Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42773.[MT7]-DDDRYEQASDVR.2y8_1.heavy 806.87 / 967.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 3 1 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42773.[MT7]-DDDRYEQASDVR.2b4_1.heavy 806.87 / 646.291 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 5 1 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42773.[MT7]-DDDRYEQASDVR.2y10_2.heavy 806.87 / 619.792 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 7 1 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42773.[MT7]-DDDRYEQASDVR.2y11_2.heavy 806.87 / 677.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 9 2 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37155.[MT7]-LQETQDR.2y4_1.heavy 517.273 / 519.252 4080.0 16.996599197387695 46 16 10 10 10 1.1261958459601995 54.72006317387797 0.0 3 0.9673075138441171 6.806879442898312 4080.0 50.773333333333326 0.0 - - - - - - - 171.3684210526316 8 19 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 11 2 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37155.[MT7]-LQETQDR.2y5_1.heavy 517.273 / 648.295 3818.0 16.996599197387695 46 16 10 10 10 1.1261958459601995 54.72006317387797 0.0 3 0.9673075138441171 6.806879442898312 3818.0 15.975256090314915 0.0 - - - - - - - 131.89473684210526 7 19 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 13 2 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37155.[MT7]-LQETQDR.2b6_1.heavy 517.273 / 859.428 5540.0 16.996599197387695 46 16 10 10 10 1.1261958459601995 54.72006317387797 0.0 3 0.9673075138441171 6.806879442898312 5540.0 55.99251336898395 0.0 - - - - - - - 166.27777777777777 11 18 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 15 2 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37155.[MT7]-LQETQDR.2y6_1.heavy 517.273 / 776.353 13138.0 16.996599197387695 46 16 10 10 10 1.1261958459601995 54.72006317387797 0.0 3 0.9673075138441171 6.806879442898312 13138.0 135.22937933425797 0.0 - - - - - - - 143.38888888888889 26 18 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 17 3 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23608.[MT7]-ASEEVSK[MT7].2y4_1.heavy 519.289 / 606.358 2926.0 16.04450035095215 48 18 10 10 10 4.547067333096434 21.992196876465123 0.0 3 0.9887334842256775 11.61606307484575 2926.0 28.009572649572647 0.0 - - - - - - - 115.22727272727273 5 22 CAB39L calcium binding protein 39-like 19 3 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23608.[MT7]-ASEEVSK[MT7].2b4_1.heavy 519.289 / 561.264 3121.0 16.04450035095215 48 18 10 10 10 4.547067333096434 21.992196876465123 0.0 3 0.9887334842256775 11.61606307484575 3121.0 36.67841880341881 0.0 - - - - - - - 136.5 6 22 CAB39L calcium binding protein 39-like 21 3 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23608.[MT7]-ASEEVSK[MT7].2y6_1.heavy 519.289 / 822.432 5969.0 16.04450035095215 48 18 10 10 10 4.547067333096434 21.992196876465123 0.0 3 0.9887334842256775 11.61606307484575 5969.0 52.32896214896215 0.0 - - - - - - - 140.4 11 25 CAB39L calcium binding protein 39-like 23 3 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23608.[MT7]-ASEEVSK[MT7].2b5_1.heavy 519.289 / 660.332 1834.0 16.04450035095215 48 18 10 10 10 4.547067333096434 21.992196876465123 0.0 3 0.9887334842256775 11.61606307484575 1834.0 9.405128205128205 0.0 - - - - - - - 145.08 3 25 CAB39L calcium binding protein 39-like 25 4 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543972.[MT7]-ARAQAALQAQQVNR.3b6_1.heavy 556.984 / 713.417 3883.0 19.41320037841797 42 14 10 10 8 1.7299614941074832 45.806462212044224 0.0 4 0.9420172057353446 5.1002523147695475 3883.0 8.285004012531264 1.0 - - - - - - - 179.0 12 12 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 27 4 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543972.[MT7]-ARAQAALQAQQVNR.3y6_1.heavy 556.984 / 715.385 9639.0 19.41320037841797 42 14 10 10 8 1.7299614941074832 45.806462212044224 0.0 4 0.9420172057353446 5.1002523147695475 9639.0 58.85350961538461 0.0 - - - - - - - 154.53846153846155 19 13 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 29 4 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543972.[MT7]-ARAQAALQAQQVNR.3b7_1.heavy 556.984 / 826.502 6588.0 19.41320037841797 42 14 10 10 8 1.7299614941074832 45.806462212044224 0.0 4 0.9420172057353446 5.1002523147695475 6588.0 164.22260869565218 1.0 - - - - - - - 123.16666666666667 18 18 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 31 5 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23607.[MT7]-SASDVEER.2y4_1.heavy 518.755 / 532.273 2929.0 15.221149921417236 40 14 10 6 10 1.1788352504714577 52.048352088343705 0.036299705505371094 3 0.930227524012175 4.644748634930254 2929.0 10.22205782697086 0.0 - - - - - - - 125.46153846153847 5 26 SOS1 son of sevenless homolog 1 (Drosophila) 33 5 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23607.[MT7]-SASDVEER.2b4_1.heavy 518.755 / 505.237 2996.0 15.221149921417236 40 14 10 6 10 1.1788352504714577 52.048352088343705 0.036299705505371094 3 0.930227524012175 4.644748634930254 2996.0 14.874877192982456 0.0 - - - - - - - 223.25 5 24 SOS1 son of sevenless homolog 1 (Drosophila) 35 5 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23607.[MT7]-SASDVEER.2b6_1.heavy 518.755 / 733.349 3029.0 15.221149921417236 40 14 10 6 10 1.1788352504714577 52.048352088343705 0.036299705505371094 3 0.930227524012175 4.644748634930254 3029.0 18.148 0.0 - - - - - - - 109.58823529411765 6 17 SOS1 son of sevenless homolog 1 (Drosophila) 37 5 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23607.[MT7]-SASDVEER.2y7_1.heavy 518.755 / 805.369 1298.0 15.221149921417236 40 14 10 6 10 1.1788352504714577 52.048352088343705 0.036299705505371094 3 0.930227524012175 4.644748634930254 1298.0 14.0184 0.0 - - - - - - - 95.0 2 20 SOS1 son of sevenless homolog 1 (Drosophila) 39 6 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23606.[MT7]-GAFSVVRR.2b4_1.heavy 518.313 / 507.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 41 6 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23606.[MT7]-GAFSVVRR.2b6_1.heavy 518.313 / 705.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 43 6 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23606.[MT7]-GAFSVVRR.2b7_1.heavy 518.313 / 861.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 45 6 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23606.[MT7]-GAFSVVRR.2b5_1.heavy 518.313 / 606.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 47 7 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37345.[MT7]-EQLEQIQK[MT7].2b3_1.heavy 652.377 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 49 7 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37345.[MT7]-EQLEQIQK[MT7].2b4_1.heavy 652.377 / 644.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 51 7 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37345.[MT7]-EQLEQIQK[MT7].2y3_1.heavy 652.377 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 53 7 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37345.[MT7]-EQLEQIQK[MT7].2b5_1.heavy 652.377 / 772.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 55 8 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24007.[MT7]-FIWNHGITLPLK[MT7].3y3_1.heavy 576.346 / 501.352 25615.0 40.31209945678711 44 14 10 10 10 2.1099246253873294 47.3950580019618 0.0 3 0.9404301819868721 5.031174613265322 25615.0 51.74852226720648 0.0 - - - - - - - 773.8181818181819 51 11 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 57 8 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24007.[MT7]-FIWNHGITLPLK[MT7].3b4_1.heavy 576.346 / 705.384 5093.0 40.31209945678711 44 14 10 10 10 2.1099246253873294 47.3950580019618 0.0 3 0.9404301819868721 5.031174613265322 5093.0 21.801614035087717 0.0 - - - - - - - 662.2857142857143 10 7 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 59 8 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24007.[MT7]-FIWNHGITLPLK[MT7].3b3_1.heavy 576.346 / 591.341 2356.0 40.31209945678711 44 14 10 10 10 2.1099246253873294 47.3950580019618 0.0 3 0.9404301819868721 5.031174613265322 2356.0 5.020277777777777 1.0 - - - - - - - 727.4285714285714 4 7 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 61 8 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24007.[MT7]-FIWNHGITLPLK[MT7].3y5_1.heavy 576.346 / 715.483 4789.0 40.31209945678711 44 14 10 10 10 2.1099246253873294 47.3950580019618 0.0 3 0.9404301819868721 5.031174613265322 4789.0 14.703070175438597 0.0 - - - - - - - 248.72727272727272 9 22 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 63 9 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37205.[MT7]-IYSSHAK[MT7].2b3_1.heavy 547.316 / 508.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 65 9 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37205.[MT7]-IYSSHAK[MT7].2y4_1.heavy 547.316 / 586.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 67 9 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37205.[MT7]-IYSSHAK[MT7].2y5_1.heavy 547.316 / 673.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 69 9 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37205.[MT7]-IYSSHAK[MT7].2y6_1.heavy 547.316 / 836.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 71 10 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23600.[MT7]-IPGTPGAGGR.2y8_1.heavy 513.794 / 672.342 6556.0 22.623250007629395 44 18 10 6 10 6.536330431636383 15.29910414504011 0.03709983825683594 3 0.9877567802331847 11.142187239927038 6556.0 52.940171657639766 0.0 - - - - - - - 205.45454545454547 13 11 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 73 10 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23600.[MT7]-IPGTPGAGGR.2y3_2.heavy 513.794 / 145.085 111899.0 22.623250007629395 44 18 10 6 10 6.536330431636383 15.29910414504011 0.03709983825683594 3 0.9877567802331847 11.142187239927038 111899.0 77.33772189323392 0.0 - - - - - - - 1331.3333333333333 223 3 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 75 10 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23600.[MT7]-IPGTPGAGGR.2y9_1.heavy 513.794 / 769.395 192451.0 22.623250007629395 44 18 10 6 10 6.536330431636383 15.29910414504011 0.03709983825683594 3 0.9877567802331847 11.142187239927038 192451.0 603.6532790345316 0.0 - - - - - - - 263.6666666666667 384 6 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 77 10 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23600.[MT7]-IPGTPGAGGR.2y7_1.heavy 513.794 / 615.321 2411.0 22.623250007629395 44 18 10 6 10 6.536330431636383 15.29910414504011 0.03709983825683594 3 0.9877567802331847 11.142187239927038 2411.0 9.02546437488228 0.0 - - - - - - - 230.35294117647058 4 17 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 79 11 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23881.[MT7]-LQTITAC[CAM]LQLR.2y8_1.heavy 730.922 / 974.545 1618.0 37.60110092163086 42 12 10 10 10 3.202084221037736 31.22965952706636 0.0 3 0.8874675027430204 3.6438792351971117 1618.0 4.186925795053003 0.0 - - - - - - - 228.7058823529412 3 17 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 81 11 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23881.[MT7]-LQTITAC[CAM]LQLR.2y9_1.heavy 730.922 / 1075.59 1780.0 37.60110092163086 42 12 10 10 10 3.202084221037736 31.22965952706636 0.0 3 0.8874675027430204 3.6438792351971117 1780.0 14.283950617283951 0.0 - - - - - - - 162.0 3 12 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 83 11 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23881.[MT7]-LQTITAC[CAM]LQLR.2y10_1.heavy 730.922 / 1203.65 1538.0 37.60110092163086 42 12 10 10 10 3.202084221037736 31.22965952706636 0.0 3 0.8874675027430204 3.6438792351971117 1538.0 27.854888888888887 0.0 - - - - - - - 162.0 3 10 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 85 11 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23881.[MT7]-LQTITAC[CAM]LQLR.2y7_1.heavy 730.922 / 861.461 3803.0 37.60110092163086 42 12 10 10 10 3.202084221037736 31.22965952706636 0.0 3 0.8874675027430204 3.6438792351971117 3803.0 8.075551667623696 0.0 - - - - - - - 172.8 7 15 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 87 12 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37654.[MT7]-TSEEIFQHLQNIVDFGK[MT7].3b6_1.heavy 765.074 / 851.427 2826.0 44.17770004272461 46 16 10 10 10 2.2492154385546677 36.033353169004855 0.0 3 0.9680558344906135 6.886581115831456 2826.0 44.72452173913044 0.0 - - - - - - - 230.75 5 16 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 89 12 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37654.[MT7]-TSEEIFQHLQNIVDFGK[MT7].3b5_1.heavy 765.074 / 704.358 5940.0 44.17770004272461 46 16 10 10 10 2.2492154385546677 36.033353169004855 0.0 3 0.9680558344906135 6.886581115831456 5940.0 15.510010307024393 0.0 - - - - - - - 271.29411764705884 11 17 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 91 12 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37654.[MT7]-TSEEIFQHLQNIVDFGK[MT7].3y4_1.heavy 765.074 / 610.332 4960.0 44.17770004272461 46 16 10 10 10 2.2492154385546677 36.033353169004855 0.0 3 0.9680558344906135 6.886581115831456 4960.0 19.85646425914268 0.0 - - - - - - - 207.6 9 20 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 93 12 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37654.[MT7]-TSEEIFQHLQNIVDFGK[MT7].3b7_1.heavy 765.074 / 979.485 4326.0 44.17770004272461 46 16 10 10 10 2.2492154385546677 36.033353169004855 0.0 3 0.9680558344906135 6.886581115831456 4326.0 31.122386363636362 0.0 - - - - - - - 156.64285714285714 8 14 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 95 13 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23880.[MT7]-REQLEQIQK[MT7].3b6_1.heavy 487.287 / 928.497 2085.0 21.7898006439209 37 9 10 10 8 0.7210550171539762 84.85417471177317 0.0 4 0.8197769539461685 2.862251748959934 2085.0 7.914798206278027 1.0 - - - - - - - 181.77777777777777 4 9 RFWD2 ring finger and WD repeat domain 2 97 13 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23880.[MT7]-REQLEQIQK[MT7].3y3_1.heavy 487.287 / 532.357 12210.0 21.7898006439209 37 9 10 10 8 0.7210550171539762 84.85417471177317 0.0 4 0.8197769539461685 2.862251748959934 12210.0 26.2350495842933 0.0 - - - - - - - 288.94117647058823 24 17 RFWD2 ring finger and WD repeat domain 2 99 13 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23880.[MT7]-REQLEQIQK[MT7].3b5_1.heavy 487.287 / 800.438 6701.0 21.7898006439209 37 9 10 10 8 0.7210550171539762 84.85417471177317 0.0 4 0.8197769539461685 2.862251748959934 6701.0 56.89104026845638 0.0 - - - - - - - 175.0 13 17 RFWD2 ring finger and WD repeat domain 2 101 13 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23880.[MT7]-REQLEQIQK[MT7].3b3_1.heavy 487.287 / 558.312 2904.0 21.7898006439209 37 9 10 10 8 0.7210550171539762 84.85417471177317 0.0 4 0.8197769539461685 2.862251748959934 2904.0 1.1147792706333972 3.0 - - - - - - - 707.4285714285714 8 14 RFWD2 ring finger and WD repeat domain 2 103 14 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37657.[MT7]-DLIDQSQSSGSGSGLPLLVQR.3b4_1.heavy 767.744 / 601.331 15144.0 37.842498779296875 50 20 10 10 10 5.04004518135955 19.841091974700326 0.0 3 0.9919576559189922 13.752433467873944 15144.0 34.06893361705862 0.0 - - - - - - - 732.875 30 8 BMPR1A bone morphogenetic protein receptor, type IA 105 14 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37657.[MT7]-DLIDQSQSSGSGSGLPLLVQR.3y4_1.heavy 767.744 / 515.33 5374.0 37.842498779296875 50 20 10 10 10 5.04004518135955 19.841091974700326 0.0 3 0.9919576559189922 13.752433467873944 5374.0 13.293578947368422 0.0 - - - - - - - 285.0 10 14 BMPR1A bone morphogenetic protein receptor, type IA 107 14 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37657.[MT7]-DLIDQSQSSGSGSGLPLLVQR.3y8_1.heavy 767.744 / 895.572 5292.0 37.842498779296875 50 20 10 10 10 5.04004518135955 19.841091974700326 0.0 3 0.9919576559189922 13.752433467873944 5292.0 21.471639344262293 0.0 - - - - - - - 187.76923076923077 10 13 BMPR1A bone morphogenetic protein receptor, type IA 109 14 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37657.[MT7]-DLIDQSQSSGSGSGLPLLVQR.3y9_1.heavy 767.744 / 982.604 2605.0 37.842498779296875 50 20 10 10 10 5.04004518135955 19.841091974700326 0.0 3 0.9919576559189922 13.752433467873944 2605.0 15.419210184114588 1.0 - - - - - - - 162.63636363636363 5 11 BMPR1A bone morphogenetic protein receptor, type IA 111 15 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23883.[MT7]-ELSVLEEDIK[MT7].3y3_1.heavy 488.28 / 519.326 64030.0 36.69850158691406 48 18 10 10 10 5.078255950183523 19.691799897637317 0.0 3 0.9855183967700126 10.243032337333416 64030.0 59.3554535269646 0.0 - - - - - - - 690.6666666666666 128 9 RFWD2 ring finger and WD repeat domain 2 113 15 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23883.[MT7]-ELSVLEEDIK[MT7].3b4_1.heavy 488.28 / 573.336 84933.0 36.69850158691406 48 18 10 10 10 5.078255950183523 19.691799897637317 0.0 3 0.9855183967700126 10.243032337333416 84933.0 225.68520919481654 0.0 - - - - - - - 714.9 169 10 RFWD2 ring finger and WD repeat domain 2 115 15 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23883.[MT7]-ELSVLEEDIK[MT7].3b5_1.heavy 488.28 / 686.42 36056.0 36.69850158691406 48 18 10 10 10 5.078255950183523 19.691799897637317 0.0 3 0.9855183967700126 10.243032337333416 36056.0 193.43347639484978 0.0 - - - - - - - 207.2 72 15 RFWD2 ring finger and WD repeat domain 2 117 15 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23883.[MT7]-ELSVLEEDIK[MT7].3y4_1.heavy 488.28 / 648.369 40873.0 36.69850158691406 48 18 10 10 10 5.078255950183523 19.691799897637317 0.0 3 0.9855183967700126 10.243032337333416 40873.0 182.67996784565915 0.0 - - - - - - - 655.0 81 7 RFWD2 ring finger and WD repeat domain 2 119 16 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23889.[MT7]-DVTQIFNNILR.2y9_1.heavy 738.918 / 1118.63 1321.0 44.412601470947266 47 17 10 10 10 2.8242466700560227 28.766831803762678 0.0 3 0.9776658443264685 8.24263312485532 1321.0 12.386225490196079 1.0 - - - - - - - 129.36363636363637 2 11 CAB39L calcium binding protein 39-like 121 16 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23889.[MT7]-DVTQIFNNILR.2b4_1.heavy 738.918 / 588.311 2489.0 44.412601470947266 47 17 10 10 10 2.8242466700560227 28.766831803762678 0.0 3 0.9776658443264685 8.24263312485532 2489.0 24.538001968503934 0.0 - - - - - - - 172.75 4 20 CAB39L calcium binding protein 39-like 123 16 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23889.[MT7]-DVTQIFNNILR.2y6_1.heavy 738.918 / 776.441 2083.0 44.412601470947266 47 17 10 10 10 2.8242466700560227 28.766831803762678 0.0 3 0.9776658443264685 8.24263312485532 2083.0 42.499374710514125 0.0 - - - - - - - 196.875 4 16 CAB39L calcium binding protein 39-like 125 16 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23889.[MT7]-DVTQIFNNILR.2y10_1.heavy 738.918 / 1217.7 914.0 44.412601470947266 47 17 10 10 10 2.8242466700560227 28.766831803762678 0.0 3 0.9776658443264685 8.24263312485532 914.0 8.41842105263158 0.0 - - - - - - - 0.0 1 0 CAB39L calcium binding protein 39-like 127 17 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24096.[MT7]-DLDTLSGYAMC[CAM]LPNLTR.3b4_1.heavy 695.347 / 589.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 129 17 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24096.[MT7]-DLDTLSGYAMC[CAM]LPNLTR.3b8_1.heavy 695.347 / 1009.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 131 17 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24096.[MT7]-DLDTLSGYAMC[CAM]LPNLTR.3b7_1.heavy 695.347 / 846.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 133 17 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24096.[MT7]-DLDTLSGYAMC[CAM]LPNLTR.3y5_1.heavy 695.347 / 600.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 135 18 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543975.[MT7]-LEIC[CAM]NLTPDALK[MT7].3b4_1.heavy 558.983 / 660.351 4571.0 37.87699890136719 39 16 10 3 10 2.2709102615901586 34.66492258638176 0.069000244140625 3 0.9637959233860158 6.4664299649435595 4571.0 11.06808408342026 0.0 - - - - - - - 779.0 9 7 CAPN1 calpain 1, (mu/I) large subunit 137 18 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543975.[MT7]-LEIC[CAM]NLTPDALK[MT7].3b5_1.heavy 558.983 / 774.394 14836.0 37.87699890136719 39 16 10 3 10 2.2709102615901586 34.66492258638176 0.069000244140625 3 0.9637959233860158 6.4664299649435595 14836.0 53.72324866504099 0.0 - - - - - - - 271.77777777777777 29 18 CAPN1 calpain 1, (mu/I) large subunit 139 18 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543975.[MT7]-LEIC[CAM]NLTPDALK[MT7].3b3_1.heavy 558.983 / 500.32 8821.0 37.87699890136719 39 16 10 3 10 2.2709102615901586 34.66492258638176 0.069000244140625 3 0.9637959233860158 6.4664299649435595 8821.0 7.883505605715018 1.0 - - - - - - - 748.6 17 15 CAPN1 calpain 1, (mu/I) large subunit 141 18 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543975.[MT7]-LEIC[CAM]NLTPDALK[MT7].3y5_1.heavy 558.983 / 687.416 29752.0 37.87699890136719 39 16 10 3 10 2.2709102615901586 34.66492258638176 0.069000244140625 3 0.9637959233860158 6.4664299649435595 29752.0 138.61391590637865 0.0 - - - - - - - 296.8 59 10 CAPN1 calpain 1, (mu/I) large subunit 143 19 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24094.[MT7]-DLEQDEAFIPVGESLK[MT7].3y7_1.heavy 693.368 / 873.516 10350.0 37.73899841308594 46 16 10 10 10 4.504949813693271 22.19780555513392 0.0 3 0.9675427726478341 6.83163951195372 10350.0 18.825380281982024 0.0 - - - - - - - 277.53846153846155 20 13 BMPR1A bone morphogenetic protein receptor, type IA 145 19 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24094.[MT7]-DLEQDEAFIPVGESLK[MT7].3b6_1.heavy 693.368 / 874.391 4493.0 37.73899841308594 46 16 10 10 10 4.504949813693271 22.19780555513392 0.0 3 0.9675427726478341 6.83163951195372 4493.0 44.89500778816199 0.0 - - - - - - - 169.76470588235293 8 17 BMPR1A bone morphogenetic protein receptor, type IA 147 19 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24094.[MT7]-DLEQDEAFIPVGESLK[MT7].3b5_1.heavy 693.368 / 745.349 2888.0 37.73899841308594 46 16 10 10 10 4.504949813693271 22.19780555513392 0.0 3 0.9675427726478341 6.83163951195372 2888.0 4.859663924301396 0.0 - - - - - - - 185.375 5 16 BMPR1A bone morphogenetic protein receptor, type IA 149 19 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24094.[MT7]-DLEQDEAFIPVGESLK[MT7].3b7_1.heavy 693.368 / 945.428 8425.0 37.73899841308594 46 16 10 10 10 4.504949813693271 22.19780555513392 0.0 3 0.9675427726478341 6.83163951195372 8425.0 119.17354771784233 0.0 - - - - - - - 208.45 16 20 BMPR1A bone morphogenetic protein receptor, type IA 151 20 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24093.[MT7]-TLQIDGPYDEAFYQK[MT7].2b3_1.heavy 1038.53 / 487.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 153 20 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24093.[MT7]-TLQIDGPYDEAFYQK[MT7].2y4_1.heavy 1038.53 / 729.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 155 20 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24093.[MT7]-TLQIDGPYDEAFYQK[MT7].2y3_1.heavy 1038.53 / 582.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 157 20 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24093.[MT7]-TLQIDGPYDEAFYQK[MT7].2b5_1.heavy 1038.53 / 715.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 159 21 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24092.[MT7]-TLQIDGPYDEAFYQK[MT7].3y3_1.heavy 692.689 / 582.337 19753.0 36.55929946899414 44 14 10 10 10 8.148355969478002 12.272414260567235 0.0 3 0.9393069339835427 4.983924073211398 19753.0 71.81986213580848 0.0 - - - - - - - 241.0 39 14 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 161 21 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24092.[MT7]-TLQIDGPYDEAFYQK[MT7].3b6_1.heavy 692.689 / 772.432 8030.0 36.55929946899414 44 14 10 10 10 8.148355969478002 12.272414260567235 0.0 3 0.9393069339835427 4.983924073211398 8030.0 23.89736134741029 0.0 - - - - - - - 274.6842105263158 16 19 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 163 21 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24092.[MT7]-TLQIDGPYDEAFYQK[MT7].3b5_1.heavy 692.689 / 715.411 10118.0 36.55929946899414 44 14 10 10 10 8.148355969478002 12.272414260567235 0.0 3 0.9393069339835427 4.983924073211398 10118.0 36.74881018095331 0.0 - - - - - - - 198.0 20 15 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 165 21 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24092.[MT7]-TLQIDGPYDEAFYQK[MT7].3y4_1.heavy 692.689 / 729.405 10920.0 36.55929946899414 44 14 10 10 10 8.148355969478002 12.272414260567235 0.0 3 0.9393069339835427 4.983924073211398 10920.0 43.994805517327016 0.0 - - - - - - - 699.7142857142857 21 7 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 167 22 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37148.[MT7]-EVVC[CAM]VK[MT7].2b3_1.heavy 511.301 / 472.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - BMPR1A bone morphogenetic protein receptor, type IA 169 22 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37148.[MT7]-EVVC[CAM]VK[MT7].2y4_1.heavy 511.301 / 649.382 N/A N/A - - - - - - - - - 0.0 - - - - - - - BMPR1A bone morphogenetic protein receptor, type IA 171 22 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37148.[MT7]-EVVC[CAM]VK[MT7].2y5_1.heavy 511.301 / 748.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - BMPR1A bone morphogenetic protein receptor, type IA 173 22 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37148.[MT7]-EVVC[CAM]VK[MT7].2y3_1.heavy 511.301 / 550.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - BMPR1A bone morphogenetic protein receptor, type IA 175 23 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543806.[MT7]-K[MT7]APPLLEGAPLR.3y7_1.heavy 517.327 / 755.441 8424.0 31.420650482177734 43 17 10 6 10 3.19142425291913 31.333972569937092 0.039398193359375 3 0.976580668050051 8.048665560710242 8424.0 9.704608076009501 1.0 - - - - - - - 280.77777777777777 16 9 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 177 23 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543806.[MT7]-K[MT7]APPLLEGAPLR.3y6_1.heavy 517.327 / 642.357 17036.0 31.420650482177734 43 17 10 6 10 3.19142425291913 31.333972569937092 0.039398193359375 3 0.976580668050051 8.048665560710242 17036.0 12.336583777962975 0.0 - - - - - - - 374.0 34 1 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 179 23 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543806.[MT7]-K[MT7]APPLLEGAPLR.3b5_1.heavy 517.327 / 795.533 4212.0 31.420650482177734 43 17 10 6 10 3.19142425291913 31.333972569937092 0.039398193359375 3 0.976580668050051 8.048665560710242 4212.0 13.465159194672857 0.0 - - - - - - - 212.9090909090909 8 11 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 181 23 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543806.[MT7]-K[MT7]APPLLEGAPLR.3y5_1.heavy 517.327 / 513.314 15538.0 31.420650482177734 43 17 10 6 10 3.19142425291913 31.333972569937092 0.039398193359375 3 0.976580668050051 8.048665560710242 15538.0 0.9503043573718293 2.0 - - - - - - - 187.0 31 1 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 183 24 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23498.[MT7]-LGLEK[MT7].2b3_1.heavy 424.278 / 428.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - RMND5B;SHISA9;NRIP2;IKBKG required for meiotic nuclear division 5 homolog B (S. cerevisiae);shisa homolog 9 (Xenopus laevis);nuclear receptor interacting protein 2;inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma 185 24 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23498.[MT7]-LGLEK[MT7].2y4_1.heavy 424.278 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - RMND5B;SHISA9;NRIP2;IKBKG required for meiotic nuclear division 5 homolog B (S. cerevisiae);shisa homolog 9 (Xenopus laevis);nuclear receptor interacting protein 2;inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma 187 24 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23498.[MT7]-LGLEK[MT7].2b4_1.heavy 424.278 / 557.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - RMND5B;SHISA9;NRIP2;IKBKG required for meiotic nuclear division 5 homolog B (S. cerevisiae);shisa homolog 9 (Xenopus laevis);nuclear receptor interacting protein 2;inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma 189 24 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23498.[MT7]-LGLEK[MT7].2y3_1.heavy 424.278 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - RMND5B;SHISA9;NRIP2;IKBKG required for meiotic nuclear division 5 homolog B (S. cerevisiae);shisa homolog 9 (Xenopus laevis);nuclear receptor interacting protein 2;inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma 191 25 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543802.[MT7]-APSDLYQIILK[MT7].3b6_1.heavy 516.979 / 791.406 29409.0 40.70705032348633 40 14 10 6 10 2.353698595306024 32.26195983907911 0.0334014892578125 3 0.9404784799055335 5.033236149400843 29409.0 100.16372960449027 0.0 - - - - - - - 225.53333333333333 58 15 CAPN1 calpain 1, (mu/I) large subunit 193 25 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543802.[MT7]-APSDLYQIILK[MT7].3b4_1.heavy 516.979 / 515.258 73334.0 40.70705032348633 40 14 10 6 10 2.353698595306024 32.26195983907911 0.0334014892578125 3 0.9404784799055335 5.033236149400843 73334.0 182.3598138297872 0.0 - - - - - - - 243.0 146 13 CAPN1 calpain 1, (mu/I) large subunit 195 25 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543802.[MT7]-APSDLYQIILK[MT7].3b5_1.heavy 516.979 / 628.342 132678.0 40.70705032348633 40 14 10 6 10 2.353698595306024 32.26195983907911 0.0334014892578125 3 0.9404784799055335 5.033236149400843 132678.0 248.49453223225686 0.0 - - - - - - - 225.66666666666666 265 9 CAPN1 calpain 1, (mu/I) large subunit 197 25 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543802.[MT7]-APSDLYQIILK[MT7].3b7_1.heavy 516.979 / 919.464 30988.0 40.70705032348633 40 14 10 6 10 2.353698595306024 32.26195983907911 0.0334014892578125 3 0.9404784799055335 5.033236149400843 30988.0 225.4871489361702 0.0 - - - - - - - 188.0 61 10 CAPN1 calpain 1, (mu/I) large subunit 199 26 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24016.[MT7]-RRLQTITAC[CAM]LQLR.3y7_1.heavy 591.685 / 861.461 3854.0 30.176350593566895 39 13 10 6 10 1.136025500564472 59.08568358463138 0.036998748779296875 3 0.9218514983660159 4.385633505453269 3854.0 18.07715931763767 0.0 - - - - - - - 201.6875 7 16 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 201 26 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24016.[MT7]-RRLQTITAC[CAM]LQLR.3b11_2.heavy 591.685 / 743.426 3316.0 30.176350593566895 39 13 10 6 10 1.136025500564472 59.08568358463138 0.036998748779296875 3 0.9218514983660159 4.385633505453269 3316.0 3.0834222181043267 0.0 - - - - - - - 241.23076923076923 6 13 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 203 26 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24016.[MT7]-RRLQTITAC[CAM]LQLR.3y6_1.heavy 591.685 / 760.413 2958.0 30.176350593566895 39 13 10 6 10 1.136025500564472 59.08568358463138 0.036998748779296875 3 0.9218514983660159 4.385633505453269 2958.0 2.471205357142857 1.0 - - - - - - - 209.16666666666666 5 18 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 205 26 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24016.[MT7]-RRLQTITAC[CAM]LQLR.3y5_1.heavy 591.685 / 689.376 1255.0 30.176350593566895 39 13 10 6 10 1.136025500564472 59.08568358463138 0.036998748779296875 3 0.9218514983660159 4.385633505453269 1255.0 2.689285714285714 4.0 - - - - - - - 274.11764705882354 5 17 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 207 27 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23597.[MT7]-STTLDAK[MT7].2y4_1.heavy 512.3 / 590.363 1190.0 18.555950164794922 44 18 10 6 10 7.089303012220686 14.105759032674715 0.036701202392578125 3 0.9867250729391647 10.69952970521504 1190.0 2.6027469409252553 1.0 - - - - - - - 220.33333333333334 2 18 BMPR1B bone morphogenetic protein receptor, type IB 209 27 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23597.[MT7]-STTLDAK[MT7].2y5_1.heavy 512.3 / 691.411 860.0 18.555950164794922 44 18 10 6 10 7.089303012220686 14.105759032674715 0.036701202392578125 3 0.9867250729391647 10.69952970521504 860.0 5.5590909090909095 1.0 - - - - - - - 0.0 1 0 BMPR1B bone morphogenetic protein receptor, type IB 211 27 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23597.[MT7]-STTLDAK[MT7].2y6_1.heavy 512.3 / 792.458 1786.0 18.555950164794922 44 18 10 6 10 7.089303012220686 14.105759032674715 0.036701202392578125 3 0.9867250729391647 10.69952970521504 1786.0 7.746926932637841 0.0 - - - - - - - 208.53846153846155 3 13 BMPR1B bone morphogenetic protein receptor, type IB 213 27 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23597.[MT7]-STTLDAK[MT7].2b5_1.heavy 512.3 / 662.348 4894.0 18.555950164794922 44 18 10 6 10 7.089303012220686 14.105759032674715 0.036701202392578125 3 0.9867250729391647 10.69952970521504 4894.0 13.57857288192763 0.0 - - - - - - - 188.4 9 20 BMPR1B bone morphogenetic protein receptor, type IB 215 28 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24017.[MT7]-DLK[MT7]PENLLLASK[MT7].3b3_1.heavy 591.7 / 645.417 1980.0 33.704200744628906 43 13 10 10 10 3.181498282964233 31.431731563541508 0.0 3 0.9229129033295989 4.416125047504527 1980.0 6.523255813953488 0.0 - - - - - - - 573.4444444444445 3 9 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 217 28 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24017.[MT7]-DLK[MT7]PENLLLASK[MT7].3y4_1.heavy 591.7 / 562.368 22894.0 33.704200744628906 43 13 10 10 10 3.181498282964233 31.431731563541508 0.0 3 0.9229129033295989 4.416125047504527 22894.0 39.139863930439205 0.0 - - - - - - - 301.0 45 12 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 219 28 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24017.[MT7]-DLK[MT7]PENLLLASK[MT7].3y5_1.heavy 591.7 / 675.452 7488.0 33.704200744628906 43 13 10 10 10 3.181498282964233 31.431731563541508 0.0 3 0.9229129033295989 4.416125047504527 7488.0 26.846511627906978 0.0 - - - - - - - 640.5555555555555 14 9 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 221 28 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24017.[MT7]-DLK[MT7]PENLLLASK[MT7].3b7_2.heavy 591.7 / 549.823 21689.0 33.704200744628906 43 13 10 10 10 3.181498282964233 31.431731563541508 0.0 3 0.9229129033295989 4.416125047504527 21689.0 36.8263020746888 0.0 - - - - - - - 315.3333333333333 43 15 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 223 29 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544420.[MT7]-FRLPPGEYVVVPSTFEPNK[MT7].4b8_1.heavy 616.842 / 1104.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 225 29 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544420.[MT7]-FRLPPGEYVVVPSTFEPNK[MT7].4b7_1.heavy 616.842 / 941.532 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 227 29 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544420.[MT7]-FRLPPGEYVVVPSTFEPNK[MT7].4y3_1.heavy 616.842 / 502.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 229 29 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544420.[MT7]-FRLPPGEYVVVPSTFEPNK[MT7].4b9_2.heavy 616.842 / 602.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 231 30 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42726.[MT7]-SVLDGPVLSNIDR.2y5_1.heavy 764.926 / 604.305 1124.0 36.19402503967285 44 18 10 6 10 4.405758979781223 22.697564814352532 0.03730010986328125 3 0.9836516165473393 9.63898962608982 1124.0 0.8 3.0 - - - - - - - 280.8888888888889 2 18 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 233 30 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42726.[MT7]-SVLDGPVLSNIDR.2y9_1.heavy 764.926 / 970.532 3774.0 36.19402503967285 44 18 10 6 10 4.405758979781223 22.697564814352532 0.03730010986328125 3 0.9836516165473393 9.63898962608982 3774.0 18.62884937189736 0.0 - - - - - - - 240.92857142857142 7 14 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 235 30 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42726.[MT7]-SVLDGPVLSNIDR.2y6_1.heavy 764.926 / 717.389 562.0 36.19402503967285 44 18 10 6 10 4.405758979781223 22.697564814352532 0.03730010986328125 3 0.9836516165473393 9.63898962608982 562.0 1.260910030220399 26.0 - - - - - - - 288.11764705882354 2 17 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 237 30 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42726.[MT7]-SVLDGPVLSNIDR.2y10_1.heavy 764.926 / 1085.56 1767.0 36.19402503967285 44 18 10 6 10 4.405758979781223 22.697564814352532 0.03730010986328125 3 0.9836516165473393 9.63898962608982 1767.0 24.99533865336658 0.0 - - - - - - - 197.6153846153846 3 13 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 239 31 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42725.[MT7]-LTTSDIDYALK[MT7].2y4_1.heavy 764.429 / 638.399 3314.0 34.423500061035156 40 14 10 6 10 2.759384933963329 36.23996013356828 0.03420257568359375 3 0.9479650292466842 5.386582012724833 3314.0 19.97513933996857 0.0 - - - - - - - 202.66666666666666 6 18 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 241 31 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42725.[MT7]-LTTSDIDYALK[MT7].2y6_1.heavy 764.429 / 866.51 1740.0 34.423500061035156 40 14 10 6 10 2.759384933963329 36.23996013356828 0.03420257568359375 3 0.9479650292466842 5.386582012724833 1740.0 8.532390431290379 0.0 - - - - - - - 229.53846153846155 3 13 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 243 31 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42725.[MT7]-LTTSDIDYALK[MT7].2b7_1.heavy 764.429 / 890.459 1740.0 34.423500061035156 40 14 10 6 10 2.759384933963329 36.23996013356828 0.03420257568359375 3 0.9479650292466842 5.386582012724833 1740.0 35.638554216867476 0.0 - - - - - - - 202.55555555555554 3 9 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 245 31 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42725.[MT7]-LTTSDIDYALK[MT7].2b5_1.heavy 764.429 / 662.348 2900.0 34.423500061035156 40 14 10 6 10 2.759384933963329 36.23996013356828 0.03420257568359375 3 0.9479650292466842 5.386582012724833 2900.0 8.893600344982314 0.0 - - - - - - - 253.52941176470588 5 17 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 247 32 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37663.[MT7]-QLEAESHAAQLQILMEFLK[MT7].4y3_1.heavy 622.593 / 551.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 249 32 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37663.[MT7]-QLEAESHAAQLQILMEFLK[MT7].4b6_1.heavy 622.593 / 802.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 251 32 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37663.[MT7]-QLEAESHAAQLQILMEFLK[MT7].4b10_2.heavy 622.593 / 605.303 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 253 32 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37663.[MT7]-QLEAESHAAQLQILMEFLK[MT7].4b9_2.heavy 622.593 / 541.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 255 33 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23871.[MT7]-TQPIVEILLK[MT7].2y8_1.heavy 721.465 / 1068.71 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 257 33 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23871.[MT7]-TQPIVEILLK[MT7].2y5_1.heavy 721.465 / 759.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 259 33 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23871.[MT7]-TQPIVEILLK[MT7].2b4_1.heavy 721.465 / 584.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 261 33 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23871.[MT7]-TQPIVEILLK[MT7].2y3_1.heavy 721.465 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 263 34 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB540561.[MT7]-EILMR.2b3_1.heavy 403.24 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 265 34 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB540561.[MT7]-EILMR.2y4_1.heavy 403.24 / 532.328 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 267 34 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB540561.[MT7]-EILMR.2y3_1.heavy 403.24 / 419.243 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 269 35 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23872.[MT7]-TQPIVEILLK[MT7].3b6_1.heavy 481.313 / 812.463 27850.0 42.71149921417236 43 20 10 3 10 161.9423356913586 0.617503752635674 0.07380294799804688 3 0.9900600660232945 12.36830608237346 27850.0 87.51496390952201 0.0 - - - - - - - 194.25 55 8 CAB39L calcium binding protein 39-like 271 35 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23872.[MT7]-TQPIVEILLK[MT7].3y3_1.heavy 481.313 / 517.383 31365.0 42.71149921417236 43 20 10 3 10 161.9423356913586 0.617503752635674 0.07380294799804688 3 0.9900600660232945 12.36830608237346 31365.0 32.051902672923894 0.0 - - - - - - - 292.8333333333333 62 6 CAB39L calcium binding protein 39-like 273 35 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23872.