1.heavy 754.897 / 1164.57 1007.0 29.56072473526001 39 13 10 6 10 1.6829365190041123 38.53555903661987 0.03149986267089844 3 0.9260676241308691 4.510579190112242 1007.0 19.87844155844156 0.0 - - - - - - - 162.4 2 10 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1733 221 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23904.[MT7]-VTC[CAM]SDLGISGTVR.2y7_1.heavy 754.897 / 689.394 1936.0 29.56072473526001 39 13 10 6 10 1.6829365190041123 38.53555903661987 0.03149986267089844 3 0.9260676241308691 4.510579190112242 1936.0 6.175862068965518 1.0 - - - - - - - 206.44444444444446 3 18 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1735 222 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544142.[MT7]-SLSC[CAM]LSDLDGGVALEPR.3b4_1.heavy 644.999 / 592.288 3687.0 38.00717544555664 42 16 10 6 10 3.073857992845276 32.532407233112394 0.0326995849609375 3 0.9622171115463503 6.329039580222911 3687.0 5.565721328997055 1.0 - - - - - - - 630.25 7 8 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1737 222 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544142.[MT7]-SLSC[CAM]LSDLDGGVALEPR.3y8_1.heavy 644.999 / 798.447 3386.0 38.00717544555664 42 16 10 6 10 3.073857992845276 32.532407233112394 0.0326995849609375 3 0.9622171115463503 6.329039580222911 3386.0 4.004656319290466 1.0 - - - - - - - 239.625 6 16 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1739 222 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544142.[MT7]-SLSC[CAM]LSDLDGGVALEPR.3b7_1.heavy 644.999 / 907.431 4665.0 38.00717544555664 42 16 10 6 10 3.073857992845276 32.532407233112394 0.0326995849609375 3 0.9622171115463503 6.329039580222911 4665.0 23.712458471760797 0.0 - - - - - - - 150.23076923076923 9 13 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1741 222 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544142.[MT7]-SLSC[CAM]LSDLDGGVALEPR.3y5_1.heavy 644.999 / 585.336 8879.0 38.00717544555664 42 16 10 6 10 3.073857992845276 32.532407233112394 0.0326995849609375 3 0.9622171115463503 6.329039580222911 8879.0 15.855357142857144 0.0 - - - - - - - 662.3 17 10 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1743 223 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23708.[MT7]-YGNPWEK[MT7].2b3_1.heavy 591.313 / 479.237 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 1745 223 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23708.[MT7]-YGNPWEK[MT7].2y4_1.heavy 591.313 / 703.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 1747 223 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23708.[MT7]-YGNPWEK[MT7].2y3_1.heavy 591.313 / 606.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 1749 223 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23708.[MT7]-YGNPWEK[MT7].2y6_1.heavy 591.313 / 874.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGB;PYGL;PYGM phosphorylase, glycogen; brain;phosphorylase, glycogen, liver;phosphorylase, glycogen, muscle 1751 224 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541669.[MT7]-TVIIGGK[MT7].2y4_1.heavy 488.326 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1753 224 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541669.[MT7]-TVIIGGK[MT7].2y5_1.heavy 488.326 / 631.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1755 224 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541669.[MT7]-TVIIGGK[MT7].2b6_1.heavy 488.326 / 685.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1757 224 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541669.[MT7]-TVIIGGK[MT7].2y6_1.heavy 488.326 / 730.494 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1759 225 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23707.[MT7]-TPTPDRPPR.2y4_1.heavy 590.831 / 525.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDIT4 DNA-damage-inducible transcript 4 1761 225 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23707.[MT7]-TPTPDRPPR.2y8_1.heavy 590.831 / 935.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDIT4 DNA-damage-inducible transcript 4 1763 225 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23707.[MT7]-TPTPDRPPR.2b6_1.heavy 590.831 / 812.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDIT4 DNA-damage-inducible transcript 4 1765 225 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23707.[MT7]-TPTPDRPPR.2b5_1.heavy 590.831 / 656.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDIT4 DNA-damage-inducible transcript 4 1767 226 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37499.[MT7]-FC[CAM]LIC[CAM]NYLSK[MT7].2b3_1.heavy 803.422 / 565.292 2566.0 40.25930118560791 39 13 10 6 10 1.4101807252590481 57.31703056091861 0.039600372314453125 3 0.9008429547937188 3.886376656333099 2566.0 7.149910886541111 0.0 - - - - - - - 223.06666666666666 5 15 RFC5 replication factor C (activator 1) 5, 36.5kDa 1769 226 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37499.[MT7]-FC[CAM]LIC[CAM]NYLSK[MT7].2b4_1.heavy 803.422 / 678.377 1011.0 40.25930118560791 39 13 10 6 10 1.4101807252590481 57.31703056091861 0.039600372314453125 3 0.9008429547937188 3.886376656333099 1011.0 2.925723472668811 1.0 - - - - - - - 244.57142857142858 2 21 RFC5 replication factor C (activator 1) 5, 36.5kDa 1771 226 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37499.[MT7]-FC[CAM]LIC[CAM]NYLSK[MT7].2y6_1.heavy 803.422 / 928.468 2255.0 40.25930118560791 39 13 10 6 10 1.4101807252590481 57.31703056091861 0.039600372314453125 3 0.9008429547937188 3.886376656333099 2255.0 11.199640102827765 0.0 - - - - - - - 212.73333333333332 4 15 RFC5 replication factor C (activator 1) 5, 36.5kDa 1773 226 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37499.[MT7]-FC[CAM]LIC[CAM]NYLSK[MT7].2y7_1.heavy 803.422 / 1041.55 622.0 40.25930118560791 39 13 10 6 10 1.4101807252590481 57.31703056091861 0.039600372314453125 3 0.9008429547937188 3.886376656333099 622.0 4.692777008766726 3.0 - - - - - - - 0.0 1 0 RFC5 replication factor C (activator 1) 5, 36.5kDa 1775 227 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23907.[MT7]-GIVGVENVAELK[MT7].3b6_1.heavy 505.971 / 699.416 70071.0 34.68170166015625 45 15 10 10 10 2.881956515620452 34.69864984360153 0.0 3 0.9585525465235958 6.040903243370493 70071.0 111.98850902140526 0.0 - - - - - - - 254.3 140 10 PYGL phosphorylase, glycogen, liver 1777 227 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23907.[MT7]-GIVGVENVAELK[MT7].3b5_1.heavy 505.971 / 570.373 91451.0 34.68170166015625 45 15 10 10 10 2.881956515620452 34.69864984360153 0.0 3 0.9585525465235958 6.040903243370493 91451.0 136.1526967040291 0.0 - - - - - - - 1234.7777777777778 182 9 PYGL phosphorylase, glycogen, liver 1779 227 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23907.[MT7]-GIVGVENVAELK[MT7].3y4_1.heavy 505.971 / 604.379 159356.0 34.68170166015625 45 15 10 10 10 2.881956515620452 34.69864984360153 0.0 3 0.9585525465235958 6.040903243370493 159356.0 171.09839593956394 0.0 - - - - - - - 471.0 318 1 PYGL phosphorylase, glycogen, liver 1781 227 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23907.