[MT7]-TQPIVEILLK[MT7].3b4_1.heavy 481.313 / 584.352 25822.0 42.71149921417236 43 20 10 3 10 161.9423356913586 0.617503752635674 0.07380294799804688 3 0.9900600660232945 12.36830608237346 25822.0 32.81870967741935 1.0 - - - - - - - 270.3333333333333 51 6 CAB39L calcium binding protein 39-like 275 35 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23872.[MT7]-TQPIVEILLK[MT7].3b5_1.heavy 481.313 / 683.421 17305.0 42.71149921417236 43 20 10 3 10 161.9423356913586 0.617503752635674 0.07380294799804688 3 0.9900600660232945 12.36830608237346 17305.0 28.46217105263158 1.0 - - - - - - - 319.0 34 7 CAB39L calcium binding protein 39-like 277 36 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37666.[MT7]-YTLTMEDLTPALSEYGINVK[MT7].3y3_1.heavy 849.448 / 504.326 4135.0 44.64339828491211 44 14 10 10 10 1.5051069093462777 52.73285631309706 0.0 3 0.9407705215304974 5.045755067274314 4135.0 18.406379740055314 0.0 - - - - - - - 274.55555555555554 8 18 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 279 36 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37666.[MT7]-YTLTMEDLTPALSEYGINVK[MT7].3b4_1.heavy 849.448 / 623.352 1866.0 44.64339828491211 44 14 10 10 10 1.5051069093462777 52.73285631309706 0.0 3 0.9407705215304974 5.045755067274314 1866.0 9.239942084942085 0.0 - - - - - - - 175.0 3 17 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 281 36 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37666.[MT7]-YTLTMEDLTPALSEYGINVK[MT7].3b3_1.heavy 849.448 / 522.304 2370.0 44.64339828491211 44 14 10 10 10 1.5051069093462777 52.73285631309706 0.0 3 0.9407705215304974 5.045755067274314 2370.0 13.519345238095237 0.0 - - - - - - - 196.05555555555554 4 18 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 283 36 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37666.[MT7]-YTLTMEDLTPALSEYGINVK[MT7].3b7_1.heavy 849.448 / 998.462 4387.0 44.64339828491211 44 14 10 10 10 1.5051069093462777 52.73285631309706 0.0 3 0.9407705215304974 5.045755067274314 4387.0 35.83440594059405 0.0 - - - - - - - 128.45 8 20 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 285 37 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544052.[MT7]-NQPQAPGVEASGAGEAR.3y7_1.heavy 594.967 / 647.311 8851.0 20.194124698638916 41 18 10 3 10 8.69586058911346 11.499724377503501 0.07969856262207031 3 0.9850374246545355 10.076650352230352 8851.0 3.4272991287512102 1.0 - - - - - - - 663.8571428571429 17 7 TNFRSF1B tumor necrosis factor receptor superfamily, member 1B 287 37 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544052.[MT7]-NQPQAPGVEASGAGEAR.3b5_1.heavy 594.967 / 683.359 17406.0 20.194124698638916 41 18 10 3 10 8.69586058911346 11.499724377503501 0.07969856262207031 3 0.9850374246545355 10.076650352230352 17406.0 26.233923444976078 0.0 - - - - - - - 313.5 34 4 TNFRSF1B tumor necrosis factor receptor superfamily, member 1B 289 37 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544052.[MT7]-NQPQAPGVEASGAGEAR.3y8_1.heavy 594.967 / 718.348 7744.0 20.194124698638916 41 18 10 3 10 8.69586058911346 11.499724377503501 0.07969856262207031 3 0.9850374246545355 10.076650352230352 7744.0 17.457761788513427 0.0 - - - - - - - 203.0 15 8 TNFRSF1B tumor necrosis factor receptor superfamily, member 1B 291 37 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544052.[MT7]-NQPQAPGVEASGAGEAR.3y9_1.heavy 594.967 / 847.39 5015.0 20.194124698638916 41 18 10 3 10 8.69586058911346 11.499724377503501 0.07969856262207031 3 0.9850374246545355 10.076650352230352 5015.0 9.121802325581395 1.0 - - - - - - - 179.28571428571428 10 7 TNFRSF1B tumor necrosis factor receptor superfamily, member 1B 293 38 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1546520.0 29.75790023803711 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1546520.0 3658.158102761015 0.0 - - - - - - - 1756.0 3093 7 295 38 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 490670.0 29.75790023803711 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 490670.0 840.8054084342655 0.0 - - - - - - - 675.1818181818181 981 11 297 38 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 352979.0 29.75790023803711 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 352979.0 460.882091110421 0.0 - - - - - - - 725.625 705 8 299 39 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543069.[MT7]-GYEAPQIALR.3b4_1.heavy 421.239 / 565.274 65714.0 30.713199615478516 45 15 10 10 10 1.555039311887394 46.091195565267924 0.0 3 0.9539439629734227 5.72846162386455 65714.0 268.0303886648746 0.0 - - - - - - - 268.6666666666667 131 9 CAB39L calcium binding protein 39-like 301 39 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543069.[MT7]-GYEAPQIALR.3y4_1.heavy 421.239 / 472.324 55568.0 30.713199615478516 45 15 10 10 10 1.555039311887394 46.091195565267924 0.0 3 0.9539439629734227 5.72846162386455 55568.0 64.59423237724842 0.0 - - - - - - - 232.5 111 8 CAB39L calcium binding protein 39-like 303 39 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543069.[MT7]-GYEAPQIALR.3b3_1.heavy 421.239 / 494.237 44678.0 30.713199615478516 45 15 10 10 10 1.555039311887394 46.091195565267924 0.0 3 0.9539439629734227 5.72846162386455 44678.0 87.04457208235831 0.0 - - - - - - - 232.5 89 10 CAB39L calcium binding protein 39-like 305 39 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543069.[MT7]-GYEAPQIALR.3y5_1.heavy 421.239 / 600.383 18895.0 30.713199615478516 45 15 10 10 10 1.555039311887394 46.091195565267924 0.0 3 0.9539439629734227 5.72846162386455 18895.0 51.52426391362667 0.0 - - - - - - - 678.2857142857143 37 7 CAB39L calcium binding protein 39-like 307 40 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23721.[MT7]-VC[CAM]EASPFSR.2y6_1.heavy 598.796 / 664.341 2428.0 27.024200439453125 45 20 10 5 10 3.219166869810265 23.579409869398663 0.04000091552734375 3 0.992870306306409 14.607253409867239 2428.0 26.525549132947976 0.0 - - - - - - - 236.36363636363637 4 11 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 309 40 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23721.[MT7]-VC[CAM]EASPFSR.2b3_1.heavy 598.796 / 533.251 3295.0 27.024200439453125 45 20 10 5 10 3.219166869810265 23.579409869398663 0.04000091552734375 3 0.992870306306409 14.607253409867239 3295.0 16.46769563289736 2.0 - - - - - - - 245.58333333333334 6 12 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 311 40 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23721.[MT7]-VC[CAM]EASPFSR.2y8_1.heavy 598.796 / 953.414 9104.0 27.024200439453125 45 20 10 5 10 3.219166869810265 23.579409869398663 0.04000091552734375 3 0.992870306306409 14.607253409867239 9104.0 51.01741538461539 0.0 - - - - - - - 226.76923076923077 18 13 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 313 40 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23721.[MT7]-VC[CAM]EASPFSR.2y7_1.heavy 598.796 / 793.384 2168.0 27.024200439453125 45 20 10 5 10 3.219166869810265 23.579409869398663 0.04000091552734375 3 0.992870306306409 14.607253409867239 2168.0 1.6210346899306962 1.0 - - - - - - - 208.2 4 10 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 315 41 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37326.[MT7]-VDRVPLASK[MT7].2y4_1.heavy 636.898 / 562.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 317 41 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37326.[MT7]-VDRVPLASK[MT7].2y5_1.heavy 636.898 / 659.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 319 41 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37326.[MT7]-VDRVPLASK[MT7].2b6_1.heavy 636.898 / 824.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 321 41 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37326.[MT7]-VDRVPLASK[MT7].2y6_1.heavy 636.898 / 758.489 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 323 42 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37133.[MT7]-LQQEGER.2b3_1.heavy 502.268 / 514.311 1252.0 16.483299255371094 48 18 10 10 10 14.635746067795607 6.832586431657168 0.0 3 0.9837419077555423 9.665791358425103 1252.0 10.23814850530376 0.0 - - - - - - - 214.84615384615384 2 26 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 325 42 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37133.[MT7]-LQQEGER.2y5_1.heavy 502.268 / 618.284 3215.0 16.483299255371094 48 18 10 10 10 14.635746067795607 6.832586431657168 0.0 3 0.9837419077555423 9.665791358425103 3215.0 50.991721132897595 0.0 - - - - - - - 162.04347826086956 6 23 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 327 42 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37133.[MT7]-LQQEGER.2b4_1.heavy 502.268 / 643.353 2640.0 16.483299255371094 48 18 10 10 10 14.635746067795607 6.832586431657168 0.0 3 0.9837419077555423 9.665791358425103 2640.0 18.61089573556417 0.0 - - - - - - - 159.1 5 20 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 329 42 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37133.[MT7]-LQQEGER.2y6_1.heavy 502.268 / 746.343 10424.0 16.483299255371094 48 18 10 10 10 14.635746067795607 6.832586431657168 0.0 3 0.9837419077555423 9.665791358425103 10424.0 84.28830149129894 0.0 - - - - - - - 158.0952380952381 20 21 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 331 43 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 574413.0 15.345933596293131 23 -3 10 6 10 null 0.0 0.031899452209472656 3 0.0 0.0 574413.0 5625.984581065702 0.0 - - - - - - - 810.125 1148 8 333 43 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 1205390.0 15.345933596293131 23 -3 10 6 10 null 0.0 0.031899452209472656 3 0.0 0.0 1205390.0 6908.7802186554145 0.0 - - - - - - - 664.5 2410 2 335 43 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 371703.0 15.345933596293131 23 -3 10 6 10 null 0.0 0.031899452209472656 3 0.0 0.0 371703.0 1670.710137040283 0.0 - - - - - - - 411.85714285714283 743 7 337 44 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23621.[MT7]-SSTLEVK[MT7].2y4_1.heavy 526.315 / 632.41 2906.0 21.99429941177368 46 20 10 6 10 23.44991987839553 4.2644068942909374 0.03479957580566406 3 0.9980722770674314 28.104138144685948 2906.0 13.718801313628902 0.0 - - - - - - - 238.65 5 20 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 339 44 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23621.[MT7]-SSTLEVK[MT7].2y3_1.heavy 526.315 / 519.326 5515.0 21.99429941177368 46 20 10 6 10 23.44991987839553 4.2644068942909374 0.03479957580566406 3 0.9980722770674314 28.104138144685948 5515.0 11.651387362774754 0.0 - - - - - - - 630.2727272727273 11 11 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 341 44 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23621.[MT7]-SSTLEVK[MT7].2y6_1.heavy 526.315 / 820.49 5887.0 21.99429941177368 46 20 10 6 10 23.44991987839553 4.2644068942909374 0.03479957580566406 3 0.9980722770674314 28.104138144685948 5887.0 22.231640202979207 0.0 - - - - - - - 174.16666666666666 11 18 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 343 44 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23621.[MT7]-SSTLEVK[MT7].2b5_1.heavy 526.315 / 662.348 6931.0 21.99429941177368 46 20 10 6 10 23.44991987839553 4.2644068942909374 0.03479957580566406 3 0.9980722770674314 28.104138144685948 6931.0 23.664478770032325 0.0 - - - - - - - 234.85 13 20 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 345 45 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB540735.[MT7]-LLASGSDDAK[MT7].3y3_1.heavy 422.238 / 477.279 11433.0 24.44630002975464 44 18 10 6 10 10.390390583561873 9.624277277719 0.03759956359863281 3 0.9854719806496384 10.226616552024478 11433.0 23.16084575940269 0.0 - - - - - - - 277.09090909090907 22 11 RFWD2 ring finger and WD repeat domain 2 347 45 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB540735.[MT7]-LLASGSDDAK[MT7].3b4_1.heavy 422.238 / 529.347 3049.0 24.44630002975464 44 18 10 6 10 10.390390583561873 9.624277277719 0.03759956359863281 3 0.9854719806496384 10.226616552024478 3049.0 3.419775678866588 1.0 - - - - - - - 719.75 7 12 RFWD2 ring finger and WD repeat domain 2 349 45 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB540735.[MT7]-LLASGSDDAK[MT7].3y4_1.heavy 422.238 / 592.306 6436.0 24.44630002975464 44 18 10 6 10 10.390390583561873 9.624277277719 0.03759956359863281 3 0.9854719806496384 10.226616552024478 6436.0 29.43835040531438 0.0 - - - - - - - 195.9375 12 16 RFWD2 ring finger and WD repeat domain 2 351 45 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB540735.[MT7]-LLASGSDDAK[MT7].3b3_1.heavy 422.238 / 442.315 11941.0 24.44630002975464 44 18 10 6 10 10.390390583561873 9.624277277719 0.03759956359863281 3 0.9854719806496384 10.226616552024478 11941.0 22.492518412274794 0.0 - - - - - - - 701.5714285714286 23 7 RFWD2 ring finger and WD repeat domain 2 353 46 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543169.[MT7]-IILFSNQFR.2y8_1.heavy 641.375 / 1024.56 21867.0 40.801700592041016 47 17 10 10 10 3.8436605741936756 26.01686545149165 0.0 3 0.9743435905754315 7.688320794552209 21867.0 124.36783740766437 0.0 - - - - - - - 203.66666666666666 43 12 CAB39L calcium binding protein 39-like 355 46 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543169.[MT7]-IILFSNQFR.2y5_1.heavy 641.375 / 651.321 11316.0 40.801700592041016 47 17 10 10 10 3.8436605741936756 26.01686545149165 0.0 3 0.9743435905754315 7.688320794552209 11316.0 56.94980392156863 0.0 - - - - - - - 237.77777777777777 22 18 CAB39L calcium binding protein 39-like 357 46 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543169.[MT7]-IILFSNQFR.2y6_1.heavy 641.375 / 798.389 20261.0 40.801700592041016 47 17 10 10 10 3.8436605741936756 26.01686545149165 0.0 3 0.9743435905754315 7.688320794552209 20261.0 89.62736215610275 0.0 - - - - - - - 280.27777777777777 40 18 CAB39L calcium binding protein 39-like 359 46 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543169.[MT7]-IILFSNQFR.2y7_1.heavy 641.375 / 911.473 16209.0 40.801700592041016 47 17 10 10 10 3.8436605741936756 26.01686545149165 0.0 3 0.9743435905754315 7.688320794552209 16209.0 62.19653013037676 0.0 - - - - - - - 233.38888888888889 32 18 CAB39L calcium binding protein 39-like 361 47 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23728.[MT7]-AC[CAM]TTEAHK[MT7].3b4_1.heavy 402.544 / 578.273 806.0 13.542799949645996 44 14 10 10 10 2.06758839735776 38.5790732751124 0.0 3 0.9310016801660262 4.671042050884131 806.0 9.514283516329813 1.0 - - - - - - - 0.0 1 0 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 363 47 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23728.[MT7]-AC[CAM]TTEAHK[MT7].3b5_1.heavy 402.544 / 707.315 1534.0 13.542799949645996 44 14 10 10 10 2.06758839735776 38.5790732751124 0.0 3 0.9310016801660262 4.671042050884131 1534.0 110.66433333333333 0.0 - - - - - - - 42.38461538461539 3 13 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 365 47 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23728.[MT7]-AC[CAM]TTEAHK[MT7].3y4_1.heavy 402.544 / 628.354 728.0 13.542799949645996 44 14 10 10 10 2.06758839735776 38.5790732751124 0.0 3 0.9310016801660262 4.671042050884131 728.0 11.99273607748184 0.0 - - - - - - - 0.0 1 0 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 367 47 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23728.[MT7]-AC[CAM]TTEAHK[MT7].3b3_1.heavy 402.544 / 477.225 1357.0 13.542799949645996 44 14 10 10 10 2.06758839735776 38.5790732751124 0.0 3 0.9310016801660262 4.671042050884131 1357.0 4.0249999999999995 0.0 - - - - - - - 172.69565217391303 2 23 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 369 48 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43304.[MT7]-QC[CAM]VEYALK[MT7].2b3_1.heavy 649.854 / 532.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510228;CACNA1C;CACNA1D;CACNA1F voltage-dependent L-type calcium channel subunit alpha-1C-like;calcium channel, voltage-dependent, L type, alpha 1C subunit;calcium channel, voltage-dependent, L type, alpha 1D subunit;calcium channel, voltage-dependent, L type, alpha 1F subunit 371 48 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43304.[MT7]-QC[CAM]VEYALK[MT7].2y4_1.heavy 649.854 / 638.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510228;CACNA1C;CACNA1D;CACNA1F voltage-dependent L-type calcium channel subunit alpha-1C-like;calcium channel, voltage-dependent, L type, alpha 1C subunit;calcium channel, voltage-dependent, L type, alpha 1D subunit;calcium channel, voltage-dependent, L type, alpha 1F subunit 373 48 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43304.[MT7]-QC[CAM]VEYALK[MT7].2b4_1.heavy 649.854 / 661.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510228;CACNA1C;CACNA1D;CACNA1F voltage-dependent L-type calcium channel subunit alpha-1C-like;calcium channel, voltage-dependent, L type, alpha 1C subunit;calcium channel, voltage-dependent, L type, alpha 1D subunit;calcium channel, voltage-dependent, L type, alpha 1F subunit 375 48 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43304.[MT7]-QC[CAM]VEYALK[MT7].2y7_1.heavy 649.854 / 1026.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510228;CACNA1C;CACNA1D;CACNA1F voltage-dependent L-type calcium channel subunit alpha-1C-like;calcium channel, voltage-dependent, L type, alpha 1C subunit;calcium channel, voltage-dependent, L type, alpha 1D subunit;calcium channel, voltage-dependent, L type, alpha 1F subunit 377 49 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23727.[MT7]-DNLAILEK[MT7].2y4_1.heavy 602.363 / 646.426 7065.0 32.48149871826172 40 15 10 5 10 4.023041143903836 24.856817622044765 0.04759979248046875 3 0.9599982371776364 6.149847645203059 7065.0 15.67940996714966 0.0 - - - - - - - 250.45454545454547 14 11 CAB39L calcium binding protein 39-like 379 49 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23727.[MT7]-DNLAILEK[MT7].2y5_1.heavy 602.363 / 717.463 7524.0 32.48149871826172 40 15 10 5 10 4.023041143903836 24.856817622044765 0.04759979248046875 3 0.9599982371776364 6.149847645203059 7524.0 22.28374822674362 0.0 - - - - - - - 357.9 15 10 CAB39L calcium binding protein 39-like 381 49 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23727.[MT7]-DNLAILEK[MT7].2b4_1.heavy 602.363 / 558.3 7707.0 32.48149871826172 40 15 10 5 10 4.023041143903836 24.856817622044765 0.04759979248046875 3 0.9599982371776364 6.149847645203059 7707.0 7.860235658409387 1.0 - - - - - - - 1192.8333333333333 15 12 CAB39L calcium binding protein 39-like 383 49 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23727.[MT7]-DNLAILEK[MT7].2y3_1.heavy 602.363 / 533.341 7524.0 32.48149871826172 40 15 10 5 10 4.023041143903836 24.856817622044765 0.04759979248046875 3 0.9599982371776364 6.149847645203059 7524.0 13.829994509826001 0.0 - - - - - - - 312.1 15 10 CAB39L calcium binding protein 39-like 385 50 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43302.[MT7]-QETVEC[CAM]LK[MT7].2y4_1.heavy 647.849 / 693.372 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 387 50 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43302.[MT7]-QETVEC[CAM]LK[MT7].2y3_1.heavy 647.849 / 564.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 389 50 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43302.[MT7]-QETVEC[CAM]LK[MT7].2y6_1.heavy 647.849 / 893.488 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 391 50 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43302.[MT7]-QETVEC[CAM]LK[MT7].2y7_1.heavy 647.849 / 1022.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 393 51 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544416.[MT7]-Y[MT7]VELSTFDIASDAFATFK[MT7].4y4_1.heavy 615.078 / 610.368 1368.0 45.17859903971354 42 16 10 6 10 2.71909975970328 36.77687795129386 0.031200408935546875 3 0.9672526847666134 6.8011471977615034 1368.0 9.706000515065671 0.0 - - - - - - - 162.27272727272728 2 22 CAB39L calcium binding protein 39-like 395 51 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544416.[MT7]-Y[MT7]VELSTFDIASDAFATFK[MT7].4b8_2.heavy 615.078 / 622.326 4985.0 45.17859903971354 42 16 10 6 10 2.71909975970328 36.77687795129386 0.031200408935546875 3 0.9672526847666134 6.8011471977615034 4985.0 42.95999588646647 0.0 - - - - - - - 158.0 9 24 CAB39L calcium binding protein 39-like 397 51 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544416.[MT7]-Y[MT7]VELSTFDIASDAFATFK[MT7].4y3_1.heavy 615.078 / 539.331 N/A 45.17859903971354 42 16 10 6 10 2.71909975970328 36.77687795129386 0.031200408935546875 3 0.9672526847666134 6.8011471977615034 1853.0 2.5244476105735627 1.0 - - - - - - - 220.47368421052633 4 19 CAB39L calcium binding protein 39-like 399 51 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544416.[MT7]-Y[MT7]VELSTFDIASDAFATFK[MT7].4b3_1.heavy 615.078 / 680.386 750.0 45.17859903971354 42 16 10 6 10 2.71909975970328 36.77687795129386 0.031200408935546875 3 0.9672526847666134 6.8011471977615034 750.0 2.556818181818182 0.0 - - - - - - - 0.0 1 0 CAB39L calcium binding protein 39-like 401 52 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544418.[MT7]-LVFVHSAEGNEFWSALLEK[MT7].4b11_2.heavy 616.833 / 664.342 15812.0 45.196824073791504 34 8 10 6 10 0.7564880840075121 87.62983510806687 0.031299591064453125 3 0.7784776552137725 2.5721091775604505 15812.0 31.735768779054208 0.0 - - - - - - - 726.7272727272727 31 11 CAPN1 calpain 1, (mu/I) large subunit 403 52 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544418.[MT7]-LVFVHSAEGNEFWSALLEK[MT7].4b4_1.heavy 616.833 / 603.399 3118.0 45.196824073791504 34 8 10 6 10 0.7564880840075121 87.62983510806687 0.031299591064453125 3 0.7784776552137725 2.5721091775604505 3118.0 21.26805531596803 0.0 - - - - - - - 219.75 6 24 CAPN1 calpain 1, (mu/I) large subunit 405 52 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544418.[MT7]-LVFVHSAEGNEFWSALLEK[MT7].4y3_1.heavy 616.833 / 533.341 16426.0 45.196824073791504 34 8 10 6 10 0.7564880840075121 87.62983510806687 0.031299591064453125 3 0.7784776552137725 2.5721091775604505 16426.0 29.11290899868891 0.0 - - - - - - - 263.5882352941176 32 17 CAPN1 calpain 1, (mu/I) large subunit 407 52 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544418.[MT7]-LVFVHSAEGNEFWSALLEK[MT7].4b3_1.heavy 616.833 / 504.33 1976.0 45.196824073791504 34 8 10 6 10 0.7564880840075121 87.62983510806687 0.031299591064453125 3 0.7784776552137725 2.5721091775604505 1976.0 7.8031516968945525 0.0 - - - - - - - 211.55555555555554 3 27 CAPN1 calpain 1, (mu/I) large subunit 409 53 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB540596.[MT7]-LQTYR.2b3_1.heavy 412.741 / 487.3 6381.0 21.199525356292725 46 20 10 6 10 3.89613424132314 18.882811798758617 0.03270149230957031 3 0.9970271030641404 22.628970259162866 6381.0 16.049991260457368 0.0 - - - - - - - 200.4 12 15 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 411 53 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB540596.[MT7]-LQTYR.2y4_1.heavy 412.741 / 567.289 28604.0 21.199525356292725 46 20 10 6 10 3.89613424132314 18.882811798758617 0.03270149230957031 3 0.9970271030641404 22.628970259162866 28604.0 98.72578921489296 0.0 - - - - - - - 282.85714285714283 57 7 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 413 53 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB540596.[MT7]-LQTYR.2b4_1.heavy 412.741 / 650.363 2860.0 21.199525356292725 46 20 10 6 10 3.89613424132314 18.882811798758617 0.03270149230957031 3 0.9970271030641404 22.628970259162866 2860.0 21.52587030716724 0.0 - - - - - - - 185.21052631578948 5 19 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 415 53 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB540596.[MT7]-LQTYR.2y3_1.heavy 412.741 / 439.23 5574.0 21.199525356292725 46 20 10 6 10 3.89613424132314 18.882811798758617 0.03270149230957031 3 0.9970271030641404 22.628970259162866 5574.0 19.12327485380117 0.0 - - - - - - - 207.72222222222223 11 18 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 417 54 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23490.[MT7]-NFSVGR.2b3_1.heavy 412.231 / 493.253 3154.0 22.37310028076172 42 12 10 10 10 3.1468225500832334 31.778086755274778 0.0 3 0.8892167907721332 3.6730937159866093 3154.0 8.569380348943984 0.0 - - - - - - - 268.9166666666667 6 12 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 419 54 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23490.[MT7]-NFSVGR.2y4_1.heavy 412.231 / 418.241 5481.0 22.37310028076172 42 12 10 10 10 3.1468225500832334 31.778086755274778 0.0 3 0.8892167907721332 3.6730937159866093 5481.0 19.97674023294509 0.0 - - - - - - - 225.07692307692307 10 13 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 421 54 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23490.[MT7]-NFSVGR.2y5_1.heavy 412.231 / 565.309 15243.0 22.37310028076172 42 12 10 10 10 3.1468225500832334 31.778086755274778 0.0 3 0.8892167907721332 3.6730937159866093 15243.0 34.662336550586865 0.0 - - - - - - - 684.3333333333334 30 9 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 423 54 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23490.[MT7]-NFSVGR.2y3_1.heavy 412.231 / 331.209 2253.0 22.37310028076172 42 12 10 10 10 3.1468225500832334 31.778086755274778 0.0 3 0.8892167907721332 3.6730937159866093 2253.0 3.712988165680473 0.0 - - - - - - - 631.0 4 10 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 425 55 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23491.[MT7]-FSPSSR.2y4_1.heavy 412.723 / 446.236 3483.0 19.27910041809082 41 20 9 6 6 12.260550658079355 8.156240513887754 0.03989982604980469 6 0.9992051215634574 43.77067460792922 3483.0 7.627711058902357 1.0 - - - - - - - 220.58333333333334 17 12 RFWD2 ring finger and WD repeat domain 2 427 55 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23491.[MT7]-FSPSSR.2y5_1.heavy 412.723 / 533.268 7592.0 19.27910041809082 41 20 9 6 6 12.260550658079355 8.156240513887754 0.03989982604980469 6 0.9992051215634574 43.77067460792922 7592.0 30.479209544908358 0.0 - - - - - - - 291.27272727272725 15 11 RFWD2 ring finger and WD repeat domain 2 429 55 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23491.[MT7]-FSPSSR.2b4_1.heavy 412.723 / 563.295 N/A 19.27910041809082 41 20 9 6 6 12.260550658079355 8.156240513887754 0.03989982604980469 6 0.9992051215634574 43.77067460792922 975.0 1.1810344827586208 2.0 - - - - - - - 200.76470588235293 2 17 RFWD2 ring finger and WD repeat domain 2 431 55 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23491.[MT7]-FSPSSR.2b5_1.heavy 412.723 / 650.327 1393.0 19.27910041809082 41 20 9 6 6 12.260550658079355 8.156240513887754 0.03989982604980469 6 0.9992051215634574 43.77067460792922 1393.0 4.693261648745519 2.0 - - - - - - - 190.0 3 11 RFWD2 ring finger and WD repeat domain 2 433 56 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37639.[MT7]-EQLSSLQEELESLLEK[MT7].2b3_1.heavy 1082.09 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 435 56 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37639.[MT7]-EQLSSLQEELESLLEK[MT7].2y5_1.heavy 1082.09 / 733.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 437 56 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37639.[MT7]-EQLSSLQEELESLLEK[MT7].2b4_1.heavy 1082.09 / 602.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 439 56 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37639.[MT7]-EQLSSLQEELESLLEK[MT7].2b9_1.heavy 1082.09 / 1188.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 441 57 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB541581.[MT7]-FDLDK[MT7].2b3_1.heavy 463.265 / 520.289 1975.0 27.942399978637695 41 13 10 10 8 0.9026770597429349 68.16274658661865 0.0 4 0.9018250772501416 3.906099285443905 1975.0 2.6563461814470477 8.0 - - - - - - - 785.2857142857143 10 7 CAPN1 calpain 1, (mu/I) large subunit 443 57 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB541581.[MT7]-FDLDK[MT7].2y4_1.heavy 463.265 / 634.353 5840.0 27.942399978637695 41 13 10 10 8 0.9026770597429349 68.16274658661865 0.0 4 0.9018250772501416 3.906099285443905 5840.0 23.52362097449476 0.0 - - - - - - - 331.2857142857143 11 14 CAPN1 calpain 1, (mu/I) large subunit 445 57 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB541581.[MT7]-FDLDK[MT7].2b4_1.heavy 463.265 / 635.316 5926.0 27.942399978637695 41 13 10 10 8 0.9026770597429349 68.16274658661865 0.0 4 0.9018250772501416 3.906099285443905 5926.0 13.0155074875208 0.0 - - - - - - - 242.7058823529412 11 17 CAPN1 calpain 1, (mu/I) large subunit 447 57 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB541581.[MT7]-FDLDK[MT7].2y3_1.heavy 463.265 / 519.326 3521.0 27.942399978637695 41 13 10 10 8 0.9026770597429349 68.16274658661865 0.0 4 0.9018250772501416 3.906099285443905 3521.0 5.013132041346914 1.0 - - - - - - - 695.6 12 10 CAPN1 calpain 1, (mu/I) large subunit 449 58 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543960.[MT7]-VFFTTEEASWFR.3y6_1.heavy 555.279 / 795.378 16781.0 44.412601470947266 50 20 10 10 10 19.001310774808378 5.262794824269616 0.0 3 0.9983911222918147 30.763986221573774 16781.0 145.11569523809524 0.0 - - - - - - - 162.35714285714286 33 14 BMPR1A;BMPR1B bone morphogenetic protein receptor, type IA;bone morphogenetic protein receptor, type IB 451 58 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543960.[MT7]-VFFTTEEASWFR.3b3_1.heavy 555.279 / 538.315 13402.0 44.412601470947266 50 20 10 10 10 19.001310774808378 5.262794824269616 0.0 3 0.9983911222918147 30.763986221573774 13402.0 33.92258232171909 0.0 - - - - - - - 683.3636363636364 26 11 BMPR1A;BMPR1B bone morphogenetic protein receptor, type IA;bone morphogenetic protein receptor, type IB 453 58 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543960.[MT7]-VFFTTEEASWFR.3y4_1.heavy 555.279 / 595.299 26162.0 44.412601470947266 50 20 10 10 10 19.001310774808378 5.262794824269616 0.0 3 0.9983911222918147 30.763986221573774 26162.0 174.58870909462496 0.0 - - - - - - - 198.26666666666668 52 15 BMPR1A;BMPR1B bone morphogenetic protein receptor, type IA;bone morphogenetic protein receptor, type IB 455 58 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543960.[MT7]-VFFTTEEASWFR.3y5_1.heavy 555.279 / 666.336 21792.0 44.412601470947266 50 20 10 10 10 19.001310774808378 5.262794824269616 0.0 3 0.9983911222918147 30.763986221573774 21792.0 62.86227051199189 0.0 - - - - - - - 216.57142857142858 43 14 BMPR1A;BMPR1B bone morphogenetic protein receptor, type IA;bone morphogenetic protein receptor, type IB 457 59 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23619.[MT7]-VVC[CAM]EQK[MT7].2y4_1.heavy 525.796 / 708.347 3300.0 17.583199501037598 46 20 10 6 10 5.850330925591387 17.09305016619917 0.034801483154296875 3 0.9934841801655634 15.28064683618138 3300.0 24.799999999999997 0.0 - - - - - - - 168.23529411764707 6 17 TGFBR1 transforming growth factor, beta receptor 1 459 59 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23619.[MT7]-VVC[CAM]EQK[MT7].2y5_1.heavy 525.796 / 807.415 5005.0 17.583199501037598 46 20 10 6 10 5.850330925591387 17.09305016619917 0.034801483154296875 3 0.9934841801655634 15.28064683618138 5005.0 97.37 0.0 - - - - - - - 168.66666666666666 10 15 TGFBR1 transforming growth factor, beta receptor 1 461 59 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23619.[MT7]-VVC[CAM]EQK[MT7].2b4_1.heavy 525.796 / 632.319 990.0 17.583199501037598 46 20 10 6 10 5.850330925591387 17.09305016619917 0.034801483154296875 3 0.9934841801655634 15.28064683618138 990.0 15.600000000000001 0.0 - - - - - - - 0.0 1 0 TGFBR1 transforming growth factor, beta receptor 1 463 59 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23619.[MT7]-VVC[CAM]EQK[MT7].2y3_1.heavy 525.796 / 548.316 990.0 17.583199501037598 46 20 10 6 10 5.850330925591387 17.09305016619917 0.034801483154296875 3 0.9934841801655634 15.28064683618138 990.0 5.1 1.0 - - - - - - - 0.0 1 0 TGFBR1 transforming growth factor, beta receptor 1 465 60 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB541050.[MT7]-IINTK[MT7].2y4_1.heavy 438.791 / 619.39 25253.0 22.055099487304688 48 18 10 10 10 8.115038391326221 12.322800605217745 0.0 3 0.9866976471786105 10.688469735545787 25253.0 33.35367027094208 0.0 - - - - - - - 763.25 50 12 OR5D16;CAMK2A;CAMK2B;CAMK2D;CAMK2G olfactory receptor, family 5, subfamily D, member 16;calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 467 60 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB541050.[MT7]-IINTK[MT7].2b3_1.heavy 438.791 / 485.32 2086.0 22.055099487304688 48 18 10 10 10 8.115038391326221 12.322800605217745 0.0 3 0.9866976471786105 10.688469735545787 2086.0 2.915895316804408 0.0 - - - - - - - 737.3 4 10 OR5D16;CAMK2A;CAMK2B;CAMK2D;CAMK2G olfactory receptor, family 5, subfamily D, member 16;calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 469 60 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB541050.[MT7]-IINTK[MT7].2b4_1.heavy 438.791 / 586.368 N/A 22.055099487304688 48 18 10 10 10 8.115038391326221 12.322800605217745 0.0 3 0.9866976471786105 10.688469735545787 745.0 -0.5 31.0 - - - - - - - 750.5384615384615 8 13 OR5D16;CAMK2A;CAMK2B;CAMK2D;CAMK2G olfactory receptor, family 5, subfamily D, member 16;calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 471 60 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB541050.[MT7]-IINTK[MT7].2y3_1.heavy 438.791 / 506.306 14377.0 22.055099487304688 48 18 10 10 10 8.115038391326221 12.322800605217745 0.0 3 0.9866976471786105 10.688469735545787 14377.0 30.36899877899878 0.0 - - - - - - - 662.7 28 10 OR5D16;CAMK2A;CAMK2B;CAMK2D;CAMK2G olfactory receptor, family 5, subfamily D, member 16;calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 473 61 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37315.[MT7]-IQSERPESR.3y3_1.heavy 415.894 / 391.194 2934.0 15.949899673461914 43 13 10 10 10 2.1438733407183106 46.64454662535928 0.0 3 0.917508691833397 4.267038967934363 2934.0 6.6680297016151115 0.0 - - - - - - - 298.6521739130435 5 23 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 475 61 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37315.[MT7]-IQSERPESR.3b4_1.heavy 415.894 / 602.327 3091.0 15.949899673461914 43 13 10 10 10 2.1438733407183106 46.64454662535928 0.0 3 0.917508691833397 4.267038967934363 3091.0 19.86131709826788 1.0 - - - - - - - 190.96 6 25 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 477 61 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37315.[MT7]-IQSERPESR.3y4_1.heavy 415.894 / 488.246 21571.0 15.949899673461914 43 13 10 10 10 2.1438733407183106 46.64454662535928 0.0 3 0.917508691833397 4.267038967934363 21571.0 46.28960038568674 0.0 - - - - - - - 320.0 43 16 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 479 61 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37315.[MT7]-IQSERPESR.3y8_2.heavy 415.894 / 494.744 19168.0 15.949899673461914 43 13 10 10 10 2.1438733407183106 46.64454662535928 0.0 3 0.917508691833397 4.267038967934363 19168.0 121.45121890183462 0.0 - - - - - - - 222.9090909090909 38 22 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 481 62 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542828.[MT7]-LLGELILDR.2y8_1.heavy 593.37 / 928.546 9935.0 43.96860122680664 50 20 10 10 10 12.647899060959443 7.90645146028025 0.0 3 0.9908626078121165 12.90089938809692 9935.0 102.2327165382677 0.0 - - - - - - - 172.25 19 12 CAB39L calcium binding protein 39-like 483 62 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542828.[MT7]-LLGELILDR.2b4_1.heavy 593.37 / 557.341 3226.0 43.96860122680664 50 20 10 10 10 12.647899060959443 7.90645146028025 0.0 3 0.9908626078121165 12.90089938809692 3226.0 7.635700258397932 0.0 - - - - - - - 246.88235294117646 6 17 CAB39L calcium binding protein 39-like 485 62 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542828.[MT7]-LLGELILDR.2b5_1.heavy 593.37 / 670.426 2000.0 43.96860122680664 50 20 10 10 10 12.647899060959443 7.90645146028025 0.0 3 0.9908626078121165 12.90089938809692 2000.0 2.153316106804479 2.0 - - - - - - - 201.9375 4 16 CAB39L calcium binding protein 39-like 487 62 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542828.[MT7]-LLGELILDR.2y7_1.heavy 593.37 / 815.462 6451.0 43.96860122680664 50 20 10 10 10 12.647899060959443 7.90645146028025 0.0 3 0.9908626078121165 12.90089938809692 6451.0 59.70837072099883 0.0 - - - - - - - 223.53846153846155 12 13 CAB39L calcium binding protein 39-like 489 63 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37505.[MT7]-YC[CAM]PLDLYSGNK[MT7].2y4_1.heavy 809.413 / 549.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 491 63 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37505.[MT7]-YC[CAM]PLDLYSGNK[MT7].2y8_1.heavy 809.413 / 1053.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 493 63 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37505.[MT7]-YC[CAM]PLDLYSGNK[MT7].2y6_1.heavy 809.413 / 825.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 495 63 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37505.[MT7]-YC[CAM]PLDLYSGNK[MT7].2b5_1.heavy 809.413 / 793.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 497 64 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37218.[MT7]-DLGPNSSK[MT7].2y4_1.heavy 553.308 / 579.322 588.0 17.61797523498535 43 17 10 6 10 3.0274734529929135 33.030842896786275 0.034698486328125 3 0.9722576024405152 7.392327471436453 588.0 8.120000000000001 0.0 - - - - - - - 0.0 1 0 CAPN1 calpain 1, (mu/I) large subunit 499 64 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37218.[MT7]-DLGPNSSK[MT7].2y5_1.heavy 553.308 / 676.375 2311.0 17.61797523498535 43 17 10 6 10 3.0274734529929135 33.030842896786275 0.034698486328125 3 0.9722576024405152 7.392327471436453 2311.0 2.5395604395604394 1.0 - - - - - - - 176.8421052631579 4 19 CAPN1 calpain 1, (mu/I) large subunit 501 64 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37218.[MT7]-DLGPNSSK[MT7].2y6_1.heavy 553.308 / 733.396 2689.0 17.61797523498535 43 17 10 6 10 3.0274734529929135 33.030842896786275 0.034698486328125 3 0.9722576024405152 7.392327471436453 2689.0 18.29251700680272 0.0 - - - - - - - 122.0 5 21 CAPN1 calpain 1, (mu/I) large subunit 503 64 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37218.[MT7]-DLGPNSSK[MT7].2y7_1.heavy 553.308 / 846.48 2101.0 17.61797523498535 43 17 10 6 10 3.0274734529929135 33.030842896786275 0.034698486328125 3 0.9722576024405152 7.392327471436453 2101.0 13.423055555555557 1.0 - - - - - - - 196.875 4 16 CAPN1 calpain 1, (mu/I) large subunit 505 65 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23713.[MT7]-IELPTTVK[MT7].2y6_1.heavy 594.876 / 802.516 1378.0 32.50529861450195 44 16 10 10 8 3.093476406718162 32.32609105497882 0.0 4 0.9619468883057966 6.306383596807072 1378.0 7.345221653878943 2.0 - - - - - - - 262.42857142857144 3 14 TGFBR1 transforming growth factor, beta receptor 1 507 65 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23713.[MT7]-IELPTTVK[MT7].2b3_1.heavy 594.876 / 500.32 4685.0 32.50529861450195 44 16 10 10 8 3.093476406718162 32.32609105497882 0.0 4 0.9619468883057966 6.306383596807072 4685.0 12.9226714698321 0.0 - - - - - - - 661.4 9 10 TGFBR1 transforming growth factor, beta receptor 1 509 65 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23713.[MT7]-IELPTTVK[MT7].2y4_1.heavy 594.876 / 592.379 N/A 32.50529861450195 44 16 10 10 8 3.093476406718162 32.32609105497882 0.0 4 0.9619468883057966 6.306383596807072 367.0 0.14952380952380956 33.0 - - - - - - - 275.625 3 16 TGFBR1 transforming growth factor, beta receptor 1 511 65 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23713.[MT7]-IELPTTVK[MT7].2y5_1.heavy 594.876 / 689.431 6523.0 32.50529861450195 44 16 10 10 8 3.093476406718162 32.32609105497882 0.0 4 0.9619468883057966 6.306383596807072 6523.0 26.77554328099108 0.0 - - - - - - - 265.44444444444446 13 9 TGFBR1 transforming growth factor, beta receptor 1 513 66 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543156.[MT7]-GISDVTDRK[MT7].3y7_1.heavy 426.913 / 964.518 N/A 20.93079948425293 42 12 10 10 10 1.591743284993604 35.36377729835669 0.0 3 0.8875057167641356 3.6445101990403446 0.0 -0.0 0.0 - - - - - - - 0.0 0 0 SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 515 66 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543156.[MT7]-GISDVTDRK[MT7].3b4_1.heavy 426.913 / 517.274 49241.0 20.93079948425293 42 12 10 10 10 1.591743284993604 35.36377729835669 0.0 3 0.8875057167641356 3.6445101990403446 49241.0 78.77496840818921 0.0 - - - - - - - 281.2 98 10 SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 517 66 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543156.[MT7]-GISDVTDRK[MT7].3b5_1.heavy 426.913 / 616.342 5109.0 20.93079948425293 42 12 10 10 10 1.591743284993604 35.36377729835669 0.0 3 0.8875057167641356 3.6445101990403446 5109.0 34.520270270270274 0.0 - - - - - - - 157.25 10 16 SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 519 66 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543156.[MT7]-GISDVTDRK[MT7].3y5_2.heavy 426.913 / 381.733 66495.0 20.93079948425293 42 12 10 10 10 1.591743284993604 35.36377729835669 0.0 3 0.8875057167641356 3.6445101990403446 66495.0 120.76345812306616 0.0 - - - - - - - 651.4 132 10 SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 521 67 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43101.[MT7]-TIDK[MT7]K[MT7].2b3_1.heavy 518.84 / 474.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1033;TAF7 KIAA1033;TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 523 67 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43101.[MT7]-TIDK[MT7]K[MT7].2y4_1.heavy 518.84 / 791.523 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1033;TAF7 KIAA1033;TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 525 67 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43101.[MT7]-TIDK[MT7]K[MT7].2y3_1.heavy 518.84 / 678.439 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1033;TAF7 KIAA1033;TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 527 68 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23715.[MT7]-ISETAQQK[MT7].2y4_1.heavy 596.842 / 618.369 1329.0 17.774550437927246 44 18 10 6 10 6.142157817804179 16.280923246571675 0.034999847412109375 3 0.9824165974581373 9.293354085251524 1329.0 20.593513513513514 0.0 - - - - - - - 126.5 2 14 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 529 68 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23715.[MT7]-ISETAQQK[MT7].2y5_1.heavy 596.842 / 719.417 2493.0 17.774550437927246 44 18 10 6 10 6.142157817804179 16.280923246571675 0.034999847412109375 3 0.9824165974581373 9.293354085251524 2493.0 22.45945945945946 0.0 - - - - - - - 97.76923076923077 4 13 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 531 68 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23715.[MT7]-ISETAQQK[MT7].2y3_1.heavy 596.842 / 547.332 1219.0 17.774550437927246 44 18 10 6 10 6.142157817804179 16.280923246571675 0.034999847412109375 3 0.9824165974581373 9.293354085251524 1219.0 13.054285946596416 0.0 - - - - - - - 187.91304347826087 2 23 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 533 68 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23715.[MT7]-ISETAQQK[MT7].2y7_1.heavy 596.842 / 935.491 4044.0 17.774550437927246 44 18 10 6 10 6.142157817804179 16.280923246571675 0.034999847412109375 3 0.9824165974581373 9.293354085251524 4044.0 43.76281341582547 0.0 - - - - - - - 84.73333333333333 8 15 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 535 69 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43102.[MT7]-DNAVMSTR.2y5_1.heavy 519.262 / 593.308 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 537 69 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43102.[MT7]-DNAVMSTR.2y6_1.heavy 519.262 / 664.345 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 539 69 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43102.[MT7]-DNAVMSTR.2b5_1.heavy 519.262 / 675.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 541 69 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43102.[MT7]-DNAVMSTR.2y7_1.heavy 519.262 / 778.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 543 70 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 713033.0 18.035932540893555 23 -3 10 6 10 null 0.0 0.034000396728515625 3 0.0 0.0 713033.0 1504.8959043485345 0.0 - - - - - - - 398.0 1426 1 545 70 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 439431.0 18.035932540893555 23 -3 10 6 10 null 0.0 0.034000396728515625 3 0.0 0.0 439431.0 2603.8431899351144 0.0 - - - - - - - 809.5 878 8 547 70 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 418641.0 18.035932540893555 23 -3 10 6 10 null 0.0 0.034000396728515625 3 0.0 0.0 418641.0 1499.0675435870705 0.0 - - - - - - - 352.2 837 5 549 71 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544407.[MT7]-ADQSFTSPPPRDFLLDIAR.4y8_1.heavy 573.304 / 962.531 1235.0 39.968101501464844 43 13 10 10 10 1.7183896690192804 46.25604432266845 0.0 3 0.9042867010456488 3.956852013222963 1235.0 4.399031224266075 0.0 - - - - - - - 217.27272727272728 2 11 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 551 71 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544407.[MT7]-ADQSFTSPPPRDFLLDIAR.4y12_2.heavy 573.304 / 705.399 37732.0 39.968101501464844 43 13 10 10 10 1.7183896690192804 46.25604432266845 0.0 3 0.9042867010456488 3.956852013222963 37732.0 57.67945816718798 0.0 - - - - - - - 334.3333333333333 75 3 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 553 71 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544407.[MT7]-ADQSFTSPPPRDFLLDIAR.4y11_2.heavy 573.304 / 656.872 19522.0 39.968101501464844 43 13 10 10 10 1.7183896690192804 46.25604432266845 0.0 3 0.9042867010456488 3.956852013222963 19522.0 23.644655710491786 0.0 - - - - - - - 366.75 39 4 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 555 71 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544407.[MT7]-ADQSFTSPPPRDFLLDIAR.4b4_1.heavy 573.304 / 546.264 21836.0 39.968101501464844 43 13 10 10 10 1.7183896690192804 46.25604432266845 0.0 3 0.9042867010456488 3.956852013222963 21836.0 9.313703160804534 0.0 - - - - - - - 308.5 43 4 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 557 72 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42372.[MT7]-FFSEK[MT7].2y4_1.heavy 473.268 / 654.358 18670.0 28.87849998474121 50 20 10 10 10 32.198838123212205 3.105702125565512 0.0 2 0.9985312837143097 32.198841448842764 18670.0 28.373965811520733 0.0 - - - - - - - 703.6666666666666 37 9 CAPN1 calpain 1, (mu/I) large subunit 559 72 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42372.[MT7]-FFSEK[MT7].2y3_1.heavy 473.268 / 507.289 8585.0 28.87849998474121 50 20 10 10 10 32.198838123212205 3.105702125565512 0.0 2 0.9985312837143097 32.198841448842764 8585.0 17.983976263796123 0.0 - - - - - - - 647.3846153846154 17 13 CAPN1 calpain 1, (mu/I) large subunit 561 73 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23893.[MT7]-LLQSENYVTK[MT7].3b6_1.heavy 494.952 / 829.454 28173.0 29.7947998046875 47 17 10 10 10 3.2343508349921297 24.45500327674026 0.0 3 0.9781829988965114 8.340115825780643 28173.0 142.80976652126498 0.0 - - - - - - - 218.41666666666666 56 12 CAB39L calcium binding protein 39-like 563 73 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23893.[MT7]-LLQSENYVTK[MT7].3b4_1.heavy 494.952 / 586.368 12074.0 29.7947998046875 47 17 10 10 10 3.2343508349921297 24.45500327674026 0.0 3 0.9781829988965114 8.340115825780643 12074.0 10.176657142857142 0.0 - - - - - - - 1299.5714285714287 24 7 CAB39L calcium binding protein 39-like 565 73 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23893.[MT7]-LLQSENYVTK[MT7].3b5_1.heavy 494.952 / 715.411 14874.0 29.7947998046875 47 17 10 10 10 3.2343508349921297 24.45500327674026 0.0 3 0.9781829988965114 8.340115825780643 14874.0 33.38558263205663 0.0 - - - - - - - 712.2857142857143 29 7 CAB39L calcium binding protein 39-like 567 73 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23893.[MT7]-LLQSENYVTK[MT7].3b3_1.heavy 494.952 / 499.336 26949.0 29.7947998046875 47 17 10 10 10 3.2343508349921297 24.45500327674026 0.0 3 0.9781829988965114 8.340115825780643 26949.0 24.219796063878917 0.0 - - - - - - - 1262.142857142857 53 7 CAB39L calcium binding protein 39-like 569 74 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543674.[MT7]-AQAALQAQQVNR.3y6_1.heavy 481.271 / 715.385 11184.0 21.041500091552734 50 20 10 10 10 6.139247630506699 16.288640891937202 0.0 3 0.9922805433315741 14.037482576415048 11184.0 40.78281879194631 0.0 - - - - - - - 240.63636363636363 22 22 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 571 74 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543674.[MT7]-AQAALQAQQVNR.3b4_1.heavy 481.271 / 486.279 41307.0 21.041500091552734 50 20 10 10 10 6.139247630506699 16.288640891937202 0.0 3 0.9922805433315741 14.037482576415048 41307.0 133.28678696475842 0.0 - - - - - - - 326.1875 82 16 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 573 74 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543674.[MT7]-AQAALQAQQVNR.3b5_1.heavy 481.271 / 599.363 9842.0 21.041500091552734 50 20 10 10 10 6.139247630506699 16.288640891937202 0.0 3 0.9922805433315741 14.037482576415048 9842.0 28.842692058796338 0.0 - - - - - - - 617.8571428571429 19 7 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 575 74 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543674.[MT7]-AQAALQAQQVNR.3y4_1.heavy 481.271 / 516.289 10886.0 21.041500091552734 50 20 10 10 10 6.139247630506699 16.288640891937202 0.0 3 0.9922805433315741 14.037482576415048 10886.0 9.801745687647934 0.0 - - - - - - - 236.08333333333334 21 12 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 577 75 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB541574.[MT7]-LFIGGK[MT7].2y5_1.heavy 461.802 / 665.41 43692.0 31.70609951019287 46 20 10 6 10 76.92444438167063 1.2999768903605855 0.03940010070800781 2 0.9997426185088404 76.92444969141832 43692.0 94.5458592304955 0.0 - - - - - - - 373.6666666666667 87 3 ALDH6A1;UGCG aldehyde dehydrogenase 6 family, member A1;UDP-glucose ceramide glucosyltransferase 579 75 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB541574.[MT7]-LFIGGK[MT7].2b4_1.heavy 461.802 / 575.367 2894.0 31.70609951019287 46 20 10 6 10 76.92444438167063 1.2999768903605855 0.03940010070800781 2 0.9997426185088404 76.92444969141832 2894.0 14.508793565683646 2.0 - - - - - - - 261.4 5 5 ALDH6A1;UGCG aldehyde dehydrogenase 6 family, member A1;UDP-glucose ceramide glucosyltransferase 581 75 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB541574.[MT7]-LFIGGK[MT7].2b5_1.heavy 461.802 / 632.389 N/A 31.70609951019287 46 20 10 6 10 76.92444438167063 1.2999768903605855 0.03940010070800781 2 0.9997426185088404 76.92444969141832 1400.0 2.398286937901499 5.0 - - - - - - - 248.66666666666666 7 3 ALDH6A1;UGCG aldehyde dehydrogenase 6 family, member A1;UDP-glucose ceramide glucosyltransferase 583 76 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23994.[MT7]-DANLTALAAIGPRK[MT7].3y7_1.heavy 567.008 / 856.549 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF4;TAF4B TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa;TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa 585 76 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23994.[MT7]-DANLTALAAIGPRK[MT7].3b6_1.heavy 567.008 / 730.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF4;TAF4B TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa;TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa 587 76 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23994.[MT7]-DANLTALAAIGPRK[MT7].3y6_1.heavy 567.008 / 785.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF4;TAF4B TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa;TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa 589 76 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23994.[MT7]-DANLTALAAIGPRK[MT7].3y4_1.heavy 567.008 / 601.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF4;TAF4B TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa;TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa 591 77 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543965.[MT7]-GRAGTLSPGLGPQGPR.3y6_1.heavy 555.649 / 611.326 21705.0 24.065699577331543 42 16 10 6 10 3.369100564134364 29.68151234918492 0.03619956970214844 3 0.9610673989741336 6.234282470866816 21705.0 97.74839160839161 0.0 - - - - - - - 229.0 43 15 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 593 77 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543965.[MT7]-GRAGTLSPGLGPQGPR.3y8_1.heavy 555.649 / 781.432 9952.0 24.065699577331543 42 16 10 6 10 3.369100564134364 29.68151234918492 0.03619956970214844 3 0.9610673989741336 6.234282470866816 9952.0 43.14853146853147 0.0 - - - - - - - 206.0 19 15 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 595 77 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543965.[MT7]-GRAGTLSPGLGPQGPR.3b7_1.heavy 555.649 / 787.454 9866.0 24.065699577331543 42 16 10 6 10 3.369100564134364 29.68151234918492 0.03619956970214844 3 0.9610673989741336 6.234282470866816 9866.0 71.01984435797665 0.0 - - - - - - - 202.35714285714286 19 14 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 597 77 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543965.[MT7]-GRAGTLSPGLGPQGPR.3y9_1.heavy 555.649 / 878.484 10552.0 24.065699577331543 42 16 10 6 10 3.369100564134364 29.68151234918492 0.03619956970214844 3 0.9610673989741336 6.234282470866816 10552.0 50.075250902199556 0.0 - - - - - - - 234.1818181818182 21 11 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 599 78 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543838.[MT7]-ALSAVSAQAAAAQK[MT7].3b6_1.heavy 525.642 / 673.4 77085.0 26.641199111938477 46 16 10 10 10 2.174509489256707 31.009734925809123 0.0 3 0.9680134242197469 6.881989609981617 77085.0 123.1303892852081 0.0 - - - - - - - 693.5555555555555 154 9 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 601 78 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543838.[MT7]-ALSAVSAQAAAAQK[MT7].3b5_1.heavy 525.642 / 586.368 108907.0 26.641199111938477 46 16 10 10 10 2.174509489256707 31.009734925809123 0.0 3 0.9680134242197469 6.881989609981617 108907.0 114.41862908392056 0.0 - - - - - - - 672.0 217 8 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 603 78 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543838.[MT7]-ALSAVSAQAAAAQK[MT7].3y4_1.heavy 525.642 / 561.348 144284.0 26.641199111938477 46 16 10 10 10 2.174509489256707 31.009734925809123 0.0 3 0.9680134242197469 6.881989609981617 144284.0 339.86095807732045 0.0 - - - - - - - 646.9230769230769 288 13 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 605 78 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543838.[MT7]-ALSAVSAQAAAAQK[MT7].3y5_1.heavy 525.642 / 632.385 121740.0 26.641199111938477 46 16 10 10 10 2.174509489256707 31.009734925809123 0.0 3 0.9680134242197469 6.881989609981617 121740.0 166.3758486629461 0.0 - - - - - - - 238.5 243 8 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 607 79 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23566.[MT7]-SLQAMK[MT7].2y4_1.heavy 483.288 / 621.351 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 609 79 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23566.[MT7]-SLQAMK[MT7].2y5_1.heavy 483.288 / 734.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 611 79 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23566.[MT7]-SLQAMK[MT7].2b4_1.heavy 483.288 / 544.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 613 79 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23566.[MT7]-SLQAMK[MT7].2y3_1.heavy 483.288 / 493.293 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 615 80 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23564.[MT7]-ILEIGK[MT7].2b3_1.heavy 480.82 / 500.32 5335.0 31.725799560546875 33 17 0 10 6 3.1119885693504714 32.133794122795194 0.0 5 0.9774934434050474 8.210884080499524 5335.0 5.5586052446773895 0.0 - - - - - - - 327.57142857142856 10 14 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 617 80 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23564.[MT7]-ILEIGK[MT7].2y4_1.heavy 480.82 / 590.363 3931.0 31.725799560546875 33 17 0 10 6 3.1119885693504714 32.133794122795194 0.0 5 0.9774934434050474 8.210884080499524 3931.0 2.322526712759271 3.0 - - - - - - - 748.75 9 8 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 619 80 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23564.[MT7]-ILEIGK[MT7].2y5_1.heavy 480.82 / 703.447 7113.0 31.725799560546875 33 17 0 10 6 3.1119885693504714 32.133794122795194 0.0 5 0.9774934434050474 8.210884080499524 7113.0 11.492447050116361 2.0 - - - - - - - 790.2222222222222 51 9 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 621 80 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23564.[MT7]-ILEIGK[MT7].2y3_1.heavy 480.82 / 461.32 6364.0 31.725799560546875 33 17 0 10 6 3.1119885693504714 32.133794122795194 0.0 5 0.9774934434050474 8.210884080499524 6364.0 6.40794953432156 4.0 - - - - - - - 1144.2222222222222 14 9 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 623 81 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 1779030.0 37.10449981689453 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1779030.0 3282.1039782867338 0.0 - - - - - - - 224.0 3558 10 625 81 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 881296.0 37.10449981689453 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 881296.0 271.06263994786576 0.0 - - - - - - - 137.14285714285714 1762 7 627 81 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1200660.0 37.10449981689453 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1200660.0 2520.1264674681756 0.0 - - - - - - - 320.0 2401 7 629 82 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23644.[MT7]-LYQQIK[MT7].2b3_1.heavy 540.836 / 549.315 4530.0 26.286699295043945 42 20 4 10 8 3.00932687698378 25.256066865411 0.0 4 0.9932783343905359 15.04458985699631 4530.0 7.373201886635869 0.0 - - - - - - - 777.125 9 8 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 631 82 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23644.[MT7]-LYQQIK[MT7].2y5_1.heavy 540.836 / 823.479 15989.0 26.286699295043945 42 20 4 10 8 3.00932687698378 25.256066865411 0.0 4 0.9932783343905359 15.04458985699631 15989.0 135.2182854608431 0.0 - - - - - - - 219.13333333333333 31 15 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 633 82 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23644.[MT7]-LYQQIK[MT7].2b4_1.heavy 540.836 / 677.374 5418.0 26.286699295043945 42 20 4 10 8 3.00932687698378 25.256066865411 0.0 4 0.9932783343905359 15.04458985699631 5418.0 16.114630225080386 1.0 - - - - - - - 325.55555555555554 13 9 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 635 82 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23644.[MT7]-LYQQIK[MT7].2y3_1.heavy 540.836 / 532.357 N/A 26.286699295043945 42 20 4 10 8 3.00932687698378 25.256066865411 0.0 4 0.9932783343905359 15.04458985699631 14123.0 7.257062820890855 1.0 - - - - - - - 1332.0 63 1 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 637 83 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543832.[MT7]-WNTTLYEGTWR.3y6_1.heavy 524.264 / 811.373 22239.0 36.84320068359375 48 18 10 10 10 6.699302045032641 14.926928108003043 0.0 3 0.9893167051726911 11.929503310038902 22239.0 44.71938303341902 0.0 - - - - - - - 201.47058823529412 44 17 CAPN1 calpain 1, (mu/I) large subunit 639 83 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543832.[MT7]-WNTTLYEGTWR.3b4_1.heavy 524.264 / 647.327 13919.0 36.84320068359375 48 18 10 10 10 6.699302045032641 14.926928108003043 0.0 3 0.9893167051726911 11.929503310038902 13919.0 23.623840681951794 0.0 - - - - - - - 660.8 27 10 CAPN1 calpain 1, (mu/I) large subunit 641 83 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543832.[MT7]-WNTTLYEGTWR.3y4_1.heavy 524.264 / 519.267 41290.0 36.84320068359375 48 18 10 10 10 6.699302045032641 14.926928108003043 0.0 3 0.9893167051726911 11.929503310038902 41290.0 31.783201792848097 0.0 - - - - - - - 311.0 82 2 CAPN1 calpain 1, (mu/I) large subunit 643 83 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543832.[MT7]-WNTTLYEGTWR.3y5_1.heavy 524.264 / 648.31 30404.0 36.84320068359375 48 18 10 10 10 6.699302045032641 14.926928108003043 0.0 3 0.9893167051726911 11.929503310038902 30404.0 42.1838514620877 0.0 - - - - - - - 1055.4285714285713 60 7 CAPN1 calpain 1, (mu/I) large subunit 645 84 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43011.[MT7]-LPLQK[MT7].2y4_1.heavy 443.802 / 629.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA6;NPL ubiquitin-like modifier activating enzyme 6;N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase) 647 84 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43011.[MT7]-LPLQK[MT7].2y3_1.heavy 443.802 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA6;NPL ubiquitin-like modifier activating enzyme 6;N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase) 649 85 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43399.[MT7]-AQAALQAQQVNR.2y8_1.heavy 721.403 / 956.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 651 85 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43399.[MT7]-AQAALQAQQVNR.2y9_1.heavy 721.403 / 1027.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 653 85 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43399.[MT7]-AQAALQAQQVNR.2y11_1.heavy 721.403 / 1226.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 655 85 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43399.[MT7]-AQAALQAQQVNR.2y7_1.heavy 721.403 / 843.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 657 86 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23784.[MT7]-GAILTTMLATR.2y8_1.heavy 646.38 / 906.508 3484.0 38.87295055389404 46 20 10 6 10 7.876515889225125 12.69596880224637 0.039402008056640625 3 0.9928586605710807 14.595323963360658 3484.0 27.531988978956196 0.0 - - - - - - - 158.25 6 12 CAMK2A;CAMK2B;CAMK2D calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta 659 86 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23784.[MT7]-GAILTTMLATR.2y5_1.heavy 646.38 / 591.328 1029.0 38.87295055389404 46 20 10 6 10 7.876515889225125 12.69596880224637 0.039402008056640625 3 0.9928586605710807 14.595323963360658 1029.0 2.8418231046931406 3.0 - - - - - - - 242.5625 2 16 CAMK2A;CAMK2B;CAMK2D calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta 661 86 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23784.[MT7]-GAILTTMLATR.2y6_1.heavy 646.38 / 692.376 871.0 38.87295055389404 46 20 10 6 10 7.876515889225125 12.69596880224637 0.039402008056640625 3 0.9928586605710807 14.595323963360658 871.0 4.119289896053208 6.0 - - - - - - - 186.57142857142858 3 14 CAMK2A;CAMK2B;CAMK2D calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta 663 86 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23784.[MT7]-GAILTTMLATR.2y7_1.heavy 646.38 / 793.424 2534.0 38.87295055389404 46 20 10 6 10 7.876515889225125 12.69596880224637 0.039402008056640625 3 0.9928586605710807 14.595323963360658 2534.0 14.468707664884136 1.0 - - - - - - - 190.88235294117646 5 17 CAMK2A;CAMK2B;CAMK2D calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta 665 87 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43012.[MT7]-LQDLVR.2b3_1.heavy 444.275 / 501.279 48697.0 30.652024269104004 40 14 10 6 10 2.848941082350975 35.10076098782604 0.034900665283203125 3 0.949981925071368 5.495052380253874 48697.0 60.04311421711071 0.0 - - - - - - - 746.4285714285714 97 7 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 667 87 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43012.[MT7]-LQDLVR.2y5_1.heavy 444.275 / 630.357 36849.0 30.652024269104004 40 14 10 6 10 2.848941082350975 35.10076098782604 0.034900665283203125 3 0.949981925071368 5.495052380253874 36849.0 71.51621922268907 0.0 - - - - - - - 321.22222222222223 73 9 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 669 87 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43012.[MT7]-LQDLVR.2b4_1.heavy 444.275 / 614.363 25095.0 30.652024269104004 40 14 10 6 10 2.848941082350975 35.10076098782604 0.034900665283203125 3 0.949981925071368 5.495052380253874 25095.0 57.369053759974214 0.0 - - - - - - - 618.25 50 8 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 671 87 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43012.[MT7]-LQDLVR.2b5_1.heavy 444.275 / 713.431 8023.0 30.652024269104004 40 14 10 6 10 2.848941082350975 35.10076098782604 0.034900665283203125 3 0.949981925071368 5.495052380253874 8023.0 49.11661395467278 0.0 - - - - - - - 199.06666666666666 16 15 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 673 88 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543930.[MT7]-YLEEFPEERK[MT7].3b4_1.heavy 543.291 / 679.342 11040.0 30.204100131988525 31 8 10 3 10 0.5152441870773066 98.13385316239533 0.07399940490722656 3 0.766273757352614 2.501278440608074 11040.0 12.571926930126336 0.0 - - - - - - - 262.6666666666667 22 6 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 675 88 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543930.[MT7]-YLEEFPEERK[MT7].3b3_1.heavy 543.291 / 550.299 4644.0 30.204100131988525 31 8 10 3 10 0.5152441870773066 98.13385316239533 0.07399940490722656 3 0.766273757352614 2.501278440608074 4644.0 10.178630136986301 1.0 - - - - - - - 688.5714285714286 9 7 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 677 88 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543930.[MT7]-YLEEFPEERK[MT7].3y9_2.heavy 543.291 / 660.849 15947.0 30.204100131988525 31 8 10 3 10 0.5152441870773066 98.13385316239533 0.07399940490722656 3 0.766273757352614 2.501278440608074 15947.0 28.504464831509345 0.0 - - - - - - - 280.4 31 10 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 679 88 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543930.[MT7]-YLEEFPEERK[MT7].3y5_1.heavy 543.291 / 802.454 6922.0 30.204100131988525 31 8 10 3 10 0.5152441870773066 98.13385316239533 0.07399940490722656 3 0.766273757352614 2.501278440608074 6922.0 22.85300324403451 0.0 - - - - - - - 262.84615384615387 13 13 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 681 89 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23848.[MT7]-SRQEDPEQLR.2b3_1.heavy 701.364 / 516.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 683 89 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23848.[MT7]-SRQEDPEQLR.2y5_1.heavy 701.364 / 642.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 685 89 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23848.[MT7]-SRQEDPEQLR.2b4_1.heavy 701.364 / 645.344 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 687 89 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23848.[MT7]-SRQEDPEQLR.2b5_1.heavy 701.364 / 760.371 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 689 90 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37254.[MT7]-QEDPEQLR.2b3_1.heavy 579.797 / 517.237 8289.0 20.24394941329956 38 12 10 6 10 2.851456115560573 35.06980151449422 0.03980064392089844 3 0.8927612909115398 3.7344516517152955 8289.0 49.53406088667073 0.0 - - - - - - - 232.16666666666666 16 12 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 691 90 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37254.[MT7]-QEDPEQLR.2y5_1.heavy 579.797 / 642.357 8707.0 20.24394941329956 38 12 10 6 10 2.851456115560573 35.06980151449422 0.03980064392089844 3 0.8927612909115398 3.7344516517152955 8707.0 96.78673746170529 0.0 - - - - - - - 185.77777777777777 17 9 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 693 90 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37254.[MT7]-QEDPEQLR.2b5_1.heavy 579.797 / 743.333 557.0 20.24394941329956 38 12 10 6 10 2.851456115560573 35.06980151449422 0.03980064392089844 3 0.8927612909115398 3.7344516517152955 557.0 3.886978417266187 0.0 - - - - - - - 0.0 1 0 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 695 90 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37254.[MT7]-QEDPEQLR.2y7_1.heavy 579.797 / 886.427 836.0 20.24394941329956 38 12 10 6 10 2.851456115560573 35.06980151449422 0.03980064392089844 3 0.8927612909115398 3.7344516517152955 836.0 7.32 0.0 - - - - - - - 0.0 1 0 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 697 91 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543149.[MT7]-GHAYSVTGAK[MT7].3y3_1.heavy 426.906 / 419.273 17305.0 18.32062578201294 44 18 10 6 10 5.688272166359233 17.580030820502177 0.03429985046386719 3 0.989587814095213 12.084087518335707 17305.0 28.09179593620275 0.0 - - - - - - - 665.9090909090909 34 11 CAPN1 calpain 1, (mu/I) large subunit 699 91 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543149.[MT7]-GHAYSVTGAK[MT7].3b4_1.heavy 426.906 / 573.29 2495.0 18.32062578201294 44 18 10 6 10 5.688272166359233 17.580030820502177 0.03429985046386719 3 0.989587814095213 12.084087518335707 2495.0 6.877112387202625 0.0 - - - - - - - 181.76190476190476 4 21 CAPN1 calpain 1, (mu/I) large subunit 701 91 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543149.[MT7]-GHAYSVTGAK[MT7].3b5_1.heavy 426.906 / 660.322 1752.0 18.32062578201294 44 18 10 6 10 5.688272166359233 17.580030820502177 0.03429985046386719 3 0.989587814095213 12.084087518335707 1752.0 32.52769811320755 0.0 - - - - - - - 143.47058823529412 3 17 CAPN1 calpain 1, (mu/I) large subunit 703 91 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543149.[MT7]-GHAYSVTGAK[MT7].3y4_1.heavy 426.906 / 520.321 14544.0 18.32062578201294 44 18 10 6 10 5.688272166359233 17.580030820502177 0.03429985046386719 3 0.989587814095213 12.084087518335707 14544.0 22.842185262612624 0.0 - - - - - - - 772.4444444444445 29 9 CAPN1 calpain 1, (mu/I) large subunit 705 92 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23987.[MT7]-QVNYRGQVVSLIR.3y6_1.heavy 559.329 / 686.456 5792.0 31.19526735941569 39 13 10 6 10 0.9886798880473247 60.07246989883714 0.036800384521484375 3 0.9020106300856606 3.9098585573698905 5792.0 7.283672331232893 0.0 - - - - - - - 311.4 11 15 CAPN1 calpain 1, (mu/I) large subunit 707 92 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23987.[MT7]-QVNYRGQVVSLIR.3y8_1.heavy 559.329 / 871.536 3643.0 31.19526735941569 39 13 10 6 10 0.9886798880473247 60.07246989883714 0.036800384521484375 3 0.9020106300856606 3.9098585573698905 3643.0 10.714705882352941 0.0 - - - - - - - 215.53846153846155 7 13 CAPN1 calpain 1, (mu/I) large subunit 709 92 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23987.[MT7]-QVNYRGQVVSLIR.3y12_2.heavy 559.329 / 702.409 N/A 31.19526735941569 39 13 10 6 10 0.9886798880473247 60.07246989883714 0.036800384521484375 3 0.9020106300856606 3.9098585573698905 12798.0 25.034498761139908 1.0 - - - - - - - 747.4285714285714 27 7 CAPN1 calpain 1, (mu/I) large subunit 711 92 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23987.[MT7]-QVNYRGQVVSLIR.3y5_1.heavy 559.329 / 587.388 8034.0 31.19526735941569 39 13 10 6 10 0.9886798880473247 60.07246989883714 0.036800384521484375 3 0.9020106300856606 3.9098585573698905 8034.0 15.287524946084883 0.0 - - - - - - - 760.7142857142857 16 7 CAPN1 calpain 1, (mu/I) large subunit 713 93 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24059.[MT7]-YGSIAGLAELGHDVIK[MT7].3b6_1.heavy 644.366 / 693.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 715 93 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24059.[MT7]-YGSIAGLAELGHDVIK[MT7].3b5_1.heavy 644.366 / 636.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 717 93 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24059.[MT7]-YGSIAGLAELGHDVIK[MT7].3y4_1.heavy 644.366 / 618.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 719 93 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24059.[MT7]-YGSIAGLAELGHDVIK[MT7].3b7_1.heavy 644.366 / 806.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 721 94 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42592.[MT7]-GISDVTDRK[MT7].2y4_1.heavy 639.866 / 663.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 723 94 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42592.[MT7]-GISDVTDRK[MT7].2y8_1.heavy 639.866 / 1077.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 725 94 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42592.[MT7]-GISDVTDRK[MT7].2y5_1.heavy 639.866 / 762.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 727 94 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42592.[MT7]-GISDVTDRK[MT7].2b4_1.heavy 639.866 / 517.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 729 95 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23556.[MT7]-QLC[CAM]LK[MT7].2b3_1.heavy 475.291 / 546.283 2065.0 25.770999908447266 38 8 10 10 10 1.0564447992906263 57.18222176463824 0.0 3 0.7940753981733103 2.6715118420816917 2065.0 4.306629077274393 1.0 - - - - - - - 748.2222222222222 4 9 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 731 95 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23556.[MT7]-QLC[CAM]LK[MT7].2y4_1.heavy 475.291 / 677.414 8080.0 25.770999908447266 38 8 10 10 10 1.0564447992906263 57.18222176463824 0.0 3 0.7940753981733103 2.6715118420816917 8080.0 13.296044568245126 0.0 - - - - - - - 254.33333333333334 16 6 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 733 95 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23556.[MT7]-QLC[CAM]LK[MT7].2y3_1.heavy 475.291 / 564.33 4220.0 25.770999908447266 38 8 10 10 10 1.0564447992906263 57.18222176463824 0.0 3 0.7940753981733103 2.6715118420816917 4220.0 12.218090862579523 0.0 - - - - - - - 334.54545454545456 8 11 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 735 96 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37237.[MT7]-ANVC[CAM]C[CAM]VK[MT7].2y4_1.heavy 569.801 / 710.345 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 737 96 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37237.[MT7]-ANVC[CAM]C[CAM]VK[MT7].2y5_1.heavy 569.801 / 809.413 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 739 96 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37237.[MT7]-ANVC[CAM]C[CAM]VK[MT7].2y3_1.heavy 569.801 / 550.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 741 96 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37237.[MT7]-ANVC[CAM]C[CAM]VK[MT7].2y6_1.heavy 569.801 / 923.456 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 743 97 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23775.[MT7]-IILFSNQFR.3b4_1.heavy 427.919 / 631.43 5544.0 40.801700592041016 46 16 10 10 10 2.9633056402658258 33.74609714272653 0.0 3 0.965594346979394 6.63428853183751 5544.0 16.632 0.0 - - - - - - - 171.42857142857142 11 7 CAB39L calcium binding protein 39-like 745 97 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23775.[MT7]-IILFSNQFR.3y4_1.heavy 427.919 / 564.289 15133.0 40.801700592041016 46 16 10 10 10 2.9633056402658258 33.74609714272653 0.0 3 0.965594346979394 6.63428853183751 15133.0 50.00692790500425 0.0 - - - - - - - 225.0 30 11 CAB39L calcium binding protein 39-like 747 97 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23775.[MT7]-IILFSNQFR.3b3_1.heavy 427.919 / 484.362 23075.0 40.801700592041016 46 16 10 10 10 2.9633056402658258 33.74609714272653 0.0 3 0.965594346979394 6.63428853183751 23075.0 79.0135792880259 0.0 - - - - - - - 243.75 46 16 CAB39L calcium binding protein 39-like 749 97 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23775.[MT7]-IILFSNQFR.3y5_1.heavy 427.919 / 651.321 21876.0 40.801700592041016 46 16 10 10 10 2.9633056402658258 33.74609714272653 0.0 3 0.965594346979394 6.63428853183751 21876.0 35.00156002676942 0.0 - - - - - - - 170.45454545454547 43 11 CAB39L calcium binding protein 39-like 751 98 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542499.[MT7]-VENLALK[MT7].2y5_1.heavy 537.842 / 702.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 753 98 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542499.[MT7]-VENLALK[MT7].2b4_1.heavy 537.842 / 600.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 755 98 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542499.[MT7]-VENLALK[MT7].2y6_1.heavy 537.842 / 831.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 757 98 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542499.[MT7]-VENLALK[MT7].2b5_1.heavy 537.842 / 671.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 759 99 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23771.[MT7]-LPPEYASTVR.2y8_1.heavy 638.854 / 922.463 1939.0 27.847599506378174 33 7 10 6 10 0.47135080297092297 96.86321801644965 0.03479957580566406 3 0.7376558311964515 2.3547202010788686 1939.0 8.724118567808686 0.0 - - - - - - - 664.125 3 8 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 761 99 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23771.[MT7]-LPPEYASTVR.2y9_1.heavy 638.854 / 1019.52 7589.0 27.847599506378174 33 7 10 6 10 0.47135080297092297 96.86321801644965 0.03479957580566406 3 0.7376558311964515 2.3547202010788686 7589.0 23.82301358678821 0.0 - - - - - - - 274.125 15 8 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 763 99 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23771.[MT7]-LPPEYASTVR.2y9_2.heavy 638.854 / 510.262 9865.0 27.847599506378174 33 7 10 6 10 0.47135080297092297 96.86321801644965 0.03479957580566406 3 0.7376558311964515 2.3547202010788686 9865.0 14.176370370370371 1.0 - - - - - - - 337.5 19 6 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 765 99 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23771.[MT7]-LPPEYASTVR.2y6_1.heavy 638.854 / 696.367 506.0 27.847599506378174 33 7 10 6 10 0.47135080297092297 96.86321801644965 0.03479957580566406 3 0.7376558311964515 2.3547202010788686 506.0 1.8599999999999999 8.0 - - - - - - - 227.0 2 13 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 767 100 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43025.[MT7]-VAMTAK[MT7].2b3_1.heavy 454.777 / 446.255 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 769 100 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43025.[MT7]-VAMTAK[MT7].2y4_1.heavy 454.777 / 594.34 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 771 100 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43025.[MT7]-VAMTAK[MT7].2y5_1.heavy 454.777 / 665.377 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 773 100 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43025.[MT7]-VAMTAK[MT7].2y3_1.heavy 454.777 / 463.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 775 101 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37521.[MT7]-TEGNLEQANEELR.2y8_1.heavy 823.909 / 988.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510450;CACNA1C;CACNA1D voltage-dependent L-type calcium channel subunit alpha-1C-like;calcium channel, voltage-dependent, L type, alpha 1C subunit;calcium channel, voltage-dependent, L type, alpha 1D subunit 777 101 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37521.[MT7]-TEGNLEQANEELR.2b6_1.heavy 823.909 / 788.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510450;CACNA1C;CACNA1D voltage-dependent L-type calcium channel subunit alpha-1C-like;calcium channel, voltage-dependent, L type, alpha 1C subunit;calcium channel, voltage-dependent, L type, alpha 1D subunit 779 101 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37521.[MT7]-TEGNLEQANEELR.2b5_1.heavy 823.909 / 659.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510450;CACNA1C;CACNA1D voltage-dependent L-type calcium channel subunit alpha-1C-like;calcium channel, voltage-dependent, L type, alpha 1C subunit;calcium channel, voltage-dependent, L type, alpha 1D subunit 781 101 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37521.[MT7]-TEGNLEQANEELR.2y7_1.heavy 823.909 / 859.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510450;CACNA1C;CACNA1D voltage-dependent L-type calcium channel subunit alpha-1C-like;calcium channel, voltage-dependent, L type, alpha 1C subunit;calcium channel, voltage-dependent, L type, alpha 1D subunit 783 102 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37627.[MT7]-DLEQDEAFIPVGESLK[MT7].2b3_1.heavy 1039.55 / 502.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - BMPR1A bone morphogenetic protein receptor, type IA 785 102 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37627.[MT7]-DLEQDEAFIPVGESLK[MT7].2y3_1.heavy 1039.55 / 491.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - BMPR1A bone morphogenetic protein receptor, type IA 787 102 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37627.[MT7]-DLEQDEAFIPVGESLK[MT7].2b6_1.heavy 1039.55 / 874.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - BMPR1A bone morphogenetic protein receptor, type IA 789 102 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37627.[MT7]-DLEQDEAFIPVGESLK[MT7].2b7_1.heavy 1039.55 / 945.428 N/A N/A - - - - - - - - - 0.0 - - - - - - - BMPR1A bone morphogenetic protein receptor, type IA 791 103 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23974.[MT7]-LFSANDVENIFSR.2y5_1.heavy 828.429 / 636.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOS1 son of sevenless homolog 1 (Drosophila) 793 103 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23974.[MT7]-LFSANDVENIFSR.2b6_1.heavy 828.429 / 792.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOS1 son of sevenless homolog 1 (Drosophila) 795 103 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23974.[MT7]-LFSANDVENIFSR.2b7_1.heavy 828.429 / 891.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOS1 son of sevenless homolog 1 (Drosophila) 797 103 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23974.[MT7]-LFSANDVENIFSR.2y7_1.heavy 828.429 / 864.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOS1 son of sevenless homolog 1 (Drosophila) 799 104 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43418.[MT7]-LLQSENYVTK[MT7].2b4_1.heavy 741.924 / 586.368 911.0 29.81939951578776 39 15 10 6 8 1.7020615795927936 39.94021946987884 0.036899566650390625 4 0.9543665289822946 5.755129416834196 911.0 2.002197802197802 1.0 - - - - - - - 200.2 2 15 CAB39L calcium binding protein 39-like 801 104 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43418.