[MT7]-GIVGVENVAELK[MT7].3b7_1.heavy 505.971 / 813.459 74310.0 34.68170166015625 45 15 10 10 10 2.881956515620452 34.69864984360153 0.0 3 0.9585525465235958 6.040903243370493 74310.0 345.4925583883547 0.0 - - - - - - - 266.8333333333333 148 12 PYGL phosphorylase, glycogen, liver 1783 228 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23701.[MT7]-NLPWVEK[MT7].2y4_1.heavy 587.347 / 705.405 894.0 33.71220016479492 38 20 6 10 2 7.666891815638003 13.04309522093843 0.0 15 0.9967062253308953 21.49790549524051 894.0 0.5396378269617708 14.0 - - - - - - - 757.625 13 8 RFC5 replication factor C (activator 1) 5, 36.5kDa 1785 228 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23701.[MT7]-NLPWVEK[MT7].2y5_1.heavy 587.347 / 802.458 4173.0 33.71220016479492 38 20 6 10 2 7.666891815638003 13.04309522093843 0.0 15 0.9967062253308953 21.49790549524051 4173.0 14.016029831381234 1.0 - - - - - - - 270.90909090909093 8 11 RFC5 replication factor C (activator 1) 5, 36.5kDa 1787 228 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23701.[MT7]-NLPWVEK[MT7].2y3_1.heavy 587.347 / 519.326 1590.0 33.71220016479492 38 20 6 10 2 7.666891815638003 13.04309522093843 0.0 15 0.9967062253308953 21.49790549524051 1590.0 0.6667785234899327 8.0 - - - - - - - 298.0 5 14 RFC5 replication factor C (activator 1) 5, 36.5kDa 1789 229 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24178.[MT7]-TFITIGDRNFEVEADDLVTISELGR.3y7_1.heavy 985.512 / 775.431 4692.0 46.50749969482422 39 9 10 10 10 1.6371340669911354 51.91139275890802 0.0 3 0.8041548213020154 2.74188276399807 4692.0 40.95907710280373 0.0 - - - - - - - 135.6818181818182 9 22 MAP2K3 mitogen-activated protein kinase kinase 3 1791 229 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24178.[MT7]-TFITIGDRNFEVEADDLVTISELGR.3y8_1.heavy 985.512 / 874.499 2026.0 46.50749969482422 39 9 10 10 10 1.6371340669911354 51.91139275890802 0.0 3 0.8041548213020154 2.74188276399807 2026.0 38.40799056603773 0.0 - - - - - - - 135.0 4 15 MAP2K3 mitogen-activated protein kinase kinase 3 1793 229 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24178.[MT7]-TFITIGDRNFEVEADDLVTISELGR.3y10_1.heavy 985.512 / 1102.61 1280.0 46.50749969482422 39 9 10 10 10 1.6371340669911354 51.91139275890802 0.0 3 0.8041548213020154 2.74188276399807 1280.0 25.82855986645759 0.0 - - - - - - - 145.36363636363637 2 11 MAP2K3 mitogen-activated protein kinase kinase 3 1795 229 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24178.[MT7]-TFITIGDRNFEVEADDLVTISELGR.3y9_1.heavy 985.512 / 987.583 906.0 46.50749969482422 39 9 10 10 10 1.6371340669911354 51.91139275890802 0.0 3 0.8041548213020154 2.74188276399807 906.0 7.948867924528301 0.0 - - - - - - - 0.0 1 0 MAP2K3 mitogen-activated protein kinase kinase 3 1797 230 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24177.[MT7]-TFITIGDRNFEVEADDLVTISELGR.4y5_1.heavy 739.386 / 561.299 9429.0 46.524200439453125 46 20 10 6 10 11.287611708994149 8.859270019034975 0.0334014892578125 3 0.9953716448907132 18.133489507527354 9429.0 64.53940228873239 0.0 - - - - - - - 215.66666666666666 18 21 MAP2K3 mitogen-activated protein kinase kinase 3 1799 230 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24177.[MT7]-TFITIGDRNFEVEADDLVTISELGR.4b5_1.heavy 739.386 / 720.441 2770.0 46.524200439453125 46 20 10 6 10 11.287611708994149 8.859270019034975 0.0334014892578125 3 0.9953716448907132 18.133489507527354 2770.0 10.3875 0.0 - - - - - - - 205.42857142857142 5 21 MAP2K3 mitogen-activated protein kinase kinase 3 1801 230 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24177.[MT7]-TFITIGDRNFEVEADDLVTISELGR.4y7_1.heavy 739.386 / 775.431 10494.0 46.524200439453125 46 20 10 6 10 11.287611708994149 8.859270019034975 0.0334014892578125 3 0.9953716448907132 18.133489507527354 10494.0 200.27347091932458 0.0 - - - - - - - 187.89473684210526 20 19 MAP2K3 mitogen-activated protein kinase kinase 3 1803 230 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24177.[MT7]-TFITIGDRNFEVEADDLVTISELGR.4y6_1.heavy 739.386 / 674.383 4741.0 46.524200439453125 46 20 10 6 10 11.287611708994149 8.859270019034975 0.0334014892578125 3 0.9953716448907132 18.133489507527354 4741.0 20.47087704463177 0.0 - - - - - - - 178.2608695652174 9 23 MAP2K3 mitogen-activated protein kinase kinase 3 1805 231 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43225.[MT7]-VSPEPPPAPR.2y8_1.heavy 595.836 / 860.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNG6 calcium channel, voltage-dependent, gamma subunit 6 1807 231 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43225.[MT7]-VSPEPPPAPR.2y9_1.heavy 595.836 / 947.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNG6 calcium channel, voltage-dependent, gamma subunit 6 1809 231 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43225.[MT7]-VSPEPPPAPR.2b4_1.heavy 595.836 / 557.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNG6 calcium channel, voltage-dependent, gamma subunit 6 1811 231 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43225.[MT7]-VSPEPPPAPR.2y6_1.heavy 595.836 / 634.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNG6 calcium channel, voltage-dependent, gamma subunit 6 1813 232 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37069.[MT7]-SFLNK[MT7].2b3_1.heavy 448.776 / 492.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - OSBPL5;PRKCI oxysterol binding protein-like 5;protein kinase C, iota 1815 232 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37069.[MT7]-SFLNK[MT7].2y4_1.heavy 448.776 / 665.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - OSBPL5;PRKCI oxysterol binding protein-like 5;protein kinase C, iota 1817 232 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37069.[MT7]-SFLNK[MT7].2y3_1.heavy 448.776 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - OSBPL5;PRKCI oxysterol binding protein-like 5;protein kinase C, iota 1819 233 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43591.[MT7]-SALTVQFVQGIFVEK[MT7].2y4_1.heavy 977.566 / 666.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1821 233 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43591.[MT7]-SALTVQFVQGIFVEK[MT7].2y9_1.heavy 977.566 / 1210.7 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1823 233 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43591.[MT7]-SALTVQFVQGIFVEK[MT7].2b6_1.heavy 977.566 / 744.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1825 233 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43591.[MT7]-SALTVQFVQGIFVEK[MT7].2y6_1.heavy 977.566 / 836.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1827 234 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42453.[MT7]-DRNVATTR.2b3_1.heavy 538.8 / 530.28 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1829 234 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42453.[MT7]-DRNVATTR.2b4_1.heavy 538.8 / 629.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1831 234 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42453.[MT7]-DRNVATTR.2y6_1.heavy 538.8 / 661.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1833 234 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42453.