[MT7]-LLQSENYVTK[MT7].2b6_1.heavy 741.924 / 829.454 638.0 29.81939951578776 39 15 10 6 8 1.7020615795927936 39.94021946987884 0.036899566650390625 4 0.9543665289822946 5.755129416834196 638.0 3.154945054945055 1.0 - - - - - - - 0.0 1 0 CAB39L calcium binding protein 39-like 803 104 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43418.[MT7]-LLQSENYVTK[MT7].2b7_1.heavy 741.924 / 992.517 1184.0 29.81939951578776 39 15 10 6 8 1.7020615795927936 39.94021946987884 0.036899566650390625 4 0.9543665289822946 5.755129416834196 1184.0 14.377142857142857 0.0 - - - - - - - 193.375 2 8 CAB39L calcium binding protein 39-like 805 104 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43418.[MT7]-LLQSENYVTK[MT7].2y7_1.heavy 741.924 / 984.512 N/A 29.81939951578776 39 15 10 6 8 1.7020615795927936 39.94021946987884 0.036899566650390625 4 0.9543665289822946 5.755129416834196 1275.0 13.996978021978022 1.0 - - - - - - - 169.0 3 7 CAB39L calcium binding protein 39-like 807 105 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543653.[MT7]-FYFENLLAK[MT7].3b6_1.heavy 478.274 / 958.479 3388.0 43.48320007324219 47 17 10 10 10 2.884663261522444 27.718888544965324 0.0 3 0.9727625528697311 7.460852495244246 3388.0 37.39127215022481 0.0 - - - - - - - 132.66666666666666 6 6 CAMK2B calcium/calmodulin-dependent protein kinase II beta 809 105 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543653.[MT7]-FYFENLLAK[MT7].3b4_1.heavy 478.274 / 731.352 33943.0 43.48320007324219 47 17 10 10 10 2.884663261522444 27.718888544965324 0.0 3 0.9727625528697311 7.460852495244246 33943.0 373.88342105263155 0.0 - - - - - - - 168.9090909090909 67 11 CAMK2B calcium/calmodulin-dependent protein kinase II beta 811 105 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543653.[MT7]-FYFENLLAK[MT7].3b5_1.heavy 478.274 / 845.395 39191.0 43.48320007324219 47 17 10 10 10 2.884663261522444 27.718888544965324 0.0 3 0.9727625528697311 7.460852495244246 39191.0 224.83666560400567 0.0 - - - - - - - 211.27272727272728 78 11 CAMK2B calcium/calmodulin-dependent protein kinase II beta 813 105 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543653.[MT7]-FYFENLLAK[MT7].3b3_1.heavy 478.274 / 602.31 40320.0 43.48320007324219 47 17 10 10 10 2.884663261522444 27.718888544965324 0.0 3 0.9727625528697311 7.460852495244246 40320.0 179.173297282178 0.0 - - - - - - - 189.64285714285714 80 14 CAMK2B calcium/calmodulin-dependent protein kinase II beta 815 106 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23836.[MT7]-ARSEQFINLR.3b4_1.heavy 459.929 / 588.322 6119.0 28.524799346923828 46 16 10 10 10 3.287939593444159 30.41418406815945 0.0 3 0.9657009672943991 6.644651837101136 6119.0 7.685118048286572 1.0 - - - - - - - 1240.5 19 10 CAPN1 calpain 1, (mu/I) large subunit 817 106 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23836.[MT7]-ARSEQFINLR.3b5_1.heavy 459.929 / 716.381 7795.0 28.524799346923828 46 16 10 10 10 3.287939593444159 30.41418406815945 0.0 3 0.9657009672943991 6.644651837101136 7795.0 59.43895255863539 0.0 - - - - - - - 181.61111111111111 15 18 CAPN1 calpain 1, (mu/I) large subunit 819 106 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23836.[MT7]-ARSEQFINLR.3y4_1.heavy 459.929 / 515.33 20870.0 28.524799346923828 46 16 10 10 10 3.287939593444159 30.41418406815945 0.0 3 0.9657009672943991 6.644651837101136 20870.0 20.052173796756236 0.0 - - - - - - - 1201.4444444444443 41 9 CAPN1 calpain 1, (mu/I) large subunit 821 106 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23836.[MT7]-ARSEQFINLR.3y5_1.heavy 459.929 / 662.398 9974.0 28.524799346923828 46 16 10 10 10 3.287939593444159 30.41418406815945 0.0 3 0.9657009672943991 6.644651837101136 9974.0 7.544965168372865 0.0 - - - - - - - 701.0 19 11 CAPN1 calpain 1, (mu/I) large subunit 823 107 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37381.[MT7]-LTMEEEEAK[MT7].2y8_1.heavy 684.352 / 1110.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 825 107 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37381.[MT7]-LTMEEEEAK[MT7].2y5_1.heavy 684.352 / 749.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 827 107 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37381.[MT7]-LTMEEEEAK[MT7].2y6_1.heavy 684.352 / 878.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 829 107 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37381.[MT7]-LTMEEEEAK[MT7].2y7_1.heavy 684.352 / 1009.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 831 108 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43512.[MT7]-LEIC[CAM]NLTPDALK[MT7].2b3_1.heavy 837.971 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 833 108 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43512.[MT7]-LEIC[CAM]NLTPDALK[MT7].2y5_1.heavy 837.971 / 687.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 835 108 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43512.[MT7]-LEIC[CAM]NLTPDALK[MT7].2y9_1.heavy 837.971 / 1175.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 837 108 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43512.[MT7]-LEIC[CAM]NLTPDALK[MT7].2y6_1.heavy 837.971 / 788.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 839 109 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542880.[MT7]-DNLAILEK[MT7].3y3_1.heavy 401.911 / 533.341 42535.0 32.457698822021484 47 20 9 10 8 9.91183238088902 10.088951886717712 0.0 4 0.9970099327867261 22.563871657603844 42535.0 53.65733697710999 2.0 - - - - - - - 284.8 146 10 CAB39L calcium binding protein 39-like 841 109 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542880.[MT7]-DNLAILEK[MT7].3b4_1.heavy 401.911 / 558.3 59622.0 32.457698822021484 47 20 9 10 8 9.91183238088902 10.088951886717712 0.0 4 0.9970099327867261 22.563871657603844 59622.0 135.73108279513585 0.0 - - - - - - - 336.6666666666667 119 9 CAB39L calcium binding protein 39-like 843 109 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542880.[MT7]-DNLAILEK[MT7].3b5_1.heavy 401.911 / 671.385 10565.0 32.457698822021484 47 20 9 10 8 9.91183238088902 10.088951886717712 0.0 4 0.9970099327867261 22.563871657603844 10565.0 50.90948831706596 0.0 - - - - - - - 175.54545454545453 21 11 CAB39L calcium binding protein 39-like 845 109 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542880.[MT7]-DNLAILEK[MT7].3b3_1.heavy 401.911 / 487.263 51262.0 32.457698822021484 47 20 9 10 8 9.91183238088902 10.088951886717712 0.0 4 0.9970099327867261 22.563871657603844 51262.0 161.0639588137502 0.0 - - - - - - - 275.6666666666667 102 12 CAB39L calcium binding protein 39-like 847 110 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23979.[MT7]-VFFTTEEASWFR.2b3_1.heavy 832.415 / 538.315 3475.0 44.412601470947266 44 14 10 10 10 1.601611640725099 51.57779890484076 0.0 3 0.9343312607756784 4.789357516481853 3475.0 17.46053691552428 0.0 - - - - - - - 213.9375 6 16 BMPR1A;BMPR1B bone morphogenetic protein receptor, type IA;bone morphogenetic protein receptor, type IB 849 110 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23979.[MT7]-VFFTTEEASWFR.2y5_1.heavy 832.415 / 666.336 2386.0 44.412601470947266 44 14 10 10 10 1.601611640725099 51.57779890484076 0.0 3 0.9343312607756784 4.789357516481853 2386.0 13.914430106526492 0.0 - - - - - - - 202.0 4 19 BMPR1A;BMPR1B bone morphogenetic protein receptor, type IA;bone morphogenetic protein receptor, type IB 851 110 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23979.[MT7]-VFFTTEEASWFR.2y9_1.heavy 832.415 / 1126.52 4253.0 44.412601470947266 44 14 10 10 10 1.601611640725099 51.57779890484076 0.0 3 0.9343312607756784 4.789357516481853 4253.0 89.06380430175884 0.0 - - - - - - - 161.8235294117647 8 17 BMPR1A;BMPR1B bone morphogenetic protein receptor, type IA;bone morphogenetic protein receptor, type IB 853 110 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23979.[MT7]-VFFTTEEASWFR.2y6_1.heavy 832.415 / 795.378 1815.0 44.412601470947266 44 14 10 10 10 1.601611640725099 51.57779890484076 0.0 3 0.9343312607756784 4.789357516481853 1815.0 5.595375722543352 0.0 - - - - - - - 275.5 3 16 BMPR1A;BMPR1B bone morphogenetic protein receptor, type IA;bone morphogenetic protein receptor, type IB 855 111 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 699169.0 34.195499420166016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 699169.0 156.0104256860246 0.0 - - - - - - - 421.0 1398 1 857 111 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 186224.0 34.195499420166016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 186224.0 309.9708934346887 0.0 - - - - - - - 757.8181818181819 372 11 859 111 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 256353.0 34.195499420166016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 256353.0 315.7245763709367 0.0 - - - - - - - 316.0 512 4 861 112 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37243.[MT7]-AEATEPLK[MT7].2y5_1.heavy 573.834 / 731.442 1266.0 21.319700241088867 41 17 10 6 8 4.451595754825027 22.46385465068595 0.03260040283203125 4 0.970995552226564 7.228941934616697 1266.0 5.955271315496434 0.0 - - - - - - - 180.64285714285714 2 14 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 863 112 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37243.[MT7]-AEATEPLK[MT7].2y3_1.heavy 573.834 / 501.352 5809.0 21.319700241088867 41 17 10 6 8 4.451595754825027 22.46385465068595 0.03260040283203125 4 0.970995552226564 7.228941934616697 5809.0 12.219673444856255 0.0 - - - - - - - 271.2142857142857 11 14 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 865 112 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37243.[MT7]-AEATEPLK[MT7].2y6_1.heavy 573.834 / 802.479 1489.0 21.319700241088867 41 17 10 6 8 4.451595754825027 22.46385465068595 0.03260040283203125 4 0.970995552226564 7.228941934616697 1489.0 3.5695796673923406 0.0 - - - - - - - 169.0909090909091 2 11 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 867 112 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37243.[MT7]-AEATEPLK[MT7].2b5_1.heavy 573.834 / 646.316 2830.0 21.319700241088867 41 17 10 6 8 4.451595754825027 22.46385465068595 0.03260040283203125 4 0.970995552226564 7.228941934616697 2830.0 7.614349775784754 1.0 - - - - - - - 175.28571428571428 5 14 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 869 113 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23831.[MT7]-SEEELSDLFR.2y9_1.heavy 684.842 / 1137.54 560.0 38.3755989074707 40 12 10 10 8 0.8814767631865494 60.0608824985739 0.0 4 0.8841311509338762 3.5899925971198807 560.0 7.42 1.0 - - - - - - - 0.0 1 0 TNNC1 troponin C type 1 (slow) 871 113 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23831.[MT7]-SEEELSDLFR.2b4_1.heavy 684.842 / 619.269 1439.0 38.3755989074707 40 12 10 10 8 0.8814767631865494 60.0608824985739 0.0 4 0.8841311509338762 3.5899925971198807 1439.0 5.087892857142857 0.0 - - - - - - - 248.42105263157896 2 19 TNNC1 troponin C type 1 (slow) 873 113 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23831.[MT7]-SEEELSDLFR.2b7_1.heavy 684.842 / 934.412 1759.0 38.3755989074707 40 12 10 10 8 0.8814767631865494 60.0608824985739 0.0 4 0.8841311509338762 3.5899925971198807 1759.0 11.360208333333333 0.0 - - - - - - - 174.11764705882354 3 17 TNNC1 troponin C type 1 (slow) 875 113 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23831.[MT7]-SEEELSDLFR.2y7_1.heavy 684.842 / 879.457 800.0 38.3755989074707 40 12 10 10 8 0.8814767631865494 60.0608824985739 0.0 4 0.8841311509338762 3.5899925971198807 800.0 3.7666666666666666 2.0 - - - - - - - 184.6153846153846 2 13 TNNC1 troponin C type 1 (slow) 877 114 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23830.[MT7]-YIESPDVEK[MT7].2y5_1.heavy 684.368 / 731.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 879 114 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23830.[MT7]-YIESPDVEK[MT7].2y3_1.heavy 684.368 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 881 114 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23830.[MT7]-YIESPDVEK[MT7].2y6_1.heavy 684.368 / 818.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 883 114 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23830.[MT7]-YIESPDVEK[MT7].2y7_1.heavy 684.368 / 947.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 885 115 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23582.[MT7]-LFDANK[MT7].2b3_1.heavy 498.292 / 520.289 5099.0 27.785449981689453 38 18 4 6 10 11.480458199470013 8.710453734731287 0.03549957275390625 2 0.98846627470643 11.48045929813996 5099.0 2.570924369747899 0.0 - - - - - - - 1126.25 10 8 GPI;SPTBN1 glucose-6-phosphate isomerase;spectrin, beta, non-erythrocytic 1 887 115 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23582.[MT7]-LFDANK[MT7].2y5_1.heavy 498.292 / 738.39 8244.0 27.785449981689453 38 18 4 6 10 11.480458199470013 8.710453734731287 0.03549957275390625 2 0.98846627470643 11.48045929813996 8244.0 22.571807486631016 1.0 - - - - - - - 718.6363636363636 16 11 GPI;SPTBN1 glucose-6-phosphate isomerase;spectrin, beta, non-erythrocytic 1 889 115 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23582.[MT7]-LFDANK[MT7].2y3_1.heavy 498.292 / 476.295 N/A 27.785449981689453 38 18 4 6 10 11.480458199470013 8.710453734731287 0.03549957275390625 2 0.98846627470643 11.48045929813996 8159.0 3.930946778711485 2.0 - - - - - - - 1728.3333333333333 29 9 GPI;SPTBN1 glucose-6-phosphate isomerase;spectrin, beta, non-erythrocytic 1 891 116 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24114.[MT7]-NVEPLYGFHAQEFIPFR.3y7_1.heavy 736.717 / 936.494 6217.0 41.83122539520264 44 18 10 6 10 6.006184656917972 16.64950475420685 0.039699554443359375 3 0.9874866604441317 11.02102124560491 6217.0 70.57946859903382 0.0 - - - - - - - 138.0 12 16 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 893 116 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24114.[MT7]-NVEPLYGFHAQEFIPFR.3y6_1.heavy 736.717 / 808.435 3177.0 41.83122539520264 44 18 10 6 10 6.006184656917972 16.64950475420685 0.039699554443359375 3 0.9874866604441317 11.02102124560491 3177.0 21.793913043478263 0.0 - - - - - - - 213.9 6 20 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 895 116 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24114.[MT7]-NVEPLYGFHAQEFIPFR.3b5_1.heavy 736.717 / 697.4 3039.0 41.83122539520264 44 18 10 6 10 6.006184656917972 16.64950475420685 0.039699554443359375 3 0.9874866604441317 11.02102124560491 3039.0 13.688362607123203 0.0 - - - - - - - 196.1578947368421 6 19 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 897 116 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24114.[MT7]-NVEPLYGFHAQEFIPFR.3y8_1.heavy 736.717 / 1007.53 6355.0 41.83122539520264 44 18 10 6 10 6.006184656917972 16.64950475420685 0.039699554443359375 3 0.9874866604441317 11.02102124560491 6355.0 103.15362318840579 0.0 - - - - - - - 175.23076923076923 12 13 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 899 117 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23669.[MT7]-VLLSGSDK[MT7].2y4_1.heavy 553.837 / 550.295 4566.0 26.079599380493164 48 18 10 10 10 13.406282349012645 7.459189460332742 0.0 3 0.981164239469417 8.978147464675665 4566.0 12.165503728849803 0.0 - - - - - - - 734.2 9 10 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 901 117 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23669.[MT7]-VLLSGSDK[MT7].2y5_1.heavy 553.837 / 637.327 7520.0 26.079599380493164 48 18 10 10 10 13.406282349012645 7.459189460332742 0.0 3 0.981164239469417 8.978147464675665 7520.0 17.661041583135088 0.0 - - - - - - - 752.0 15 10 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 903 117 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23669.[MT7]-VLLSGSDK[MT7].2y6_1.heavy 553.837 / 750.411 4835.0 26.079599380493164 48 18 10 10 10 13.406282349012645 7.459189460332742 0.0 3 0.981164239469417 8.978147464675665 4835.0 23.861817055311477 0.0 - - - - - - - 261.84615384615387 9 13 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 905 117 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23669.[MT7]-VLLSGSDK[MT7].2y7_1.heavy 553.837 / 863.495 5551.0 26.079599380493164 48 18 10 10 10 13.406282349012645 7.459189460332742 0.0 3 0.981164239469417 8.978147464675665 5551.0 9.272496126140425 0.0 - - - - - - - 248.15384615384616 11 13 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 907 118 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23764.[MT7]-LLASGSDDAK[MT7].2y8_1.heavy 632.853 / 894.429 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 909 118 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23764.[MT7]-LLASGSDDAK[MT7].2y9_1.heavy 632.853 / 1007.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 911 118 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23764.[MT7]-LLASGSDDAK[MT7].2y6_1.heavy 632.853 / 736.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 913 118 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23764.[MT7]-LLASGSDDAK[MT7].2y7_1.heavy 632.853 / 823.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 915 119 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23667.[MT7]-DFLLDIAR.2b3_1.heavy 553.82 / 520.289 7816.0 41.26530075073242 45 15 10 10 10 1.7625173601624111 48.78765955972992 0.0 3 0.9505331516862473 5.52584277033574 7816.0 24.125385340020877 0.0 - - - - - - - 716.5 15 10 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 917 119 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23667.[MT7]-DFLLDIAR.2y5_1.heavy 553.82 / 587.351 9553.0 41.26530075073242 45 15 10 10 10 1.7625173601624111 48.78765955972992 0.0 3 0.9505331516862473 5.52584277033574 9553.0 28.57416664394332 0.0 - - - - - - - 608.0 19 10 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 919 119 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23667.[MT7]-DFLLDIAR.2b5_1.heavy 553.82 / 748.4 15125.0 41.26530075073242 45 15 10 10 10 1.7625173601624111 48.78765955972992 0.0 3 0.9505331516862473 5.52584277033574 15125.0 95.32138884474813 0.0 - - - - - - - 216.92857142857142 30 14 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 921 119 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23667.[MT7]-DFLLDIAR.2y7_1.heavy 553.82 / 847.504 10277.0 41.26530075073242 45 15 10 10 10 1.7625173601624111 48.78765955972992 0.0 3 0.9505331516862473 5.52584277033574 10277.0 56.34596748733355 0.0 - - - - - - - 186.47368421052633 20 19 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 923 120 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23763.[MT7]-GYEAPQIALR.2y9_1.heavy 631.355 / 1060.58 2309.0 30.713199615478516 50 20 10 10 10 7.161962115418297 13.962654142601462 0.0 3 0.995158927167449 17.73030479756254 2309.0 33.12913043478261 0.0 - - - - - - - 138.5 4 6 CAB39L calcium binding protein 39-like 925 120 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23763.[MT7]-GYEAPQIALR.2b4_1.heavy 631.355 / 565.274 7018.0 30.713199615478516 50 20 10 10 10 7.161962115418297 13.962654142601462 0.0 3 0.995158927167449 17.73030479756254 7018.0 22.81589817342217 0.0 - - - - - - - 646.2857142857143 14 7 CAB39L calcium binding protein 39-like 927 120 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23763.[MT7]-GYEAPQIALR.2y6_1.heavy 631.355 / 697.435 8588.0 30.713199615478516 50 20 10 10 10 7.161962115418297 13.962654142601462 0.0 3 0.995158927167449 17.73030479756254 8588.0 79.84518918918918 0.0 - - - - - - - 193.0 17 11 CAB39L calcium binding protein 39-like 929 120 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23763.[MT7]-GYEAPQIALR.2y7_1.heavy 631.355 / 768.473 5171.0 30.713199615478516 50 20 10 10 10 7.161962115418297 13.962654142601462 0.0 3 0.995158927167449 17.73030479756254 5171.0 20.908014440433213 0.0 - - - - - - - 220.15384615384616 10 13 CAB39L calcium binding protein 39-like 931 121 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43543.[MT7]-NLINQMLTINPAK[MT7].2b3_1.heavy 879.513 / 485.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 933 121 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43543.[MT7]-NLINQMLTINPAK[MT7].2y4_1.heavy 879.513 / 573.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 935 121 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43543.[MT7]-NLINQMLTINPAK[MT7].2b4_1.heavy 879.513 / 599.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 937 121 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43543.[MT7]-NLINQMLTINPAK[MT7].2y3_1.heavy 879.513 / 459.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 939 122 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544313.[MT7]-LLDLSTEDDGTVAFALTK[MT7].3y3_1.heavy 733.066 / 505.347 11490.0 42.53182506561279 42 16 10 6 10 2.6172041375428385 26.080951388196162 0.038097381591796875 3 0.9645517570618878 6.535422643463413 11490.0 22.415024479364234 0.0 - - - - - - - 696.6153846153846 22 13 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 941 122 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544313.[MT7]-LLDLSTEDDGTVAFALTK[MT7].3y6_1.heavy 733.066 / 794.489 10814.0 42.53182506561279 42 16 10 6 10 2.6172041375428385 26.080951388196162 0.038097381591796875 3 0.9645517570618878 6.535422643463413 10814.0 31.70329918092518 0.0 - - - - - - - 690.8888888888889 21 9 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 943 122 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544313.[MT7]-LLDLSTEDDGTVAFALTK[MT7].3b4_1.heavy 733.066 / 599.388 5272.0 42.53182506561279 42 16 10 6 10 2.6172041375428385 26.080951388196162 0.038097381591796875 3 0.9645517570618878 6.535422643463413 5272.0 11.296840630677298 0.0 - - - - - - - 704.7142857142857 10 7 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 945 122 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544313.[MT7]-LLDLSTEDDGTVAFALTK[MT7].3y5_1.heavy 733.066 / 723.452 11490.0 42.53182506561279 42 16 10 6 10 2.6172041375428385 26.080951388196162 0.038097381591796875 3 0.9645517570618878 6.535422643463413 11490.0 22.130811339762836 0.0 - - - - - - - 667.375 22 8 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 947 123 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544311.[MT7]-LRPNIPNRWQSC[CAM]EALR.4b4_1.heavy 539.292 / 625.39 2997.0 28.998600006103516 38 12 10 6 10 1.9826247193727815 50.43818884273559 0.03459930419921875 3 0.8947688117838464 3.770561318132314 2997.0 4.919580176212611 1.0 - - - - - - - 262.92857142857144 5 14 TGFBR1 transforming growth factor, beta receptor 1 949 123 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544311.[MT7]-LRPNIPNRWQSC[CAM]EALR.4y11_2.heavy 539.292 / 708.844 16866.0 28.998600006103516 38 12 10 6 10 1.9826247193727815 50.43818884273559 0.03459930419921875 3 0.8947688117838464 3.770561318132314 16866.0 24.5488948787062 0.0 - - - - - - - 762.0 33 10 TGFBR1 transforming growth factor, beta receptor 1 951 123 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544311.[MT7]-LRPNIPNRWQSC[CAM]EALR.4y6_1.heavy 539.292 / 735.345 5394.0 28.998600006103516 38 12 10 6 10 1.9826247193727815 50.43818884273559 0.03459930419921875 3 0.8947688117838464 3.770561318132314 5394.0 12.611623415485827 0.0 - - - - - - - 710.6 10 10 TGFBR1 transforming growth factor, beta receptor 1 953 123 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544311.[MT7]-LRPNIPNRWQSC[CAM]EALR.4b10_2.heavy 539.292 / 710.408 2568.0 28.998600006103516 38 12 10 6 10 1.9826247193727815 50.43818884273559 0.03459930419921875 3 0.8947688117838464 3.770561318132314 2568.0 8.906513755205134 4.0 - - - - - - - 665.8888888888889 5 9 TGFBR1 transforming growth factor, beta receptor 1 955 124 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542660.[MT7]-LQNLVEK[MT7].2b3_1.heavy 566.352 / 500.295 5561.0 29.42300033569336 44 14 10 10 10 8.58507314115971 11.64812440799911 0.0 3 0.9434470502807739 5.1649540453285905 5561.0 6.055818462664119 1.0 - - - - - - - 702.2222222222222 15 9 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 957 124 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542660.[MT7]-LQNLVEK[MT7].2b4_1.heavy 566.352 / 613.379 9184.0 29.42300033569336 44 14 10 10 10 8.58507314115971 11.64812440799911 0.0 3 0.9434470502807739 5.1649540453285905 9184.0 14.326706502445699 0.0 - - - - - - - 642.75 18 8 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 959 124 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542660.[MT7]-LQNLVEK[MT7].2y3_1.heavy 566.352 / 519.326 9184.0 29.42300033569336 44 14 10 10 10 8.58507314115971 11.64812440799911 0.0 3 0.9434470502807739 5.1649540453285905 9184.0 13.55063179684539 0.0 - - - - - - - 1203.5714285714287 18 7 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 961 124 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542660.[MT7]-LQNLVEK[MT7].2y6_1.heavy 566.352 / 874.511 6657.0 29.42300033569336 44 14 10 10 10 8.58507314115971 11.64812440799911 0.0 3 0.9434470502807739 5.1649540453285905 6657.0 7.41433529956613 0.0 - - - - - - - 238.66666666666666 13 12 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 963 125 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43672.[MT7]-DNQLVVPSEGLYLIYSQVLFK[MT7].3b6_1.heavy 905.173 / 813.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNF tumor necrosis factor 965 125 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43672.[MT7]-DNQLVVPSEGLYLIYSQVLFK[MT7].3b4_1.heavy 905.173 / 615.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNF tumor necrosis factor 967 125 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43672.[MT7]-DNQLVVPSEGLYLIYSQVLFK[MT7].3b10_1.heavy 905.173 / 1183.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNF tumor necrosis factor 969 125 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43672.[MT7]-DNQLVVPSEGLYLIYSQVLFK[MT7].3b5_1.heavy 905.173 / 714.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNF tumor necrosis factor 971 126 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23967.[MT7]-ILATNSELVGTLTR.2y9_1.heavy 816.476 / 975.547 2838.0 37.557326316833496 42 16 10 6 10 3.5298148002214935 28.330098223205667 0.036701202392578125 3 0.965299216868463 6.605851425999529 2838.0 9.33841356757168 0.0 - - - - - - - 212.6875 5 16 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 973 126 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23967.[MT7]-ILATNSELVGTLTR.2y10_1.heavy 816.476 / 1089.59 7866.0 37.557326316833496 42 16 10 6 10 3.5298148002214935 28.330098223205667 0.036701202392578125 3 0.965299216868463 6.605851425999529 7866.0 68.46333333333334 0.0 - - - - - - - 149.53846153846155 15 13 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 975 126 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23967.[MT7]-ILATNSELVGTLTR.2y11_1.heavy 816.476 / 1190.64 8028.0 37.557326316833496 42 16 10 6 10 3.5298148002214935 28.330098223205667 0.036701202392578125 3 0.965299216868463 6.605851425999529 8028.0 55.708703703703705 0.0 - - - - - - - 190.92857142857142 16 14 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 977 126 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23967.[MT7]-ILATNSELVGTLTR.2y7_1.heavy 816.476 / 759.472 3892.0 37.557326316833496 42 16 10 6 10 3.5298148002214935 28.330098223205667 0.036701202392578125 3 0.965299216868463 6.605851425999529 3892.0 7.33954199316765 0.0 - - - - - - - 302.89473684210526 7 19 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 979 127 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23861.[MT7]-YLGQDYEQLR.2y8_1.heavy 714.866 / 1008.47 9910.0 31.118525505065918 43 17 10 6 10 10.196265576365967 9.807512294676894 0.036899566650390625 3 0.975617002341114 7.8873733680442655 9910.0 203.52795698924731 0.0 - - - - - - - 155.44444444444446 19 9 CAPN1 calpain 1, (mu/I) large subunit 981 127 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23861.[MT7]-YLGQDYEQLR.2y5_1.heavy 714.866 / 708.367 9349.0 31.118525505065918 43 17 10 6 10 10.196265576365967 9.807512294676894 0.036899566650390625 3 0.975617002341114 7.8873733680442655 9349.0 29.80751127836095 0.0 - - - - - - - 336.3 18 10 CAPN1 calpain 1, (mu/I) large subunit 983 127 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23861.[MT7]-YLGQDYEQLR.2y9_1.heavy 714.866 / 1121.56 9629.0 31.118525505065918 43 17 10 6 10 10.196265576365967 9.807512294676894 0.036899566650390625 3 0.975617002341114 7.8873733680442655 9629.0 142.6327807486631 0.0 - - - - - - - 180.07142857142858 19 14 CAPN1 calpain 1, (mu/I) large subunit 985 127 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23861.[MT7]-YLGQDYEQLR.2b5_1.heavy 714.866 / 721.364 7853.0 31.118525505065918 43 17 10 6 10 10.196265576365967 9.807512294676894 0.036899566650390625 3 0.975617002341114 7.8873733680442655 7853.0 25.47675579322638 0.0 - - - - - - - 238.55555555555554 15 9 CAPN1 calpain 1, (mu/I) large subunit 987 128 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43548.[MT7]-ERTDDEQFADEK[MT7].2y5_1.heavy 885.923 / 753.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 989 128 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43548.[MT7]-ERTDDEQFADEK[MT7].2b4_1.heavy 885.923 / 646.328 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 991 128 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43548.[MT7]-ERTDDEQFADEK[MT7].2b6_1.heavy 885.923 / 890.397 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 993 128 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43548.[MT7]-ERTDDEQFADEK[MT7].2b5_1.heavy 885.923 / 761.355 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 995 129 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 276326.0 22.451200485229492 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 276326.0 300.2859841362062 0.0 - - - - - - - 660.375 552 8 997 129 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 472925.0 22.451200485229492 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 472925.0 520.0087030905077 0.0 - - - - - - - 712.7777777777778 945 9 999 129 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 1718510.0 22.451200485229492 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1718510.0 1280.1157490287692 0.0 - - - - - - - 320.5 3437 4 1001 130 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23860.[MT7]-DANLTALAAIGPR.2y8_1.heavy 713.91 / 768.473 1874.0 36.04840087890625 38 12 10 6 10 0.9097976646436851 64.66665855249757 0.037200927734375 3 0.885010499006219 3.6039689795746317 1874.0 7.363858974358974 0.0 - - - - - - - 248.625 3 16 TAF4;TAF4B TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa;TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa 1003 130 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23860.[MT7]-DANLTALAAIGPR.2y12_1.heavy 713.91 / 1167.68 1093.0 36.04840087890625 38 12 10 6 10 0.9097976646436851 64.66665855249757 0.037200927734375 3 0.885010499006219 3.6039689795746317 1093.0 7.707051282051282 0.0 - - - - - - - 141.8181818181818 2 11 TAF4;TAF4B TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa;TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa 1005 130 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23860.[MT7]-DANLTALAAIGPR.2b4_1.heavy 713.91 / 558.3 3436.0 36.04840087890625 38 12 10 6 10 0.9097976646436851 64.66665855249757 0.037200927734375 3 0.885010499006219 3.6039689795746317 3436.0 12.187521367521368 0.0 - - - - - - - 286.0 6 18 TAF4;TAF4B TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa;TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa 1007 130 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23860.[MT7]-DANLTALAAIGPR.2y9_1.heavy 713.91 / 869.52 2967.0 36.04840087890625 38 12 10 6 10 0.9097976646436851 64.66665855249757 0.037200927734375 3 0.885010499006219 3.6039689795746317 2967.0 17.75128205128205 0.0 - - - - - - - 243.1764705882353 5 17 TAF4;TAF4B TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa;TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa 1009 131 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23590.[MT7]-GISDVTDR.2b4_1.heavy 503.768 / 517.274 9557.0 22.09709930419922 40 14 10 6 10 2.0991848517554694 47.637538883902366 0.033599853515625 3 0.9359800097537326 4.851320007818064 9557.0 25.22536693898835 0.0 - - - - - - - 802.75 19 8 SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 1011 131 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23590.[MT7]-GISDVTDR.2y6_1.heavy 503.768 / 692.321 5077.0 22.09709930419922 40 14 10 6 10 2.0991848517554694 47.637538883902366 0.033599853515625 3 0.9359800097537326 4.851320007818064 5077.0 18.712860639210348 0.0 - - - - - - - 203.22222222222223 10 18 SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 1013 131 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23590.[MT7]-GISDVTDR.2b5_1.heavy 503.768 / 616.342 4032.0 22.09709930419922 40 14 10 6 10 2.0991848517554694 47.637538883902366 0.033599853515625 3 0.9359800097537326 4.851320007818064 4032.0 19.435681045845403 1.0 - - - - - - - 280.0 8 16 SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 1015 131 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23590.[MT7]-GISDVTDR.2y7_1.heavy 503.768 / 805.405 2539.0 22.09709930419922 40 14 10 6 10 2.0991848517554694 47.637538883902366 0.033599853515625 3 0.9359800097537326 4.851320007818064 2539.0 44.777281431767335 0.0 - - - - - - - 159.92857142857142 5 14 SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 1017 132 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24074.[MT7]-FYATFLIQDYFRK[MT7].3y7_1.heavy 667.368 / 1113.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNA1D;CACNA1F calcium channel, voltage-dependent, L type, alpha 1D subunit;calcium channel, voltage-dependent, L type, alpha 1F subunit 1019 132 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24074.[MT7]-FYATFLIQDYFRK[MT7].3b4_1.heavy 667.368 / 627.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNA1D;CACNA1F calcium channel, voltage-dependent, L type, alpha 1D subunit;calcium channel, voltage-dependent, L type, alpha 1F subunit 1021 132 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24074.[MT7]-FYATFLIQDYFRK[MT7].3b3_1.heavy 667.368 / 526.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNA1D;CACNA1F calcium channel, voltage-dependent, L type, alpha 1D subunit;calcium channel, voltage-dependent, L type, alpha 1F subunit 1023 132 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24074.[MT7]-FYATFLIQDYFRK[MT7].3y4_1.heavy 667.368 / 757.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNA1D;CACNA1F calcium channel, voltage-dependent, L type, alpha 1D subunit;calcium channel, voltage-dependent, L type, alpha 1F subunit 1025 133 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23968.[MT7]-DVTQIFNNILRR.3y6_1.heavy 544.982 / 785.474 1660.0 41.871649742126465 38 13 10 5 10 0.9848108660196895 64.53340367179663 0.042598724365234375 3 0.9221098280347736 4.392997521475442 1660.0 16.519227750745568 1.0 - - - - - - - 202.9375 3 16 CAB39L calcium binding protein 39-like 1027 133 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23968.[MT7]-DVTQIFNNILRR.3y11_2.heavy 544.982 / 687.404 12309.0 41.871649742126465 38 13 10 5 10 0.9848108660196895 64.53340367179663 0.042598724365234375 3 0.9221098280347736 4.392997521475442 12309.0 48.91264778268845 0.0 - - - - - - - 730.8571428571429 24 7 CAB39L calcium binding protein 39-like 1029 133 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23968.[MT7]-DVTQIFNNILRR.3b4_1.heavy 544.982 / 588.311 18532.0 41.871649742126465 38 13 10 5 10 0.9848108660196895 64.53340367179663 0.042598724365234375 3 0.9221098280347736 4.392997521475442 18532.0 48.64298363973689 0.0 - - - - - - - 286.42857142857144 37 14 CAB39L calcium binding protein 39-like 1031 133 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23968.[MT7]-DVTQIFNNILRR.3b5_1.heavy 544.982 / 701.395 9266.0 41.871649742126465 38 13 10 5 10 0.9848108660196895 64.53340367179663 0.042598724365234375 3 0.9221098280347736 4.392997521475442 9266.0 52.09907060124556 0.0 - - - - - - - 233.25 18 16 CAB39L calcium binding protein 39-like 1033 134 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24073.[MT7]-ESSDSANTTIEDEDAK[MT7].3y6_1.heavy 667.311 / 850.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 1035 134 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24073.[MT7]-ESSDSANTTIEDEDAK[MT7].3b4_1.heavy 667.311 / 563.243 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 1037 134 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24073.[MT7]-ESSDSANTTIEDEDAK[MT7].3b5_1.heavy 667.311 / 650.275 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 1039 134 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24073.[MT7]-ESSDSANTTIEDEDAK[MT7].3b7_1.heavy 667.311 / 835.355 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 1041 135 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23653.[MT7]-AGFEASDPR.2y8_1.heavy 547.273 / 878.4 1043.0 21.45400047302246 40 14 10 6 10 2.358061942834647 42.407707017140154 0.033599853515625 3 0.9489979007647324 5.441329311006689 1043.0 2.7937499999999997 1.0 - - - - - - - 176.73684210526315 2 19 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 1043 135 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23653.[MT7]-AGFEASDPR.2b6_1.heavy 547.273 / 707.348 894.0 21.45400047302246 40 14 10 6 10 2.358061942834647 42.407707017140154 0.033599853515625 3 0.9489979007647324 5.441329311006689 894.0 0.9587131367292225 2.0 - - - - - - - 220.1 2 20 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 1045 135 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23653.[MT7]-AGFEASDPR.2b7_1.heavy 547.273 / 822.375 33832.0 21.45400047302246 40 14 10 6 10 2.358061942834647 42.407707017140154 0.033599853515625 3 0.9489979007647324 5.441329311006689 33832.0 103.88013422818793 0.0 - - - - - - - 670.8 67 10 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 1047 135 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23653.[MT7]-AGFEASDPR.2b5_1.heavy 547.273 / 620.316 1416.0 21.45400047302246 40 14 10 6 10 2.358061942834647 42.407707017140154 0.033599853515625 3 0.9489979007647324 5.441329311006689 1416.0 4.276510067114094 1.0 - - - - - - - 240.72727272727272 2 22 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 1049 136 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543867.[MT7]-FFEQLDQIEK[MT7].3b6_1.heavy 528.955 / 924.458 26725.0 38.25292491912842 42 16 10 6 10 1.8537004062551659 42.95894362831275 0.037097930908203125 3 0.9644055764755991 6.521908371857692 26725.0 297.15734102244386 0.0 - - - - - - - 160.46153846153845 53 13 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1051 136 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543867.[MT7]-FFEQLDQIEK[MT7].3y3_1.heavy 528.955 / 533.341 89405.0 38.25292491912842 42 16 10 6 10 1.8537004062551659 42.95894362831275 0.037097930908203125 3 0.9644055764755991 6.521908371857692 89405.0 166.83142130869345 0.0 - - - - - - - 334.5 178 12 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1053 136 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543867.[MT7]-FFEQLDQIEK[MT7].3b4_1.heavy 528.955 / 696.347 117253.0 38.25292491912842 42 16 10 6 10 1.8537004062551659 42.95894362831275 0.037097930908203125 3 0.9644055764755991 6.521908371857692 117253.0 324.90839646354107 0.0 - - - - - - - 278.0 234 13 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1055 136 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543867.[MT7]-FFEQLDQIEK[MT7].3b3_1.heavy 528.955 / 568.289 71187.0 38.25292491912842 42 16 10 6 10 1.8537004062551659 42.95894362831275 0.037097930908203125 3 0.9644055764755991 6.521908371857692 71187.0 163.96907395199133 0.0 - - - - - - - 732.375 142 8 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1057 137 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23573.[MT7]-C[CAM]ATLDTR.2y5_1.heavy 490.751 / 605.325 1012.0 18.72992467880249 37 13 10 6 8 2.113867038815879 47.30666506632168 0.03809928894042969 4 0.9255067965380923 4.493352097164771 1012.0 2.2006931164596844 8.0 - - - - - - - 276.5 6 20 BMPR1A bone morphogenetic protein receptor, type IA 1059 137 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23573.[MT7]-C[CAM]ATLDTR.2b4_1.heavy 490.751 / 590.309 1282.0 18.72992467880249 37 13 10 6 8 2.113867038815879 47.30666506632168 0.03809928894042969 4 0.9255067965380923 4.493352097164771 1282.0 4.639659303220134 3.0 - - - - - - - 177.3684210526316 4 19 BMPR1A bone morphogenetic protein receptor, type IA 1061 137 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23573.[MT7]-C[CAM]ATLDTR.2y6_1.heavy 490.751 / 676.362 1485.0 18.72992467880249 37 13 10 6 8 2.113867038815879 47.30666506632168 0.03809928894042969 4 0.9255067965380923 4.493352097164771 1485.0 14.218397626112761 0.0 - - - - - - - 209.05 2 20 BMPR1A bone morphogenetic protein receptor, type IA 1063 137 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23573.[MT7]-C[CAM]ATLDTR.2b5_1.heavy 490.751 / 705.336 20180.0 18.72992467880249 37 13 10 6 8 2.113867038815879 47.30666506632168 0.03809928894042969 4 0.9255067965380923 4.493352097164771 20180.0 139.7651851851852 0.0 - - - - - - - 215.8 40 15 BMPR1A bone morphogenetic protein receptor, type IA 1065 138 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43285.[MT7]-VDRVPLASK[MT7].3y3_1.heavy 424.934 / 449.284 24107.0 23.904699325561523 50 20 10 10 10 6.861531780332518 14.574005222366527 0.0 3 0.9929082612883992 14.646336700880662 24107.0 118.60590919284797 0.0 - - - - - - - 265.1818181818182 48 11 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1067 138 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43285.[MT7]-VDRVPLASK[MT7].3b3_2.heavy 424.934 / 258.156 10209.0 23.904699325561523 50 20 10 10 10 6.861531780332518 14.574005222366527 0.0 3 0.9929082612883992 14.646336700880662 10209.0 6.795008016143344 0.0 - - - - - - - 1243.875 20 8 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1069 138 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43285.[MT7]-VDRVPLASK[MT7].3y4_1.heavy 424.934 / 562.368 6091.0 23.904699325561523 50 20 10 10 10 6.861531780332518 14.574005222366527 0.0 3 0.9929082612883992 14.646336700880662 6091.0 26.986391431697555 0.0 - - - - - - - 212.0 12 17 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1071 138 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43285.[MT7]-VDRVPLASK[MT7].3y5_1.heavy 424.934 / 659.421 8064.0 23.904699325561523 50 20 10 10 10 6.861531780332518 14.574005222366527 0.0 3 0.9929082612883992 14.646336700880662 8064.0 30.174358353792627 0.0 - - - - - - - 246.0 16 15 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1073 139 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24109.[MT7]-EQLSSLQEELESLLEK[MT7].3y3_1.heavy 721.726 / 533.341 13659.0 48.94089889526367 47 17 10 10 10 3.5638979608351016 28.059164740106013 0.0 3 0.9796626285502438 8.639252463868441 13659.0 98.24655344655345 0.0 - - - - - - - 118.125 27 24 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1075 139 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24109.[MT7]-EQLSSLQEELESLLEK[MT7].3b5_1.heavy 721.726 / 689.359 3986.0 48.94089889526367 47 17 10 10 10 3.5638979608351016 28.059164740106013 0.0 3 0.9796626285502438 8.639252463868441 3986.0 69.00931972789115 0.0 - - - - - - - 90.125 7 24 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1077 139 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24109.[MT7]-EQLSSLQEELESLLEK[MT7].3b3_1.heavy 721.726 / 515.295 N/A 48.94089889526367 47 17 10 10 10 3.5638979608351016 28.059164740106013 0.0 3 0.9796626285502438 8.639252463868441 4616.0 24.12815539017786 0.0 - - - - - - - 157.5 9 20 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1079 139 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24109.[MT7]-EQLSSLQEELESLLEK[MT7].3y5_1.heavy 721.726 / 733.458 6106.0 48.94089889526367 47 17 10 10 10 3.5638979608351016 28.059164740106013 0.0 3 0.9796626285502438 8.639252463868441 6106.0 48.44606442577031 0.0 - - - - - - - 143.34782608695653 12 23 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1081 140 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24108.[MT7]-EQLSSLQEELESLLEK[MT7].4b4_1.heavy 541.546 / 602.327 1873.0 48.948899269104004 40 16 10 6 8 3.721902441466959 26.867979903467266 0.032001495361328125 4 0.967254654230404 6.80135285150127 1873.0 25.919438461538462 0.0 - - - - - - - 100.0 3 26 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1083 140 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24108.[MT7]-EQLSSLQEELESLLEK[MT7].4b5_1.heavy 541.546 / 689.359 3080.0 48.948899269104004 40 16 10 6 8 3.721902441466959 26.867979903467266 0.032001495361328125 4 0.967254654230404 6.80135285150127 3080.0 27.21711463633643 1.0 - - - - - - - 108.25 10 20 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1085 140 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24108.[MT7]-EQLSSLQEELESLLEK[MT7].4y3_1.heavy 541.546 / 533.341 8198.0 48.948899269104004 40 16 10 6 8 3.721902441466959 26.867979903467266 0.032001495361328125 4 0.967254654230404 6.80135285150127 8198.0 67.69132935841452 0.0 - - - - - - - 107.4 16 25 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1087 140 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24108.[MT7]-EQLSSLQEELESLLEK[MT7].4b3_1.heavy 541.546 / 515.295 3974.0 48.948899269104004 40 16 10 6 8 3.721902441466959 26.867979903467266 0.032001495361328125 4 0.967254654230404 6.80135285150127 3974.0 53.74267990074441 0.0 - - - - - - - 92.51851851851852 7 27 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1089 141 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23656.[MT7]-GFSLESC[CAM]R.2y5_1.heavy 550.27 / 664.308 1682.0 28.21857452392578 37 14 10 3 10 1.4901232212623408 45.332265080031895 0.06729888916015625 3 0.9390207284819234 4.972093020534331 1682.0 3.0639484544091298 0.0 - - - - - - - 260.5 3 20 CAPN1 calpain 1, (mu/I) large subunit 1091 141 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23656.[MT7]-GFSLESC[CAM]R.2y6_1.heavy 550.27 / 751.34 2103.0 28.21857452392578 37 14 10 3 10 1.4901232212623408 45.332265080031895 0.06729888916015625 3 0.9390207284819234 4.972093020534331 2103.0 5.7846731433386225 1.0 - - - - - - - 148.23529411764707 4 17 CAPN1 calpain 1, (mu/I) large subunit 1093 141 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23656.[MT7]-GFSLESC[CAM]R.2b5_1.heavy 550.27 / 678.358 2523.0 28.21857452392578 37 14 10 3 10 1.4901232212623408 45.332265080031895 0.06729888916015625 3 0.9390207284819234 4.972093020534331 2523.0 10.801442144553784 0.0 - - - - - - - 631.0 5 8 CAPN1 calpain 1, (mu/I) large subunit 1095 141 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23656.[MT7]-GFSLESC[CAM]R.2y7_1.heavy 550.27 / 898.409 1850.0 28.21857452392578 37 14 10 3 10 1.4901232212623408 45.332265080031895 0.06729888916015625 3 0.9390207284819234 4.972093020534331 1850.0 4.404761904761905 1.0 - - - - - - - 149.33333333333334 3 18 CAPN1 calpain 1, (mu/I) large subunit 1097 142 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543635.[MT7]-YLGQDYEQLR.3b4_1.heavy 476.913 / 606.337 25805.0 31.10930061340332 48 20 10 10 8 5.498768804986531 18.18588915928153 0.0 4 0.9950177180598035 17.47703435884297 25805.0 89.42586897301402 0.0 - - - - - - - 288.0833333333333 51 12 CAPN1 calpain 1, (mu/I) large subunit 1099 142 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543635.[MT7]-YLGQDYEQLR.3b5_1.heavy 476.913 / 721.364 70684.0 31.10930061340332 48 20 10 10 8 5.498768804986531 18.18588915928153 0.0 4 0.9950177180598035 17.47703435884297 70684.0 190.25461675579322 0.0 - - - - - - - 264.5833333333333 141 12 CAPN1 calpain 1, (mu/I) large subunit 1101 142 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543635.[MT7]-YLGQDYEQLR.3y4_1.heavy 476.913 / 545.304 111822.0 31.10930061340332 48 20 10 10 8 5.498768804986531 18.18588915928153 0.0 4 0.9950177180598035 17.47703435884297 111822.0 98.85192283736141 0.0 - - - - - - - 303.75 223 4 CAPN1 calpain 1, (mu/I) large subunit 1103 142 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543635.[MT7]-YLGQDYEQLR.3y5_1.heavy 476.913 / 708.367 28984.0 31.10930061340332 48 20 10 10 8 5.498768804986531 18.18588915928153 0.0 4 0.9950177180598035 17.47703435884297 28984.0 76.54524481075057 1.0 - - - - - - - 311.3333333333333 133 12 CAPN1 calpain 1, (mu/I) large subunit 1105 143 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37358.[MT7]-RITAHEALK[MT7].3y3_1.heavy 442.941 / 475.336 17890.0 18.758499145507812 43 13 10 10 10 1.8135744773403446 43.438082116360626 0.0 3 0.9203502487999375 4.343546699842549 17890.0 42.32162479487202 0.0 - - - - - - - 237.1875 35 16 CAMK2B calcium/calmodulin-dependent protein kinase II beta 1107 143 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37358.[MT7]-RITAHEALK[MT7].3b4_1.heavy 442.941 / 586.379 11927.0 18.758499145507812 43 13 10 10 10 1.8135744773403446 43.438082116360626 0.0 3 0.9203502487999375 4.343546699842549 11927.0 73.38553832086993 0.0 - - - - - - - 209.9047619047619 23 21 CAMK2B calcium/calmodulin-dependent protein kinase II beta 1109 143 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37358.[MT7]-RITAHEALK[MT7].3b3_1.heavy 442.941 / 515.342 1288.0 18.758499145507812 43 13 10 10 10 1.8135744773403446 43.438082116360626 0.0 3 0.9203502487999375 4.343546699842549 1288.0 4.420073800738007 2.0 - - - - - - - 255.0 8 21 CAMK2B calcium/calmodulin-dependent protein kinase II beta 1111 143 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37358.[MT7]-RITAHEALK[MT7].3y4_1.heavy 442.941 / 604.379 9148.0 18.758499145507812 43 13 10 10 10 1.8135744773403446 43.438082116360626 0.0 3 0.9203502487999375 4.343546699842549 9148.0 65.653918653821 0.0 - - - - - - - 196.6 18 20 CAMK2B calcium/calmodulin-dependent protein kinase II beta 1113 144 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544306.[MT7]-ASPAGTAGGPGAGAAAGGTGPLAAR.3b9_1.heavy 703.37 / 814.417 34977.0 25.075199127197266 50 20 10 10 10 8.843689794403481 11.307497472749736 0.0 3 0.9967678682956934 21.70205206198062 34977.0 202.8957397603558 0.0 - - - - - - - 268.8 69 10 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 1115 144 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544306.[MT7]-ASPAGTAGGPGAGAAAGGTGPLAAR.3y11_1.heavy 703.37 / 941.516 13901.0 25.075199127197266 50 20 10 10 10 8.843689794403481 11.307497472749736 0.0 3 0.9967678682956934 21.70205206198062 13901.0 296.55466666666666 0.0 - - - - - - - 217.85714285714286 27 7 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 1117 144 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544306.[MT7]-ASPAGTAGGPGAGAAAGGTGPLAAR.3y10_1.heavy 703.37 / 870.479 20717.0 25.075199127197266 50 20 10 10 10 8.843689794403481 11.307497472749736 0.0 3 0.9967678682956934 21.70205206198062 20717.0 275.9697594246032 0.0 - - - - - - - 269.0 41 7 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 1119 144 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544306.[MT7]-ASPAGTAGGPGAGAAAGGTGPLAAR.3y9_1.heavy 703.37 / 799.442 38833.0 25.075199127197266 50 20 10 10 10 8.843689794403481 11.307497472749736 0.0 3 0.9967678682956934 21.70205206198062 38833.0 134.44954264420204 0.0 - - - - - - - 268.875 77 8 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 1121 145 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23859.[MT7]-YVTTILDDAK[MT7].2y4_1.heavy 713.905 / 592.306 5254.0 35.849098205566406 46 16 10 10 10 2.6363694893776715 37.930950271923194 0.0 3 0.9647068630293375 6.549853582509723 5254.0 19.87124767104294 0.0 - - - - - - - 231.10526315789474 10 19 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1123 145 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23859.[MT7]-YVTTILDDAK[MT7].2y8_1.heavy 713.905 / 1020.57 2274.0 35.849098205566406 46 16 10 10 10 2.6363694893776715 37.930950271923194 0.0 3 0.9647068630293375 6.549853582509723 2274.0 52.47692307692308 0.0 - - - - - - - 137.0 4 8 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1125 145 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23859.[MT7]-YVTTILDDAK[MT7].2y5_1.heavy 713.905 / 705.39 6352.0 35.849098205566406 46 16 10 10 10 2.6363694893776715 37.930950271923194 0.0 3 0.9647068630293375 6.549853582509723 6352.0 5.399392835458409 0.0 - - - - - - - 721.5 12 10 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1127 145 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23859.[MT7]-YVTTILDDAK[MT7].2y7_1.heavy 713.905 / 919.522 N/A 35.849098205566406 46 16 10 10 10 2.6363694893776715 37.930950271923194 0.0 3 0.9647068630293375 6.549853582509723 2196.0 6.614267515923567 2.0 - - - - - - - 696.0 5 8 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1129 146 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543924.[MT7]-NRFQAVLDELK[MT7].3y3_1.heavy 540.982 / 533.341 14655.0 37.52980041503906 29 17 0 10 2 2.710019475382259 36.90010382153974 0.0 13 0.9761444813959237 7.974450703580355 14655.0 12.9 0.0 - - - - - - - 773.6 29 10 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1131 146 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543924.[MT7]-NRFQAVLDELK[MT7].3b4_1.heavy 540.982 / 690.38 N/A 37.52980041503906 29 17 0 10 2 2.710019475382259 36.90010382153974 0.0 13 0.9761444813959237 7.974450703580355 2361.0 5.0696319018404905 7.0 - - - - - - - 732.8571428571429 180 7 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1133 146 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543924.[MT7]-NRFQAVLDELK[MT7].3b3_1.heavy 540.982 / 562.322 1058.0 37.52980041503906 29 17 0 10 2 2.710019475382259 36.90010382153974 0.0 13 0.9761444813959237 7.974450703580355 1058.0 1.2000479383171303 19.0 - - - - - - - 1186.2857142857142 9 7 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1135 146 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543924.[MT7]-NRFQAVLDELK[MT7].3y4_1.heavy 540.982 / 648.369 20762.0 37.52980041503906 29 17 0 10 2 2.710019475382259 36.90010382153974 0.0 13 0.9761444813959237 7.974450703580355 20762.0 47.240725806451614 0.0 - - - - - - - 719.1666666666666 41 12 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1137 147 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543926.[MT7]-ELGLGRHENAIK[MT7].4b8_2.heavy 406.99 / 518.786 4844.0 23.013450145721436 29 11 6 6 6 0.802570358735088 64.177216941338 0.03460121154785156 5 0.8539585180805508 3.1892703875559354 4844.0 23.987859424920128 0.0 - - - - - - - 218.73333333333332 9 15 CAPN1 calpain 1, (mu/I) large subunit 1139 147 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543926.[MT7]-ELGLGRHENAIK[MT7].4b7_2.heavy 406.99 / 454.265 5235.0 23.013450145721436 29 11 6 6 6 0.802570358735088 64.177216941338 0.03460121154785156 5 0.8539585180805508 3.1892703875559354 5235.0 9.871957650868016 1.0 - - - - - - - 1205.5714285714287 36 7 CAPN1 calpain 1, (mu/I) large subunit 1141 147 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543926.[MT7]-ELGLGRHENAIK[MT7].4b9_2.heavy 406.99 / 575.808 11330.0 23.013450145721436 29 11 6 6 6 0.802570358735088 64.177216941338 0.03460121154785156 5 0.8539585180805508 3.1892703875559354 11330.0 92.12876218563119 0.0 - - - - - - - 234.5 22 14 CAPN1 calpain 1, (mu/I) large subunit 1143 147 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543926.[MT7]-ELGLGRHENAIK[MT7].4b3_1.heavy 406.99 / 444.258 5079.0 23.013450145721436 29 11 6 6 6 0.802570358735088 64.177216941338 0.03460121154785156 5 0.8539585180805508 3.1892703875559354 5079.0 7.832217010068579 1.0 - - - - - - - 726.6 30 10 CAPN1 calpain 1, (mu/I) large subunit 1145 148 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543630.[MT7]-DANLTALAAIGPR.3b6_1.heavy 476.276 / 730.385 17948.0 36.07630157470703 46 18 10 10 8 4.900577620713207 20.405757798291226 0.0 4 0.9897061260645619 12.153453237198969 17948.0 80.83960662872448 0.0 - - - - - - - 216.4 35 15 TAF4;TAF4B TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa;TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa 1147 148 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543630.[MT7]-DANLTALAAIGPR.3b4_1.heavy 476.276 / 558.3 12533.0 36.07630157470703 46 18 10 10 8 4.900577620713207 20.405757798291226 0.0 4 0.9897061260645619 12.153453237198969 12533.0 14.320054041354616 2.0 - - - - - - - 673.2 28 10 TAF4;TAF4B TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa;TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa 1149 148 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543630.[MT7]-DANLTALAAIGPR.3y8_1.heavy 476.276 / 768.473 11217.0 36.07630157470703 46 18 10 10 8 4.900577620713207 20.405757798291226 0.0 4 0.9897061260645619 12.153453237198969 11217.0 111.78320689655173 0.0 - - - - - - - 209.1764705882353 22 17 TAF4;TAF4B TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa;TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa 1151 148 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543630.[MT7]-DANLTALAAIGPR.3y5_1.heavy 476.276 / 513.314 26690.0 36.07630157470703 46 18 10 10 8 4.900577620713207 20.405757798291226 0.0 4 0.9897061260645619 12.153453237198969 26690.0 47.01627045105306 0.0 - - - - - - - 275.0 53 9 TAF4;TAF4B TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa;TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa 1153 149 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23854.[MT7]-ELYFYEEK[MT7].3y3_1.heavy 470.246 / 549.3 37985.0 33.739200592041016 48 18 10 10 10 4.549961007314909 21.978210327348165 0.0 3 0.9879162350304415 11.215610972667948 37985.0 117.5227366970789 0.0 - - - - - - - 689.0 75 8 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1155 149 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23854.[MT7]-ELYFYEEK[MT7].3b4_1.heavy 470.246 / 697.368 27649.0 33.739200592041016 48 18 10 10 10 4.549961007314909 21.978210327348165 0.0 3 0.9879162350304415 11.215610972667948 27649.0 179.28462777191132 0.0 - - - - - - - 179.33333333333334 55 12 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1157 149 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23854.[MT7]-ELYFYEEK[MT7].3y4_1.heavy 470.246 / 712.363 9733.0 33.739200592041016 48 18 10 10 10 4.549961007314909 21.978210327348165 0.0 3 0.9879162350304415 11.215610972667948 9733.0 62.357464442197504 0.0 - - - - - - - 238.05882352941177 19 17 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1159 149 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23854.[MT7]-ELYFYEEK[MT7].3b3_1.heavy 470.246 / 550.299 51939.0 33.739200592041016 48 18 10 10 10 4.549961007314909 21.978210327348165 0.0 3 0.9879162350304415 11.215610972667948 51939.0 100.9200382047349 0.0 - - - - - - - 750.4285714285714 103 7 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1161 150 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543922.[MT7]-TLSQLSQQEGIK[MT7].3b4_1.heavy 540.645 / 574.332 56193.0 29.087099075317383 48 18 10 10 10 5.118650874244484 19.536397862798186 0.0 3 0.9811079652994377 8.964723444079493 56193.0 125.83503554502369 0.0 - - - - - - - 1218.6666666666667 112 9 TGFBR1 transforming growth factor, beta receptor 1 1163 150 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543922.[MT7]-TLSQLSQQEGIK[MT7].3b5_1.heavy 540.645 / 687.416 29953.0 29.087099075317383 48 18 10 10 10 5.118650874244484 19.536397862798186 0.0 3 0.9811079652994377 8.964723444079493 29953.0 37.76401939655172 0.0 - - - - - - - 691.7 59 10 TGFBR1 transforming growth factor, beta receptor 1 1165 150 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543922.[MT7]-TLSQLSQQEGIK[MT7].3y4_1.heavy 540.645 / 590.363 33665.0 29.087099075317383 48 18 10 10 10 5.118650874244484 19.536397862798186 0.0 3 0.9811079652994377 8.964723444079493 33665.0 73.29566864295126 0.0 - - - - - - - 725.6 67 10 TGFBR1 transforming growth factor, beta receptor 1 1167 150 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543922.[MT7]-TLSQLSQQEGIK[MT7].3y5_1.heavy 540.645 / 718.422 17128.0 29.087099075317383 48 18 10 10 10 5.118650874244484 19.536397862798186 0.0 3 0.9811079652994377 8.964723444079493 17128.0 69.087262864051 0.0 - - - - - - - 213.53333333333333 34 15 TGFBR1 transforming growth factor, beta receptor 1 1169 151 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23954.[MT7]-DDDRYEQASDVR.3y6_1.heavy 538.249 / 675.342 2818.0 18.720399856567383 48 18 10 10 10 4.060835779270707 24.625472546924616 0.0 3 0.9806499514217669 8.85765051049301 2818.0 28.4729157782516 0.0 - - - - - - - 176.47368421052633 5 19 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1171 151 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23954.[MT7]-DDDRYEQASDVR.3b10_2.heavy 538.249 / 670.28 82604.0 18.720399856567383 48 18 10 10 10 4.060835779270707 24.625472546924616 0.0 3 0.9806499514217669 8.85765051049301 82604.0 85.45581674802126 0.0 - - - - - - - 754.75 165 8 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1173 151 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23954.[MT7]-DDDRYEQASDVR.3b8_2.heavy 538.249 / 569.25 5570.0 18.720399856567383 48 18 10 10 10 4.060835779270707 24.625472546924616 0.0 3 0.9806499514217669 8.85765051049301 5570.0 25.25767606049864 0.0 - - - - - - - 197.0625 11 16 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1175 151 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23954.[MT7]-DDDRYEQASDVR.3b7_2.heavy 538.249 / 533.732 5972.0 18.720399856567383 48 18 10 10 10 4.060835779270707 24.625472546924616 0.0 3 0.9806499514217669 8.85765051049301 5972.0 11.48023752640021 0.0 - - - - - - - 690.1428571428571 11 7 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1177 152 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37600.[MT7]-TASQLDEFQEC[CAM]LSK[MT7].2b8_1.heavy 972.485 / 1036.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 1179 152 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37600.[MT7]-TASQLDEFQEC[CAM]LSK[MT7].2y4_1.heavy 972.485 / 651.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 1181 152 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37600.[MT7]-TASQLDEFQEC[CAM]LSK[MT7].2b4_1.heavy 972.485 / 532.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 1183 152 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37600.[MT7]-TASQLDEFQEC[CAM]LSK[MT7].2b6_1.heavy 972.485 / 760.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 1185 153 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 643624.0 31.60770034790039 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 643624.0 1160.5714747735112 0.0 - - - - - - - 468.0 1287 3 1187 153 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 779599.0 31.60770034790039 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 779599.0 1344.0334782549173 0.0 - - - - - - - 789.0 1559 7 1189 153 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1264910.0 31.60770034790039 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1264910.0 477.5717205314064 0.0 - - - - - - - 711.6 2529 5 1191 154 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24080.[MT7]-LWSTNLDNSVASIEAK[MT7].3y6_1.heavy 679.368 / 762.448 6674.0 38.61050033569336 48 18 10 10 10 7.062662053150841 14.158967149700636 0.0 3 0.9899472445097401 12.298589792289679 6674.0 28.056305732484077 0.0 - - - - - - - 202.07142857142858 13 14 RFWD2 ring finger and WD repeat domain 2 1193 154 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24080.[MT7]-LWSTNLDNSVASIEAK[MT7].3b5_1.heavy 679.368 / 746.395 3376.0 38.61050033569336 48 18 10 10 10 7.062662053150841 14.158967149700636 0.0 3 0.9899472445097401 12.298589792289679 3376.0 24.37027600849257 0.0 - - - - - - - 220.06666666666666 6 15 RFWD2 ring finger and WD repeat domain 2 1195 154 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24080.[MT7]-LWSTNLDNSVASIEAK[MT7].3y4_1.heavy 679.368 / 604.379 2513.0 38.61050033569336 48 18 10 10 10 7.062662053150841 14.158967149700636 0.0 3 0.9899472445097401 12.298589792289679 2513.0 8.427781154276268 0.0 - - - - - - - 270.6111111111111 5 18 RFWD2 ring finger and WD repeat domain 2 1197 154 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24080.[MT7]-LWSTNLDNSVASIEAK[MT7].3y5_1.heavy 679.368 / 691.411 4947.0 38.61050033569336 48 18 10 10 10 7.062662053150841 14.158967149700636 0.0 3 0.9899472445097401 12.298589792289679 4947.0 31.509554140127385 0.0 - - - - - - - 235.8235294117647 9 17 RFWD2 ring finger and WD repeat domain 2 1199 155 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43291.[MT7]-GHAYSVTGAK[MT7].2y4_1.heavy 639.856 / 520.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 1201 155 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43291.[MT7]-GHAYSVTGAK[MT7].2y8_1.heavy 639.856 / 940.522 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 1203 155 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43291.[MT7]-GHAYSVTGAK[MT7].2b4_1.heavy 639.856 / 573.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 1205 155 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43291.[MT7]-GHAYSVTGAK[MT7].2y7_1.heavy 639.856 / 869.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 1207 156 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43539.[MT7]-K[MT7]DVTQIFNNILR.3y7_1.heavy 583.68 / 889.525 1999.0 39.942749977111816 28 14 0 6 8 1.706455564014202 48.030977375165065 0.033802032470703125 4 0.9324938617675224 4.722987511359461 1999.0 4.7434013096294105 1.0 - - - - - - - 186.71428571428572 3 14 CAB39L calcium binding protein 39-like 1209 156 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43539.[MT7]-K[MT7]DVTQIFNNILR.3y6_1.heavy 583.68 / 776.441 6919.0 39.942749977111816 28 14 0 6 8 1.706455564014202 48.030977375165065 0.033802032470703125 4 0.9324938617675224 4.722987511359461 6919.0 27.94175420738328 1.0 - - - - - - - 273.75 84 16 CAB39L calcium binding protein 39-like 1211 156 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43539.[MT7]-K[MT7]DVTQIFNNILR.3b5_1.heavy 583.68 / 860.508 1922.0 39.942749977111816 28 14 0 6 8 1.706455564014202 48.030977375165065 0.033802032470703125 4 0.9324938617675224 4.722987511359461 1922.0 8.32034632034632 1.0 - - - - - - - 181.05882352941177 3 17 CAB39L calcium binding protein 39-like 1213 156 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43539.[MT7]-K[MT7]DVTQIFNNILR.3y5_1.heavy 583.68 / 629.373 4151.0 39.942749977111816 28 14 0 6 8 1.706455564014202 48.030977375165065 0.033802032470703125 4 0.9324938617675224 4.722987511359461 4151.0 9.541788501843394 0.0 - - - - - - - 239.7058823529412 8 17 CAB39L calcium binding protein 39-like 1215 157 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23955.[MT7]-YC[CAM]PLDLYSGNK[MT7].3b6_1.heavy 539.944 / 906.451 21342.0 33.94449996948242 44 14 10 10 10 2.4122435730621503 30.955731927844848 0.0 3 0.935405045334295 4.829443762055278 21342.0 70.81999307958478 0.0 - - - - - - - 247.91666666666666 42 12 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1217 157 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23955.[MT7]-YC[CAM]PLDLYSGNK[MT7].3b5_1.heavy 539.944 / 793.367 64280.0 33.94449996948242 44 14 10 10 10 2.4122435730621503 30.955731927844848 0.0 3 0.935405045334295 4.829443762055278 64280.0 105.41816232065494 0.0 - - - - - - - 667.8571428571429 128 7 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1219 157 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23955.[MT7]-YC[CAM]PLDLYSGNK[MT7].3y4_1.heavy 539.944 / 549.311 97355.0 33.94449996948242 44 14 10 10 10 2.4122435730621503 30.955731927844848 0.0 3 0.935405045334295 4.829443762055278 97355.0 76.96531766118737 0.0 - - - - - - - 690.625 194 8 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1221 157 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23955.[MT7]-YC[CAM]PLDLYSGNK[MT7].3y5_1.heavy 539.944 / 712.375 20236.0 33.94449996948242 44 14 10 10 10 2.4122435730621503 30.955731927844848 0.0 3 0.935405045334295 4.829443762055278 20236.0 53.16909803921569 0.0 - - - - - - - 255.0 40 14 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1223 158 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23958.[MT7]-ELGLGRHENAIK[MT7].3b9_2.heavy 542.317 / 575.808 1499.0 23.01056671142578 42 20 10 6 6 3.2495306838382496 30.773674640881666 0.03460121154785156 5 0.991157855791698 13.114841463302197 1499.0 3.1682404788136855 0.0 - - - - - - - 241.52941176470588 2 17 CAPN1 calpain 1, (mu/I) large subunit 1225 158 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23958.[MT7]-ELGLGRHENAIK[MT7].3y11_2.heavy 542.317 / 676.4 3866.0 23.01056671142578 42 20 10 6 6 3.2495306838382496 30.773674640881666 0.03460121154785156 5 0.991157855791698 13.114841463302197 3866.0 9.80458150920566 0.0 - - - - - - - 227.58823529411765 7 17 CAPN1 calpain 1, (mu/I) large subunit 1227 158 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23958.[MT7]-ELGLGRHENAIK[MT7].3y4_1.heavy 542.317 / 589.379 N/A 23.01056671142578 42 20 10 6 6 3.2495306838382496 30.773674640881666 0.03460121154785156 5 0.991157855791698 13.114841463302197 1184.0 2.476236164491507 10.0 - - - - - - - 710.0 3 8 CAPN1 calpain 1, (mu/I) large subunit 1229 158 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23958.[MT7]-ELGLGRHENAIK[MT7].3y5_1.heavy 542.317 / 718.422 631.0 23.01056671142578 42 20 10 6 6 3.2495306838382496 30.773674640881666 0.03460121154785156 5 0.991157855791698 13.114841463302197 631.0 1.277974683544304 7.0 - - - - - - - 0.0 1 0 CAPN1 calpain 1, (mu/I) large subunit 1231 159 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43536.[MT7]-EVDLSDIINTPLPR.2y8_1.heavy 863.479 / 923.567 2472.0 41.20352363586426 43 17 10 6 10 3.1384073275588174 31.863295475346767 0.03530120849609375 3 0.9731033175934594 7.508181335050206 2472.0 34.426467232855885 0.0 - - - - - - - 224.1578947368421 4 19 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1233 159 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43536.[MT7]-EVDLSDIINTPLPR.2b6_1.heavy 863.479 / 803.39 3915.0 41.20352363586426 43 17 10 6 10 3.1384073275588174 31.863295475346767 0.03530120849609375 3 0.9731033175934594 7.508181335050206 3915.0 18.040789938217124 0.0 - - - - - - - 222.11764705882354 7 17 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1235 159 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43536.[MT7]-EVDLSDIINTPLPR.2y10_1.heavy 863.479 / 1125.63 3709.0 41.20352363586426 43 17 10 6 10 3.1384073275588174 31.863295475346767 0.03530120849609375 3 0.9731033175934594 7.508181335050206 3709.0 30.96834951456311 0.0 - - - - - - - 188.875 7 16 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1237 159 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43536.[MT7]-EVDLSDIINTPLPR.2y11_1.heavy 863.479 / 1238.71 3915.0 41.20352363586426 43 17 10 6 10 3.1384073275588174 31.863295475346767 0.03530120849609375 3 0.9731033175934594 7.508181335050206 3915.0 34.96893203883496 0.0 - - - - - - - 154.5 7 12 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1239 160 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542740.[MT7]-SEQFINLR.2y5_1.heavy 575.82 / 662.398 2523.0 31.440349578857422 34 20 2 6 6 7.7066222972472405 12.975853252302166 0.039398193359375 5 0.9954135079966717 18.216121696402713 2523.0 3.0587912989083588 0.0 - - - - - - - 764.5454545454545 5 11 CAPN1 calpain 1, (mu/I) large subunit 1241 160 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542740.[MT7]-SEQFINLR.2b4_1.heavy 575.82 / 636.311 4579.0 31.440349578857422 34 20 2 6 6 7.7066222972472405 12.975853252302166 0.039398193359375 5 0.9954135079966717 18.216121696402713 4579.0 3.4317987152034264 2.0 - - - - - - - 331.1818181818182 29 11 CAPN1 calpain 1, (mu/I) large subunit 1243 160 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542740.[MT7]-SEQFINLR.2y6_1.heavy 575.82 / 790.457 3458.0 31.440349578857422 34 20 2 6 6 7.7066222972472405 12.975853252302166 0.039398193359375 5 0.9954135079966717 18.216121696402713 3458.0 8.390773352231594 0.0 - - - - - - - 654.4285714285714 6 7 CAPN1 calpain 1, (mu/I) large subunit 1245 160 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542740.[MT7]-SEQFINLR.2y7_1.heavy 575.82 / 919.5 3831.0 31.440349578857422 34 20 2 6 6 7.7066222972472405 12.975853252302166 0.039398193359375 5 0.9954135079966717 18.216121696402713 3831.0 14.666736250797234 0.0 - - - - - - - 226.78571428571428 7 14 CAPN1 calpain 1, (mu/I) large subunit 1247 161 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37161.[MT7]-GC[CAM]LLYK[MT7].2y4_1.heavy 521.304 / 680.446 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1249 161 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37161.[MT7]-GC[CAM]LLYK[MT7].2y5_1.heavy 521.304 / 840.477 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1251 161 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37161.[MT7]-GC[CAM]LLYK[MT7].2b4_1.heavy 521.304 / 588.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1253 161 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37161.[MT7]-GC[CAM]LLYK[MT7].2y3_1.heavy 521.304 / 567.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1255 162 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37462.[MT7]-LSPENNQVLTK[MT7].2y4_1.heavy 765.94 / 604.415 892.0 26.601200103759766 50 20 10 10 10 9.2775515536044 10.778705935743275 0.0 3 0.9946259251993237 16.82735395907193 892.0 1.84 0.0 - - - - - - - 0.0 1 0 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 1257 162 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37462.[MT7]-LSPENNQVLTK[MT7].2b5_1.heavy 765.94 / 685.364 N/A 26.601200103759766 50 20 10 10 10 9.2775515536044 10.778705935743275 0.0 3 0.9946259251993237 16.82735395907193 446.0 0.30000000000000004 10.0 - - - - - - - 0.0 1 0 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 1259 162 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37462.[MT7]-LSPENNQVLTK[MT7].2y9_1.heavy 765.94 / 1186.65 1873.0 26.601200103759766 50 20 10 10 10 9.2775515536044 10.778705935743275 0.0 3 0.9946259251993237 16.82735395907193 1873.0 20.308370786516853 0.0 - - - - - - - 148.33333333333334 3 6 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 1261 162 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37462.[MT7]-LSPENNQVLTK[MT7].2y3_1.heavy 765.94 / 505.347 2052.0 26.601200103759766 50 20 10 10 10 9.2775515536044 10.778705935743275 0.0 3 0.9946259251993237 16.82735395907193 2052.0 9.592526604644938 0.0 - - - - - - - 210.8181818181818 4 11 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 1263 163 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 352609.0 26.20639991760254 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 352609.0 1834.6224816781303 0.0 - - - - - - - 2143.0 705 2 1265 163 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 403505.0 26.20639991760254 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 403505.0 871.4500788356777 0.0 - - - - - - - 2054.0 807 1 1267 163 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 436185.0 26.20639991760254 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 436185.0 18.15914393456791 1.0 - - - - - - - 2947.0 951 1 1269 164 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24142.[MT7]-LVFVHSAEGNEFWSALLEK[MT7].3y7_1.heavy 822.109 / 990.574 1987.0 45.196824073791504 34 11 9 6 8 13.010706640470183 7.68597761546226 0.031299591064453125 4 0.8594263607501188 3.252268967883241 1987.0 9.891869796898142 0.0 - - - - - - - 168.0 3 28 CAPN1 calpain 1, (mu/I) large subunit 1271 164 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24142.[MT7]-LVFVHSAEGNEFWSALLEK[MT7].3y3_1.heavy 822.109 / 533.341 5182.0 45.196824073791504 34 11 9 6 8 13.010706640470183 7.68597761546226 0.031299591064453125 4 0.8594263607501188 3.252268967883241 5182.0 13.002123831501546 1.0 - - - - - - - 256.55555555555554 11 18 CAPN1 calpain 1, (mu/I) large subunit 1273 164 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24142.[MT7]-LVFVHSAEGNEFWSALLEK[MT7].3y6_1.heavy 822.109 / 804.495 5096.0 45.196824073791504 34 11 9 6 8 13.010706640470183 7.68597761546226 0.031299591064453125 4 0.8594263607501188 3.252268967883241 5096.0 10.783536737942118 0.0 - - - - - - - 680.1666666666666 10 12 CAPN1 calpain 1, (mu/I) large subunit 1275 164 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24142.[MT7]-LVFVHSAEGNEFWSALLEK[MT7].3b3_1.heavy 822.109 / 504.33 1857.0 45.196824073791504 34 11 9 6 8 13.010706640470183 7.68597761546226 0.031299591064453125 4 0.8594263607501188 3.252268967883241 1857.0 0.21698841698841675 1.0 - - - - - - - 230.8846153846154 3 26 CAPN1 calpain 1, (mu/I) large subunit 1277 165 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24134.[MT7]-DLIYDMTTSGSGSGLPLLVQR.2b3_1.heavy 1184.12 / 486.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBR1 transforming growth factor, beta receptor 1 1279 165 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24134.[MT7]-DLIYDMTTSGSGSGLPLLVQR.2y12_1.heavy 1184.12 / 1183.68 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBR1 transforming growth factor, beta receptor 1 1281 165 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24134.[MT7]-DLIYDMTTSGSGSGLPLLVQR.2b14_2.heavy 1184.12 / 765.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBR1 transforming growth factor, beta receptor 1 1283 165 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24134.[MT7]-DLIYDMTTSGSGSGLPLLVQR.2b5_1.heavy 1184.12 / 764.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBR1 transforming growth factor, beta receptor 1 1285 166 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23515.[MT7]-NILIK[MT7].2b3_1.heavy 444.81 / 485.32 9763.0 28.390300750732422 40 14 8 10 8 1.6361156948388755 40.94623092105742 0.0 4 0.9465189963562995 5.31260823192642 9763.0 12.147323660176657 1.0 - - - - - - - 696.2727272727273 25 11 BMPR1A bone morphogenetic protein receptor, type IA 1287 166 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23515.[MT7]-NILIK[MT7].2y4_1.heavy 444.81 / 630.467 8416.0 28.390300750732422 40 14 8 10 8 1.6361156948388755 40.94623092105742 0.0 4 0.9465189963562995 5.31260823192642 8416.0 11.802158879574826 0.0 - - - - - - - 596.7272727272727 16 11 BMPR1A bone morphogenetic protein receptor, type IA 1289 166 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23515.[MT7]-NILIK[MT7].2y3_1.heavy 444.81 / 517.383 9679.0 28.390300750732422 40 14 8 10 8 1.6361156948388755 40.94623092105742 0.0 4 0.9465189963562995 5.31260823192642 9679.0 14.581214902807776 0.0 - - - - - - - 715.0833333333334 19 12 BMPR1A bone morphogenetic protein receptor, type IA 1291 167 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37557.[MT7]-K[MT7]QPWYNSTLASR.3y7_1.heavy 580.321 / 748.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 1293 167 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37557.[MT7]-K[MT7]QPWYNSTLASR.3b4_1.heavy 580.321 / 828.497 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 1295 167 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37557.[MT7]-K[MT7]QPWYNSTLASR.3y8_1.heavy 580.321 / 911.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 1297 167 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37557.[MT7]-K[MT7]QPWYNSTLASR.3y3_2.heavy 580.321 / 167.098 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 1299 168 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543373.[MT7]-RDFFLANASR.3y6_1.heavy 447.578 / 631.352 17697.0 30.130199432373047 48 18 10 10 10 6.389657585485902 15.650290905595607 0.0 3 0.9845729206025042 9.923402384511466 17697.0 44.421886822724744 0.0 - - - - - - - 639.6666666666666 35 9 CAPN1 calpain 1, (mu/I) large subunit 1301 168 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543373.[MT7]-RDFFLANASR.3b4_1.heavy 447.578 / 710.374 38695.0 30.130199432373047 48 18 10 10 10 6.389657585485902 15.650290905595607 0.0 3 0.9845729206025042 9.923402384511466 38695.0 184.60857547673797 0.0 - - - - - - - 235.44444444444446 77 9 CAPN1 calpain 1, (mu/I) large subunit 1303 168 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543373.[MT7]-RDFFLANASR.3b3_1.heavy 447.578 / 563.306 8806.0 30.130199432373047 48 18 10 10 10 6.389657585485902 15.650290905595607 0.0 3 0.9845729206025042 9.923402384511466 8806.0 30.524548872880253 0.0 - - - - - - - 713.7142857142857 17 7 CAPN1 calpain 1, (mu/I) large subunit 1305 168 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543373.[MT7]-RDFFLANASR.3y5_1.heavy 447.578 / 518.268 83148.0 30.130199432373047 48 18 10 10 10 6.389657585485902 15.650290905595607 0.0 3 0.9845729206025042 9.923402384511466 83148.0 199.97606907832173 0.0 - - - - - - - 701.5714285714286 166 7 CAPN1 calpain 1, (mu/I) large subunit 1307 169 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543627.[MT7]-YVTTILDDAK[MT7].3b4_1.heavy 476.273 / 609.336 52966.0 35.849098205566406 50 20 10 10 10 18.62546009516949 5.368994885980561 0.0 3 0.9993330437757754 47.78477703530768 52966.0 216.72638929978962 0.0 - - - - - - - 244.75 105 16 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1309 169 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543627.[MT7]-YVTTILDDAK[MT7].3b3_1.heavy 476.273 / 508.289 21860.0 35.849098205566406 50 20 10 10 10 18.62546009516949 5.368994885980561 0.0 3 0.9993330437757754 47.78477703530768 21860.0 37.34100267766681 0.0 - - - - - - - 253.07692307692307 43 13 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1311 169 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543627.[MT7]-YVTTILDDAK[MT7].3y4_1.heavy 476.273 / 592.306 116744.0 35.849098205566406 50 20 10 10 10 18.62546009516949 5.368994885980561 0.0 3 0.9993330437757754 47.78477703530768 116744.0 152.78879836301758 0.0 - - - - - - - 306.27272727272725 233 11 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1313 169 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543627.[MT7]-YVTTILDDAK[MT7].3y5_1.heavy 476.273 / 705.39 35963.0 35.849098205566406 50 20 10 10 10 18.62546009516949 5.368994885980561 0.0 3 0.9993330437757754 47.78477703530768 35963.0 112.10134009986973 0.0 - - - - - - - 267.29411764705884 71 17 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1315 170 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542234.[MT7]-GQVVSLIR.2y5_1.heavy 508.323 / 587.388 5957.0 30.8267502784729 36 20 2 6 8 14.699208775090534 6.8030872634084405 0.03579902648925781 4 0.9978962405807021 26.902222856624018 5957.0 10.894900971121801 1.0 - - - - - - - 733.0 24 12 CAPN1 calpain 1, (mu/I) large subunit 1317 170 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542234.