[MT7]-DRNVATTR.2b5_1.heavy 538.8 / 700.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1835 235 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544258.[MT7]-QLGGSTLLWEAESSWR.3y7_1.heavy 655.338 / 864.385 8697.0 43.500999450683594 48 18 10 10 10 8.802226561365693 11.360761882557666 0.0 3 0.9899317881313425 12.28913008942771 8697.0 59.9051171875 0.0 - - - - - - - 146.8235294117647 17 17 NODAL nodal homolog (mouse) 1837 235 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544258.[MT7]-QLGGSTLLWEAESSWR.3y6_1.heavy 655.338 / 735.342 10104.0 43.500999450683594 48 18 10 10 10 8.802226561365693 11.360761882557666 0.0 3 0.9899317881313425 12.28913008942771 10104.0 24.840983939540834 0.0 - - - - - - - 682.2222222222222 20 9 NODAL nodal homolog (mouse) 1839 235 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544258.[MT7]-QLGGSTLLWEAESSWR.3y8_1.heavy 655.338 / 1050.46 5627.0 43.500999450683594 48 18 10 10 10 8.802226561365693 11.360761882557666 0.0 3 0.9899317881313425 12.28913008942771 5627.0 26.59148263888889 0.0 - - - - - - - 134.4 11 10 NODAL nodal homolog (mouse) 1841 235 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544258.[MT7]-QLGGSTLLWEAESSWR.3b7_1.heavy 655.338 / 801.459 8058.0 43.500999450683594 48 18 10 10 10 8.802226561365693 11.360761882557666 0.0 3 0.9899317881313425 12.28913008942771 8058.0 74.10482142857143 0.0 - - - - - - - 220.44444444444446 16 18 NODAL nodal homolog (mouse) 1843 236 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 128836.0 42.68239974975586 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 128836.0 419.6279144307469 0.0 - - - - - - - 320.125 257 8 1845 236 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 247953.0 42.68239974975586 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 247953.0 511.930970067566 0.0 - - - - - - - 275.8 495 5 1847 236 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 182288.0 42.68239974975586 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 182288.0 534.492876627676 0.0 - - - - - - - 648.5 364 8 1849 237 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544252.[MT7]-SALTVQFVQGIFVEK[MT7].3y3_1.heavy 652.047 / 519.326 20528.0 44.11192512512207 43 17 10 6 10 5.0046074819749355 19.981587039576908 0.03150177001953125 3 0.9733494301906384 7.542926163293664 20528.0 83.03653831995877 0.0 - - - - - - - 228.0 41 18 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1851 237 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544252.[MT7]-SALTVQFVQGIFVEK[MT7].3b6_1.heavy 652.047 / 744.437 38453.0 44.11192512512207 43 17 10 6 10 5.0046074819749355 19.981587039576908 0.03150177001953125 3 0.9733494301906384 7.542926163293664 38453.0 227.427112943155 0.0 - - - - - - - 208.77777777777777 76 18 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1853 237 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544252.[MT7]-SALTVQFVQGIFVEK[MT7].3b4_1.heavy 652.047 / 517.31 13184.0 44.11192512512207 43 17 10 6 10 5.0046074819749355 19.981587039576908 0.03150177001953125 3 0.9733494301906384 7.542926163293664 13184.0 88.03313896478161 0.0 - - - - - - - 197.0909090909091 26 22 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1855 237 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544252.[MT7]-SALTVQFVQGIFVEK[MT7].3y4_1.heavy 652.047 / 666.394 33596.0 44.11192512512207 43 17 10 6 10 5.0046074819749355 19.981587039576908 0.03150177001953125 3 0.9733494301906384 7.542926163293664 33596.0 173.36322917221185 0.0 - - - - - - - 240.94444444444446 67 18 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1857 238 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24175.[MT7]-YQHGIAVIGNFLYVVGGQSNYDTK[MT7].4b11_2.heavy 733.637 / 672.863 7041.0 44.503950119018555 38 11 10 7 10 1.9864840296441661 50.34019831405981 0.02899932861328125 3 0.8674863592397712 3.3520870527872444 7041.0 14.72609927205312 0.0 - - - - - - - 262.63157894736844 14 19 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1859 238 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24175.[MT7]-YQHGIAVIGNFLYVVGGQSNYDTK[MT7].4b5_1.heavy 733.637 / 743.396 610.0 44.503950119018555 38 11 10 7 10 1.9864840296441661 50.34019831405981 0.02899932861328125 3 0.8674863592397712 3.3520870527872444 610.0 1.7032068169252284 5.0 - - - - - - - 0.0 1 0 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1861 238 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24175.[MT7]-YQHGIAVIGNFLYVVGGQSNYDTK[MT7].4b6_1.heavy 733.637 / 814.433 1109.0 44.503950119018555 38 11 10 7 10 1.9864840296441661 50.34019831405981 0.02899932861328125 3 0.8674863592397712 3.3520870527872444 1109.0 6.405776173285199 0.0 - - - - - - - 181.3181818181818 2 22 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1863 238 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24175.[MT7]-YQHGIAVIGNFLYVVGGQSNYDTK[MT7].4b10_2.heavy 733.637 / 599.328 4879.0 44.503950119018555 38 11 10 7 10 1.9864840296441661 50.34019831405981 0.02899932861328125 3 0.8674863592397712 3.3520870527872444 4879.0 7.629257273029283 0.0 - - - - - - - 294.6842105263158 9 19 KLHL9;KLHL13 kelch-like 9 (Drosophila);kelch-like 13 (Drosophila) 1865 239 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544015.[MT7]-SAWGSATREEGFDR.3y6_1.heavy 571.608 / 752.321 6200.0 26.935449600219727 37 11 10 6 10 0.9622448710982366 68.04326070213955 0.0363006591796875 3 0.8542702714690564 3.1927675679443506 6200.0 32.23394584435614 0.0 - - - - - - - 204.05882352941177 12 17 DDIT4 DNA-damage-inducible transcript 4 1867 239 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544015.[MT7]-SAWGSATREEGFDR.3y5_1.heavy 571.608 / 623.278 5979.0 26.935449600219727 37 11 10 6 10 0.9622448710982366 68.04326070213955 0.0363006591796875 3 0.8542702714690564 3.1927675679443506 5979.0 15.38760300244086 0.0 - - - - - - - 281.8181818181818 11 11 DDIT4 DNA-damage-inducible transcript 4 1869 239 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544015.[MT7]-SAWGSATREEGFDR.3b13_2.heavy 571.608 / 769.853 18601.0 26.935449600219727 37 11 10 6 10 0.9622448710982366 68.04326070213955 0.0363006591796875 3 0.8542702714690564 3.1927675679443506 18601.0 97.06082503730343 0.0 - - - - - - - 247.85714285714286 37 14 DDIT4 DNA-damage-inducible transcript 4 1871 239 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544015.[MT7]-SAWGSATREEGFDR.3y13_2.heavy 571.608 / 741.342 24728.0 26.935449600219727 37 11 10 6 10 0.9622448710982366 68.04326070213955 0.0363006591796875 3 0.8542702714690564 3.1927675679443506 24728.0 76.78524708753064 0.0 - - - - - - - 692.125 49 8 DDIT4 DNA-damage-inducible transcript 4 1873 240 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43627.[MT7]-LTDGVC[CAM]SEPLPFTYLPR.2b3_1.heavy 1055.04 / 474.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - RELB v-rel reticuloendotheliosis viral oncogene homolog B 1875 240 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43627.[MT7]-LTDGVC[CAM]SEPLPFTYLPR.2b4_1.heavy 1055.04 / 531.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - RELB v-rel reticuloendotheliosis viral oncogene homolog B 1877 240 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43627.[MT7]-LTDGVC[CAM]SEPLPFTYLPR.2b5_1.heavy 1055.04 / 630.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - RELB v-rel reticuloendotheliosis viral oncogene homolog B 1879 240 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43627.[MT7]-LTDGVC[CAM]SEPLPFTYLPR.2y7_1.heavy 1055.04 / 893.488 N/A N/A - - - - - - - - - 0.0 - - - - - - - RELB v-rel reticuloendotheliosis viral oncogene homolog B 1881 241 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542512.[MT7]-IVALFPK[MT7].2y5_1.heavy 538.359 / 719.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1883 241 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542512.[MT7]-IVALFPK[MT7].2b4_1.heavy 538.359 / 541.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1885 241 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542512.[MT7]-IVALFPK[MT7].2y3_1.heavy 538.359 / 535.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1887 241 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542512.[MT7]-IVALFPK[MT7].2y6_1.heavy 538.359 / 818.526 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1889 242 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42857.[MT7]-GIDIIRGPILSFASTR.2b3_1.heavy 930.545 / 430.242 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1891 242 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42857.[MT7]-GIDIIRGPILSFASTR.2y5_1.heavy 930.545 / 581.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1893 242 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42857.[MT7]-GIDIIRGPILSFASTR.2b4_1.heavy 930.545 / 543.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1895 242 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42857.[MT7]-GIDIIRGPILSFASTR.2y7_1.heavy 930.545 / 781.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 1897 243 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543075.[MT7]-VFQSWWDR.2b3_1.heavy 634.321 / 519.305 3417.0 40.21962642669678 42 16 10 6 10 3.50651528372503 28.518341404109986 0.039699554443359375 3 0.9648386783245007 6.562192406515405 3417.0 12.746777241182386 0.0 - - - - - - - 305.3333333333333 6 15 BAD BCL2-associated agonist of cell death 1899 243 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543075.[MT7]-VFQSWWDR.2y5_1.heavy 634.321 / 749.336 5359.0 40.21962642669678 42 16 10 6 10 3.50651528372503 28.518341404109986 0.039699554443359375 3 0.9648386783245007 6.562192406515405 5359.0 21.98632368703108 0.0 - - - - - - - 181.33333333333334 10 15 BAD BCL2-associated agonist of cell death 1901 243 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543075.[MT7]-VFQSWWDR.2y6_1.heavy 634.321 / 877.395 4971.0 40.21962642669678 42 16 10 6 10 3.50651528372503 28.518341404109986 0.039699554443359375 3 0.9648386783245007 6.562192406515405 4971.0 38.870563477779314 0.0 - - - - - - - 199.71428571428572 9 14 BAD BCL2-associated agonist of cell death 1903 243 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543075.[MT7]-VFQSWWDR.2y7_1.heavy 634.321 / 1024.46 10407.0 40.21962642669678 42 16 10 6 10 3.50651528372503 28.518341404109986 0.039699554443359375 3 0.9648386783245007 6.562192406515405 10407.0 35.46616795001262 0.0 - - - - - - - 207.25 20 12 BAD BCL2-associated agonist of cell death 1905 244 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542614.[MT7]-LLVYLWR.2y4_1.heavy 553.846 / 637.346 4553.0 46.57502555847168 31 10 10 3 8 0.7256135696532446 80.18614662524601 0.0699005126953125 4 0.8352236780516374 2.997524308797533 4553.0 27.918395604395606 0.0 - - - - - - - 180.72222222222223 9 18 DET1 de-etiolated homolog 1 (Arabidopsis) 1907 244 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542614.[MT7]-LLVYLWR.2y5_1.heavy 553.846 / 736.414 4174.0 46.57502555847168 31 10 10 3 8 0.7256135696532446 80.18614662524601 0.0699005126953125 4 0.8352236780516374 2.997524308797533 4174.0 27.22339408825067 0.0 - - - - - - - 145.42105263157896 8 19 DET1 de-etiolated homolog 1 (Arabidopsis) 1909 244 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542614.[MT7]-LLVYLWR.2b4_1.heavy 553.846 / 633.409 1193.0 46.57502555847168 31 10 10 3 8 0.7256135696532446 80.18614662524601 0.0699005126953125 4 0.8352236780516374 2.997524308797533 1193.0 22.452871794871793 1.0 - - - - - - - 151.05263157894737 2 19 DET1 de-etiolated homolog 1 (Arabidopsis) 1911 244 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542614.[MT7]-LLVYLWR.2y6_1.heavy 553.846 / 849.498 4174.0 46.57502555847168 31 10 10 3 8 0.7256135696532446 80.18614662524601 0.0699005126953125 4 0.8352236780516374 2.997524308797533 4174.0 54.1074074074074 1.0 - - - - - - - 130.0 8 10 DET1 de-etiolated homolog 1 (Arabidopsis) 1913 245 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543283.[MT7]-SGPASGPSVPTGR.3y6_1.heavy 438.569 / 616.341 20387.0 20.50079917907715 50 20 10 10 10 6.36141737741041 15.71976716307015 0.0 3 0.9913665500306243 13.272637425418718 20387.0 66.94767074480151 0.0 - - - - - - - 668.3 40 10 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1915 245 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543283.[MT7]-SGPASGPSVPTGR.3b6_1.heavy 438.569 / 601.306 36591.0 20.50079917907715 50 20 10 10 10 6.36141737741041 15.71976716307015 0.0 3 0.9913665500306243 13.272637425418718 36591.0 75.7860402217164 0.0 - - - - - - - 679.0 73 8 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1917 245 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543283.[MT7]-SGPASGPSVPTGR.3b4_1.heavy 438.569 / 457.253 21108.0 20.50079917907715 50 20 10 10 10 6.36141737741041 15.71976716307015 0.0 3 0.9913665500306243 13.272637425418718 21108.0 53.35546063305186 0.0 - - - - - - - 690.4545454545455 42 11 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1919 245 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543283.[MT7]-SGPASGPSVPTGR.3b5_1.heavy 438.569 / 544.285 15098.0 20.50079917907715 50 20 10 10 10 6.36141737741041 15.71976716307015 0.0 3 0.9913665500306243 13.272637425418718 15098.0 42.09029505773672 0.0 - - - - - - - 741.5714285714286 30 7 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1921 246 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541559.[MT7]-DSGLLK[MT7].2y4_1.heavy 460.786 / 574.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - DET1 de-etiolated homolog 1 (Arabidopsis) 1923 246 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541559.[MT7]-DSGLLK[MT7].2y5_1.heavy 460.786 / 661.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - DET1 de-etiolated homolog 1 (Arabidopsis) 1925 246 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB541559.[MT7]-DSGLLK[MT7].2b5_1.heavy 460.786 / 630.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - DET1 de-etiolated homolog 1 (Arabidopsis) 1927 247 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542617.[MT7]-QIAIVFK[MT7].2y4_1.heavy 553.862 / 650.436 3969.0 35.19915008544922 42 16 10 6 10 2.2687992096200555 35.385841101331025 0.03389739990234375 3 0.9687021088308454 6.957697888028191 3969.0 11.587745582296154 1.0 - - - - - - - 298.5 7 12 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1929 247 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542617.