[MT7]-GQVVSLIR.2b4_1.heavy 508.323 / 528.326 4307.0 30.8267502784729 36 20 2 6 8 14.699208775090534 6.8030872634084405 0.03579902648925781 4 0.9978962405807021 26.902222856624018 4307.0 5.693682390657202 0.0 - - - - - - - 744.5 8 8 CAPN1 calpain 1, (mu/I) large subunit 1319 170 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542234.[MT7]-GQVVSLIR.2y6_1.heavy 508.323 / 686.456 5040.0 30.8267502784729 36 20 2 6 8 14.699208775090534 6.8030872634084405 0.03579902648925781 4 0.9978962405807021 26.902222856624018 5040.0 15.15370819915779 0.0 - - - - - - - 280.6875 10 16 CAPN1 calpain 1, (mu/I) large subunit 1321 170 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542234.[MT7]-GQVVSLIR.2y7_1.heavy 508.323 / 814.515 5224.0 30.8267502784729 36 20 2 6 8 14.699208775090534 6.8030872634084405 0.03579902648925781 4 0.9978962405807021 26.902222856624018 5224.0 18.044558193849745 0.0 - - - - - - - 217.6875 10 16 CAPN1 calpain 1, (mu/I) large subunit 1323 171 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23512.[MT7]-GAFSVVR.2y5_1.heavy 440.262 / 607.356 4411.0 27.873699188232422 48 18 10 10 10 6.917698142042621 14.455675565293248 0.0 3 0.9887435528661973 11.621266859411493 4411.0 21.860283851760595 0.0 - - - - - - - 243.33333333333334 8 15 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1325 171 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23512.[MT7]-GAFSVVR.2b4_1.heavy 440.262 / 507.268 10435.0 27.873699188232422 48 18 10 10 10 6.917698142042621 14.455675565293248 0.0 3 0.9887435528661973 11.621266859411493 10435.0 23.30349622197862 0.0 - - - - - - - 650.6666666666666 20 9 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1327 171 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23512.[MT7]-GAFSVVR.2y6_1.heavy 440.262 / 678.393 7635.0 27.873699188232422 48 18 10 10 10 6.917698142042621 14.455675565293248 0.0 3 0.9887435528661973 11.621266859411493 7635.0 47.621299944506106 0.0 - - - - - - - 169.91666666666666 15 12 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1329 171 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23512.[MT7]-GAFSVVR.2b5_1.heavy 440.262 / 606.337 N/A 27.873699188232422 48 18 10 10 10 6.917698142042621 14.455675565293248 0.0 3 0.9887435528661973 11.621266859411493 8484.0 7.525898085373819 0.0 - - - - - - - 654.5714285714286 16 7 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1331 172 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23673.[MT7]-ELVHVITR.2y5_1.heavy 555.841 / 625.378 5319.0 26.72010040283203 50 20 10 10 10 13.540486574512 7.385258974979192 0.0 3 0.9981308300845162 28.541073755470045 5319.0 14.64178214956058 0.0 - - - - - - - 245.25 10 16 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1333 172 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23673.[MT7]-ELVHVITR.2b4_1.heavy 555.841 / 623.363 1918.0 26.72010040283203 50 20 10 10 10 13.540486574512 7.385258974979192 0.0 3 0.9981308300845162 28.541073755470045 1918.0 3.6576247374855027 0.0 - - - - - - - 241.11764705882354 3 17 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1335 172 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23673.[MT7]-ELVHVITR.2y6_1.heavy 555.841 / 724.446 3139.0 26.72010040283203 50 20 10 10 10 13.540486574512 7.385258974979192 0.0 3 0.9981308300845162 28.541073755470045 3139.0 13.783202825958572 0.0 - - - - - - - 224.8421052631579 6 19 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1337 172 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23673.[MT7]-ELVHVITR.2y7_1.heavy 555.841 / 837.531 3575.0 26.72010040283203 50 20 10 10 10 13.540486574512 7.385258974979192 0.0 3 0.9981308300845162 28.541073755470045 3575.0 20.289467327368527 0.0 - - - - - - - 261.75 7 12 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1339 173 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23935.[MT7]-DETFLLQAPLQR.2y6_1.heavy 787.937 / 712.41 1849.0 37.87699890136719 48 18 10 10 10 4.542776107462039 22.01297128329489 0.0 3 0.9887909867834033 11.645876363862135 1849.0 7.008207065096645 0.0 - - - - - - - 258.10526315789474 3 19 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1341 173 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23935.[MT7]-DETFLLQAPLQR.2b4_1.heavy 787.937 / 637.295 1849.0 37.87699890136719 48 18 10 10 10 4.542776107462039 22.01297128329489 0.0 3 0.9887909867834033 11.645876363862135 1849.0 4.369527363184079 0.0 - - - - - - - 196.75 3 20 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1343 173 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23935.[MT7]-DETFLLQAPLQR.2y9_1.heavy 787.937 / 1085.65 N/A 37.87699890136719 48 18 10 10 10 4.542776107462039 22.01297128329489 0.0 3 0.9887909867834033 11.645876363862135 482.0 -0.5 2.0 - - - - - - - 0.0 0 0 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1345 173 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23935.[MT7]-DETFLLQAPLQR.2y7_1.heavy 787.937 / 825.494 2170.0 37.87699890136719 48 18 10 10 10 4.542776107462039 22.01297128329489 0.0 3 0.9887909867834033 11.645876363862135 2170.0 10.518407960199006 0.0 - - - - - - - 224.26315789473685 4 19 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1347 174 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37175.[MT7]-NPAEIVK[MT7].2y4_1.heavy 529.826 / 632.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 1349 174 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37175.[MT7]-NPAEIVK[MT7].2b4_1.heavy 529.826 / 556.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 1351 174 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37175.[MT7]-NPAEIVK[MT7].2y3_1.heavy 529.826 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 1353 174 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37175.[MT7]-NPAEIVK[MT7].2y6_1.heavy 529.826 / 800.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 1355 175 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23932.[MT7]-WNTTLYEGTWR.2y4_1.heavy 785.892 / 519.267 2411.0 36.84320068359375 44 14 10 10 10 1.279934153681506 51.3263437253679 0.0 3 0.9463183779565837 5.302581396014258 2411.0 11.587048900608833 0.0 - - - - - - - 272.1666666666667 4 18 CAPN1 calpain 1, (mu/I) large subunit 1357 175 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23932.[MT7]-WNTTLYEGTWR.2y8_1.heavy 785.892 / 1025.51 1849.0 36.84320068359375 44 14 10 10 10 1.279934153681506 51.3263437253679 0.0 3 0.9463183779565837 5.302581396014258 1849.0 15.733726708074533 0.0 - - - - - - - 166.0 3 15 CAPN1 calpain 1, (mu/I) large subunit 1359 175 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23932.[MT7]-WNTTLYEGTWR.2y6_1.heavy 785.892 / 811.373 3054.0 36.84320068359375 44 14 10 10 10 1.279934153681506 51.3263437253679 0.0 3 0.9463183779565837 5.302581396014258 3054.0 22.769339019189765 0.0 - - - - - - - 198.2 6 15 CAPN1 calpain 1, (mu/I) large subunit 1361 175 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23932.[MT7]-WNTTLYEGTWR.2y10_1.heavy 785.892 / 1240.6 3536.0 36.84320068359375 44 14 10 10 10 1.279934153681506 51.3263437253679 0.0 3 0.9463183779565837 5.302581396014258 3536.0 50.352815920398015 0.0 - - - - - - - 127.08333333333333 7 12 CAPN1 calpain 1, (mu/I) large subunit 1363 176 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 148624.0 36.07630157470703 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 148624.0 127.40370065992903 0.0 - - - - - - - 305.65 297 20 1365 176 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 341990.0 36.07630157470703 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 341990.0 227.15653704161758 0.0 - - - - - - - 175.0 683 19 1367 176 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 353059.0 36.07630157470703 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 353059.0 103.0662856614168 0.0 - - - - - - - 247.75 706 20 1369 177 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42915.[MT7]-SK[MT7]DDAPHELESQFILR.4b4_1.heavy 544.043 / 734.392 3758.0 32.64820098876953 43 13 10 10 10 2.7368575329301943 36.53825557113885 0.0 3 0.9116463538694362 4.120969610266711 3758.0 1.159202247841315 1.0 - - - - - - - 686.4285714285714 8 7 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1371 177 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42915.[MT7]-SK[MT7]DDAPHELESQFILR.4b5_1.heavy 544.043 / 805.429 2359.0 32.64820098876953 43 13 10 10 10 2.7368575329301943 36.53825557113885 0.0 3 0.9116463538694362 4.120969610266711 2359.0 9.454007633587786 0.0 - - - - - - - 215.88235294117646 4 17 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1373 177 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42915.[MT7]-SK[MT7]DDAPHELESQFILR.4y7_1.heavy 544.043 / 892.489 3845.0 32.64820098876953 43 13 10 10 10 2.7368575329301943 36.53825557113885 0.0 3 0.9116463538694362 4.120969610266711 3845.0 17.034896044458975 0.0 - - - - - - - 205.92857142857142 7 14 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1375 177 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42915.[MT7]-SK[MT7]DDAPHELESQFILR.4y6_1.heavy 544.043 / 763.446 9001.0 32.64820098876953 43 13 10 10 10 2.7368575329301943 36.53825557113885 0.0 3 0.9116463538694362 4.120969610266711 9001.0 61.51187591036415 0.0 - - - - - - - 218.5 18 12 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1377 178 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43457.[MT7]-RLLSTDAEAVSTR.3y7_1.heavy 521.625 / 733.384 13997.0 25.11389923095703 42 12 10 10 10 0.8669699466487418 60.34453012870199 0.0 3 0.8943917656711371 3.7637013671278403 13997.0 157.67306146572105 0.0 - - - - - - - 259.3333333333333 27 9 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1379 178 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43457.[MT7]-RLLSTDAEAVSTR.3y6_1.heavy 521.625 / 662.347 17587.0 25.11389923095703 42 12 10 10 10 0.8669699466487418 60.34453012870199 0.0 3 0.8943917656711371 3.7637013671278403 17587.0 113.92999744648517 0.0 - - - - - - - 794.7142857142857 35 7 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1381 178 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43457.[MT7]-RLLSTDAEAVSTR.3b6_1.heavy 521.625 / 830.485 16958.0 25.11389923095703 42 12 10 10 10 0.8669699466487418 60.34453012870199 0.0 3 0.8943917656711371 3.7637013671278403 16958.0 49.62494744799163 0.0 - - - - - - - 215.33333333333334 33 15 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1383 178 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43457.[MT7]-RLLSTDAEAVSTR.3y5_1.heavy 521.625 / 533.304 37775.0 25.11389923095703 42 12 10 10 10 0.8669699466487418 60.34453012870199 0.0 3 0.8943917656711371 3.7637013671278403 37775.0 27.32902817772755 0.0 - - - - - - - 743.4285714285714 75 7 TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1385 179 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23526.[MT7]-LAIQC[CAM]R.2y4_1.heavy 452.761 / 576.292 11413.0 24.239550590515137 46 20 10 6 10 4.372197924325118 22.871791655094334 0.036998748779296875 3 0.9951827341525555 17.774097814850986 11413.0 33.902895142400205 0.0 - - - - - - - 632.875 22 8 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1387 179 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23526.[MT7]-LAIQC[CAM]R.2y5_1.heavy 452.761 / 647.329 49770.0 24.239550590515137 46 20 10 6 10 4.372197924325118 22.871791655094334 0.036998748779296875 3 0.9951827341525555 17.774097814850986 49770.0 38.28461538461538 0.0 - - - - - - - 809.0 99 7 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1389 179 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23526.[MT7]-LAIQC[CAM]R.2b4_1.heavy 452.761 / 570.373 7551.0 24.239550590515137 46 20 10 6 10 4.372197924325118 22.871791655094334 0.036998748779296875 3 0.9951827341525555 17.774097814850986 7551.0 5.804696540068873 0.0 - - - - - - - 234.0 15 11 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1391 179 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23526.[MT7]-LAIQC[CAM]R.2y3_1.heavy 452.761 / 463.208 11155.0 24.239550590515137 46 20 10 6 10 4.372197924325118 22.871791655094334 0.036998748779296875 3 0.9951827341525555 17.774097814850986 11155.0 24.015319432567033 0.0 - - - - - - - 650.8333333333334 22 12 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1393 180 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24124.[MT7]-ADQSFTSPPPRDFLLDIAR.3y7_1.heavy 764.07 / 847.504 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1395 180 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24124.[MT7]-ADQSFTSPPPRDFLLDIAR.3y17_2.heavy 764.07 / 980.518 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1397 180 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24124.[MT7]-ADQSFTSPPPRDFLLDIAR.3b4_1.heavy 764.07 / 546.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1399 180 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24124.[MT7]-ADQSFTSPPPRDFLLDIAR.3y14_2.heavy 764.07 / 799.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1401 181 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37568.[MT7]-NQPQAPGVEASGAGEAR.2y8_1.heavy 891.946 / 718.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF1B tumor necrosis factor receptor superfamily, member 1B 1403 181 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37568.[MT7]-NQPQAPGVEASGAGEAR.2y12_1.heavy 891.946 / 1100.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF1B tumor necrosis factor receptor superfamily, member 1B 1405 181 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37568.[MT7]-NQPQAPGVEASGAGEAR.2y13_1.heavy 891.946 / 1171.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF1B tumor necrosis factor receptor superfamily, member 1B 1407 181 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37568.[MT7]-NQPQAPGVEASGAGEAR.2b5_1.heavy 891.946 / 683.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF1B tumor necrosis factor receptor superfamily, member 1B 1409 182 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23528.[MT7]-TPWTTR.2y4_1.heavy 453.252 / 563.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1411 182 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23528.[MT7]-TPWTTR.2y5_1.heavy 453.252 / 660.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1413 182 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23528.[MT7]-TPWTTR.2y3_1.heavy 453.252 / 377.214 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1415 183 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24127.[MT7]-TSEEIFQHLQNIVDFGK[MT7].4y4_1.heavy 574.057 / 610.332 79237.0 44.17770004272461 38 8 10 10 10 0.6958230543216802 95.26287572345862 0.0 3 0.7588363476453465 2.460734065573087 79237.0 203.48266768792433 0.0 - - - - - - - 558.875 158 8 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1417 183 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24127.[MT7]-TSEEIFQHLQNIVDFGK[MT7].4b11_2.heavy 574.057 / 736.369 73497.0 44.17770004272461 38 8 10 10 10 0.6958230543216802 95.26287572345862 0.0 3 0.7588363476453465 2.460734065573087 73497.0 196.56445307518186 0.0 - - - - - - - 216.86666666666667 146 15 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1419 183 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24127.[MT7]-TSEEIFQHLQNIVDFGK[MT7].4b7_1.heavy 574.057 / 979.485 6603.0 44.17770004272461 38 8 10 10 10 0.6958230543216802 95.26287572345862 0.0 3 0.7588363476453465 2.460734065573087 6603.0 71.08453914959813 0.0 - - - - - - - 147.4 13 10 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1421 183 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24127.[MT7]-TSEEIFQHLQNIVDFGK[MT7].4b5_1.heavy 574.057 / 704.358 11530.0 44.17770004272461 38 8 10 10 10 0.6958230543216802 95.26287572345862 0.0 3 0.7588363476453465 2.460734065573087 11530.0 67.24326831957822 0.0 - - - - - - - 169.27777777777777 23 18 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1423 184 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24128.[MT7]-YVELSTFDIASDAFATFK[MT7].3y3_1.heavy 771.735 / 539.331 17371.0 48.58420181274414 43 13 10 10 10 0.9972766531090873 58.53024332041356 0.0 3 0.9101205399761345 4.085303519390454 17371.0 268.4609090909091 0.0 - - - - - - - 202.88888888888889 34 27 CAB39L calcium binding protein 39-like 1425 184 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24128.[MT7]-YVELSTFDIASDAFATFK[MT7].3b4_1.heavy 771.735 / 649.368 10458.0 48.58420181274414 43 13 10 10 10 0.9972766531090873 58.53024332041356 0.0 3 0.9101205399761345 4.085303519390454 10458.0 39.79369834710744 0.0 - - - - - - - 188.89655172413794 20 29 CAB39L calcium binding protein 39-like 1427 184 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24128.[MT7]-YVELSTFDIASDAFATFK[MT7].3b3_1.heavy 771.735 / 536.284 9225.0 48.58420181274414 43 13 10 10 10 0.9972766531090873 58.53024332041356 0.0 3 0.9101205399761345 4.085303519390454 9225.0 81.51361138861138 1.0 - - - - - - - 682.6666666666666 24 9 CAB39L calcium binding protein 39-like 1429 184 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24128.[MT7]-YVELSTFDIASDAFATFK[MT7].3b8_1.heavy 771.735 / 1099.54 12197.0 48.58420181274414 43 13 10 10 10 0.9972766531090873 58.53024332041356 0.0 3 0.9101205399761345 4.085303519390454 12197.0 148.58163636363633 0.0 - - - - - - - 129.64285714285714 24 28 CAB39L calcium binding protein 39-like 1431 185 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37464.[MT7]-AAVEQLTEEQK[MT7].2y8_1.heavy 767.422 / 1148.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNNC1 troponin C type 1 (slow) 1433 185 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37464.[MT7]-AAVEQLTEEQK[MT7].2y5_1.heavy 767.422 / 778.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNNC1 troponin C type 1 (slow) 1435 185 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37464.[MT7]-AAVEQLTEEQK[MT7].2b4_1.heavy 767.422 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNNC1 troponin C type 1 (slow) 1437 185 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37464.[MT7]-AAVEQLTEEQK[MT7].2b5_1.heavy 767.422 / 643.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNNC1 troponin C type 1 (slow) 1439 186 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43254.[MT7]-VPLDVC[CAM]LK[MT7].2y4_1.heavy 616.37 / 663.398 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1441 186 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43254.[MT7]-VPLDVC[CAM]LK[MT7].2y5_1.heavy 616.37 / 778.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1443 186 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43254.[MT7]-VPLDVC[CAM]LK[MT7].2y3_1.heavy 616.37 / 564.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1445 186 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43254.[MT7]-VPLDVC[CAM]LK[MT7].2y7_1.heavy 616.37 / 988.562 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1447 187 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43357.[MT7]-TIVLQESIGK[MT7].2y4_1.heavy 688.424 / 548.352 2871.0 31.21980094909668 44 20 4 10 10 7.962304858066436 12.55917749729115 0.0 3 0.9952170300270493 17.837758880221326 2871.0 22.7480556095664 0.0 - - - - - - - 254.91666666666666 5 12 TGFBR1 transforming growth factor, beta receptor 1 1449 187 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43357.[MT7]-TIVLQESIGK[MT7].2y5_1.heavy 688.424 / 677.395 2871.0 31.21980094909668 44 20 4 10 10 7.962304858066436 12.55917749729115 0.0 3 0.9952170300270493 17.837758880221326 2871.0 3.2014748201438845 0.0 - - - - - - - 648.4444444444445 5 9 TGFBR1 transforming growth factor, beta receptor 1 1451 187 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43357.[MT7]-TIVLQESIGK[MT7].2b4_1.heavy 688.424 / 571.394 2316.0 31.21980094909668 44 20 4 10 10 7.962304858066436 12.55917749729115 0.0 3 0.9952170300270493 17.837758880221326 2316.0 11.265095095095095 1.0 - - - - - - - 235.30769230769232 10 13 TGFBR1 transforming growth factor, beta receptor 1 1453 187 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43357.[MT7]-TIVLQESIGK[MT7].2y7_1.heavy 688.424 / 918.538 3149.0 31.21980094909668 44 20 4 10 10 7.962304858066436 12.55917749729115 0.0 3 0.9952170300270493 17.837758880221326 3149.0 36.5781590006666 0.0 - - - - - - - 202.36363636363637 6 11 TGFBR1 transforming growth factor, beta receptor 1 1455 188 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23521.[MT7]-SLTC[CAM]K[MT7].2b3_1.heavy 448.759 / 446.273 554.0 18.092500686645508 29 13 2 10 4 1.5999149270310364 36.96889046058924 0.0 9 0.9002754230450165 3.8751119639275733 554.0 1.1954060324825986 10.0 - - - - - - - 265.2173913043478 3 23 ATXN7L1;IL7R;ATXN7 ataxin 7-like 1;interleukin 7 receptor;ataxin 7 1457 188 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23521.[MT7]-SLTC[CAM]K[MT7].2y4_1.heavy 448.759 / 665.377 2772.0 18.092500686645508 29 13 2 10 4 1.5999149270310364 36.96889046058924 0.0 9 0.9002754230450165 3.8751119639275733 2772.0 7.691137297889833 1.0 - - - - - - - 196.0909090909091 5 22 ATXN7L1;IL7R;ATXN7 ataxin 7-like 1;interleukin 7 receptor;ataxin 7 1459 188 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23521.[MT7]-SLTC[CAM]K[MT7].2y3_1.heavy 448.759 / 552.293 2217.0 18.092500686645508 29 13 2 10 4 1.5999149270310364 36.96889046058924 0.0 9 0.9002754230450165 3.8751119639275733 2217.0 9.591353302761245 1.0 - - - - - - - 249.94444444444446 12 18 ATXN7L1;IL7R;ATXN7 ataxin 7-like 1;interleukin 7 receptor;ataxin 7 1461 189 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23682.[MT7]-LISLAAQK[MT7].2y4_1.heavy 566.371 / 561.348 12543.0 31.807600021362305 44 20 6 10 8 11.923014752212854 8.387140507516397 0.0 4 0.997078712393759 22.828082324814947 12543.0 16.017344668478604 1.0 - - - - - - - 327.6666666666667 49 6 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 1463 189 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23682.[MT7]-LISLAAQK[MT7].2y5_1.heavy 566.371 / 674.432 5148.0 31.807600021362305 44 20 6 10 8 11.923014752212854 8.387140507516397 0.0 4 0.997078712393759 22.828082324814947 5148.0 11.683982516840796 0.0 - - - - - - - 713.75 10 8 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 1465 189 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23682.[MT7]-LISLAAQK[MT7].2y6_1.heavy 566.371 / 761.464 14883.0 31.807600021362305 44 20 6 10 8 11.923014752212854 8.387140507516397 0.0 4 0.997078712393759 22.828082324814947 14883.0 42.80760908497145 0.0 - - - - - - - 304.0833333333333 29 12 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 1467 189 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23682.[MT7]-LISLAAQK[MT7].2y7_1.heavy 566.371 / 874.548 9173.0 31.807600021362305 44 20 6 10 8 11.923014752212854 8.387140507516397 0.0 4 0.997078712393759 22.828082324814947 9173.0 26.50204819211649 0.0 - - - - - - - 224.6 18 10 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 1469 190 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23920.[MT7]-APSDLYQIILK[MT7].2b4_1.heavy 774.966 / 515.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 1471 190 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23920.[MT7]-APSDLYQIILK[MT7].2y3_1.heavy 774.966 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 1473 190 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23920.[MT7]-APSDLYQIILK[MT7].2b7_1.heavy 774.966 / 919.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 1475 190 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23920.[MT7]-APSDLYQIILK[MT7].2b5_1.heavy 774.966 / 628.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 1477 191 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43192.[MT7]-GRFGEVWR.2y5_1.heavy 575.816 / 646.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBR1;ACVR1B transforming growth factor, beta receptor 1;activin A receptor, type IB 1479 191 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43192.[MT7]-GRFGEVWR.2b6_1.heavy 575.816 / 790.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBR1;ACVR1B transforming growth factor, beta receptor 1;activin A receptor, type IB 1481 191 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43192.[MT7]-GRFGEVWR.2y6_1.heavy 575.816 / 793.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBR1;ACVR1B transforming growth factor, beta receptor 1;activin A receptor, type IB 1483 191 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43192.[MT7]-GRFGEVWR.2b5_1.heavy 575.816 / 691.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBR1;ACVR1B transforming growth factor, beta receptor 1;activin A receptor, type IB 1485 192 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23925.[MT7]-DRPFVC[CAM]APSSK[MT7].3y3_1.heavy 517.945 / 465.279 N/A 23.542499542236328 43 17 10 10 6 3.8107157057682843 26.241789658732586 0.0 6 0.9771291260548581 8.144975314834523 25381.0 14.98024917350451 2.0 - - - - - - - 485.0 113 1 TGFBR1 transforming growth factor, beta receptor 1 1487 192 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23925.[MT7]-DRPFVC[CAM]APSSK[MT7].3b4_1.heavy 517.945 / 660.359 3476.0 23.542499542236328 43 17 10 10 6 3.8107157057682843 26.241789658732586 0.0 6 0.9771291260548581 8.144975314834523 3476.0 1.2282685512367493 4.0 - - - - - - - 404.0 68 5 TGFBR1 transforming growth factor, beta receptor 1 1489 192 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23925.[MT7]-DRPFVC[CAM]APSSK[MT7].3b5_1.heavy 517.945 / 759.427 4042.0 23.542499542236328 43 17 10 10 6 3.8107157057682843 26.241789658732586 0.0 6 0.9771291260548581 8.144975314834523 4042.0 18.464554302179444 0.0 - - - - - - - 272.2105263157895 8 19 TGFBR1 transforming growth factor, beta receptor 1 1491 192 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23925.[MT7]-DRPFVC[CAM]APSSK[MT7].3y4_1.heavy 517.945 / 562.332 60461.0 23.542499542236328 43 17 10 10 6 3.8107157057682843 26.241789658732586 0.0 6 0.9771291260548581 8.144975314834523 60461.0 260.6377191502655 0.0 - - - - - - - 276.85714285714283 120 7 TGFBR1 transforming growth factor, beta receptor 1 1493 193 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43589.[MT7]-TASQLDEFQEC[CAM]LSK[MT7].3b6_1.heavy 648.659 / 760.396 6100.0 33.41909980773926 41 15 10 6 10 1.4493875783072048 42.78624619478189 0.038402557373046875 3 0.9573782291814635 5.956510267674117 6100.0 24.011698158303567 0.0 - - - - - - - 211.71428571428572 12 14 RFWD2 ring finger and WD repeat domain 2 1495 193 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43589.[MT7]-TASQLDEFQEC[CAM]LSK[MT7].3b4_1.heavy 648.659 / 532.285 4321.0 33.41909980773926 41 15 10 6 10 1.4493875783072048 42.78624619478189 0.038402557373046875 3 0.9573782291814635 5.956510267674117 4321.0 10.354601136895944 0.0 - - - - - - - 738.2857142857143 8 7 RFWD2 ring finger and WD repeat domain 2 1497 193 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43589.[MT7]-TASQLDEFQEC[CAM]LSK[MT7].3y4_1.heavy 648.659 / 651.362 6524.0 33.41909980773926 41 15 10 6 10 1.4493875783072048 42.78624619478189 0.038402557373046875 3 0.9573782291814635 5.956510267674117 6524.0 38.76260139652355 0.0 - - - - - - - 249.9 13 20 RFWD2 ring finger and WD repeat domain 2 1499 193 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43589.[MT7]-TASQLDEFQEC[CAM]LSK[MT7].3b7_1.heavy 648.659 / 889.438 5762.0 33.41909980773926 41 15 10 6 10 1.4493875783072048 42.78624619478189 0.038402557373046875 3 0.9573782291814635 5.956510267674117 5762.0 40.723021242429 0.0 - - - - - - - 188.84615384615384 11 13 RFWD2 ring finger and WD repeat domain 2 1501 194 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43442.[MT7]-SLLQEAQNNLK[MT7].2y4_1.heavy 773.446 / 632.385 1193.0 33.76552486419678 43 17 10 6 10 3.1936365793006045 31.312266601699452 0.035099029541015625 3 0.9741850651097302 7.6645758371236985 1193.0 3.498533724340176 5.0 - - - - - - - 198.72222222222223 2 18 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1503 194 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43442.[MT7]-SLLQEAQNNLK[MT7].2b4_1.heavy 773.446 / 586.368 2386.0 33.76552486419678 43 17 10 6 10 3.1936365793006045 31.312266601699452 0.035099029541015625 3 0.9741850651097302 7.6645758371236985 2386.0 16.809457720588235 0.0 - - - - - - - 205.52941176470588 4 17 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1505 194 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43442.[MT7]-SLLQEAQNNLK[MT7].2b6_1.heavy 773.446 / 786.448 1108.0 33.76552486419678 43 17 10 6 10 3.1936365793006045 31.312266601699452 0.035099029541015625 3 0.9741850651097302 7.6645758371236985 1108.0 14.323547794117648 2.0 - - - - - - - 223.5625 3 16 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1507 194 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43442.[MT7]-SLLQEAQNNLK[MT7].2y6_1.heavy 773.446 / 831.481 1960.0 33.76552486419678 43 17 10 6 10 3.1936365793006045 31.312266601699452 0.035099029541015625 3 0.9741850651097302 7.6645758371236985 1960.0 9.78478523374159 0.0 - - - - - - - 170.26315789473685 3 19 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1509 195 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43584.[MT7]-FISDIANDALQHC[CAM]K[MT7].3b6_1.heavy 640.668 / 791.442 2420.0 36.11240005493164 43 13 10 10 10 1.6037198539617192 50.8171241121956 0.0 3 0.914505309718348 4.190337161787463 2420.0 10.176410256410257 0.0 - - - - - - - 205.26315789473685 4 19 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 1511 195 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43584.[MT7]-FISDIANDALQHC[CAM]K[MT7].3y3_1.heavy 640.668 / 588.304 5700.0 36.11240005493164 43 13 10 10 10 1.6037198539617192 50.8171241121956 0.0 3 0.914505309718348 4.190337161787463 5700.0 17.04473226304212 0.0 - - - - - - - 679.6 11 10 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 1513 195 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43584.[MT7]-FISDIANDALQHC[CAM]K[MT7].3y6_1.heavy 640.668 / 900.484 N/A 36.11240005493164 43 13 10 10 10 1.6037198539617192 50.8171241121956 0.0 3 0.914505309718348 4.190337161787463 468.0 0.6000000000000001 6.0 - - - - - - - 0.0 1 0 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 1515 195 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43584.[MT7]-FISDIANDALQHC[CAM]K[MT7].3b4_1.heavy 640.668 / 607.321 6090.0 36.11240005493164 43 13 10 10 10 1.6037198539617192 50.8171241121956 0.0 3 0.914505309718348 4.190337161787463 6090.0 23.94358974358974 0.0 - - - - - - - 262.7368421052632 12 19 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 1517 196 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23825.[MT7]-YLEEFPEER.2b3_1.heavy 678.334 / 550.299 N/A 33.21179962158203 37 13 8 10 6 1.5739545836222364 54.01389472161908 0.0 5 0.9147570474776898 4.196610902651749 1141.0 0.6501424501424502 6.0 - - - - - - - 271.9 2 10 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1519 196 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23825.[MT7]-YLEEFPEER.2y4_1.heavy 678.334 / 530.257 1316.0 33.21179962158203 37 13 8 10 6 1.5739545836222364 54.01389472161908 0.0 5 0.9147570474776898 4.196610902651749 1316.0 8.265397506310054 0.0 - - - - - - - 201.2941176470588 2 17 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1521 196 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23825.[MT7]-YLEEFPEER.2y5_1.heavy 678.334 / 677.325 2018.0 33.21179962158203 37 13 8 10 6 1.5739545836222364 54.01389472161908 0.0 5 0.9147570474776898 4.196610902651749 2018.0 4.467221468726986 3.0 - - - - - - - 294.64285714285717 5 14 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1523 196 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23825.[MT7]-YLEEFPEER.2y7_1.heavy 678.334 / 935.411 2193.0 33.21179962158203 37 13 8 10 6 1.5739545836222364 54.01389472161908 0.0 5 0.9147570474776898 4.196610902651749 2193.0 15.274641067360886 0.0 - - - - - - - 252.125 4 8 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1525 197 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43390.[MT7]-FYFENLLAK[MT7].2y5_1.heavy 716.908 / 702.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 1527 197 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43390.[MT7]-FYFENLLAK[MT7].2b4_1.heavy 716.908 / 731.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 1529 197 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43390.[MT7]-FYFENLLAK[MT7].2b5_1.heavy 716.908 / 845.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 1531 197 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43390.[MT7]-FYFENLLAK[MT7].2y7_1.heavy 716.908 / 978.574 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 1533 198 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42928.[MT7]-DLIDQSQSSGSGSGLPLLVQR.2b3_1.heavy 1151.11 / 486.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - BMPR1A bone morphogenetic protein receptor, type IA 1535 198 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42928.[MT7]-DLIDQSQSSGSGSGLPLLVQR.2y12_1.heavy 1151.11 / 1183.68 N/A N/A - - - - - - - - - 0.0 - - - - - - - BMPR1A bone morphogenetic protein receptor, type IA 1537 198 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42928.[MT7]-DLIDQSQSSGSGSGLPLLVQR.2b4_1.heavy 1151.11 / 601.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - BMPR1A bone morphogenetic protein receptor, type IA 1539 198 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42928.[MT7]-DLIDQSQSSGSGSGLPLLVQR.2y7_1.heavy 1151.11 / 838.551 N/A N/A - - - - - - - - - 0.0 - - - - - - - BMPR1A bone morphogenetic protein receptor, type IA 1541 199 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23827.[MT7]-WRGEEVAVK[MT7].2b8_1.heavy 681.393 / 1071.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBR1 transforming growth factor, beta receptor 1 1543 199 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23827.[MT7]-WRGEEVAVK[MT7].2b4_1.heavy 681.393 / 673.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBR1 transforming growth factor, beta receptor 1 1545 199 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23827.[MT7]-WRGEEVAVK[MT7].2b7_1.heavy 681.393 / 972.502 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBR1 transforming growth factor, beta receptor 1 1547 199 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23827.[MT7]-WRGEEVAVK[MT7].2b5_1.heavy 681.393 / 802.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBR1 transforming growth factor, beta receptor 1 1549 200 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37287.[MT7]-IAVSYQTK[MT7].2y4_1.heavy 599.358 / 683.385 N/A 25.268800735473633 41 13 10 10 8 0.9087921488494678 70.10967620733751 0.0 4 0.9040380210103401 3.9516368196673604 1061.0 1.398870056497175 2.0 - - - - - - - 200.33333333333334 2 15 TNF tumor necrosis factor 1551 200 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37287.[MT7]-IAVSYQTK[MT7].2y5_1.heavy 599.358 / 770.417 1857.0 25.268800735473633 41 13 10 10 8 0.9087921488494678 70.10967620733751 0.0 4 0.9040380210103401 3.9516368196673604 1857.0 9.101893188359451 0.0 - - - - - - - 176.75 3 12 TNF tumor necrosis factor 1553 200 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37287.[MT7]-IAVSYQTK[MT7].2y6_1.heavy 599.358 / 869.485 1503.0 25.268800735473633 41 13 10 10 8 0.9087921488494678 70.10967620733751 0.0 4 0.9040380210103401 3.9516368196673604 1503.0 9.64188679245283 0.0 - - - - - - - 164.0 3 7 TNF tumor necrosis factor 1555 200 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37287.[MT7]-IAVSYQTK[MT7].2y7_1.heavy 599.358 / 940.522 1326.0 25.268800735473633 41 13 10 10 8 0.9087921488494678 70.10967620733751 0.0 4 0.9040380210103401 3.9516368196673604 1326.0 3.5774999999999997 1.0 - - - - - - - 241.0909090909091 3 11 TNF tumor necrosis factor 1557 201 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37280.[MT7]-GQGATTADGK[MT7].2b8_1.heavy 597.322 / 846.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1559 201 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37280.[MT7]-GQGATTADGK[MT7].2y4_1.heavy 597.322 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1561 201 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37280.[MT7]-GQGATTADGK[MT7].2y8_1.heavy 597.322 / 864.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1563 201 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37280.[MT7]-GQGATTADGK[MT7].2y5_1.heavy 597.322 / 635.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1565 202 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37582.[MT7]-SPNIQFEAFHVFK[MT7].3y3_1.heavy 618.005 / 537.352 7233.0 38.385149002075195 36 10 10 6 10 0.754603804574225 68.38737369381312 0.03820037841796875 3 0.8476273859638929 3.1205669370401306 7233.0 62.185367626238786 0.0 - - - - - - - 260.94736842105266 14 19 CAB39L calcium binding protein 39-like 1567 202 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37582.[MT7]-SPNIQFEAFHVFK[MT7].3b4_1.heavy 618.005 / 556.321 3251.0 38.385149002075195 36 10 10 6 10 0.754603804574225 68.38737369381312 0.03820037841796875 3 0.8476273859638929 3.1205669370401306 3251.0 6.536757613385246 0.0 - - - - - - - 751.625 6 8 CAB39L calcium binding protein 39-like 1569 202 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37582.[MT7]-SPNIQFEAFHVFK[MT7].3b5_1.heavy 618.005 / 684.38 2438.0 38.385149002075195 36 10 10 6 10 0.754603804574225 68.38737369381312 0.03820037841796875 3 0.8476273859638929 3.1205669370401306 2438.0 6.074585296622198 1.0 - - - - - - - 682.6 4 10 CAB39L calcium binding protein 39-like 1571 202 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37582.[MT7]-SPNIQFEAFHVFK[MT7].3y4_1.heavy 618.005 / 674.411 4063.0 38.385149002075195 36 10 10 6 10 0.754603804574225 68.38737369381312 0.03820037841796875 3 0.8476273859638929 3.1205669370401306 4063.0 12.504928229085246 0.0 - - - - - - - 313.4761904761905 8 21 CAB39L calcium binding protein 39-like 1573 203 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42929.[MT7]-YVELSTFDIASDAFATFK[MT7].2b8_1.heavy 1157.1 / 1099.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 1575 203 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42929.[MT7]-YVELSTFDIASDAFATFK[MT7].2b3_1.heavy 1157.1 / 536.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 1577 204 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 274541.0 39.08679962158203 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 274541.0 74.52594146494917 1.0 - - - - - - - 349.3076923076923 579 13 1579 204 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 560036.0 39.08679962158203 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 560036.0 246.19693639651467 0.0 - - - - - - - 685.0 1120 8 1581 204 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 667758.0 39.08679962158203 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 667758.0 224.051832611143 0.0 - - - - - - - 293.5 1335 4 1583 205 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43043.[MT7]-NFSYK[MT7].2b3_1.heavy 473.765 / 493.253 1590.0 23.055500030517578 39 13 10 10 6 2.180760544800823 34.424796034528654 0.0 5 0.9236846891147238 4.4386930307877215 1590.0 2.2502598374434264 4.0 - - - - - - - 670.7142857142857 5 7 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1585 205 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43043.[MT7]-NFSYK[MT7].2y4_1.heavy 473.765 / 688.379 7039.0 23.055500030517578 39 13 10 10 6 2.180760544800823 34.424796034528654 0.0 5 0.9236846891147238 4.4386930307877215 7039.0 17.778384728340676 0.0 - - - - - - - 577.25 14 8 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1587 205 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43043.[MT7]-NFSYK[MT7].2b4_1.heavy 473.765 / 656.316 984.0 23.055500030517578 39 13 10 10 6 2.180760544800823 34.424796034528654 0.0 5 0.9236846891147238 4.4386930307877215 984.0 3.2489553801195097 6.0 - - - - - - - 279.9 3 20 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1589 205 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43043.[MT7]-NFSYK[MT7].2y3_1.heavy 473.765 / 541.31 5147.0 23.055500030517578 39 13 10 10 6 2.180760544800823 34.424796034528654 0.0 5 0.9236846891147238 4.4386930307877215 5147.0 6.608040573707624 0.0 - - - - - - - 719.1666666666666 10 12 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1591 206 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543758.[MT7]-LIEFLSSFQK[MT7].3y3_1.heavy 500.629 / 566.342 67637.0 46.49140167236328 46 16 10 10 10 2.4344468998035285 34.061717870682955 0.0 3 0.9607517195111269 6.208994526770923 67637.0 505.13234938602136 0.0 - - - - - - - 166.33333333333334 135 18 CAB39L calcium binding protein 39-like 1593 206 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543758.[MT7]-LIEFLSSFQK[MT7].3b4_1.heavy 500.629 / 647.388 150460.0 46.49140167236328 46 16 10 10 10 2.4344468998035285 34.061717870682955 0.0 3 0.9607517195111269 6.208994526770923 150460.0 855.1538255719069 0.0 - - - - - - - 191.93333333333334 300 15 CAB39L calcium binding protein 39-like 1595 206 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543758.[MT7]-LIEFLSSFQK[MT7].3b3_1.heavy 500.629 / 500.32 129252.0 46.49140167236328 46 16 10 10 10 2.4344468998035285 34.061717870682955 0.0 3 0.9607517195111269 6.208994526770923 129252.0 33.11429199175137 0.0 - - - - - - - 4820.285714285715 258 7 CAB39L calcium binding protein 39-like 1597 206 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543758.