[MT7]-QIAIVFK[MT7].2y5_1.heavy 553.862 / 721.473 6099.0 35.19915008544922 42 16 10 6 10 2.2687992096200555 35.385841101331025 0.03389739990234375 3 0.9687021088308454 6.957697888028191 6099.0 21.005686533509454 1.0 - - - - - - - 332.8125 12 16 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1931 247 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542617.[MT7]-QIAIVFK[MT7].2y3_1.heavy 553.862 / 537.352 7357.0 35.19915008544922 42 16 10 6 10 2.2687992096200555 35.385841101331025 0.03389739990234375 3 0.9687021088308454 6.957697888028191 7357.0 1.8998063266623628 1.0 - - - - - - - 373.42857142857144 14 7 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1933 247 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542617.[MT7]-QIAIVFK[MT7].2y6_1.heavy 553.862 / 834.557 7551.0 35.19915008544922 42 16 10 6 10 2.2687992096200555 35.385841101331025 0.03389739990234375 3 0.9687021088308454 6.957697888028191 7551.0 49.32260624234789 0.0 - - - - - - - 241.88888888888889 15 18 RELB v-rel reticuloendotheliosis viral oncogene homolog B 1935 248 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543492.[MT7]-DAIAILDGIPSR.2y5_1.heavy 692.899 / 529.309 6602.0 39.48930072784424 41 15 10 6 10 2.8947681654496717 34.54508074033143 0.039600372314453125 3 0.9594410143306696 6.107168603703813 6602.0 27.63807928852706 0.0 - - - - - - - 286.84615384615387 13 13 ANAPC7 anaphase promoting complex subunit 7 1937 248 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543492.[MT7]-DAIAILDGIPSR.2y9_1.heavy 692.899 / 941.542 4815.0 39.48930072784424 41 15 10 6 10 2.8947681654496717 34.54508074033143 0.039600372314453125 3 0.9594410143306696 6.107168603703813 4815.0 14.55337620578778 1.0 - - - - - - - 171.0 9 10 ANAPC7 anaphase promoting complex subunit 7 1939 248 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543492.[MT7]-DAIAILDGIPSR.2b4_1.heavy 692.899 / 515.295 6602.0 39.48930072784424 41 15 10 6 10 2.8947681654496717 34.54508074033143 0.039600372314453125 3 0.9594410143306696 6.107168603703813 6602.0 34.56476532940053 0.0 - - - - - - - 271.8 13 10 ANAPC7 anaphase promoting complex subunit 7 1941 248 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543492.[MT7]-DAIAILDGIPSR.2y7_1.heavy 692.899 / 757.42 2485.0 39.48930072784424 41 15 10 6 10 2.8947681654496717 34.54508074033143 0.039600372314453125 3 0.9594410143306696 6.107168603703813 2485.0 7.5109324758842435 1.0 - - - - - - - 215.77777777777777 4 9 ANAPC7 anaphase promoting complex subunit 7 1943 249 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544261.[MT7]-VFNAGDDPSVPLHVLSR.3y7_1.heavy 656.354 / 821.499 34699.0 35.15670108795166 43 17 10 6 10 5.891264300574974 16.9742851275982 0.034000396728515625 3 0.9795447668356816 8.614241857828421 34699.0 149.62233571296935 0.0 - - - - - - - 699.3333333333334 69 9 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1945 249 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544261.[MT7]-VFNAGDDPSVPLHVLSR.3b3_1.heavy 656.354 / 505.289 4108.0 35.15670108795166 43 17 10 6 10 5.891264300574974 16.9742851275982 0.034000396728515625 3 0.9795447668356816 8.614241857828421 4108.0 1.709885535900104 1.0 - - - - - - - 699.1111111111111 8 9 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1947 249 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544261.[MT7]-VFNAGDDPSVPLHVLSR.3y5_1.heavy 656.354 / 611.362 5069.0 35.15670108795166 43 17 10 6 10 5.891264300574974 16.9742851275982 0.034000396728515625 3 0.9795447668356816 8.614241857828421 5069.0 13.014185375044704 0.0 - - - - - - - 646.8 10 10 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1949 249 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544261.[MT7]-VFNAGDDPSVPLHVLSR.3b7_1.heavy 656.354 / 863.402 14509.0 35.15670108795166 43 17 10 6 10 5.891264300574974 16.9742851275982 0.034000396728515625 3 0.9795447668356816 8.614241857828421 14509.0 98.42703075245366 0.0 - - - - - - - 273.1875 29 16 PPP1R3D protein phosphatase 1, regulatory (inhibitor) subunit 3D 1951 250 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37680.[MT7]-DFNVGDYIQAVLDRNLAENISR.4b4_1.heavy 667.347 / 620.316 1634.0 48.5015983581543 41 11 10 10 10 0.7426766492689852 83.46750319219558 0.0 3 0.8764189708138567 3.4738334252115175 1634.0 36.52470588235294 0.0 - - - - - - - 136.0 3 12 PYGL phosphorylase, glycogen, liver 1953 250 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37680.[MT7]-DFNVGDYIQAVLDRNLAENISR.4y13_2.heavy 667.347 / 735.905 3523.0 48.5015983581543 41 11 10 10 10 0.7426766492689852 83.46750319219558 0.0 3 0.8764189708138567 3.4738334252115175 3523.0 32.236601307189545 0.0 - - - - - - - 111.27272727272727 7 11 PYGL phosphorylase, glycogen, liver 1955 250 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37680.[MT7]-DFNVGDYIQAVLDRNLAENISR.4b6_1.heavy 667.347 / 792.364 5004.0 48.5015983581543 41 11 10 10 10 0.7426766492689852 83.46750319219558 0.0 3 0.8764189708138567 3.4738334252115175 5004.0 108.32188235294119 0.0 - - - - - - - 105.4 10 15 PYGL phosphorylase, glycogen, liver 1957 250 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37680.[MT7]-DFNVGDYIQAVLDRNLAENISR.4b3_1.heavy 667.347 / 521.248 2655.0 48.5015983581543 41 11 10 10 10 0.7426766492689852 83.46750319219558 0.0 3 0.8764189708138567 3.4738334252115175 2655.0 30.19411764705882 0.0 - - - - - - - 102.0 5 15 PYGL phosphorylase, glycogen, liver 1959 251 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37478.[MT7]-LHSFLGDDVFLR.3y7_1.heavy 521.62 / 821.415 34207.0 40.04180145263672 48 18 10 10 10 12.858099307217257 7.777199227561569 0.0 3 0.9819683617564412 9.176773697609773 34207.0 189.2476395078151 0.0 - - - - - - - 225.0 68 10 PYGL phosphorylase, glycogen, liver 1961 251 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37478.[MT7]-LHSFLGDDVFLR.3y6_1.heavy 521.62 / 764.394 8998.0 40.04180145263672 48 18 10 10 10 12.858099307217257 7.777199227561569 0.0 3 0.9819683617564412 9.176773697609773 8998.0 50.330026636315495 0.0 - - - - - - - 211.27777777777777 17 18 PYGL phosphorylase, glycogen, liver 1963 251 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37478.[MT7]-LHSFLGDDVFLR.3y4_1.heavy 521.62 / 534.34 13884.0 40.04180145263672 48 18 10 10 10 12.858099307217257 7.777199227561569 0.0 3 0.9819683617564412 9.176773697609773 13884.0 74.85663554709969 0.0 - - - - - - - 200.58333333333334 27 12 PYGL phosphorylase, glycogen, liver 1965 251 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37478.[MT7]-LHSFLGDDVFLR.3y8_1.heavy 521.62 / 934.499 7524.0 40.04180145263672 48 18 10 10 10 12.858099307217257 7.777199227561569 0.0 3 0.9819683617564412 9.176773697609773 7524.0 99.98394044665014 0.0 - - - - - - - 146.66666666666666 15 9 PYGL phosphorylase, glycogen, liver 1967 252 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43349.[MT7]-DFSELEPDK[MT7].2b3_1.heavy 684.35 / 494.237 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1969 252 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43349.[MT7]-DFSELEPDK[MT7].2b4_1.heavy 684.35 / 623.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1971 252 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43349.[MT7]-DFSELEPDK[MT7].2y3_1.heavy 684.35 / 503.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1973 252 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43349.[MT7]-DFSELEPDK[MT7].2y7_1.heavy 684.35 / 961.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - PYGL phosphorylase, glycogen, liver 1975 253 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543395.[MT7]-SAPPNLWAAQR.3y6_1.heavy 452.25 / 744.415 7895.0 30.861400604248047 50 20 10 10 10 11.227568716764155 8.906647781250056 0.0 3 0.996398418360566 20.55821038672423 7895.0 51.71075080338884 0.0 - - - - - - - 180.77777777777777 15 9 BAD BCL2-associated agonist of cell death 1977 253 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543395.[MT7]-SAPPNLWAAQR.3b6_1.heavy 452.25 / 724.411 24824.0 30.861400604248047 50 20 10 10 10 11.227568716764155 8.906647781250056 0.0 3 0.996398418360566 20.55821038672423 24824.0 148.3718078878177 0.0 - - - - - - - 151.14285714285714 49 7 BAD BCL2-associated agonist of cell death 1979 253 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543395.[MT7]-SAPPNLWAAQR.3b5_1.heavy 452.25 / 611.327 62101.0 30.861400604248047 50 20 10 10 10 11.227568716764155 8.906647781250056 0.0 3 0.996398418360566 20.55821038672423 62101.0 107.73737921976844 0.0 - - - - - - - 325.6 124 5 BAD BCL2-associated agonist of cell death 1981 253 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543395.[MT7]-SAPPNLWAAQR.3y5_1.heavy 452.25 / 631.331 61531.0 30.861400604248047 50 20 10 10 10 11.227568716764155 8.906647781250056 0.0 3 0.996398418360566 20.55821038672423 61531.0 38.03783305544917 0.0 - - - - - - - 326.0 123 2 BAD BCL2-associated agonist of cell death 1983 254 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43204.[MT7]-RQEQIAK[MT7].2b3_1.heavy 580.853 / 558.312 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6 ribosomal protein S6 1985 254 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43204.[MT7]-RQEQIAK[MT7].2b4_1.heavy 580.853 / 686.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6 ribosomal protein S6 1987 254 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43204.[MT7]-RQEQIAK[MT7].2b6_1.heavy 580.853 / 870.491 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6 ribosomal protein S6 1989 254 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB43204.[MT7]-RQEQIAK[MT7].2y6_1.heavy 580.853 / 860.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6 ribosomal protein S6 1991 255 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543995.[MT7]-VFQSWWDRNLGR.3b4_1.heavy 569.966 / 606.337 11011.0 38.98849868774414 47 17 10 10 10 4.542244798914992 22.015546151076457 0.0 3 0.9788673054648735 8.474559510153284 11011.0 34.33658505154639 0.0 - - - - - - - 603.2857142857143 22 7 BAD BCL2-associated agonist of cell death 1993 255 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543995.[MT7]-VFQSWWDRNLGR.3y11_2.heavy 569.966 / 732.86 59053.0 38.98849868774414 47 17 10 10 10 4.542244798914992 22.015546151076457 0.0 3 0.9788673054648735 8.474559510153284 59053.0 216.2221966327304 0.0 - - - - - - - 301.8181818181818 118 11 BAD BCL2-associated agonist of cell death 1995 255 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543995.[MT7]-VFQSWWDRNLGR.3b3_1.heavy 569.966 / 519.305 7391.0 38.98849868774414 47 17 10 10 10 4.542244798914992 22.015546151076457 0.0 3 0.9788673054648735 8.474559510153284 7391.0 16.950463785490218 0.0 - - - - - - - 713.5384615384615 14 13 BAD BCL2-associated agonist of cell death 1997 255 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB543995.[MT7]-VFQSWWDRNLGR.3y5_1.heavy 569.966 / 615.369 5732.0 38.98849868774414 47 17 10 10 10 4.542244798914992 22.015546151076457 0.0 3 0.9788673054648735 8.474559510153284 5732.0 14.855409342039174 0.0 - - - - - - - 667.8571428571429 11 7 BAD BCL2-associated agonist of cell death 1999 256 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544462.[MT7]-VARPPAAPELGALGSPDLSSLSLAVSR.4b11_2.heavy 694.643 / 602.352 23594.0 40.53010177612305 43 13 10 10 10 1.9682184221694379 40.536384672566975 0.0 3 0.9254890327330564 4.4928096076404875 23594.0 47.933019411086306 0.0 - - - - - - - 183.8 47 10 RELB v-rel reticuloendotheliosis viral oncogene homolog B 2001 256 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544462.[MT7]-VARPPAAPELGALGSPDLSSLSLAVSR.4y9_1.heavy 694.643 / 919.521 9652.0 40.53010177612305 43 13 10 10 10 1.9682184221694379 40.536384672566975 0.0 3 0.9254890327330564 4.4928096076404875 9652.0 45.31525021949078 0.0 - - - - - - - 235.84615384615384 19 13 RELB v-rel reticuloendotheliosis viral oncogene homolog B 2003 256 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544462.[MT7]-VARPPAAPELGALGSPDLSSLSLAVSR.4b12_2.heavy 694.643 / 637.87 33246.0 40.53010177612305 43 13 10 10 10 1.9682184221694379 40.536384672566975 0.0 3 0.9254890327330564 4.4928096076404875 33246.0 105.75317070492295 0.0 - - - - - - - 229.9 66 10 RELB v-rel reticuloendotheliosis viral oncogene homolog B 2005 256 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544462.[MT7]-VARPPAAPELGALGSPDLSSLSLAVSR.4y6_1.heavy 694.643 / 632.373 20990.0 40.53010177612305 43 13 10 10 10 1.9682184221694379 40.536384672566975 0.0 3 0.9254890327330564 4.4928096076404875 20990.0 58.302749454425005 0.0 - - - - - - - 236.8181818181818 41 11 RELB v-rel reticuloendotheliosis viral oncogene homolog B 2007 257 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544279.[MT7]-IRDGWQVEEADDWLR.3y7_1.heavy 678.005 / 904.416 6090.0 38.06439971923828 50 20 10 10 10 12.72465803320068 7.858757362208392 0.0 3 0.9909020761023271 12.928894882673426 6090.0 96.01628446628446 0.0 - - - - - - - 206.92857142857142 12 14 PYGL phosphorylase, glycogen, liver 2009 257 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544279.[MT7]-IRDGWQVEEADDWLR.3b6_1.heavy 678.005 / 900.481 4233.0 38.06439971923828 50 20 10 10 10 12.72465803320068 7.858757362208392 0.0 3 0.9909020761023271 12.928894882673426 4233.0 26.173400387127117 0.0 - - - - - - - 155.95 8 20 PYGL phosphorylase, glycogen, liver 2011 257 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544279.[MT7]-IRDGWQVEEADDWLR.3y4_1.heavy 678.005 / 589.309 5198.0 38.06439971923828 50 20 10 10 10 12.72465803320068 7.858757362208392 0.0 3 0.9909020761023271 12.928894882673426 5198.0 34.567676984999935 0.0 - - - - - - - 254.05263157894737 10 19 PYGL phosphorylase, glycogen, liver 2013 257 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544279.[MT7]-IRDGWQVEEADDWLR.3y8_1.heavy 678.005 / 1033.46 6090.0 38.06439971923828 50 20 10 10 10 12.72465803320068 7.858757362208392 0.0 3 0.9909020761023271 12.928894882673426 6090.0 63.40916724350678 0.0 - - - - - - - 158.53333333333333 12 15 PYGL phosphorylase, glycogen, liver 2015 258 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542206.[MT7]-LFNLSK[MT7].2b3_1.heavy 505.318 / 519.305 2386.0 34.038466135660805 39 18 10 5 6 4.500884824655069 22.217853576749462 0.044902801513671875 5 0.9892586396873407 11.897157654961797 2386.0 1.7592939625863075 8.0 - - - - - - - 738.5714285714286 15 7 RPS6 ribosomal protein S6 2017 258 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542206.[MT7]-LFNLSK[MT7].2y4_1.heavy 505.318 / 605.374 4176.0 34.038466135660805 39 18 10 5 6 4.500884824655069 22.217853576749462 0.044902801513671875 5 0.9892586396873407 11.897157654961797 4176.0 10.028214817102272 0.0 - - - - - - - 271.09090909090907 8 11 RPS6 ribosomal protein S6 2019 258 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542206.[MT7]-LFNLSK[MT7].2y5_1.heavy 505.318 / 752.442 8452.0 34.038466135660805 39 18 10 5 6 4.500884824655069 22.217853576749462 0.044902801513671875 5 0.9892586396873407 11.897157654961797 8452.0 10.925403579492185 0.0 - - - - - - - 306.4166666666667 16 12 RPS6 ribosomal protein S6 2021 258 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542206.[MT7]-LFNLSK[MT7].2b4_1.heavy 505.318 / 632.389 N/A 34.038466135660805 39 18 10 5 6 4.500884824655069 22.217853576749462 0.044902801513671875 5 0.9892586396873407 11.897157654961797 2287.0 0.2450859552384042 2.0 - - - - - - - 252.9090909090909 6 11 RPS6 ribosomal protein S6 2023 259 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37496.[MT7]-SDSTHLVTLGGVLR.2y8_1.heavy 799.953 / 814.515 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9 kelch-like 9 (Drosophila) 2025 259 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37496.[MT7]-SDSTHLVTLGGVLR.2y9_1.heavy 799.953 / 927.599 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9 kelch-like 9 (Drosophila) 2027 259 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37496.[MT7]-SDSTHLVTLGGVLR.2y10_1.heavy 799.953 / 1064.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9 kelch-like 9 (Drosophila) 2029 259 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37496.[MT7]-SDSTHLVTLGGVLR.2b5_1.heavy 799.953 / 672.307 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL9 kelch-like 9 (Drosophila) 2031 260 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544133.[MT7]-AIQLNSNSVQALLLK[MT7].3y3_1.heavy 634.054 / 517.383 2876.0 40.59692573547363 40 14 10 6 10 1.865526485087791 36.97243984612011 0.03749847412109375 3 0.9418210488783374 5.09156197336846 2876.0 4.258088235294118 1.0 - - - - - - - 710.7142857142857 5 7 ANAPC7 anaphase promoting complex subunit 7 2033 260 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544133.[MT7]-AIQLNSNSVQALLLK[MT7].3b4_1.heavy 634.054 / 570.373 1477.0 40.59692573547363 40 14 10 6 10 1.865526485087791 36.97243984612011 0.03749847412109375 3 0.9418210488783374 5.09156197336846 1477.0 6.465510574952636 0.0 - - - - - - - 254.66666666666666 2 18 ANAPC7 anaphase promoting complex subunit 7 2035 260 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544133.[MT7]-AIQLNSNSVQALLLK[MT7].3b5_1.heavy 634.054 / 684.416 1710.0 40.59692573547363 40 14 10 6 10 1.865526485087791 36.97243984612011 0.03749847412109375 3 0.9418210488783374 5.09156197336846 1710.0 10.250843878945116 0.0 - - - - - - - 182.7058823529412 3 17 ANAPC7 anaphase promoting complex subunit 7 2037 260 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544133.[MT7]-AIQLNSNSVQALLLK[MT7].3y5_1.heavy 634.054 / 701.504 2487.0 40.59692573547363 40 14 10 6 10 1.865526485087791 36.97243984612011 0.03749847412109375 3 0.9418210488783374 5.09156197336846 2487.0 13.662489270386265 0.0 - - - - - - - 247.625 4 16 ANAPC7 anaphase promoting complex subunit 7 2039 261 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37693.[MT7]-RVARPPAAPELGALGSPDLSSLSLAVSR.4y8_1.heavy 733.668 / 832.489 2759.0 38.57565116882324 42 16 10 6 10 2.118508842948464 37.29461500741763 0.034900665283203125 3 0.9627392134132398 6.37350806787983 2759.0 7.0343901254115915 0.0 - - - - - - - 179.06666666666666 5 15 RELB v-rel reticuloendotheliosis viral oncogene homolog B 2041 261 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37693.[MT7]-RVARPPAAPELGALGSPDLSSLSLAVSR.4b12_2.heavy 733.668 / 680.403 2759.0 38.57565116882324 42 16 10 6 10 2.118508842948464 37.29461500741763 0.034900665283203125 3 0.9627392134132398 6.37350806787983 2759.0 5.675627181708158 0.0 - - - - - - - 214.5 5 16 RELB v-rel reticuloendotheliosis viral oncogene homolog B 2043 261 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37693.[MT7]-RVARPPAAPELGALGSPDLSSLSLAVSR.4b13_2.heavy 733.668 / 715.921 7531.0 38.57565116882324 42 16 10 6 10 2.118508842948464 37.29461500741763 0.034900665283203125 3 0.9627392134132398 6.37350806787983 7531.0 15.301553686526535 0.0 - - - - - - - 671.1666666666666 15 12 RELB v-rel reticuloendotheliosis viral oncogene homolog B 2045 261 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37693.[MT7]-RVARPPAAPELGALGSPDLSSLSLAVSR.4y6_1.heavy 733.668 / 632.373 5592.0 38.57565116882324 42 16 10 6 10 2.118508842948464 37.29461500741763 0.034900665283203125 3 0.9627392134132398 6.37350806787983 5592.0 9.740667227361929 0.0 - - - - - - - 627.3333333333334 11 12 RELB v-rel reticuloendotheliosis viral oncogene homolog B 2047 262 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42530.[MT7]-GPILSFASTR.2y8_1.heavy 596.844 / 894.504 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 2049 262 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42530.[MT7]-GPILSFASTR.2y9_1.heavy 596.844 / 991.557 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 2051 262 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42530.[MT7]-GPILSFASTR.2y6_1.heavy 596.844 / 668.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 2053 262 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42530.[MT7]-GPILSFASTR.2y7_1.heavy 596.844 / 781.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFC5 replication factor C (activator 1) 5, 36.5kDa 2055 263 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37691.[MT7]-VRPSTGNSASTPQSQC[CAM]LPSEIEVK[MT7].4y4_1.heavy 715.873 / 632.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 2057 263 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37691.[MT7]-VRPSTGNSASTPQSQC[CAM]LPSEIEVK[MT7].4b8_1.heavy 715.873 / 943.508 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 2059 263 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37691.[MT7]-VRPSTGNSASTPQSQC[CAM]LPSEIEVK[MT7].4b7_1.heavy 715.873 / 856.476 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 2061 263 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37691.[MT7]-VRPSTGNSASTPQSQC[CAM]LPSEIEVK[MT7].4y7_1.heavy 715.873 / 945.537 N/A N/A - - - - - - - - - 0.0 - - - - - - - ANAPC7 anaphase promoting complex subunit 7 2063 264 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37488.[MT7]-FSQFLETEYK[MT7].3y3_1.heavy 527.28 / 583.321 15562.0 36.67682361602783 46 20 10 6 10 7.477429009074891 13.373580662368871 0.032299041748046875 3 0.9962617332853864 20.178637692753167 15562.0 20.080000000000002 0.0 - - - - - - - 721.6666666666666 31 15 PYGL phosphorylase, glycogen, liver 2065 264 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37488.[MT7]-FSQFLETEYK[MT7].3b4_1.heavy 527.28 / 654.337 50070.0 36.67682361602783 46 20 10 6 10 7.477429009074891 13.373580662368871 0.032299041748046875 3 0.9962617332853864 20.178637692753167 50070.0 90.23566160679678 0.0 - - - - - - - 601.2222222222222 100 9 PYGL phosphorylase, glycogen, liver 2067 264 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37488.[MT7]-FSQFLETEYK[MT7].3y4_1.heavy 527.28 / 684.369 23090.0 36.67682361602783 46 20 10 6 10 7.477429009074891 13.373580662368871 0.032299041748046875 3 0.9962617332853864 20.178637692753167 23090.0 37.24916956521132 0.0 - - - - - - - 704.8888888888889 46 9 PYGL phosphorylase, glycogen, liver 2069 264 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB37488.[MT7]-FSQFLETEYK[MT7].3b3_1.heavy 527.28 / 507.268 47702.0 36.67682361602783 46 20 10 6 10 7.477429009074891 13.373580662368871 0.032299041748046875 3 0.9962617332853864 20.178637692753167 47702.0 63.16640267409747 0.0 - - - - - - - 1163.125 95 8 PYGL phosphorylase, glycogen, liver 2071 265 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42971.[MT7]-GAASLSTVTLGPVAPPATPPPWGC[CAM]PLGR.4y8_1.heavy 718.638 / 942.461 N/A N/A - - - - - - - - - 0.0 - - - - - - - RELB v-rel reticuloendotheliosis viral oncogene homolog B 2073 265 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42971.[MT7]-GAASLSTVTLGPVAPPATPPPWGC[CAM]PLGR.4y10_1.heavy 718.638 / 1136.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - RELB v-rel reticuloendotheliosis viral oncogene homolog B 2075 265 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42971.[MT7]-GAASLSTVTLGPVAPPATPPPWGC[CAM]PLGR.4b12_1.heavy 718.638 / 1199.68 N/A N/A - - - - - - - - - 0.0 - - - - - - - RELB v-rel reticuloendotheliosis viral oncogene homolog B 2077 265 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB42971.[MT7]-GAASLSTVTLGPVAPPATPPPWGC[CAM]PLGR.4y6_1.heavy 718.638 / 659.329 N/A N/A - - - - - - - - - 0.0 - - - - - - - RELB v-rel reticuloendotheliosis viral oncogene homolog B 2079 266 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542933.[MT7]-INPELNQK[MT7].3y3_1.heavy 415.246 / 533.316 14908.0 24.28890037536621 50 20 10 10 10 12.261751261170037 8.155441899777848 0.0 3 0.9948477583028708 17.186111042126978 14908.0 50.75654502951781 0.0 - - - - - - - 310.0 29 13 LOC100133591;LOC100509916;LOC100510195;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 2081 266 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542933.[MT7]-INPELNQK[MT7].3b4_1.heavy 415.246 / 598.332 20078.0 24.28890037536621 50 20 10 10 10 12.261751261170037 8.155441899777848 0.0 3 0.9948477583028708 17.186111042126978 20078.0 44.103041257593645 0.0 - - - - - - - 249.35714285714286 40 14 LOC100133591;LOC100509916;LOC100510195;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 2083 266 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542933.[MT7]-INPELNQK[MT7].3b5_1.heavy 415.246 / 711.416 2955.0 24.28890037536621 50 20 10 10 10 12.261751261170037 8.155441899777848 0.0 3 0.9948477583028708 17.186111042126978 2955.0 12.305961232076474 0.0 - - - - - - - 170.0 5 15 LOC100133591;LOC100509916;LOC100510195;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 2085 266 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB542933.[MT7]-INPELNQK[MT7].3y4_1.heavy 415.246 / 646.4 4365.0 24.28890037536621 50 20 10 10 10 12.261751261170037 8.155441899777848 0.0 3 0.9948477583028708 17.186111042126978 4365.0 9.248138957816376 1.0 - - - - - - - 190.11111111111111 8 18 LOC100133591;LOC100509916;LOC100510195;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 2087 267 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544475.[MT7]-GAASLSTVTLGPVAPPATPPPWGC[CAM]PLGR.3b11_1.heavy 957.848 / 1102.62 6296.0 41.101274490356445 38 15 10 3 10 1.41649263930745 45.00762482689483 0.07770156860351562 3 0.9581693687859413 6.012976603080942 6296.0 3.944484483332234 0.0 - - - - - - - 235.125 12 8 RELB v-rel reticuloendotheliosis viral oncogene homolog B 2089 267 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544475.[MT7]-GAASLSTVTLGPVAPPATPPPWGC[CAM]PLGR.3y8_1.heavy 957.848 / 942.461 1954.0 41.101274490356445 38 15 10 3 10 1.41649263930745 45.00762482689483 0.07770156860351562 3 0.9581693687859413 6.012976603080942 1954.0 0.6354471544715448 1.0 - - - - - - - 197.27272727272728 3 11 RELB v-rel reticuloendotheliosis viral oncogene homolog B 2091 267 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544475.[MT7]-GAASLSTVTLGPVAPPATPPPWGC[CAM]PLGR.3y10_1.heavy 957.848 / 1136.57 10204.0 41.101274490356445 38 15 10 3 10 1.41649263930745 45.00762482689483 0.07770156860351562 3 0.9581693687859413 6.012976603080942 10204.0 43.437974737671254 0.0 - - - - - - - 196.42857142857142 20 7 RELB v-rel reticuloendotheliosis viral oncogene homolog B 2093 267 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB544475.[MT7]-GAASLSTVTLGPVAPPATPPPWGC[CAM]PLGR.3y9_1.heavy 957.848 / 1039.51 2388.0 41.101274490356445 38 15 10 3 10 1.41649263930745 45.00762482689483 0.07770156860351562 3 0.9581693687859413 6.012976603080942 2388.0 31.750705128205123 0.0 - - - - - - - 137.3 4 10 RELB v-rel reticuloendotheliosis viral oncogene homolog B 2095 268 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24188.[MT7]-LALLLAAVGATLAVLSVGTEFWVELNTYK[MT7].4b7_1.heavy 838.486 / 810.557 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNG6 calcium channel, voltage-dependent, gamma subunit 6 2097 268 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24188.[MT7]-LALLLAAVGATLAVLSVGTEFWVELNTYK[MT7].4b5_1.heavy 838.486 / 668.483 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNG6 calcium channel, voltage-dependent, gamma subunit 6 2099 268 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24188.[MT7]-LALLLAAVGATLAVLSVGTEFWVELNTYK[MT7].4y6_1.heavy 838.486 / 911.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNG6 calcium channel, voltage-dependent, gamma subunit 6 2101 268 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB24188.[MT7]-LALLLAAVGATLAVLSVGTEFWVELNTYK[MT7].4b6_1.heavy 838.486 / 739.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNG6 calcium channel, voltage-dependent, gamma subunit 6 2103 269 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23505.[MT7]-GYNVK[MT7].2y4_1.heavy 434.76 / 667.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100133591;LOC100509916;LOC100510195;MAP2K3 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3 2105 269 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23505.[MT7]-GYNVK[MT7].2b3_1.heavy 434.76 / 479.237 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100133591;LOC100509916;LOC100510195;MAP2K3 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3 2107 269 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23505.[MT7]-GYNVK[MT7].2b4_1.heavy 434.76 / 578.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100133591;LOC100509916;LOC100510195;MAP2K3 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3 2109 269 B20140227_KEGG1700_set04_03 B20140227_KEGG1700_set04_03 TB23505.[MT7]-GYNVK[MT7].2y3_1.heavy 434.76 / 504.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100133591;LOC100509916;LOC100510195;MAP2K3 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3