[MT7]-LIEFLSSFQK[MT7].3y5_1.heavy 500.629 / 740.406 58056.0 46.49140167236328 46 16 10 10 10 2.4344468998035285 34.061717870682955 0.0 3 0.9607517195111269 6.208994526770923 58056.0 739.4293857770765 0.0 - - - - - - - 164.13333333333333 116 15 CAB39L calcium binding protein 39-like 1599 207 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24158.[MT7]-DNQLVVPSEGLYLIYSQVLFK[MT7].4b4_1.heavy 679.132 / 615.322 2034.0 49.96179962158203 41 11 10 10 10 1.6891613796582468 47.813052071050436 0.0 3 0.8608648171299644 3.269450837333391 2034.0 12.390688378978535 0.0 - - - - - - - 130.21428571428572 4 28 TNF tumor necrosis factor 1601 207 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24158.[MT7]-DNQLVVPSEGLYLIYSQVLFK[MT7].4b5_1.heavy 679.132 / 714.39 2806.0 49.96179962158203 41 11 10 10 10 1.6891613796582468 47.813052071050436 0.0 3 0.8608648171299644 3.269450837333391 2806.0 20.596887340301972 0.0 - - - - - - - 45.8 5 20 TNF tumor necrosis factor 1603 207 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24158.[MT7]-DNQLVVPSEGLYLIYSQVLFK[MT7].4b6_1.heavy 679.132 / 813.459 1526.0 49.96179962158203 41 11 10 10 10 1.6891613796582468 47.813052071050436 0.0 3 0.8608648171299644 3.269450837333391 1526.0 3.4681818181818174 0.0 - - - - - - - 65.35714285714286 3 14 TNF tumor necrosis factor 1605 207 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24158.[MT7]-DNQLVVPSEGLYLIYSQVLFK[MT7].4b3_1.heavy 679.132 / 502.238 1350.0 49.96179962158203 41 11 10 10 10 1.6891613796582468 47.813052071050436 0.0 3 0.8608648171299644 3.269450837333391 1350.0 5.094339622641509 0.0 - - - - - - - 68.69565217391305 2 23 TNF tumor necrosis factor 1607 208 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23537.[MT7]-QLQDK[MT7].2y4_1.heavy 460.276 / 647.385 5536.0 16.339267094930012 43 17 10 6 10 2.2201907279614246 35.32729035117127 0.030199050903320312 3 0.9783317798240195 8.36880438786776 5536.0 22.463042005420057 0.0 - - - - - - - 245.42857142857142 11 21 GNL1;TAF7 guanine nucleotide binding protein-like 1;TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1609 208 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23537.[MT7]-QLQDK[MT7].2b4_1.heavy 460.276 / 629.338 3662.0 16.339267094930012 43 17 10 6 10 2.2201907279614246 35.32729035117127 0.030199050903320312 3 0.9783317798240195 8.36880438786776 3662.0 13.622329066649643 1.0 - - - - - - - 803.0 7 7 GNL1;TAF7 guanine nucleotide binding protein-like 1;TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1611 208 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23537.[MT7]-QLQDK[MT7].2y3_1.heavy 460.276 / 534.3 1874.0 16.339267094930012 43 17 10 6 10 2.2201907279614246 35.32729035117127 0.030199050903320312 3 0.9783317798240195 8.36880438786776 1874.0 8.358215962441314 0.0 - - - - - - - 194.24 3 25 GNL1;TAF7 guanine nucleotide binding protein-like 1;TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1613 209 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23792.[MT7]-EQLEQIQK[MT7].3y3_1.heavy 435.254 / 532.357 8902.0 24.20247459411621 44 18 10 6 10 4.360117947876964 22.93515936849648 0.03710174560546875 3 0.9894224667233261 11.98910079418768 8902.0 19.080485708438502 0.0 - - - - - - - 599.3333333333334 17 9 RFWD2 ring finger and WD repeat domain 2 1615 209 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23792.[MT7]-EQLEQIQK[MT7].3b4_1.heavy 435.254 / 644.337 14037.0 24.20247459411621 44 18 10 6 10 4.360117947876964 22.93515936849648 0.03710174560546875 3 0.9894224667233261 11.98910079418768 14037.0 63.42953204996928 0.0 - - - - - - - 237.66666666666666 28 9 RFWD2 ring finger and WD repeat domain 2 1617 209 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23792.[MT7]-EQLEQIQK[MT7].3b5_1.heavy 435.254 / 772.396 7361.0 24.20247459411621 44 18 10 6 10 4.360117947876964 22.93515936849648 0.03710174560546875 3 0.9894224667233261 11.98910079418768 7361.0 120.49095063239494 0.0 - - - - - - - 281.2857142857143 14 7 RFWD2 ring finger and WD repeat domain 2 1619 209 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23792.[MT7]-EQLEQIQK[MT7].3b3_1.heavy 435.254 / 515.295 16434.0 24.20247459411621 44 18 10 6 10 4.360117947876964 22.93515936849648 0.03710174560546875 3 0.9894224667233261 11.98910079418768 16434.0 31.98150536608633 0.0 - - - - - - - 256.6 32 5 RFWD2 ring finger and WD repeat domain 2 1621 210 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23536.[MT7]-TPGLLK[MT7].2y4_1.heavy 458.807 / 574.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1623 210 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23536.[MT7]-TPGLLK[MT7].2y5_1.heavy 458.807 / 671.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1625 210 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23536.[MT7]-TPGLLK[MT7].2y3_1.heavy 458.807 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1627 211 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23694.[MT7]-DVQLHLER.2y4_1.heavy 577.326 / 554.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 1629 211 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23694.[MT7]-DVQLHLER.2b4_1.heavy 577.326 / 600.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 1631 211 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23694.[MT7]-DVQLHLER.2y6_1.heavy 577.326 / 795.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 1633 211 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23694.[MT7]-DVQLHLER.2y7_1.heavy 577.326 / 894.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 1635 212 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 702899.0 34.23059844970703 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 702899.0 367.1289357931046 0.0 - - - - - - - 748.875 1405 8 1637 212 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 112128.0 34.23059844970703 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 112128.0 247.8887679509549 0.0 - - - - - - - 682.0 224 12 1639 212 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 90951.0 34.23059844970703 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 90951.0 98.3472427733349 0.0 - - - - - - - 625.8333333333334 181 12 1641 213 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23692.[MT7]-WLQLTMFA.2b3_1.heavy 577.313 / 572.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 1643 213 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23692.[MT7]-WLQLTMFA.2b4_1.heavy 577.313 / 685.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 1645 213 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23692.[MT7]-WLQLTMFA.2b5_1.heavy 577.313 / 786.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 1647 214 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23697.[MT7]-K[MT7]LQDLVR.2b3_1.heavy 580.374 / 658.449 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 1649 214 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23697.[MT7]-K[MT7]LQDLVR.2b4_1.heavy 580.374 / 773.476 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 1651 214 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23697.[MT7]-K[MT7]LQDLVR.2y6_1.heavy 580.374 / 743.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 1653 214 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23697.[MT7]-K[MT7]LQDLVR.2b5_1.heavy 580.374 / 886.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 1655 215 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37433.[MT7]-ELSVLEEDIK[MT7].2y5_1.heavy 731.916 / 777.411 1881.0 36.69850158691406 43 13 10 10 10 2.5019732887930695 26.77694791327808 0.0 3 0.9092121880457701 4.064496699091459 1881.0 5.600062783397279 0.0 - - - - - - - 207.0 3 14 RFWD2 ring finger and WD repeat domain 2 1657 215 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37433.[MT7]-ELSVLEEDIK[MT7].2b4_1.heavy 731.916 / 573.336 2117.0 36.69850158691406 43 13 10 10 10 2.5019732887930695 26.77694791327808 0.0 3 0.9092121880457701 4.064496699091459 2117.0 6.302129467783738 0.0 - - - - - - - 251.6315789473684 4 19 RFWD2 ring finger and WD repeat domain 2 1659 215 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37433.[MT7]-ELSVLEEDIK[MT7].2y3_1.heavy 731.916 / 519.326 784.0 36.69850158691406 43 13 10 10 10 2.5019732887930695 26.77694791327808 0.0 3 0.9092121880457701 4.064496699091459 784.0 1.4 5.0 - - - - - - - 0.0 1 0 RFWD2 ring finger and WD repeat domain 2 1661 215 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37433.[MT7]-ELSVLEEDIK[MT7].2y6_1.heavy 731.916 / 890.495 2901.0 36.69850158691406 43 13 10 10 10 2.5019732887930695 26.77694791327808 0.0 3 0.9092121880457701 4.064496699091459 2901.0 16.980234476769432 0.0 - - - - - - - 188.1 5 20 RFWD2 ring finger and WD repeat domain 2 1663 216 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43185.[MT7]-NSAAATSPK[MT7].2y4_1.heavy 567.821 / 576.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 1665 216 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43185.[MT7]-NSAAATSPK[MT7].2y5_1.heavy 567.821 / 647.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 1667 216 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43185.[MT7]-NSAAATSPK[MT7].2y6_1.heavy 567.821 / 718.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 1669 216 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43185.[MT7]-NSAAATSPK[MT7].2b5_1.heavy 567.821 / 559.296 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 1671 217 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23912.[MT7]-DLSLISPLAQAVR.2y8_1.heavy 763.955 / 841.489 8162.0 41.04202365875244 43 17 10 6 10 4.925640533824701 20.301928107277288 0.035900115966796875 3 0.9797650339887031 8.661160175099202 8162.0 32.76096885813149 0.0 - - - - - - - 232.0 16 14 TNF tumor necrosis factor 1673 217 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23912.[MT7]-DLSLISPLAQAVR.2y9_1.heavy 763.955 / 954.573 4623.0 41.04202365875244 43 17 10 6 10 4.925640533824701 20.301928107277288 0.035900115966796875 3 0.9797650339887031 8.661160175099202 4623.0 27.458880320907895 0.0 - - - - - - - 224.1578947368421 9 19 TNF tumor necrosis factor 1675 217 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23912.[MT7]-DLSLISPLAQAVR.2y11_1.heavy 763.955 / 1154.69 2167.0 41.04202365875244 43 17 10 6 10 4.925640533824701 20.301928107277288 0.035900115966796875 3 0.9797650339887031 8.661160175099202 2167.0 17.43243608227605 0.0 - - - - - - - 155.46153846153845 4 13 TNF tumor necrosis factor 1677 217 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23912.[MT7]-DLSLISPLAQAVR.2y7_1.heavy 763.955 / 754.457 4262.0 41.04202365875244 43 17 10 6 10 4.925640533824701 20.301928107277288 0.035900115966796875 3 0.9797650339887031 8.661160175099202 4262.0 10.362929110263245 0.0 - - - - - - - 650.25 8 8 TNF tumor necrosis factor 1679 218 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37450.[MT7]-DVELAEEALPK[MT7].2b4_1.heavy 751.421 / 601.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNF tumor necrosis factor 1681 218 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37450.[MT7]-DVELAEEALPK[MT7].2b6_1.heavy 751.421 / 801.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNF tumor necrosis factor 1683 218 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37450.[MT7]-DVELAEEALPK[MT7].2b5_1.heavy 751.421 / 672.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNF tumor necrosis factor 1685 218 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37450.[MT7]-DVELAEEALPK[MT7].2y7_1.heavy 751.421 / 901.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNF tumor necrosis factor 1687 219 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23910.[MT7]-WEIIAEDETK[MT7].2b3_1.heavy 761.406 / 573.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1689 219 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23910.[MT7]-WEIIAEDETK[MT7].2y5_1.heavy 761.406 / 765.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1691 219 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23910.[MT7]-WEIIAEDETK[MT7].2y6_1.heavy 761.406 / 836.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1693 219 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23910.[MT7]-WEIIAEDETK[MT7].2y7_1.heavy 761.406 / 949.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 1695 220 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43579.[MT7]-NYPATFWVNPQFK[MT7].3y3_1.heavy 634.005 / 566.342 2160.0 39.86439895629883 46 16 10 10 10 3.219950080301494 31.056382088580914 0.0 3 0.9647483949515727 6.553733804469757 2160.0 18.63638885386458 0.0 - - - - - - - 254.11764705882354 4 17 CAPN1 calpain 1, (mu/I) large subunit 1697 220 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43579.[MT7]-NYPATFWVNPQFK[MT7].3b6_1.heavy 634.005 / 838.422 5862.0 39.86439895629883 46 16 10 10 10 3.219950080301494 31.056382088580914 0.0 3 0.9647483949515727 6.553733804469757 5862.0 32.94033539276258 0.0 - - - - - - - 174.52631578947367 11 19 CAPN1 calpain 1, (mu/I) large subunit 1699 220 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43579.[MT7]-NYPATFWVNPQFK[MT7].3y4_1.heavy 634.005 / 663.395 15657.0 39.86439895629883 46 16 10 10 10 3.219950080301494 31.056382088580914 0.0 3 0.9647483949515727 6.553733804469757 15657.0 95.86745631067961 0.0 - - - - - - - 226.2 31 15 CAPN1 calpain 1, (mu/I) large subunit 1701 220 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43579.[MT7]-NYPATFWVNPQFK[MT7].3y5_1.heavy 634.005 / 777.438 5322.0 39.86439895629883 46 16 10 10 10 3.219950080301494 31.056382088580914 0.0 3 0.9647483949515727 6.553733804469757 5322.0 18.549302491581358 0.0 - - - - - - - 198.28571428571428 10 14 CAPN1 calpain 1, (mu/I) large subunit 1703 221 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23913.[MT7]-LTTSDIDYALK[MT7].3b5_1.heavy 509.955 / 662.348 94954.0 34.44060134887695 48 18 10 10 10 4.0255515853669195 24.841316246823165 0.0 3 0.9869659649685495 10.798167976385681 94954.0 113.97319674008548 0.0 - - - - - - - 801.0 189 8 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1705 221 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23913.[MT7]-LTTSDIDYALK[MT7].3y4_1.heavy 509.955 / 638.399 31207.0 34.44060134887695 48 18 10 10 10 4.0255515853669195 24.841316246823165 0.0 3 0.9869659649685495 10.798167976385681 31207.0 86.73192362173495 0.0 - - - - - - - 724.1 62 10 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1707 221 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23913.[MT7]-LTTSDIDYALK[MT7].3y5_1.heavy 509.955 / 753.426 19141.0 34.44060134887695 48 18 10 10 10 4.0255515853669195 24.841316246823165 0.0 3 0.9869659649685495 10.798167976385681 19141.0 47.421396396396396 0.0 - - - - - - - 223.4375 38 16 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1709 221 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23913.[MT7]-LTTSDIDYALK[MT7].3b7_1.heavy 509.955 / 890.459 58504.0 34.44060134887695 48 18 10 10 10 4.0255515853669195 24.841316246823165 0.0 3 0.9869659649685495 10.798167976385681 58504.0 562.9917455421687 0.0 - - - - - - - 208.0 117 12 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1711 222 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37595.[MT7]-FTDEYQLYEDIGK[MT7].2b3_1.heavy 954.977 / 508.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 1713 222 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37595.[MT7]-FTDEYQLYEDIGK[MT7].2b4_1.heavy 954.977 / 637.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 1715 222 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37595.[MT7]-FTDEYQLYEDIGK[MT7].2b6_1.heavy 954.977 / 928.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 1717 222 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37595.[MT7]-FTDEYQLYEDIGK[MT7].2y7_1.heavy 954.977 / 981.537 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B calcium/calmodulin-dependent protein kinase II beta 1719 223 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37594.[MT7]-NYPATFWVNPQFK[MT7].2y4_1.heavy 950.503 / 663.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 1721 223 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37594.[MT7]-NYPATFWVNPQFK[MT7].2y8_1.heavy 950.503 / 1209.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 1723 223 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37594.[MT7]-NYPATFWVNPQFK[MT7].2y5_1.heavy 950.503 / 777.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 1725 223 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37594.[MT7]-NYPATFWVNPQFK[MT7].2y6_1.heavy 950.503 / 876.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN1 calpain 1, (mu/I) large subunit 1727 224 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24147.[MT7]-NLLASSDYEGTVILWDGFTGQR.3y6_1.heavy 862.77 / 665.337 21689.0 47.576900482177734 43 13 10 10 10 1.1181418968442345 52.54967012374123 0.0 3 0.9068762598415028 4.012387246439607 21689.0 75.71594906675102 0.0 - - - - - - - 680.75 43 8 RFWD2 ring finger and WD repeat domain 2 1729 224 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24147.[MT7]-NLLASSDYEGTVILWDGFTGQR.3b4_1.heavy 862.77 / 556.357 15589.0 47.576900482177734 43 13 10 10 10 1.1181418968442345 52.54967012374123 0.0 3 0.9068762598415028 4.012387246439607 15589.0 53.09310864244022 0.0 - - - - - - - 239.37037037037038 31 27 RFWD2 ring finger and WD repeat domain 2 1731 224 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24147.[MT7]-NLLASSDYEGTVILWDGFTGQR.3b7_1.heavy 862.77 / 845.448 13798.0 47.576900482177734 43 13 10 10 10 1.1181418968442345 52.54967012374123 0.0 3 0.9068762598415028 4.012387246439607 13798.0 48.9882480620155 0.0 - - - - - - - 346.0 27 24 RFWD2 ring finger and WD repeat domain 2 1733 224 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24147.[MT7]-NLLASSDYEGTVILWDGFTGQR.3y10_1.heavy 862.77 / 1192.61 7165.0 47.576900482177734 43 13 10 10 10 1.1181418968442345 52.54967012374123 0.0 3 0.9068762598415028 4.012387246439607 7165.0 59.194667614646285 0.0 - - - - - - - 124.34482758620689 14 29 RFWD2 ring finger and WD repeat domain 2 1735 225 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43377.[MT7]-ELYFYEEK[MT7].2y4_1.heavy 704.866 / 712.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1737 225 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43377.[MT7]-ELYFYEEK[MT7].2b3_1.heavy 704.866 / 550.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1739 225 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43377.[MT7]-ELYFYEEK[MT7].2y5_1.heavy 704.866 / 859.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1741 225 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43377.[MT7]-ELYFYEEK[MT7].2y6_1.heavy 704.866 / 1022.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1743 226 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37095.[MT7]-VFC[CAM]TK[MT7].2y4_1.heavy 471.77 / 699.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF1B tumor necrosis factor receptor superfamily, member 1B 1745 226 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37095.[MT7]-VFC[CAM]TK[MT7].2y3_1.heavy 471.77 / 552.293 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF1B tumor necrosis factor receptor superfamily, member 1B 1747 227 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542242.[MT7]-DLSLISPLAQAVR.3y7_1.heavy 509.639 / 754.457 28426.0 41.05099868774414 47 17 10 10 10 2.2085433349285895 36.11259869929833 0.0 3 0.973138904345508 7.513175774842715 28426.0 114.14018024658269 0.0 - - - - - - - 213.8 56 15 TNF tumor necrosis factor 1749 227 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542242.[MT7]-DLSLISPLAQAVR.3y6_1.heavy 509.639 / 657.404 19024.0 41.05099868774414 47 17 10 10 10 2.2085433349285895 36.11259869929833 0.0 3 0.973138904345508 7.513175774842715 19024.0 138.5588998119796 0.0 - - - - - - - 218.73333333333332 38 15 TNF tumor necrosis factor 1751 227 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542242.[MT7]-DLSLISPLAQAVR.3b4_1.heavy 509.639 / 573.336 38193.0 41.05099868774414 47 17 10 10 10 2.2085433349285895 36.11259869929833 0.0 3 0.973138904345508 7.513175774842715 38193.0 214.22873329950954 0.0 - - - - - - - 708.1428571428571 76 7 TNF tumor necrosis factor 1753 227 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542242.[MT7]-DLSLISPLAQAVR.3y5_1.heavy 509.639 / 544.32 43003.0 41.05099868774414 47 17 10 10 10 2.2085433349285895 36.11259869929833 0.0 3 0.973138904345508 7.513175774842715 43003.0 100.80503740648379 0.0 - - - - - - - 258.0 86 13 TNF tumor necrosis factor 1755 228 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23543.[MT7]-AVSYAK[MT7].2y4_1.heavy 463.781 / 612.347 7184.0 19.212600708007812 50 20 10 10 10 6.474177819544513 15.445976738253297 0.0 3 0.9910694355595638 13.049659414402315 7184.0 24.67805964786202 0.0 - - - - - - - 210.68421052631578 14 19 RFWD2 ring finger and WD repeat domain 2 1757 228 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23543.[MT7]-AVSYAK[MT7].2y5_1.heavy 463.781 / 711.416 4421.0 19.212600708007812 50 20 10 10 10 6.474177819544513 15.445976738253297 0.0 3 0.9910694355595638 13.049659414402315 4421.0 23.002544017247573 0.0 - - - - - - - 255.4 8 20 RFWD2 ring finger and WD repeat domain 2 1759 228 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23543.[MT7]-AVSYAK[MT7].2b4_1.heavy 463.781 / 565.31 N/A 19.212600708007812 50 20 10 10 10 6.474177819544513 15.445976738253297 0.0 3 0.9910694355595638 13.049659414402315 2970.0 4.96492453623371 1.0 - - - - - - - 819.1428571428571 5 7 RFWD2 ring finger and WD repeat domain 2 1761 228 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23543.[MT7]-AVSYAK[MT7].2y3_1.heavy 463.781 / 525.315 3109.0 19.212600708007812 50 20 10 10 10 6.474177819544513 15.445976738253297 0.0 3 0.9910694355595638 13.049659414402315 3109.0 8.433996092637063 1.0 - - - - - - - 281.0 6 14 RFWD2 ring finger and WD repeat domain 2 1763 229 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43178.[MT7]-SLVVAHAQR.2y8_1.heavy 562.836 / 893.532 2077.0 19.998300552368164 43 15 10 10 8 2.6640280420354596 37.53714241070625 0.0 4 0.9512128808659384 5.5645251501334245 2077.0 32.34923465423466 1.0 - - - - - - - 167.08333333333334 7 12 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1765 229 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43178.[MT7]-SLVVAHAQR.2y5_1.heavy 562.836 / 582.311 2220.0 19.998300552368164 43 15 10 10 8 2.6640280420354596 37.53714241070625 0.0 4 0.9512128808659384 5.5645251501334245 2220.0 11.032005204098228 0.0 - - - - - - - 143.33333333333334 4 6 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1767 229 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43178.[MT7]-SLVVAHAQR.2y6_1.heavy 562.836 / 681.379 4583.0 19.998300552368164 43 15 10 10 8 2.6640280420354596 37.53714241070625 0.0 4 0.9512128808659384 5.5645251501334245 4583.0 23.82209406362101 0.0 - - - - - - - 155.94117647058823 9 17 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1769 229 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43178.[MT7]-SLVVAHAQR.2y7_1.heavy 562.836 / 780.448 1862.0 19.998300552368164 43 15 10 10 8 2.6640280420354596 37.53714241070625 0.0 4 0.9512128808659384 5.5645251501334245 1862.0 12.36993006993007 0.0 - - - - - - - 165.3846153846154 3 13 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1771 230 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37449.[MT7]-LIEFLSSFQK[MT7].2b3_1.heavy 750.439 / 500.32 5781.0 46.49140167236328 46 16 10 10 10 2.3163296526636965 34.71337179496645 0.0 3 0.9612835969003859 6.251779064004688 5781.0 66.17811418685122 0.0 - - - - - - - 195.37037037037038 11 27 CAB39L calcium binding protein 39-like 1773 230 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37449.[MT7]-LIEFLSSFQK[MT7].2y5_1.heavy 750.439 / 740.406 5419.0 46.49140167236328 46 16 10 10 10 2.3163296526636965 34.71337179496645 0.0 3 0.9612835969003859 6.251779064004688 5419.0 44.08048173301596 0.0 - - - - - - - 169.10714285714286 10 28 CAB39L calcium binding protein 39-like 1775 230 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37449.[MT7]-LIEFLSSFQK[MT7].2y9_1.heavy 750.439 / 1242.69 2348.0 46.49140167236328 46 16 10 10 10 2.3163296526636965 34.71337179496645 0.0 3 0.9612835969003859 6.251779064004688 2348.0 52.177777777777784 0.0 - - - - - - - 74.46666666666667 4 15 CAB39L calcium binding protein 39-like 1777 230 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37449.[MT7]-LIEFLSSFQK[MT7].2y6_1.heavy 750.439 / 853.49 2673.0 46.49140167236328 46 16 10 10 10 2.3163296526636965 34.71337179496645 0.0 3 0.9612835969003859 6.251779064004688 2673.0 23.608359687559535 0.0 - - - - - - - 119.43478260869566 5 23 CAB39L calcium binding protein 39-like 1779 231 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23918.[MT7]-LTQYIDGQGRPR.3b6_1.heavy 516.619 / 878.474 17075.0 28.00006675720215 40 14 10 6 10 1.132896636691087 57.62540005050478 0.03460121154785156 3 0.9411204829144109 5.060878910800075 17075.0 99.65084077970064 0.0 - - - - - - - 189.1 34 20 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 1781 231 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23918.[MT7]-LTQYIDGQGRPR.3y6_1.heavy 516.619 / 670.374 13878.0 28.00006675720215 40 14 10 6 10 1.132896636691087 57.62540005050478 0.03460121154785156 3 0.9411204829144109 5.060878910800075 13878.0 37.00146208415546 0.0 - - - - - - - 643.0 27 14 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 1783 231 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23918.[MT7]-LTQYIDGQGRPR.3y11_2.heavy 516.619 / 645.831 N/A 28.00006675720215 40 14 10 6 10 1.132896636691087 57.62540005050478 0.03460121154785156 3 0.9411204829144109 5.060878910800075 54924.0 41.48533636917294 1.0 - - - - - - - 294.5 109 2 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 1785 231 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23918.[MT7]-LTQYIDGQGRPR.3b4_1.heavy 516.619 / 650.363 33056.0 28.00006675720215 40 14 10 6 10 1.132896636691087 57.62540005050478 0.03460121154785156 3 0.9411204829144109 5.060878910800075 33056.0 87.95239588783781 0.0 - - - - - - - 315.3333333333333 66 12 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 1787 232 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544248.[MT7]-K[MT7]ADGVK[MT7]PQTNSTK[MT7].4y4_1.heavy 488.292 / 593.338 484.0 14.957774877548218 33 7 10 6 10 0.7283938900167934 70.63052657625457 0.036299705505371094 3 0.7268442035411905 2.3053416116580654 484.0 -0.5 3.0 - - - - - - - 0.0 1 0 CAMK2B calcium/calmodulin-dependent protein kinase II beta 1789 232 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544248.[MT7]-K[MT7]ADGVK[MT7]PQTNSTK[MT7].4y5_1.heavy 488.292 / 694.385 847.0 14.957774877548218 33 7 10 6 10 0.7283938900167934 70.63052657625457 0.036299705505371094 3 0.7268442035411905 2.3053416116580654 847.0 9.312082728592163 0.0 - - - - - - - 0.0 1 0 CAMK2B calcium/calmodulin-dependent protein kinase II beta 1791 232 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544248.[MT7]-K[MT7]ADGVK[MT7]PQTNSTK[MT7].4y10_2.heavy 488.292 / 674.395 3538.0 14.957774877548218 33 7 10 6 10 0.7283938900167934 70.63052657625457 0.036299705505371094 3 0.7268442035411905 2.3053416116580654 3538.0 11.84229372080955 0.0 - - - - - - - 251.4090909090909 7 22 CAMK2B calcium/calmodulin-dependent protein kinase II beta 1793 232 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544248.[MT7]-K[MT7]ADGVK[MT7]PQTNSTK[MT7].4b3_1.heavy 488.292 / 603.37 1270.0 14.957774877548218 33 7 10 6 10 0.7283938900167934 70.63052657625457 0.036299705505371094 3 0.7268442035411905 2.3053416116580654 1270.0 3.783774051633711 1.0 - - - - - - - 213.1 2 20 CAMK2B calcium/calmodulin-dependent protein kinase II beta 1795 233 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24182.[MT7]-TLQVQMLDLLDIEGLYPLYNRVER.3b4_1.heavy 1012.55 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1797 233 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24182.[MT7]-TLQVQMLDLLDIEGLYPLYNRVER.3b5_1.heavy 1012.55 / 714.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1799 233 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24182.[MT7]-TLQVQMLDLLDIEGLYPLYNRVER.3b8_1.heavy 1012.55 / 1073.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1801 233 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24182.[MT7]-TLQVQMLDLLDIEGLYPLYNRVER.3y13_2.heavy 1012.55 / 811.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1803 234 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37698.[MT7]-VVAESMGIAQIQEETC[CAM]QLLTDEVSYR.3b7_1.heavy 1038.51 / 818.42 1475.0 48.44357490539551 47 20 10 7 10 4.816052199444536 20.763894546561097 0.02249908447265625 3 0.9900405611276655 12.356168738826357 1475.0 20.40709374475935 0.0 - - - - - - - 83.17241379310344 2 29 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1805 234 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37698.[MT7]-VVAESMGIAQIQEETC[CAM]QLLTDEVSYR.3b4_1.heavy 1038.51 / 543.326 715.0 48.44357490539551 47 20 10 7 10 4.816052199444536 20.763894546561097 0.02249908447265625 3 0.9900405611276655 12.356168738826357 715.0 1.6067415730337076 0.0 - - - - - - - 0.0 1 0 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1807 234 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37698.[MT7]-VVAESMGIAQIQEETC[CAM]QLLTDEVSYR.3b5_1.heavy 1038.51 / 630.358 693.0 48.44357490539551 47 20 10 7 10 4.816052199444536 20.763894546561097 0.02249908447265625 3 0.9900405611276655 12.356168738826357 693.0 5.431668473276078 0.0 - - - - - - - 0.0 1 0 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1809 234 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37698.[MT7]-VVAESMGIAQIQEETC[CAM]QLLTDEVSYR.3y10_1.heavy 1038.51 / 1223.63 179.0 48.44357490539551 47 20 10 7 10 4.816052199444536 20.763894546561097 0.02249908447265625 3 0.9900405611276655 12.356168738826357 179.0 2.7202170963364996 1.0 - - - - - - - 0.0 0 0 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1811 235 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544001.[MT7]-QRDANLTALAAIGPR.3y7_1.heavy 570.996 / 697.435 9417.0 32.48149871826172 36 11 10 5 10 2.3148376100269763 28.824210464098357 0.04759979248046875 3 0.8675235495614962 3.352568462459757 9417.0 23.18883982984781 0.0 - - - - - - - 764.5555555555555 18 9 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1813 235 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544001.[MT7]-QRDANLTALAAIGPR.3b5_1.heavy 570.996 / 729.376 5433.0 32.48149871826172 36 11 10 5 10 2.3148376100269763 28.824210464098357 0.04759979248046875 3 0.8675235495614962 3.352568462459757 5433.0 15.292383801336687 0.0 - - - - - - - 320.53846153846155 10 13 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1815 235 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544001.[MT7]-QRDANLTALAAIGPR.3y8_1.heavy 570.996 / 768.473 10775.0 32.48149871826172 36 11 10 5 10 2.3148376100269763 28.824210464098357 0.04759979248046875 3 0.8675235495614962 3.352568462459757 10775.0 50.721436304583186 0.0 - - - - - - - 312.0 21 9 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1817 235 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544001.[MT7]-QRDANLTALAAIGPR.3y5_1.heavy 570.996 / 513.314 14669.0 32.48149871826172 36 11 10 5 10 2.3148376100269763 28.824210464098357 0.04759979248046875 3 0.8675235495614962 3.352568462459757 14669.0 21.839363866840674 0.0 - - - - - - - 778.8 29 10 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 1819 236 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23901.[MT7]-DVELAEEALPK[MT7].3b6_1.heavy 501.283 / 801.411 41749.0 32.364498138427734 48 18 10 10 10 3.2989060249178688 24.062686764837196 0.0 3 0.9802196700261112 8.760464203349226 41749.0 244.55796619914486 0.0 - - - - - - - 249.75 83 8 TNF tumor necrosis factor 1821 236 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23901.[MT7]-DVELAEEALPK[MT7].3b4_1.heavy 501.283 / 601.331 56179.0 32.364498138427734 48 18 10 10 10 3.2989060249178688 24.062686764837196 0.0 3 0.9802196700261112 8.760464203349226 56179.0 70.15585525066712 0.0 - - - - - - - 363.25 112 4 TNF tumor necrosis factor 1823 236 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23901.[MT7]-DVELAEEALPK[MT7].3b5_1.heavy 501.283 / 672.369 62532.0 32.364498138427734 48 18 10 10 10 3.2989060249178688 24.062686764837196 0.0 3 0.9802196700261112 8.760464203349226 62532.0 77.86032985486028 0.0 - - - - - - - 227.0 125 2 TNF tumor necrosis factor 1825 236 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23901.[MT7]-DVELAEEALPK[MT7].3b7_1.heavy 501.283 / 930.454 20058.0 32.364498138427734 48 18 10 10 10 3.2989060249178688 24.062686764837196 0.0 3 0.9802196700261112 8.760464203349226 20058.0 161.05360185269274 0.0 - - - - - - - 199.8 40 10 TNF tumor necrosis factor 1827 237 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23704.[MT7]-EIAQDALK[MT7].2y4_1.heavy 588.347 / 590.363 1880.0 25.288700103759766 36 20 0 6 10 7.5089244862646725 13.317486436695432 0.039798736572265625 3 0.9939654660751607 15.878953031154973 1880.0 8.439562915399346 0.0 - - - - - - - 255.85714285714286 3 14 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1829 237 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23704.[MT7]-EIAQDALK[MT7].2y6_1.heavy 588.347 / 789.459 3491.0 25.288700103759766 36 20 0 6 10 7.5089244862646725 13.317486436695432 0.039798736572265625 3 0.9939654660751607 15.878953031154973 3491.0 22.428212290502795 0.0 - - - - - - - 223.91666666666666 6 12 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1831 237 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23704.[MT7]-EIAQDALK[MT7].2b5_1.heavy 588.347 / 701.359 3670.0 25.288700103759766 36 20 0 6 10 7.5089244862646725 13.317486436695432 0.039798736572265625 3 0.9939654660751607 15.878953031154973 3670.0 10.041754243563455 0.0 - - - - - - - 690.7142857142857 7 7 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1833 237 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23704.[MT7]-EIAQDALK[MT7].2y7_1.heavy 588.347 / 902.543 1790.0 25.288700103759766 36 20 0 6 10 7.5089244862646725 13.317486436695432 0.039798736572265625 3 0.9939654660751607 15.878953031154973 1790.0 12.321561338289964 1.0 - - - - - - - 179.30769230769232 39 13 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1835 238 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23703.[MT7]-IVNYYSK[MT7].2y4_1.heavy 587.839 / 704.374 1552.0 27.179149627685547 43 17 10 6 10 3.398589997226982 23.676763369151406 0.037899017333984375 3 0.9764843339341236 8.032097546916585 1552.0 6.600633102354956 0.0 - - - - - - - 213.0 3 17 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1837 238 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23703.[MT7]-IVNYYSK[MT7].2y5_1.heavy 587.839 / 818.417 4053.0 27.179149627685547 43 17 10 6 10 3.398589997226982 23.676763369151406 0.037899017333984375 3 0.9764843339341236 8.032097546916585 4053.0 18.401539547284226 0.0 - - - - - - - 237.0625 8 16 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1839 238 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23703.[MT7]-IVNYYSK[MT7].2y3_1.heavy 587.839 / 541.31 3880.0 27.179149627685547 43 17 10 6 10 3.398589997226982 23.676763369151406 0.037899017333984375 3 0.9764843339341236 8.032097546916585 3880.0 9.653834988380938 1.0 - - - - - - - 644.2352941176471 7 17 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1841 238 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23703.[MT7]-IVNYYSK[MT7].2y6_1.heavy 587.839 / 917.485 4743.0 27.179149627685547 43 17 10 6 10 3.398589997226982 23.676763369151406 0.037899017333984375 3 0.9764843339341236 8.032097546916585 4743.0 23.8360233338929 0.0 - - - - - - - 202.64705882352942 9 17 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1843 239 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB541565.[MT7]-LEAATK[MT7].2y4_1.heavy 460.786 / 534.337 6912.0 19.707399368286133 46 16 10 10 10 2.894861978183904 34.54396125052399 0.0 3 0.9649841713948415 6.57589221394358 6912.0 32.64708487084871 0.0 - - - - - - - 239.2941176470588 13 17 FLAD1;IKBKG FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae);inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma 1845 239 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB541565.[MT7]-LEAATK[MT7].2y5_1.heavy 460.786 / 663.379 10707.0 19.707399368286133 46 16 10 10 10 2.894861978183904 34.54396125052399 0.0 3 0.9649841713948415 6.57589221394358 10707.0 65.72574481143504 1.0 - - - - - - - 255.53846153846155 21 13 FLAD1;IKBKG FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae);inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma 1847 239 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB541565.[MT7]-LEAATK[MT7].2b4_1.heavy 460.786 / 529.31 1830.0 19.707399368286133 46 16 10 10 10 2.894861978183904 34.54396125052399 0.0 3 0.9649841713948415 6.57589221394358 1830.0 3.118898695931061 3.0 - - - - - - - 706.7142857142857 6 7 FLAD1;IKBKG FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae);inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma 1849 239 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB541565.[MT7]-LEAATK[MT7].2y3_1.heavy 460.786 / 463.3 3049.0 19.707399368286133 46 16 10 10 10 2.894861978183904 34.54396125052399 0.0 3 0.9649841713948415 6.57589221394358 3049.0 6.296706327788295 1.0 - - - - - - - 232.64285714285714 6 14 FLAD1;IKBKG FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae);inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma 1851 240 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42506.[MT7]-HENILGFIAADIK[MT7].3b6_1.heavy 577.001 / 808.443 5928.0 42.387399673461914 37 11 10 6 10 3.433833905401413 29.12196767662531 0.03440093994140625 3 0.8719498352607828 3.411341573646806 5928.0 42.5951452830743 0.0 - - - - - - - 150.23076923076923 11 13 BMPR1A;BMPR1B bone morphogenetic protein receptor, type IA;bone morphogenetic protein receptor, type IB 1853 240 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42506.[MT7]-HENILGFIAADIK[MT7].3b4_1.heavy 577.001 / 638.338 3166.0 42.387399673461914 37 11 10 6 10 3.433833905401413 29.12196767662531 0.03440093994140625 3 0.8719498352607828 3.411341573646806 3166.0 11.85943894389439 0.0 - - - - - - - 223.26315789473685 6 19 BMPR1A;BMPR1B bone morphogenetic protein receptor, type IA;bone morphogenetic protein receptor, type IB 1855 240 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42506.[MT7]-HENILGFIAADIK[MT7].3b3_1.heavy 577.001 / 525.254 3099.0 42.387399673461914 37 11 10 6 10 3.433833905401413 29.12196767662531 0.03440093994140625 3 0.8719498352607828 3.411341573646806 3099.0 4.521914417469144 0.0 - - - - - - - 660.2 6 10 BMPR1A;BMPR1B bone morphogenetic protein receptor, type IA;bone morphogenetic protein receptor, type IB 1857 240 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42506.[MT7]-HENILGFIAADIK[MT7].3y5_1.heavy 577.001 / 661.4 6534.0 42.387399673461914 37 11 10 6 10 3.433833905401413 29.12196767662531 0.03440093994140625 3 0.8719498352607828 3.411341573646806 6534.0 55.19323442136499 0.0 - - - - - - - 235.72222222222223 13 18 BMPR1A;BMPR1B bone morphogenetic protein receptor, type IA;bone morphogenetic protein receptor, type IB 1859 241 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 198789.0 42.63650131225586 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 198789.0 977.5041116310347 0.0 - - - - - - - 259.6470588235294 397 17 1861 241 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 341612.0 42.63650131225586 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 341612.0 970.7134469474155 0.0 - - - - - - - 227.2 683 5 1863 241 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 309250.0 42.63650131225586 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 309250.0 642.2119979130935 0.0 - - - - - - - 313.61538461538464 618 13 1865 242 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543481.[MT7]-TIVLQESIGK[MT7].3y3_1.heavy 459.285 / 461.32 49508.0 31.21980094909668 50 20 10 10 10 6.726642168510697 14.866258304645385 0.0 3 0.9936743002718853 15.508824544789766 49508.0 97.66312943636905 0.0 - - - - - - - 759.1111111111111 99 9 TGFBR1 transforming growth factor, beta receptor 1 1867 242 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543481.[MT7]-TIVLQESIGK[MT7].3b4_1.heavy 459.285 / 571.394 53719.0 31.21980094909668 50 20 10 10 10 6.726642168510697 14.866258304645385 0.0 3 0.9936743002718853 15.508824544789766 53719.0 142.9732726179435 0.0 - - - - - - - 323.3636363636364 107 11 TGFBR1 transforming growth factor, beta receptor 1 1869 242 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543481.[MT7]-TIVLQESIGK[MT7].3b5_1.heavy 459.285 / 699.452 18811.0 31.21980094909668 50 20 10 10 10 6.726642168510697 14.866258304645385 0.0 3 0.9936743002718853 15.508824544789766 18811.0 250.36704626334517 0.0 - - - - - - - 223.3846153846154 37 13 TGFBR1 transforming growth factor, beta receptor 1 1871 242 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543481.[MT7]-TIVLQESIGK[MT7].3y4_1.heavy 459.285 / 548.352 41366.0 31.21980094909668 50 20 10 10 10 6.726642168510697 14.866258304645385 0.0 3 0.9936743002718853 15.508824544789766 41366.0 140.17803053435114 0.0 - - - - - - - 304.125 82 16 TGFBR1 transforming growth factor, beta receptor 1 1873 243 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24173.[MT7]-EFLGENYVHYGEVVQLPLEFVK[MT7].3b6_1.heavy 966.516 / 834.411 1221.0 45.04515075683594 35 9 10 6 10 1.914234551351687 52.24020218911397 0.032501220703125 3 0.8147904197592578 2.822199538733189 1221.0 34.09648854961832 0.0 - - - - - - - 163.2173913043478 2 23 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1875 243 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24173.[MT7]-EFLGENYVHYGEVVQLPLEFVK[MT7].3y6_1.heavy 966.516 / 876.531 4403.0 45.04515075683594 35 9 10 6 10 1.914234551351687 52.24020218911397 0.032501220703125 3 0.8147904197592578 2.822199538733189 4403.0 18.651396721311475 0.0 - - - - - - - 152.55 8 20 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1877 243 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24173.[MT7]-EFLGENYVHYGEVVQLPLEFVK[MT7].3b8_1.heavy 966.516 / 1096.54 1003.0 45.04515075683594 35 9 10 6 10 1.914234551351687 52.24020218911397 0.032501220703125 3 0.8147904197592578 2.822199538733189 1003.0 15.430904624023867 0.0 - - - - - - - 94.66666666666667 2 18 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1879 243 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24173.[MT7]-EFLGENYVHYGEVVQLPLEFVK[MT7].3b7_1.heavy 966.516 / 997.475 828.0 45.04515075683594 35 9 10 6 10 1.914234551351687 52.24020218911397 0.032501220703125 3 0.8147904197592578 2.822199538733189 828.0 1.7788990825688074 1.0 - - - - - - - 0.0 1 0 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1881 244 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42958.[MT7]-VLVADFLEQNYDTIFEDYEK[MT7].4b4_1.heavy 685.597 / 527.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 1883 244 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42958.[MT7]-VLVADFLEQNYDTIFEDYEK[MT7].4b5_1.heavy 685.597 / 642.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 1885 244 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42958.[MT7]-VLVADFLEQNYDTIFEDYEK[MT7].4y3_1.heavy 685.597 / 583.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 1887 244 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42958.[MT7]-VLVADFLEQNYDTIFEDYEK[MT7].4b6_1.heavy 685.597 / 789.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 1889 245 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24174.[MT7]-EFLGENYVHYGEVVQLPLEFVK[MT7].4b8_1.heavy 725.139 / 1096.54 1508.0 45.05327606201172 31 5 10 6 10 1.4075248252384769 71.0467042618996 0.032501220703125 3 0.6553108149157258 2.0384542900891565 1508.0 38.35640986132511 0.0 - - - - - - - 116.9090909090909 3 11 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1891 245 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24174.[MT7]-EFLGENYVHYGEVVQLPLEFVK[MT7].4b7_1.heavy 725.139 / 997.475 1286.0 45.05327606201172 31 5 10 6 10 1.4075248252384769 71.0467042618996 0.032501220703125 3 0.6553108149157258 2.0384542900891565 1286.0 42.49317058222676 0.0 - - - - - - - 86.0 2 18 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1893 245 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24174.[MT7]-EFLGENYVHYGEVVQLPLEFVK[MT7].4b12_2.heavy 725.139 / 791.868 9313.0 45.05327606201172 31 5 10 6 10 1.4075248252384769 71.0467042618996 0.032501220703125 3 0.6553108149157258 2.0384542900891565 9313.0 78.60124476034264 0.0 - - - - - - - 175.05 18 20 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1895 245 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24174.[MT7]-EFLGENYVHYGEVVQLPLEFVK[MT7].4b6_1.heavy 725.139 / 834.411 1197.0 45.05327606201172 31 5 10 6 10 1.4075248252384769 71.0467042618996 0.032501220703125 3 0.6553108149157258 2.0384542900891565 1197.0 4.852702702702703 0.0 - - - - - - - 160.0 2 23 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1897 246 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542916.[MT7]-VPLDVC[CAM]LK[MT7].3y3_1.heavy 411.249 / 564.33 8010.0 34.3449010848999 44 20 10 6 8 30.616415332177464 3.266221695617686 0.035198211669921875 4 0.9997027544962601 71.58037421190782 8010.0 29.63391409349664 1.0 - - - - - - - 210.83333333333334 16 12 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1899 246 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542916.[MT7]-VPLDVC[CAM]LK[MT7].3b4_1.heavy 411.249 / 569.341 14671.0 34.3449010848999 44 20 10 6 8 30.616415332177464 3.266221695617686 0.035198211669921875 4 0.9997027544962601 71.58037421190782 14671.0 33.78480902614948 0.0 - - - - - - - 566.1428571428571 29 7 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1901 246 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542916.[MT7]-VPLDVC[CAM]LK[MT7].3b5_1.heavy 411.249 / 668.41 2782.0 34.3449010848999 44 20 10 6 8 30.616415332177464 3.266221695617686 0.035198211669921875 4 0.9997027544962601 71.58037421190782 2782.0 8.085374115428253 1.0 - - - - - - - 204.85714285714286 5 7 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1903 246 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542916.[MT7]-VPLDVC[CAM]LK[MT7].3b3_1.heavy 411.249 / 454.315 3373.0 34.3449010848999 44 20 10 6 8 30.616415332177464 3.266221695617686 0.035198211669921875 4 0.9997027544962601 71.58037421190782 3373.0 4.6972148148148145 1.0 - - - - - - - 176.27272727272728 7 11 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1905 247 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37070.[MT7]-FDTVK[MT7].2b3_1.heavy 449.268 / 508.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 1907 247 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37070.[MT7]-FDTVK[MT7].2y4_1.heavy 449.268 / 606.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 1909 247 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37070.[MT7]-FDTVK[MT7].2b4_1.heavy 449.268 / 607.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 1911 247 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37070.[MT7]-FDTVK[MT7].2y3_1.heavy 449.268 / 491.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - RFWD2 ring finger and WD repeat domain 2 1913 248 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543794.[MT7]-SLLQEAQNNLK[MT7].3y3_1.heavy 515.966 / 518.342 34308.0 33.739200592041016 44 14 10 10 10 1.4348778395145048 46.38694347061666 0.0 3 0.9477566304564561 5.375732557033799 34308.0 44.83215946843854 0.0 - - - - - - - 774.0 68 13 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1915 248 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543794.[MT7]-SLLQEAQNNLK[MT7].3b4_1.heavy 515.966 / 586.368 55804.0 33.739200592041016 44 14 10 10 10 1.4348778395145048 46.38694347061666 0.0 3 0.9477566304564561 5.375732557033799 55804.0 99.52324221974072 0.0 - - - - - - - 286.6666666666667 111 3 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1917 248 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543794.[MT7]-SLLQEAQNNLK[MT7].3b5_1.heavy 515.966 / 715.411 49527.0 33.739200592041016 44 14 10 10 10 1.4348778395145048 46.38694347061666 0.0 3 0.9477566304564561 5.375732557033799 49527.0 26.26533711604899 0.0 - - - - - - - 223.6 99 5 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1919 248 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543794.[MT7]-SLLQEAQNNLK[MT7].3y4_1.heavy 515.966 / 632.385 49957.0 33.739200592041016 44 14 10 10 10 1.4348778395145048 46.38694347061666 0.0 3 0.9477566304564561 5.375732557033799 49957.0 138.53473925299505 0.0 - - - - - - - 721.0769230769231 99 13 IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1921 249 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543796.[MT7]-AAAPPQPSPPPTK[MT7].3b6_1.heavy 516.299 / 680.385 3057.0 20.24394941329956 43 17 10 6 10 1.8606193113541143 41.7340684973372 0.03980064392089844 3 0.9713181023450878 7.269673307218123 3057.0 2.827753635012147 0.0 - - - - - - - 0.0 6 0 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1923 249 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543796.[MT7]-AAAPPQPSPPPTK[MT7].3b3_1.heavy 516.299 / 358.221 12228.0 20.24394941329956 43 17 10 6 10 1.8606193113541143 41.7340684973372 0.03980064392089844 3 0.9713181023450878 7.269673307218123 12228.0 17.886743174243882 0.0 - - - - - - - 0.0 24 0 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1925 249 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543796.[MT7]-AAAPPQPSPPPTK[MT7].3y4_1.heavy 516.299 / 586.368 4399.0 20.24394941329956 43 17 10 6 10 1.8606193113541143 41.7340684973372 0.03980064392089844 3 0.9713181023450878 7.269673307218123 4399.0 0.4370591157476404 2.0 - - - - - - - 0.0 8 0 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1927 249 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543796.[MT7]-AAAPPQPSPPPTK[MT7].3y5_1.heavy 516.299 / 683.421 6860.0 20.24394941329956 43 17 10 6 10 1.8606193113541143 41.7340684973372 0.03980064392089844 3 0.9713181023450878 7.269673307218123 6860.0 9.158977490985977 0.0 - - - - - - - 0.0 13 0 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1929 250 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543790.[MT7]-LSPENNQVLTK[MT7].3y3_1.heavy 510.962 / 505.347 190540.0 26.601200103759766 47 17 10 10 10 4.902285279222345 20.398649671375942 0.0 3 0.9729692160409646 7.489449347212056 190540.0 29.122447607916214 0.0 - - - - - - - 1390.0 381 2 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 1931 250 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543790.[MT7]-LSPENNQVLTK[MT7].3b4_1.heavy 510.962 / 571.321 43530.0 26.601200103759766 47 17 10 10 10 4.902285279222345 20.398649671375942 0.0 3 0.9729692160409646 7.489449347212056 43530.0 24.641279285401303 0.0 - - - - - - - 434.0 87 1 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 1933 250 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543790.[MT7]-LSPENNQVLTK[MT7].3b5_1.heavy 510.962 / 685.364 37448.0 26.601200103759766 47 17 10 10 10 4.902285279222345 20.398649671375942 0.0 3 0.9729692160409646 7.489449347212056 37448.0 44.69667371449873 0.0 - - - - - - - 702.9090909090909 74 11 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 1935 250 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543790.[MT7]-LSPENNQVLTK[MT7].3y4_1.heavy 510.962 / 604.415 57084.0 26.601200103759766 47 17 10 10 10 4.902285279222345 20.398649671375942 0.0 3 0.9729692160409646 7.489449347212056 57084.0 36.12911392405063 0.0 - - - - - - - 174.0 114 1 TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 1937 251 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543792.[MT7]-AAVEQLTEEQK[MT7].3b4_1.heavy 511.95 / 515.295 38207.0 25.64109992980957 47 17 10 10 10 2.3746972226069154 35.895544336719816 0.0 3 0.9715319718213286 7.29706078752717 38207.0 51.805378207288264 0.0 - - - - - - - 728.875 76 8 TNNC1 troponin C type 1 (slow) 1939 251 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543792.[MT7]-AAVEQLTEEQK[MT7].3b5_1.heavy 511.95 / 643.353 57042.0 25.64109992980957 47 17 10 10 10 2.3746972226069154 35.895544336719816 0.0 3 0.9715319718213286 7.29706078752717 57042.0 140.68876536121041 0.0 - - - - - - - 318.0 114 11 TNNC1 troponin C type 1 (slow) 1941 251 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543792.[MT7]-AAVEQLTEEQK[MT7].3y4_1.heavy 511.95 / 677.359 28431.0 25.64109992980957 47 17 10 10 10 2.3746972226069154 35.895544336719816 0.0 3 0.9715319718213286 7.29706078752717 28431.0 90.79713389537972 0.0 - - - - - - - 236.36363636363637 56 11 TNNC1 troponin C type 1 (slow) 1943 251 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB543792.[MT7]-AAVEQLTEEQK[MT7].3y5_1.heavy 511.95 / 778.406 23229.0 25.64109992980957 47 17 10 10 10 2.3746972226069154 35.895544336719816 0.0 3 0.9715319718213286 7.29706078752717 23229.0 98.59895196280456 0.0 - - - - - - - 285.27272727272725 46 11 TNNC1 troponin C type 1 (slow) 1945 252 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544022.[MT7]-EVDLSDIINTPLPR.3y6_1.heavy 575.988 / 697.399 55686.0 41.221174240112305 44 18 10 6 10 5.754003971609705 17.379202463780125 0.03530120849609375 3 0.9897710586107312 12.192033035213292 55686.0 145.12073494357134 0.0 - - - - - - - 712.8 111 10 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1947 252 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544022.[MT7]-EVDLSDIINTPLPR.3b6_1.heavy 575.988 / 803.39 92834.0 41.221174240112305 44 18 10 6 10 5.754003971609705 17.379202463780125 0.03530120849609375 3 0.9897710586107312 12.192033035213292 92834.0 288.7696811594203 0.0 - - - - - - - 261.53333333333336 185 15 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1949 252 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544022.[MT7]-EVDLSDIINTPLPR.3b4_1.heavy 575.988 / 601.331 19964.0 41.221174240112305 44 18 10 6 10 5.754003971609705 17.379202463780125 0.03530120849609375 3 0.9897710586107312 12.192033035213292 19964.0 64.83635514018692 0.0 - - - - - - - 280.875 39 16 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1951 252 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544022.[MT7]-EVDLSDIINTPLPR.3b7_1.heavy 575.988 / 916.474 23886.0 41.221174240112305 44 18 10 6 10 5.754003971609705 17.379202463780125 0.03530120849609375 3 0.9897710586107312 12.192033035213292 23886.0 173.6157464855101 0.0 - - - - - - - 240.6875 47 16 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1953 253 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37673.[MT7]-TTLTITQPRPTLTLSQAPQPGPR.3y6_1.heavy 873.496 / 651.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1955 253 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37673.[MT7]-TTLTITQPRPTLTLSQAPQPGPR.3b4_1.heavy 873.496 / 561.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1957 253 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37673.[MT7]-TTLTITQPRPTLTLSQAPQPGPR.3y10_1.heavy 873.496 / 1050.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1959 253 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37673.[MT7]-TTLTITQPRPTLTLSQAPQPGPR.3y9_1.heavy 873.496 / 937.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1961 254 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542529.[MT7]-TSQSEETR.2y5_1.heavy 541.266 / 621.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 1963 254 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542529.[MT7]-TSQSEETR.2b6_1.heavy 541.266 / 806.365 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 1965 254 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542529.[MT7]-TSQSEETR.2b5_1.heavy 541.266 / 677.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 1967 254 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542529.[MT7]-TSQSEETR.2y7_1.heavy 541.266 / 836.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 1969 255 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42829.[MT7]-NLINQMLTINPAK[MT7].3b6_1.heavy 586.678 / 858.462 4315.0 40.46922492980957 39 13 10 6 10 1.9721385893025003 40.18768845485031 0.03189849853515625 3 0.9219765552656718 4.389193865606455 4315.0 32.66215277777778 0.0 - - - - - - - 165.1764705882353 8 17 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 1971 255 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42829.[MT7]-NLINQMLTINPAK[MT7].3b4_1.heavy 586.678 / 599.363 2589.0 40.46922492980957 39 13 10 6 10 1.9721385893025003 40.18768845485031 0.03189849853515625 3 0.9219765552656718 4.389193865606455 2589.0 0.39984555984555975 1.0 - - - - - - - 288.0 5 15 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 1973 255 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42829.[MT7]-NLINQMLTINPAK[MT7].3b5_1.heavy 586.678 / 727.422 9062.0 40.46922492980957 39 13 10 6 10 1.9721385893025003 40.18768845485031 0.03189849853515625 3 0.9219765552656718 4.389193865606455 9062.0 34.13096439879243 0.0 - - - - - - - 203.2941176470588 18 17 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 1975 255 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42829.[MT7]-NLINQMLTINPAK[MT7].3y4_1.heavy 586.678 / 573.348 9925.0 40.46922492980957 39 13 10 6 10 1.9721385893025003 40.18768845485031 0.03189849853515625 3 0.9219765552656718 4.389193865606455 9925.0 26.186266674743095 0.0 - - - - - - - 655.0 19 9 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 1977 256 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544027.[MT7]-VPGSIALPVQTLVSAR.3y7_1.heavy 584.688 / 774.447 11816.0 40.907100677490234 46 16 10 10 10 2.3605364302821763 34.003600666613295 0.0 3 0.969501010029428 7.048709652891921 11816.0 41.014766894983346 0.0 - - - - - - - 286.42857142857144 23 7 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1979 256 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544027.[MT7]-VPGSIALPVQTLVSAR.3y6_1.heavy 584.688 / 646.388 8880.0 40.907100677490234 46 16 10 10 10 2.3605364302821763 34.003600666613295 0.0 3 0.969501010029428 7.048709652891921 8880.0 16.83832335329341 1.0 - - - - - - - 671.375 17 8 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1981 256 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544027.[MT7]-VPGSIALPVQTLVSAR.3b6_1.heavy 584.688 / 669.405 17258.0 40.907100677490234 46 16 10 10 10 2.3605364302821763 34.003600666613295 0.0 3 0.969501010029428 7.048709652891921 17258.0 0.5100635436677997 2.0 - - - - - - - 286.3333333333333 34 3 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1983 256 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544027.[MT7]-VPGSIALPVQTLVSAR.3y9_1.heavy 584.688 / 970.568 9667.0 40.907100677490234 46 16 10 10 10 2.3605364302821763 34.003600666613295 0.0 3 0.969501010029428 7.048709652891921 9667.0 43.61390697674419 1.0 - - - - - - - 214.875 19 8 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 1985 257 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544122.[MT7]-FNSDTNEVDVPLNTR.3y7_1.heavy 622.31 / 814.442 8882.0 30.500600814819336 47 17 10 10 10 4.6942597563306725 21.30261323207352 0.0 3 0.9795094945992923 8.606798921552675 8882.0 18.97518181818182 0.0 - - - - - - - 314.09090909090907 17 11 BMPR1A bone morphogenetic protein receptor, type IA 1987 257 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544122.[MT7]-FNSDTNEVDVPLNTR.3y6_1.heavy 622.31 / 699.415 3740.0 30.500600814819336 47 17 10 10 10 4.6942597563306725 21.30261323207352 0.0 3 0.9795094945992923 8.606798921552675 3740.0 13.1 0.0 - - - - - - - 314.1818181818182 7 11 BMPR1A bone morphogenetic protein receptor, type IA 1989 257 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544122.[MT7]-FNSDTNEVDVPLNTR.3b4_1.heavy 622.31 / 608.28 5423.0 30.500600814819336 47 17 10 10 10 4.6942597563306725 21.30261323207352 0.0 3 0.9795094945992923 8.606798921552675 5423.0 7.3688045267489715 0.0 - - - - - - - 700.875 10 8 BMPR1A bone morphogenetic protein receptor, type IA 1991 257 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544122.[MT7]-FNSDTNEVDVPLNTR.3y5_1.heavy 622.31 / 600.346 17296.0 30.500600814819336 47 17 10 10 10 4.6942597563306725 21.30261323207352 0.0 3 0.9795094945992923 8.606798921552675 17296.0 13.301868290950384 0.0 - - - - - - - 373.6666666666667 34 3 BMPR1A bone morphogenetic protein receptor, type IA 1993 258 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43488.[MT7]-TLSQLSQQEGIK[MT7].2y4_1.heavy 810.464 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBR1 transforming growth factor, beta receptor 1 1995 258 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43488.[MT7]-TLSQLSQQEGIK[MT7].2y8_1.heavy 810.464 / 1046.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBR1 transforming growth factor, beta receptor 1 1997 258 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43488.[MT7]-TLSQLSQQEGIK[MT7].2b4_1.heavy 810.464 / 574.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBR1 transforming growth factor, beta receptor 1 1999 258 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB43488.[MT7]-TLSQLSQQEGIK[MT7].2y7_1.heavy 810.464 / 933.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBR1 transforming growth factor, beta receptor 1 2001 259 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42826.[MT7]-VPGSIALPVQTLVSAR.2y9_1.heavy 876.529 / 970.568 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 2003 259 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42826.[MT7]-VPGSIALPVQTLVSAR.2y10_1.heavy 876.529 / 1083.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 2005 259 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42826.[MT7]-VPGSIALPVQTLVSAR.2y11_1.heavy 876.529 / 1154.69 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 2007 260 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37479.[MT7]-RLLSTDAEAVSTR.2b8_1.heavy 781.935 / 1030.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 2009 260 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37479.[MT7]-RLLSTDAEAVSTR.2b6_1.heavy 781.935 / 830.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 2011 260 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37479.[MT7]-RLLSTDAEAVSTR.2y10_1.heavy 781.935 / 1036.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 2013 260 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37479.[MT7]-RLLSTDAEAVSTR.2y7_1.heavy 781.935 / 733.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa 2015 261 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542724.[MT7]-VNLLSAIK[MT7].2y4_1.heavy 573.378 / 562.368 12777.0 37.65275001525879 41 15 10 6 10 1.4023342356731088 45.87548325532153 0.034496307373046875 3 0.9599076967235274 6.142852579130413 12777.0 23.475798607146935 0.0 - - - - - - - 374.5 25 10 TNF tumor necrosis factor 2017 261 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542724.[MT7]-VNLLSAIK[MT7].2y5_1.heavy 573.378 / 675.452 7324.0 37.65275001525879 41 15 10 6 10 1.4023342356731088 45.87548325532153 0.034496307373046875 3 0.9599076967235274 6.142852579130413 7324.0 28.76214578214578 0.0 - - - - - - - 282.2 14 15 TNF tumor necrosis factor 2019 261 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542724.[MT7]-VNLLSAIK[MT7].2b4_1.heavy 573.378 / 584.389 8870.0 37.65275001525879 41 15 10 6 10 1.4023342356731088 45.87548325532153 0.034496307373046875 3 0.9599076967235274 6.142852579130413 8870.0 20.58135343083607 0.0 - - - - - - - 301.2 17 10 TNF tumor necrosis factor 2021 261 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542724.[MT7]-VNLLSAIK[MT7].2y7_1.heavy 573.378 / 902.579 6592.0 37.65275001525879 41 15 10 6 10 1.4023342356731088 45.87548325532153 0.034496307373046875 3 0.9599076967235274 6.142852579130413 6592.0 46.92431648603428 0.0 - - - - - - - 197.71428571428572 13 14 TNF tumor necrosis factor 2023 262 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542212.[MT7]-TLLTFK[MT7].2b3_1.heavy 505.828 / 472.325 4378.0 35.08222484588623 42 16 10 6 10 2.3225611295149715 43.05591733591242 0.031497955322265625 3 0.9642213486882174 6.50499453439965 4378.0 5.673434125269979 1.0 - - - - - - - 1136.375 8 8 RFWD2 ring finger and WD repeat domain 2 2025 262 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542212.[MT7]-TLLTFK[MT7].2y4_1.heavy 505.828 / 652.415 4378.0 35.08222484588623 42 16 10 6 10 2.3225611295149715 43.05591733591242 0.031497955322265625 3 0.9642213486882174 6.50499453439965 4378.0 10.295936128077113 0.0 - - - - - - - 659.5833333333334 8 12 RFWD2 ring finger and WD repeat domain 2 2027 262 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542212.[MT7]-TLLTFK[MT7].2y5_1.heavy 505.828 / 765.499 3536.0 35.08222484588623 42 16 10 6 10 2.3225611295149715 43.05591733591242 0.031497955322265625 3 0.9642213486882174 6.50499453439965 3536.0 25.876067892503535 0.0 - - - - - - - 182.33333333333334 7 18 RFWD2 ring finger and WD repeat domain 2 2029 262 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542212.[MT7]-TLLTFK[MT7].2y3_1.heavy 505.828 / 539.331 7072.0 35.08222484588623 42 16 10 6 10 2.3225611295149715 43.05591733591242 0.031497955322265625 3 0.9642213486882174 6.50499453439965 7072.0 16.062963378098814 0.0 - - - - - - - 622.9 14 10 RFWD2 ring finger and WD repeat domain 2 2031 263 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542924.[MT7]-ILEIGK[MT7]K[MT7].3y6_2.heavy 411.615 / 488.326 16203.0 27.862099329630535 33 11 10 6 6 1.8811541522351631 53.158854568713195 0.03479957580566406 5 0.8707285832870937 3.3948268030186615 16203.0 57.97538575852798 0.0 - - - - - - - 733.3333333333334 32 9 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 2033 263 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542924.[MT7]-ILEIGK[MT7]K[MT7].3y3_1.heavy 411.615 / 620.433 3429.0 27.862099329630535 33 11 10 6 6 1.8811541522351631 53.158854568713195 0.03479957580566406 5 0.8707285832870937 3.3948268030186615 3429.0 20.28046692607004 2.0 - - - - - - - 208.9375 17 16 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 2035 263 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542924.[MT7]-ILEIGK[MT7]K[MT7].3y4_1.heavy 411.615 / 733.517 2829.0 27.862099329630535 33 11 10 6 6 1.8811541522351631 53.158854568713195 0.03479957580566406 5 0.8707285832870937 3.3948268030186615 2829.0 19.839756979998636 0.0 - - - - - - - 139.25 5 8 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 2037 263 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB542924.[MT7]-ILEIGK[MT7]K[MT7].3y5_1.heavy 411.615 / 862.56 N/A 27.862099329630535 33 11 10 6 6 1.8811541522351631 53.158854568713195 0.03479957580566406 5 0.8707285832870937 3.3948268030186615 0.0 0.0 2.0 - - - - - - - 0.0 0 0 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 2039 264 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37040.[MT7]-TTVDK[MT7].2b3_1.heavy 426.257 / 446.273 1671.0 15.16670036315918 43 13 10 10 10 1.1725996997258166 68.00348345465923 0.0 3 0.9115387400110527 4.118424074364362 1671.0 13.031907015198424 0.0 - - - - - - - 187.96296296296296 3 27 SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 2041 264 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37040.[MT7]-TTVDK[MT7].2y4_1.heavy 426.257 / 606.358 10298.0 15.16670036315918 43 13 10 10 10 1.1725996997258166 68.00348345465923 0.0 3 0.9115387400110527 4.118424074364362 10298.0 41.537778734395175 0.0 - - - - - - - 194.95833333333334 20 24 SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 2043 264 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37040.[MT7]-TTVDK[MT7].2b4_1.heavy 426.257 / 561.3 9838.0 15.16670036315918 43 13 10 10 10 1.1725996997258166 68.00348345465923 0.0 3 0.9115387400110527 4.118424074364362 9838.0 44.77565721787181 0.0 - - - - - - - 203.66666666666666 19 24 SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 2045 264 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37040.[MT7]-TTVDK[MT7].2y3_1.heavy 426.257 / 505.31 4261.0 15.16670036315918 43 13 10 10 10 1.1725996997258166 68.00348345465923 0.0 3 0.9115387400110527 4.118424074364362 4261.0 39.200505955410776 0.0 - - - - - - - 171.96153846153845 8 26 SLC8A3 solute carrier family 8 (sodium/calcium exchanger), member 3 2047 265 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24191.[MT7]-EVDPNEQLDEDVEEMLLQIADDFIESVVTAAC[CAM]QLAR.4b8_1.heavy 1063.01 / 1069.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 2049 265 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24191.[MT7]-EVDPNEQLDEDVEEMLLQIADDFIESVVTAAC[CAM]QLAR.4y8_1.heavy 1063.01 / 890.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 2051 265 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24191.[MT7]-EVDPNEQLDEDVEEMLLQIADDFIESVVTAAC[CAM]QLAR.4b7_1.heavy 1063.01 / 956.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 2053 265 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB24191.[MT7]-EVDPNEQLDEDVEEMLLQIADDFIESVVTAAC[CAM]QLAR.4y9_1.heavy 1063.01 / 989.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa 2055 266 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42337.[MT7]-AGEPAER.2y4_1.heavy 437.231 / 472.251 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 2057 266 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42337.[MT7]-AGEPAER.2b4_1.heavy 437.231 / 499.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 2059 266 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42337.[MT7]-AGEPAER.2y6_1.heavy 437.231 / 658.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 2061 266 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42337.[MT7]-AGEPAER.2b5_1.heavy 437.231 / 570.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 2063 267 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544135.[MT7]-FTDEYQLYEDIGK[MT7].3b6_1.heavy 636.987 / 928.417 16083.0 37.26029968261719 43 13 10 10 10 1.070059820479256 62.30181284333072 0.0 3 0.9156520585977179 4.219141957607328 16083.0 7.246731657260134 1.0 - - - - - - - 206.07692307692307 35 13 CAMK2B calcium/calmodulin-dependent protein kinase II beta 2065 267 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544135.[MT7]-FTDEYQLYEDIGK[MT7].3b5_1.heavy 636.987 / 800.358 12996.0 37.26029968261719 43 13 10 10 10 1.070059820479256 62.30181284333072 0.0 3 0.9156520585977179 4.219141957607328 12996.0 38.468652661506866 0.0 - - - - - - - 211.94444444444446 25 18 CAMK2B calcium/calmodulin-dependent protein kinase II beta 2067 267 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544135.[MT7]-FTDEYQLYEDIGK[MT7].3y4_1.heavy 636.987 / 576.347 21850.0 37.26029968261719 43 13 10 10 10 1.070059820479256 62.30181284333072 0.0 3 0.9156520585977179 4.219141957607328 21850.0 71.27951875710497 0.0 - - - - - - - 227.26666666666668 43 15 CAMK2B calcium/calmodulin-dependent protein kinase II beta 2069 267 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544135.[MT7]-FTDEYQLYEDIGK[MT7].3b3_1.heavy 636.987 / 508.252 14621.0 37.26029968261719 43 13 10 10 10 1.070059820479256 62.30181284333072 0.0 3 0.9156520585977179 4.219141957607328 14621.0 32.848771883289125 0.0 - - - - - - - 680.375 29 8 CAMK2B calcium/calmodulin-dependent protein kinase II beta 2071 268 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544035.[MT7]-ERTDDEQFADEK[MT7].3y3_1.heavy 590.951 / 535.284 5843.0 20.515950202941895 38 12 10 6 10 3.5787748206513834 27.942523632095604 0.039798736572265625 3 0.8860384754874997 3.6205108791175316 5843.0 26.71183970623045 0.0 - - - - - - - 283.42857142857144 11 14 CAB39L calcium binding protein 39-like 2073 268 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544035.[MT7]-ERTDDEQFADEK[MT7].3b5_1.heavy 590.951 / 761.355 2164.0 20.515950202941895 38 12 10 6 10 3.5787748206513834 27.942523632095604 0.039798736572265625 3 0.8860384754874997 3.6205108791175316 2164.0 10.25840830449827 0.0 - - - - - - - 192.33333333333334 4 18 CAB39L calcium binding protein 39-like 2075 268 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544035.[MT7]-ERTDDEQFADEK[MT7].3y4_1.heavy 590.951 / 606.321 5626.0 20.515950202941895 38 12 10 6 10 3.5787748206513834 27.942523632095604 0.039798736572265625 3 0.8860384754874997 3.6205108791175316 5626.0 29.926171841587546 0.0 - - - - - - - 180.1875 11 16 CAB39L calcium binding protein 39-like 2077 268 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544035.[MT7]-ERTDDEQFADEK[MT7].3b7_1.heavy 590.951 / 1018.46 3174.0 20.515950202941895 38 12 10 6 10 3.5787748206513834 27.942523632095604 0.039798736572265625 3 0.8860384754874997 3.6205108791175316 3174.0 7.1348074807480755 0.0 - - - - - - - 148.35294117647058 6 17 CAB39L calcium binding protein 39-like 2079 269 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544137.[MT7]-FISDIANDALQHC[CAM]K[MT7].4y4_1.heavy 480.753 / 716.363 6038.0 36.11240005493164 50 20 10 10 10 3.8471046006767122 25.993574487787473 0.0 3 0.9932416856158626 15.003696805378304 6038.0 42.9426724137931 0.0 - - - - - - - 203.04166666666666 12 24 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 2081 269 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544137.[MT7]-FISDIANDALQHC[CAM]K[MT7].4b4_1.heavy 480.753 / 607.321 57904.0 36.11240005493164 50 20 10 10 10 3.8471046006767122 25.993574487787473 0.0 3 0.9932416856158626 15.003696805378304 57904.0 140.0833112895607 0.0 - - - - - - - 294.1 115 10 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 2083 269 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544137.[MT7]-FISDIANDALQHC[CAM]K[MT7].4b5_1.heavy 480.753 / 720.405 10373.0 36.11240005493164 50 20 10 10 10 3.8471046006767122 25.993574487787473 0.0 3 0.9932416856158626 15.003696805378304 10373.0 42.885788113695085 0.0 - - - - - - - 203.1875 20 16 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 2085 269 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544137.[MT7]-FISDIANDALQHC[CAM]K[MT7].4y3_1.heavy 480.753 / 588.304 16721.0 36.11240005493164 50 20 10 10 10 3.8471046006767122 25.993574487787473 0.0 3 0.9932416856158626 15.003696805378304 16721.0 35.68813475951801 0.0 - - - - - - - 619.4285714285714 33 7 TAF10 TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa 2087 270 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37491.[MT7]-FFEQLDQIEK[MT7].2b3_1.heavy 792.929 / 568.289 4226.0 38.25292491912842 44 18 10 6 10 4.1257317665903726 24.238124448561273 0.037097930908203125 3 0.9832199474543674 9.513855354296682 4226.0 19.37906843501326 0.0 - - - - - - - 225.83333333333334 8 18 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 2089 270 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37491.[MT7]-FFEQLDQIEK[MT7].2y5_1.heavy 792.929 / 776.427 5282.0 38.25292491912842 44 18 10 6 10 4.1257317665903726 24.238124448561273 0.037097930908203125 3 0.9832199474543674 9.513855354296682 5282.0 20.06352428857126 0.0 - - - - - - - 741.5 10 8 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 2091 270 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37491.[MT7]-FFEQLDQIEK[MT7].2b4_1.heavy 792.929 / 696.347 3576.0 38.25292491912842 44 18 10 6 10 4.1257317665903726 24.238124448561273 0.037097930908203125 3 0.9832199474543674 9.513855354296682 3576.0 34.10650910188072 0.0 - - - - - - - 214.78571428571428 7 14 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 2093 270 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37491.[MT7]-FFEQLDQIEK[MT7].2b6_1.heavy 792.929 / 924.458 3088.0 38.25292491912842 44 18 10 6 10 4.1257317665903726 24.238124448561273 0.037097930908203125 3 0.9832199474543674 9.513855354296682 3088.0 24.04774517211158 0.0 - - - - - - - 216.77777777777777 6 18 TAF4 TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa 2095 271 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544037.[MT7]-DLK[MT7]PENLLLASK[MT7].4y4_1.heavy 444.027 / 562.368 36637.0 33.704200744628906 48 18 10 10 10 17.904619052271617 5.5851509439019695 0.0 3 0.9802424530020842 8.765530479013432 36637.0 182.10806059260034 0.0 - - - - - - - 246.05882352941177 73 17 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 2097 271 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544037.[MT7]-DLK[MT7]PENLLLASK[MT7].4y3_1.heavy 444.027 / 449.284 49447.0 33.704200744628906 48 18 10 10 10 17.904619052271617 5.5851509439019695 0.0 3 0.9802424530020842 8.765530479013432 49447.0 153.7205023032625 0.0 - - - - - - - 683.0 98 7 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 2099 271 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544037.[MT7]-DLK[MT7]PENLLLASK[MT7].4b3_1.heavy 444.027 / 645.417 4441.0 33.704200744628906 48 18 10 10 10 17.904619052271617 5.5851509439019695 0.0 3 0.9802424530020842 8.765530479013432 4441.0 23.649116296600877 0.0 - - - - - - - 188.68421052631578 8 19 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 2101 271 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB544037.[MT7]-DLK[MT7]PENLLLASK[MT7].4b6_2.heavy 444.027 / 493.281 88476.0 33.704200744628906 48 18 10 10 10 17.904619052271617 5.5851509439019695 0.0 3 0.9802424530020842 8.765530479013432 88476.0 113.54745114712952 0.0 - - - - - - - 707.5 176 14 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 2103 272 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37685.[MT7]-VLVADFLEQNYDTIFEDYEK[MT7].3y3_1.heavy 913.793 / 583.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 2105 272 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37685.[MT7]-VLVADFLEQNYDTIFEDYEK[MT7].3y6_1.heavy 913.793 / 974.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 2107 272 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37685.[MT7]-VLVADFLEQNYDTIFEDYEK[MT7].3b6_1.heavy 913.793 / 789.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 2109 272 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB37685.[MT7]-VLVADFLEQNYDTIFEDYEK[MT7].3b5_1.heavy 913.793 / 642.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAB39L calcium binding protein 39-like 2111 273 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23508.[MT7]-TLLLK[MT7].2b3_1.heavy 438.312 / 472.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIF20A;PHLPP1;ABCA5;FAM190A;DUOX2;DUOX1;TEX10;RASA2;SLC4A3;C13orf38 kinesin family member 20A;PH domain and leucine rich repeat protein phosphatase 1;ATP-binding cassette, sub-family A (ABC1), member 5;family with sequence similarity 190, member A;dual oxidase 2;dual oxidase 1;testis expressed 10;RAS p21 protein activator 2;solute carrier family 4, anion exchanger, member 3;chromosome 13 open reading frame 38 2113 273 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23508.[MT7]-TLLLK[MT7].2y4_1.heavy 438.312 / 630.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIF20A;PHLPP1;ABCA5;FAM190A;DUOX2;DUOX1;TEX10;RASA2;SLC4A3;C13orf38 kinesin family member 20A;PH domain and leucine rich repeat protein phosphatase 1;ATP-binding cassette, sub-family A (ABC1), member 5;family with sequence similarity 190, member A;dual oxidase 2;dual oxidase 1;testis expressed 10;RAS p21 protein activator 2;solute carrier family 4, anion exchanger, member 3;chromosome 13 open reading frame 38 2115 273 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23508.[MT7]-TLLLK[MT7].2b4_1.heavy 438.312 / 585.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIF20A;PHLPP1;ABCA5;FAM190A;DUOX2;DUOX1;TEX10;RASA2;SLC4A3;C13orf38 kinesin family member 20A;PH domain and leucine rich repeat protein phosphatase 1;ATP-binding cassette, sub-family A (ABC1), member 5;family with sequence similarity 190, member A;dual oxidase 2;dual oxidase 1;testis expressed 10;RAS p21 protein activator 2;solute carrier family 4, anion exchanger, member 3;chromosome 13 open reading frame 38 2117 273 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23508.[MT7]-TLLLK[MT7].2y3_1.heavy 438.312 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIF20A;PHLPP1;ABCA5;FAM190A;DUOX2;DUOX1;TEX10;RASA2;SLC4A3;C13orf38 kinesin family member 20A;PH domain and leucine rich repeat protein phosphatase 1;ATP-binding cassette, sub-family A (ABC1), member 5;family with sequence similarity 190, member A;dual oxidase 2;dual oxidase 1;testis expressed 10;RAS p21 protein activator 2;solute carrier family 4, anion exchanger, member 3;chromosome 13 open reading frame 38 2119 274 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23502.[MT7]-TLILPR.2b3_1.heavy 428.79 / 472.325 5485.0 31.192200660705566 38 17 10 3 8 4.815060853521183 20.768169508568405 0.07360076904296875 4 0.9726191482132852 7.441199260457907 5485.0 4.059645953880118 1.0 - - - - - - - 757.2857142857143 13 7 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 2121 274 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23502.[MT7]-TLILPR.2y4_1.heavy 428.79 / 498.34 6972.0 31.192200660705566 38 17 10 3 8 4.815060853521183 20.768169508568405 0.07360076904296875 4 0.9726191482132852 7.441199260457907 6972.0 6.747096774193548 1.0 - - - - - - - 260.4 13 10 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 2123 274 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23502.[MT7]-TLILPR.2y5_1.heavy 428.79 / 611.424 12828.0 31.192200660705566 38 17 10 3 8 4.815060853521183 20.768169508568405 0.07360076904296875 4 0.9726191482132852 7.441199260457907 12828.0 37.13912903225806 0.0 - - - - - - - 209.25 25 12 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 2125 274 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB23502.[MT7]-TLILPR.2b4_1.heavy 428.79 / 585.409 3997.0 31.192200660705566 38 17 10 3 8 4.815060853521183 20.768169508568405 0.07360076904296875 4 0.9726191482132852 7.441199260457907 3997.0 8.108661061849649 1.0 - - - - - - - 755.625 7 8 TAF6 TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 2127 275 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42977.[MT7]-TLQVQMLDLLDIEGLYPLYNRVER.4y12_2.heavy 759.664 / 754.896 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 2129 275 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42977.[MT7]-TLQVQMLDLLDIEGLYPLYNRVER.4b4_1.heavy 759.664 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 2131 275 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42977.[MT7]-TLQVQMLDLLDIEGLYPLYNRVER.4b5_1.heavy 759.664 / 714.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase 2133 275 B20140227_KEGG1700_set04_04 B20140227_KEGG1700_set04_04 TB42977.[MT7]-TLQVQMLDLLDIEGLYPLYNRVER.4b6_1.heavy 759.664 / 845.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase