Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542957.[MT7]-SDAEAVSTR.2y5_1.heavy 540.276 / 533.304 4628.0 15.748475074768066 47 20 10 7 10 16.569910229889363 6.035035713085314 0.028499603271484375 3 0.9932778092189422 15.044001505717727 4628.0 8.502665694376926 0.0 - - - - - - - 197.1304347826087 9 23 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 3 1 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542957.[MT7]-SDAEAVSTR.2b4_1.heavy 540.276 / 547.248 5399.0 15.748475074768066 47 20 10 7 10 16.569910229889363 6.035035713085314 0.028499603271484375 3 0.9932778092189422 15.044001505717727 5399.0 27.764002959674436 0.0 - - - - - - - 181.375 10 16 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 5 1 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542957.[MT7]-SDAEAVSTR.2b5_1.heavy 540.276 / 618.285 4220.0 15.748475074768066 47 20 10 7 10 16.569910229889363 6.035035713085314 0.028499603271484375 3 0.9932778092189422 15.044001505717727 4220.0 27.081051727481785 0.0 - - - - - - - 198.8095238095238 8 21 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 7 1 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542957.[MT7]-SDAEAVSTR.2y7_1.heavy 540.276 / 733.384 7033.0 15.748475074768066 47 20 10 7 10 16.569910229889363 6.035035713085314 0.028499603271484375 3 0.9932778092189422 15.044001505717727 7033.0 41.30773236919077 0.0 - - - - - - - 128.44444444444446 14 18 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 9 2 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542443.[MT7]-NVNVFK[MT7].2y4_1.heavy 504.808 / 651.395 10792.0 26.857099533081055 50 20 10 10 10 5.4625171962350105 18.306578525542047 0.0 3 0.99216318859254 13.931845188621303 10792.0 37.33059336593102 0.0 - - - - - - - 309.84615384615387 21 13 LDHB lactate dehydrogenase B 11 2 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542443.[MT7]-NVNVFK[MT7].2y5_1.heavy 504.808 / 750.463 7974.0 26.857099533081055 50 20 10 10 10 5.4625171962350105 18.306578525542047 0.0 3 0.99216318859254 13.931845188621303 7974.0 45.502269390688355 0.0 - - - - - - - 210.5 15 18 LDHB lactate dehydrogenase B 13 2 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542443.[MT7]-NVNVFK[MT7].2b4_1.heavy 504.808 / 571.332 7732.0 26.857099533081055 50 20 10 10 10 5.4625171962350105 18.306578525542047 0.0 3 0.99216318859254 13.931845188621303 7732.0 21.834620778940554 0.0 - - - - - - - 292.90909090909093 15 11 LDHB lactate dehydrogenase B 15 2 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542443.[MT7]-NVNVFK[MT7].2y3_1.heavy 504.808 / 537.352 6524.0 26.857099533081055 50 20 10 10 10 5.4625171962350105 18.306578525542047 0.0 3 0.99216318859254 13.931845188621303 6524.0 12.805756293304086 0.0 - - - - - - - 724.8571428571429 13 7 LDHB lactate dehydrogenase B 17 3 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544922.[MT7]-SWHLTPSC[CAM]PLDPAPLR.3b5_1.heavy 664.348 / 769.411 1615.0 34.67275047302246 45 20 10 5 10 5.99174419423527 16.68963105871763 0.041698455810546875 3 0.9965499790634006 21.005187616889884 1615.0 9.38430637241677 0.0 - - - - - - - 247.6 3 10 IRAK1 interleukin-1 receptor-associated kinase 1 19 3 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544922.[MT7]-SWHLTPSC[CAM]PLDPAPLR.3b3_1.heavy 664.348 / 555.28 2799.0 34.67275047302246 45 20 10 5 10 5.99174419423527 16.68963105871763 0.041698455810546875 3 0.9965499790634006 21.005187616889884 2799.0 10.199704855835954 0.0 - - - - - - - 686.375 5 8 IRAK1 interleukin-1 receptor-associated kinase 1 21 3 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544922.[MT7]-SWHLTPSC[CAM]PLDPAPLR.3y8_1.heavy 664.348 / 878.509 2476.0 34.67275047302246 45 20 10 5 10 5.99174419423527 16.68963105871763 0.041698455810546875 3 0.9965499790634006 21.005187616889884 2476.0 12.435868937494597 0.0 - - - - - - - 226.1 4 10 IRAK1 interleukin-1 receptor-associated kinase 1 23 3 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544922.[MT7]-SWHLTPSC[CAM]PLDPAPLR.3y5_1.heavy 664.348 / 553.346 9581.0 34.67275047302246 45 20 10 5 10 5.99174419423527 16.68963105871763 0.041698455810546875 3 0.9965499790634006 21.005187616889884 9581.0 20.695042334679908 0.0 - - - - - - - 722.8571428571429 19 7 IRAK1 interleukin-1 receptor-associated kinase 1 25 4 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22611.[MT7]-EVFAGK[MT7].2b3_1.heavy 469.781 / 520.289 6770.0 23.80369997024536 43 17 10 6 10 4.536211525669534 22.044827370619636 0.03320121765136719 3 0.9765469337080716 8.042852165302602 6770.0 8.031314580975184 0.0 - - - - - - - 668.4444444444445 13 9 PLK1 polo-like kinase 1 27 4 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22611.[MT7]-EVFAGK[MT7].2y4_1.heavy 469.781 / 566.342 18190.0 23.80369997024536 43 17 10 6 10 4.536211525669534 22.044827370619636 0.03320121765136719 3 0.9765469337080716 8.042852165302602 18190.0 28.693983174053404 0.0 - - - - - - - 692.375 36 8 PLK1 polo-like kinase 1 29 4 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22611.[MT7]-EVFAGK[MT7].2y5_1.heavy 469.781 / 665.41 17096.0 23.80369997024536 43 17 10 6 10 4.536211525669534 22.044827370619636 0.03320121765136719 3 0.9765469337080716 8.042852165302602 17096.0 52.060945294375486 0.0 - - - - - - - 200.9375 34 16 PLK1 polo-like kinase 1 31 4 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22611.[MT7]-EVFAGK[MT7].2b4_1.heavy 469.781 / 591.326 4787.0 23.80369997024536 43 17 10 6 10 4.536211525669534 22.044827370619636 0.03320121765136719 3 0.9765469337080716 8.042852165302602 4787.0 7.057317171381291 1.0 - - - - - - - 264.3333333333333 9 15 PLK1 polo-like kinase 1 33 5 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22881.[MT7]-VSEVK[MT7]PK[MT7].2y4_1.heavy 609.893 / 759.533 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 35 5 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22881.[MT7]-VSEVK[MT7]PK[MT7].2y3_1.heavy 609.893 / 660.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 37 5 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22881.[MT7]-VSEVK[MT7]PK[MT7].2y6_1.heavy 609.893 / 975.608 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 39 5 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22881.[MT7]-VSEVK[MT7]PK[MT7].2b5_1.heavy 609.893 / 831.518 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 41 6 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23229.[MT7]-VLTQMGSPLNPISSVS.2b4_1.heavy 887.48 / 586.368 710.0 40.23809814453125 29 13 2 10 4 5.761726679313191 17.35590831808082 0.0 9 0.9149550170813391 4.201564103173399 710.0 1.9023809523809523 9.0 - - - - - - - 0.0 1 0 SMAD5 SMAD family member 5 43 6 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23229.[MT7]-VLTQMGSPLNPISSVS.2b6_1.heavy 887.48 / 774.43 1349.0 40.23809814453125 29 13 2 10 4 5.761726679313191 17.35590831808082 0.0 9 0.9149550170813391 4.201564103173399 1349.0 2.111111111111111 16.0 - - - - - - - 740.4285714285714 9 7 SMAD5 SMAD family member 5 45 6 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23229.[MT7]-VLTQMGSPLNPISSVS.2b7_1.heavy 887.48 / 861.462 1562.0 40.23809814453125 29 13 2 10 4 5.761726679313191 17.35590831808082 0.0 9 0.9149550170813391 4.201564103173399 1562.0 1.153846153846154 1.0 - - - - - - - 759.7 3 10 SMAD5 SMAD family member 5 47 6 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23229.[MT7]-VLTQMGSPLNPISSVS.2b10_1.heavy 887.48 / 1185.64 2343.0 40.23809814453125 29 13 2 10 4 5.761726679313191 17.35590831808082 0.0 9 0.9149550170813391 4.201564103173399 2343.0 21.119999999999997 0.0 - - - - - - - 157.21428571428572 4 14 SMAD5 SMAD family member 5 49 7 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543566.[MT7]-YEPSETAK[MT7].2y4_1.heavy 606.821 / 592.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD1 phospholipase C, delta 1 51 7 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543566.[MT7]-YEPSETAK[MT7].2y5_1.heavy 606.821 / 679.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD1 phospholipase C, delta 1 53 7 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543566.[MT7]-YEPSETAK[MT7].2y6_1.heavy 606.821 / 776.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD1 phospholipase C, delta 1 55 7 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543566.[MT7]-YEPSETAK[MT7].2y7_1.heavy 606.821 / 905.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD1 phospholipase C, delta 1 57 8 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23228.[MT7]-DLVEEEAEEAGVALR.2y9_1.heavy 887.453 / 915.489 3302.0 37.86359977722168 46 20 10 6 10 8.382913716073967 11.9290265159539 0.03440093994140625 3 0.9963585555910072 20.44530771090394 3302.0 21.06448275862069 0.0 - - - - - - - 179.11764705882354 6 17 IRAK1 interleukin-1 receptor-associated kinase 1 59 8 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23228.[MT7]-DLVEEEAEEAGVALR.2y6_1.heavy 887.453 / 586.367 2173.0 37.86359977722168 46 20 10 6 10 8.382913716073967 11.9290265159539 0.03440093994140625 3 0.9963585555910072 20.44530771090394 2173.0 5.587839242848938 0.0 - - - - - - - 245.64705882352942 4 17 IRAK1 interleukin-1 receptor-associated kinase 1 61 8 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23228.[MT7]-DLVEEEAEEAGVALR.2y10_1.heavy 887.453 / 1044.53 1825.0 37.86359977722168 46 20 10 6 10 8.382913716073967 11.9290265159539 0.03440093994140625 3 0.9963585555910072 20.44530771090394 1825.0 10.838122605363985 0.0 - - - - - - - 174.0 3 14 IRAK1 interleukin-1 receptor-associated kinase 1 63 8 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23228.[MT7]-DLVEEEAEEAGVALR.2y11_1.heavy 887.453 / 1173.57 2607.0 37.86359977722168 46 20 10 6 10 8.382913716073967 11.9290265159539 0.03440093994140625 3 0.9963585555910072 20.44530771090394 2607.0 10.068413793103447 0.0 - - - - - - - 201.1875 5 16 IRAK1 interleukin-1 receptor-associated kinase 1 65 9 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23225.[MT7]-HAVVEVEDVPLAAK[MT7].3b4_1.heavy 589.008 / 551.342 17574.0 30.361149311065674 39 13 10 6 10 1.8607006765588636 41.73862519583221 0.030599594116210938 3 0.9097525344851696 4.076836297061154 17574.0 31.06189515307162 0.0 - - - - - - - 659.2307692307693 35 13 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 67 9 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23225.[MT7]-HAVVEVEDVPLAAK[MT7].3b5_1.heavy 589.008 / 680.385 31651.0 30.361149311065674 39 13 10 6 10 1.8607006765588636 41.73862519583221 0.030599594116210938 3 0.9097525344851696 4.076836297061154 31651.0 72.4279176201373 0.0 - - - - - - - 291.26666666666665 63 15 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 69 9 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23225.[MT7]-HAVVEVEDVPLAAK[MT7].3b8_1.heavy 589.008 / 1023.52 16525.0 30.361149311065674 39 13 10 6 10 1.8607006765588636 41.73862519583221 0.030599594116210938 3 0.9097525344851696 4.076836297061154 16525.0 87.70130718954248 0.0 - - - - - - - 141.07692307692307 33 13 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 71 9 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23225.[MT7]-HAVVEVEDVPLAAK[MT7].3y5_1.heavy 589.008 / 643.426 71259.0 30.361149311065674 39 13 10 6 10 1.8607006765588636 41.73862519583221 0.030599594116210938 3 0.9097525344851696 4.076836297061154 71259.0 173.25517756458805 0.0 - - - - - - - 274.7142857142857 142 14 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 73 10 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23328.[MT7]-TPESQLFSIEDIQEVR.3y7_1.heavy 679.02 / 888.442 19140.0 40.28310012817383 47 17 10 10 10 3.205095651598745 24.858727153978585 0.0 3 0.9703847875083286 7.153643042515984 19140.0 92.5986111111111 0.0 - - - - - - - 274.90909090909093 38 11 PLCD1 phospholipase C, delta 1 75 10 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23328.[MT7]-TPESQLFSIEDIQEVR.3b6_1.heavy 679.02 / 800.427 16406.0 40.28310012817383 47 17 10 10 10 3.205095651598745 24.858727153978585 0.0 3 0.9703847875083286 7.153643042515984 16406.0 53.94230540691242 1.0 - - - - - - - 220.8 37 15 PLCD1 phospholipase C, delta 1 77 10 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23328.[MT7]-TPESQLFSIEDIQEVR.3b5_1.heavy 679.02 / 687.343 28495.0 40.28310012817383 47 17 10 10 10 3.205095651598745 24.858727153978585 0.0 3 0.9703847875083286 7.153643042515984 28495.0 120.70798611111111 0.0 - - - - - - - 216.0 56 15 PLCD1 phospholipase C, delta 1 79 10 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23328.[MT7]-TPESQLFSIEDIQEVR.3y5_1.heavy 679.02 / 644.373 12377.0 40.28310012817383 47 17 10 10 10 3.205095651598745 24.858727153978585 0.0 3 0.9703847875083286 7.153643042515984 12377.0 42.97569444444444 0.0 - - - - - - - 206.4 24 15 PLCD1 phospholipase C, delta 1 81 11 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543702.[MT7]-GLTSASLSTK[MT7].2y8_1.heavy 626.871 / 938.528 N/A N/A - - - - - - - - - 0.0 - - - - - - - PITX2 paired-like homeodomain 2 83 11 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543702.[MT7]-GLTSASLSTK[MT7].2y5_1.heavy 626.871 / 679.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - PITX2 paired-like homeodomain 2 85 11 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543702.[MT7]-GLTSASLSTK[MT7].2b6_1.heavy 626.871 / 661.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - PITX2 paired-like homeodomain 2 87 11 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543702.[MT7]-GLTSASLSTK[MT7].2y7_1.heavy 626.871 / 837.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - PITX2 paired-like homeodomain 2 89 12 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22899.[MT7]-IFGAAGAGYK[MT7].3b6_1.heavy 414.908 / 661.379 15326.0 30.200499534606934 40 14 10 6 10 2.028036133741365 38.952275239484834 0.030599594116210938 3 0.9423856804632349 5.116696279883615 15326.0 147.0587283236994 0.0 - - - - - - - 159.92307692307693 30 13 INPP1 inositol polyphosphate-1-phosphatase 91 12 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22899.[MT7]-IFGAAGAGYK[MT7].3y3_1.heavy 414.908 / 511.3 36107.0 30.200499534606934 40 14 10 6 10 2.028036133741365 38.952275239484834 0.030599594116210938 3 0.9423856804632349 5.116696279883615 36107.0 114.25607729387953 0.0 - - - - - - - 230.83333333333334 72 12 INPP1 inositol polyphosphate-1-phosphatase 93 12 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22899.[MT7]-IFGAAGAGYK[MT7].3b4_1.heavy 414.908 / 533.32 23812.0 30.200499534606934 40 14 10 6 10 2.028036133741365 38.952275239484834 0.030599594116210938 3 0.9423856804632349 5.116696279883615 23812.0 133.01977971220467 0.0 - - - - - - - 254.76470588235293 47 17 INPP1 inositol polyphosphate-1-phosphatase 95 12 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22899.[MT7]-IFGAAGAGYK[MT7].3b5_1.heavy 414.908 / 604.357 7447.0 30.200499534606934 40 14 10 6 10 2.028036133741365 38.952275239484834 0.030599594116210938 3 0.9423856804632349 5.116696279883615 7447.0 29.82607936860827 0.0 - - - - - - - 202.16666666666666 14 12 INPP1 inositol polyphosphate-1-phosphatase 97 13 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22750.[MT7]-WNTEDK[MT7].2y4_1.heavy 540.782 / 636.332 2390.0 21.88403383890788 37 15 9 3 10 1.7085927968781411 46.53492501654413 0.0597991943359375 3 0.9563829640201158 5.887663288820311 2390.0 6.182326394715227 1.0 - - - - - - - 658.4285714285714 4 7 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 99 13 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22750.[MT7]-WNTEDK[MT7].2y5_1.heavy 540.782 / 750.375 4609.0 21.88403383890788 37 15 9 3 10 1.7085927968781411 46.53492501654413 0.0597991943359375 3 0.9563829640201158 5.887663288820311 4609.0 8.748631831030151 0.0 - - - - - - - 173.8421052631579 9 19 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 101 13 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22750.[MT7]-WNTEDK[MT7].2y3_1.heavy 540.782 / 535.284 N/A 21.88403383890788 37 15 9 3 10 1.7085927968781411 46.53492501654413 0.0597991943359375 3 0.9563829640201158 5.887663288820311 4097.0 2.1657535598911286 4.0 - - - - - - - 2235.4285714285716 10 7 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 103 13 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22750.[MT7]-WNTEDK[MT7].2b5_1.heavy 540.782 / 790.349 3301.0 21.88403383890788 37 15 9 3 10 1.7085927968781411 46.53492501654413 0.0597991943359375 3 0.9563829640201158 5.887663288820311 3301.0 16.35569490131579 0.0 - - - - - - - 173.89473684210526 6 19 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 105 14 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22606.[MT7]-K[MT7]NQITNNQR.3y6_1.heavy 468.603 / 745.395 1134.0 14.097824811935425 39 13 10 6 10 1.519401321346009 42.95224177066608 0.03769969940185547 3 0.9219019490062579 4.387068806872772 1134.0 9.799999999999999 0.0 - - - - - - - 97.73684210526316 2 19 PGK2 phosphoglycerate kinase 2 107 14 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22606.[MT7]-K[MT7]NQITNNQR.3b3_2.heavy 468.603 / 330.208 5305.0 14.097824811935425 39 13 10 6 10 1.519401321346009 42.95224177066608 0.03769969940185547 3 0.9219019490062579 4.387068806872772 5305.0 6.782165579991666 0.0 - - - - - - - 657.75 10 8 PGK2 phosphoglycerate kinase 2 109 14 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22606.[MT7]-K[MT7]NQITNNQR.3b3_1.heavy 468.603 / 659.408 931.0 14.097824811935425 39 13 10 6 10 1.519401321346009 42.95224177066608 0.03769969940185547 3 0.9219019490062579 4.387068806872772 931.0 2.681893004115226 0.0 - - - - - - - 0.0 1 0 PGK2 phosphoglycerate kinase 2 111 14 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22606.[MT7]-K[MT7]NQITNNQR.3y5_1.heavy 468.603 / 632.311 4738.0 14.097824811935425 39 13 10 6 10 1.519401321346009 42.95224177066608 0.03769969940185547 3 0.9219019490062579 4.387068806872772 4738.0 11.238573423879018 0.0 - - - - - - - 240.73684210526315 9 19 PGK2 phosphoglycerate kinase 2 113 15 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22893.[MT7]-NHAQVVAQAR.2y8_1.heavy 619.348 / 842.484 2855.0 15.281200408935547 50 20 10 10 10 8.07250217517805 12.387732803279718 0.0 3 0.9948505567827691 17.190784345445262 2855.0 51.439224137931035 0.0 - - - - - - - 114.0909090909091 5 11 PGK2 phosphoglycerate kinase 2 115 15 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22893.[MT7]-NHAQVVAQAR.2y5_1.heavy 619.348 / 544.32 1258.0 15.281200408935547 50 20 10 10 10 8.07250217517805 12.387732803279718 0.0 3 0.9948505567827691 17.190784345445262 1258.0 18.612854603626023 0.0 - - - - - - - 181.5 2 20 PGK2 phosphoglycerate kinase 2 117 15 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22893.[MT7]-NHAQVVAQAR.2y9_1.heavy 619.348 / 979.543 2419.0 15.281200408935547 50 20 10 10 10 8.07250217517805 12.387732803279718 0.0 3 0.9948505567827691 17.190784345445262 2419.0 50.343878865979384 0.0 - - - - - - - 61.36363636363637 4 11 PGK2 phosphoglycerate kinase 2 119 15 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22893.[MT7]-NHAQVVAQAR.2y7_1.heavy 619.348 / 771.447 3435.0 15.281200408935547 50 20 10 10 10 8.07250217517805 12.387732803279718 0.0 3 0.9948505567827691 17.190784345445262 3435.0 31.96928754630949 0.0 - - - - - - - 193.46153846153845 6 13 PGK2 phosphoglycerate kinase 2 121 16 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22604.[MT7]-GSQLLK[MT7].2y5_1.heavy 467.302 / 732.474 2932.0 22.88889980316162 34 8 10 6 10 0.46034401039520817 103.82014949400607 0.030199050903320312 3 0.7558034923477007 2.444726372611367 2932.0 20.251628415300544 0.0 - - - - - - - 226.76190476190476 5 21 PLCD1 phospholipase C, delta 1 123 16 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22604.[MT7]-GSQLLK[MT7].2b4_1.heavy 467.302 / 530.305 3665.0 22.88889980316162 34 8 10 6 10 0.46034401039520817 103.82014949400607 0.030199050903320312 3 0.7558034923477007 2.444726372611367 3665.0 7.317708333333333 0.0 - - - - - - - 704.8461538461538 7 13 PLCD1 phospholipase C, delta 1 125 16 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22604.[MT7]-GSQLLK[MT7].2y3_1.heavy 467.302 / 517.383 2687.0 22.88889980316162 34 8 10 6 10 0.46034401039520817 103.82014949400607 0.030199050903320312 3 0.7558034923477007 2.444726372611367 2687.0 5.278279112948766 0.0 - - - - - - - 649.125 5 8 PLCD1 phospholipase C, delta 1 127 16 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22604.[MT7]-GSQLLK[MT7].2b5_1.heavy 467.302 / 643.39 5802.0 22.88889980316162 34 8 10 6 10 0.46034401039520817 103.82014949400607 0.030199050903320312 3 0.7558034923477007 2.444726372611367 5802.0 8.444791060209765 1.0 - - - - - - - 699.1111111111111 11 9 PLCD1 phospholipase C, delta 1 129 17 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22891.[MT7]-QEFFVDFR.2b3_1.heavy 616.315 / 549.279 2095.0 38.627201080322266 39 9 10 10 10 0.744091866380243 68.0723578445099 0.0 3 0.806032750398432 2.755588536843217 2095.0 4.397900763358779 0.0 - - - - - - - 643.875 4 8 INHBC inhibin, beta C 131 17 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22891.[MT7]-QEFFVDFR.2y5_1.heavy 616.315 / 683.351 N/A 38.627201080322266 39 9 10 10 10 0.744091866380243 68.0723578445099 0.0 3 0.806032750398432 2.755588536843217 786.0 0.42034964613447934 8.0 - - - - - - - 687.5 8 8 INHBC inhibin, beta C 133 17 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22891.[MT7]-QEFFVDFR.2b4_1.heavy 616.315 / 696.347 1920.0 38.627201080322266 39 9 10 10 10 0.744091866380243 68.0723578445099 0.0 3 0.806032750398432 2.755588536843217 1920.0 15.649846909537452 1.0 - - - - - - - 203.66666666666666 3 15 INHBC inhibin, beta C 135 17 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22891.[MT7]-QEFFVDFR.2b6_1.heavy 616.315 / 910.443 6634.0 38.627201080322266 39 9 10 10 10 0.744091866380243 68.0723578445099 0.0 3 0.806032750398432 2.755588536843217 6634.0 36.094566810297685 0.0 - - - - - - - 181.30769230769232 13 13 INHBC inhibin, beta C 137 18 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22758.[MT7]-SPGGSQEQR.2y8_1.heavy 545.274 / 858.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 139 18 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22758.[MT7]-SPGGSQEQR.2y6_1.heavy 545.274 / 704.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 141 18 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22758.[MT7]-SPGGSQEQR.2b7_1.heavy 545.274 / 787.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 143 18 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22758.[MT7]-SPGGSQEQR.2y7_1.heavy 545.274 / 761.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 145 19 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22759.[MT7]-EDVNEAIR.2b6_1.heavy 545.286 / 802.37 6439.0 21.46809959411621 50 20 10 10 10 6.099811870054168 16.393948228293798 0.0 3 0.990703087361379 12.789570296538672 6439.0 55.60254437869823 0.0 - - - - - - - 159.11764705882354 12 17 MCM7 minichromosome maintenance complex component 7 147 19 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22759.[MT7]-EDVNEAIR.2y6_1.heavy 545.286 / 701.394 9602.0 21.46809959411621 50 20 10 10 10 6.099811870054168 16.393948228293798 0.0 3 0.990703087361379 12.789570296538672 9602.0 70.83832862612188 0.0 - - - - - - - 172.38888888888889 19 18 MCM7 minichromosome maintenance complex component 7 149 19 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22759.[MT7]-EDVNEAIR.2b5_1.heavy 545.286 / 731.333 5309.0 21.46809959411621 50 20 10 10 10 6.099811870054168 16.393948228293798 0.0 3 0.990703087361379 12.789570296538672 5309.0 36.928088495575224 0.0 - - - - - - - 216.89473684210526 10 19 MCM7 minichromosome maintenance complex component 7 151 19 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22759.[MT7]-EDVNEAIR.2y7_1.heavy 545.286 / 816.421 8698.0 21.46809959411621 50 20 10 10 10 6.099811870054168 16.393948228293798 0.0 3 0.990703087361379 12.789570296538672 8698.0 44.25290255013877 0.0 - - - - - - - 225.66666666666666 17 15 MCM7 minichromosome maintenance complex component 7 153 20 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542051.[MT7]-VASEALAR.2b4_1.heavy 480.783 / 531.289 19455.0 22.49959945678711 48 18 10 10 10 4.941093961795813 20.238433183661932 0.0 3 0.9899334516783951 12.290147177423856 19455.0 21.68834576128625 0.0 - - - - - - - 758.25 38 16 INPP1 inositol polyphosphate-1-phosphatase 155 20 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542051.[MT7]-VASEALAR.2y6_1.heavy 480.783 / 646.352 31058.0 22.49959945678711 48 18 10 10 10 4.941093961795813 20.238433183661932 0.0 3 0.9899334516783951 12.290147177423856 31058.0 85.19735793787905 0.0 - - - - - - - 259.5 62 14 INPP1 inositol polyphosphate-1-phosphatase 157 20 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542051.[MT7]-VASEALAR.2b5_1.heavy 480.783 / 602.327 31116.0 22.49959945678711 48 18 10 10 10 4.941093961795813 20.238433183661932 0.0 3 0.9899334516783951 12.290147177423856 31116.0 51.09502754389922 0.0 - - - - - - - 776.4166666666666 62 12 INPP1 inositol polyphosphate-1-phosphatase 159 20 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542051.[MT7]-VASEALAR.2y7_1.heavy 480.783 / 717.389 130852.0 22.49959945678711 48 18 10 10 10 4.941093961795813 20.238433183661932 0.0 3 0.9899334516783951 12.290147177423856 130852.0 140.8578522938589 0.0 - - - - - - - 710.5 261 8 INPP1 inositol polyphosphate-1-phosphatase 161 21 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544056.[MT7]-TIWQESRK[MT7].3y6_2.heavy 445.926 / 489.268 18654.0 24.82550048828125 45 15 10 10 10 1.3900475932405403 47.614097506248754 0.0 3 0.9580475811125798 6.0041805492716085 18654.0 26.943707146789446 0.0 - - - - - - - 698.6666666666666 37 9 PLCD1 phospholipase C, delta 1 163 21 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544056.[MT7]-TIWQESRK[MT7].3y6_1.heavy 445.926 / 977.529 N/A 24.82550048828125 45 15 10 10 10 1.3900475932405403 47.614097506248754 0.0 3 0.9580475811125798 6.0041805492716085 0.0 0.0 2.0 - - - - - - - 0.0 0 0 PLCD1 phospholipase C, delta 1 165 21 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544056.[MT7]-TIWQESRK[MT7].3y7_2.heavy 445.926 / 545.81 16887.0 24.82550048828125 45 15 10 10 10 1.3900475932405403 47.614097506248754 0.0 3 0.9580475811125798 6.0041805492716085 16887.0 19.635587372793783 0.0 - - - - - - - 785.3333333333334 33 9 PLCD1 phospholipase C, delta 1 167 21 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544056.[MT7]-TIWQESRK[MT7].3y5_1.heavy 445.926 / 791.449 6430.0 24.82550048828125 45 15 10 10 10 1.3900475932405403 47.614097506248754 0.0 3 0.9580475811125798 6.0041805492716085 6430.0 63.771458286344384 0.0 - - - - - - - 169.73333333333332 12 15 PLCD1 phospholipase C, delta 1 169 22 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544054.[MT7]-GSSGVGLTAAVLR.3y6_1.heavy 444.597 / 630.393 26020.0 32.879798889160156 48 18 10 10 10 4.835385353386789 20.680874985477267 0.0 3 0.9848755426453902 10.02244247914905 26020.0 11.209570204314158 1.0 - - - - - - - 213.75 54 8 MCM7 minichromosome maintenance complex component 7 171 22 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544054.[MT7]-GSSGVGLTAAVLR.3b6_1.heavy 444.597 / 589.306 40628.0 32.879798889160156 48 18 10 10 10 4.835385353386789 20.680874985477267 0.0 3 0.9848755426453902 10.02244247914905 40628.0 41.95501375258508 0.0 - - - - - - - 256.5 81 8 MCM7 minichromosome maintenance complex component 7 173 22 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544054.[MT7]-GSSGVGLTAAVLR.3y4_1.heavy 444.597 / 458.309 31726.0 32.879798889160156 48 18 10 10 10 4.835385353386789 20.680874985477267 0.0 3 0.9848755426453902 10.02244247914905 31726.0 40.46624753160007 0.0 - - - - - - - 199.5 63 4 MCM7 minichromosome maintenance complex component 7 175 22 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544054.[MT7]-GSSGVGLTAAVLR.3y5_1.heavy 444.597 / 529.346 27960.0 32.879798889160156 48 18 10 10 10 4.835385353386789 20.680874985477267 0.0 3 0.9848755426453902 10.02244247914905 27960.0 23.274479737130342 0.0 - - - - - - - 733.8571428571429 55 7 MCM7 minichromosome maintenance complex component 7 177 23 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545313.[MT7]-EPAPETADGPYLVIVEQPK[MT7].3b9_1.heavy 781.089 / 1012.47 7455.0 36.28410053253174 35 15 4 6 10 2.0966906281885405 39.629119249212806 0.032398223876953125 3 0.9579784073972676 5.999201507992096 7455.0 92.25479715724015 0.0 - - - - - - - 182.66666666666666 14 12 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 179 23 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545313.[MT7]-EPAPETADGPYLVIVEQPK[MT7].3y6_1.heavy 781.089 / 857.521 6403.0 36.28410053253174 35 15 4 6 10 2.0966906281885405 39.629119249212806 0.032398223876953125 3 0.9579784073972676 5.999201507992096 6403.0 11.748522073601777 0.0 - - - - - - - 664.0 12 7 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 181 23 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545313.[MT7]-EPAPETADGPYLVIVEQPK[MT7].3b5_1.heavy 781.089 / 668.337 3245.0 36.28410053253174 35 15 4 6 10 2.0966906281885405 39.629119249212806 0.032398223876953125 3 0.9579784073972676 5.999201507992096 3245.0 1.8507604562737643 2.0 - - - - - - - 676.5714285714286 28 7 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 183 23 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545313.[MT7]-EPAPETADGPYLVIVEQPK[MT7].3b8_1.heavy 781.089 / 955.449 4210.0 36.28410053253174 35 15 4 6 10 2.0966906281885405 39.629119249212806 0.032398223876953125 3 0.9579784073972676 5.999201507992096 4210.0 39.213142857142856 0.0 - - - - - - - 175.52941176470588 8 17 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 185 24 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1145190.0 29.528499603271484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1145190.0 548.1136820267743 0.0 - - - - - - - 215.4375 2290 16 187 24 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 369565.0 29.528499603271484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 369565.0 650.8080553656004 0.0 - - - - - - - 277.0 739 11 189 24 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 277014.0 29.528499603271484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 277014.0 335.1089022099642 0.0 - - - - - - - 750.4285714285714 554 14 191 25 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544190.[MT7]-SHSGGELESLAR.3y6_1.heavy 462.908 / 688.399 8869.0 24.329299926757812 47 17 10 10 10 5.754532160933554 17.377607284720963 0.0 3 0.9776119542484951 8.232669483510787 8869.0 58.450515506891946 0.0 - - - - - - - 187.47058823529412 17 17 PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 193 25 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544190.[MT7]-SHSGGELESLAR.3b6_1.heavy 462.908 / 699.318 16352.0 24.329299926757812 47 17 10 10 10 5.754532160933554 17.377607284720963 0.0 3 0.9776119542484951 8.232669483510787 16352.0 93.61900305470702 0.0 - - - - - - - 179.41176470588235 32 17 PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 195 25 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544190.[MT7]-SHSGGELESLAR.3b5_1.heavy 462.908 / 570.275 5682.0 24.329299926757812 47 17 10 10 10 5.754532160933554 17.377607284720963 0.0 3 0.9776119542484951 8.232669483510787 5682.0 21.853846153846156 0.0 - - - - - - - 284.1 11 20 PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 197 25 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544190.[MT7]-SHSGGELESLAR.3y5_1.heavy 462.908 / 575.315 31872.0 24.329299926757812 47 17 10 10 10 5.754532160933554 17.377607284720963 0.0 3 0.9776119542484951 8.232669483510787 31872.0 135.35296347059173 0.0 - - - - - - - 250.16666666666666 63 18 PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 199 26 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542973.[MT7]-NTVYAVK[MT7].2y4_1.heavy 541.826 / 624.384 8376.0 22.79819965362549 40 14 10 6 10 2.8651495795160615 34.90219174417083 0.030199050903320312 3 0.9341878357989966 4.784077330552129 8376.0 14.16384595625284 0.0 - - - - - - - 244.7058823529412 16 17 IRAK1 interleukin-1 receptor-associated kinase 1 201 26 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542973.[MT7]-NTVYAVK[MT7].2y5_1.heavy 541.826 / 723.452 1145.0 22.79819965362549 40 14 10 6 10 2.8651495795160615 34.90219174417083 0.030199050903320312 3 0.9341878357989966 4.784077330552129 1145.0 4.325653768213837 2.0 - - - - - - - 209.7391304347826 5 23 IRAK1 interleukin-1 receptor-associated kinase 1 203 26 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542973.[MT7]-NTVYAVK[MT7].2y6_1.heavy 541.826 / 824.5 1928.0 22.79819965362549 40 14 10 6 10 2.8651495795160615 34.90219174417083 0.030199050903320312 3 0.9341878357989966 4.784077330552129 1928.0 -0.07345132743362842 1.0 - - - - - - - 180.9047619047619 3 21 IRAK1 interleukin-1 receptor-associated kinase 1 205 26 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542973.[MT7]-NTVYAVK[MT7].2b5_1.heavy 541.826 / 693.369 1386.0 22.79819965362549 40 14 10 6 10 2.8651495795160615 34.90219174417083 0.030199050903320312 3 0.9341878357989966 4.784077330552129 1386.0 0.7657458563535909 1.0 - - - - - - - 188.69565217391303 2 23 IRAK1 interleukin-1 receptor-associated kinase 1 207 27 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544578.[MT7]-QIVLGC[CAM]QYLHR.3y6_1.heavy 510.949 / 876.414 1408.0 30.284650325775146 39 13 10 6 10 4.619580931085728 21.646985190169026 0.030599594116210938 3 0.9097710305724738 4.0772606325876275 1408.0 0.588235294117647 19.0 - - - - - - - 744.6153846153846 9 13 PLK1 polo-like kinase 1 209 27 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544578.[MT7]-QIVLGC[CAM]QYLHR.3b4_1.heavy 510.949 / 598.404 7567.0 30.284650325775146 39 13 10 6 10 4.619580931085728 21.646985190169026 0.030599594116210938 3 0.9097710305724738 4.0772606325876275 7567.0 27.25579201101928 1.0 - - - - - - - 823.4285714285714 15 14 PLK1 polo-like kinase 1 211 27 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544578.[MT7]-QIVLGC[CAM]QYLHR.3y4_1.heavy 510.949 / 588.325 13726.0 30.284650325775146 39 13 10 6 10 4.619580931085728 21.646985190169026 0.030599594116210938 3 0.9097710305724738 4.0772606325876275 13726.0 19.497159090909093 0.0 - - - - - - - 731.0769230769231 27 13 PLK1 polo-like kinase 1 213 27 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544578.[MT7]-QIVLGC[CAM]QYLHR.3y5_1.heavy 510.949 / 716.384 6159.0 30.284650325775146 39 13 10 6 10 4.619580931085728 21.646985190169026 0.030599594116210938 3 0.9097710305724738 4.0772606325876275 6159.0 10.664935064935065 0.0 - - - - - - - 671.0 12 8 PLK1 polo-like kinase 1 215 28 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22868.[MT7]-ELLLDLAK[MT7].2y4_1.heavy 601.884 / 590.363 13332.0 39.3984489440918 46 20 10 6 10 11.682550328397014 8.559774808496048 0.039398193359375 3 0.9905344525001196 12.67495232692871 13332.0 20.189164020405716 0.0 - - - - - - - 768.375 26 8 INHBC inhibin, beta C 217 28 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22868.[MT7]-ELLLDLAK[MT7].2b3_1.heavy 601.884 / 500.32 12207.0 39.3984489440918 46 20 10 6 10 11.682550328397014 8.559774808496048 0.039398193359375 3 0.9905344525001196 12.67495232692871 12207.0 25.243914851485147 0.0 - - - - - - - 655.4285714285714 24 7 INHBC inhibin, beta C 219 28 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22868.[MT7]-ELLLDLAK[MT7].2y5_1.heavy 601.884 / 703.447 13332.0 39.3984489440918 46 20 10 6 10 11.682550328397014 8.559774808496048 0.039398193359375 3 0.9905344525001196 12.67495232692871 13332.0 39.78095238095238 0.0 - - - - - - - 714.25 26 8 INHBC inhibin, beta C 221 28 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22868.[MT7]-ELLLDLAK[MT7].2b5_1.heavy 601.884 / 728.431 12380.0 39.3984489440918 46 20 10 6 10 11.682550328397014 8.559774808496048 0.039398193359375 3 0.9905344525001196 12.67495232692871 12380.0 71.31909592110829 0.0 - - - - - - - 259.7142857142857 24 7 INHBC inhibin, beta C 223 29 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 492228.0 15.249199867248535 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 492228.0 2627.467149640617 0.0 - - - - - - - 715.9090909090909 984 11 225 29 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 995465.0 15.249199867248535 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 995465.0 10683.458115942029 0.0 - - - - - - - 894.8333333333334 1990 6 227 29 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 377023.0 15.249199867248535 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 377023.0 785.1450482936124 0.0 - - - - - - - 664.8571428571429 754 7 229 30 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544803.[MT7]-SLEQNIQLPAALLSR.3y7_1.heavy 599.683 / 727.446 36115.0 40.90620040893555 50 20 10 10 10 7.200103173885919 13.888689868041109 0.0 3 0.9948599998385518 17.206581864593996 36115.0 134.06333074804098 1.0 - - - - - - - 282.2 74 5 MCM7 minichromosome maintenance complex component 7 231 30 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544803.[MT7]-SLEQNIQLPAALLSR.3b6_1.heavy 599.683 / 829.454 5370.0 40.90620040893555 50 20 10 10 10 7.200103173885919 13.888689868041109 0.0 3 0.9948599998385518 17.206581864593996 5370.0 27.16318199088146 0.0 - - - - - - - 225.8181818181818 10 11 MCM7 minichromosome maintenance complex component 7 233 30 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544803.[MT7]-SLEQNIQLPAALLSR.3b5_1.heavy 599.683 / 716.37 23092.0 40.90620040893555 50 20 10 10 10 7.200103173885919 13.888689868041109 0.0 3 0.9948599998385518 17.206581864593996 23092.0 73.84960171655554 0.0 - - - - - - - 335.75 46 8 MCM7 minichromosome maintenance complex component 7 235 30 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544803.[MT7]-SLEQNIQLPAALLSR.3y8_1.heavy 599.683 / 840.53 5840.0 40.90620040893555 50 20 10 10 10 7.200103173885919 13.888689868041109 0.0 3 0.9948599998385518 17.206581864593996 5840.0 45.88519545131486 0.0 - - - - - - - 256.1818181818182 11 11 MCM7 minichromosome maintenance complex component 7 237 31 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22862.[MT7]-LGNLFLNEDLEVK[MT7].3y3_1.heavy 598.008 / 519.326 7191.0 41.80630111694336 45 15 10 10 10 2.454764193397204 40.73711041939541 0.0 3 0.9569438980947385 5.926172857117947 7191.0 30.2445 0.0 - - - - - - - 276.4736842105263 14 19 PLK1 polo-like kinase 1 239 31 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22862.[MT7]-LGNLFLNEDLEVK[MT7].3b4_1.heavy 598.008 / 542.342 11629.0 41.80630111694336 45 15 10 10 10 2.454764193397204 40.73711041939541 0.0 3 0.9569438980947385 5.926172857117947 11629.0 35.28381334351923 0.0 - - - - - - - 656.625 23 8 PLK1 polo-like kinase 1 241 31 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22862.[MT7]-LGNLFLNEDLEVK[MT7].3b5_1.heavy 598.008 / 689.41 8160.0 41.80630111694336 45 15 10 10 10 2.454764193397204 40.73711041939541 0.0 3 0.9569438980947385 5.926172857117947 8160.0 36.96969696969697 0.0 - - - - - - - 207.0 16 17 PLK1 polo-like kinase 1 243 31 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22862.[MT7]-LGNLFLNEDLEVK[MT7].3y4_1.heavy 598.008 / 632.41 3570.0 41.80630111694336 45 15 10 10 10 2.454764193397204 40.73711041939541 0.0 3 0.9569438980947385 5.926172857117947 3570.0 16.1375 0.0 - - - - - - - 269.57142857142856 7 21 PLK1 polo-like kinase 1 245 32 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544415.[MT7]-IAQPGDHVSVTGIFLPILR.3y6_1.heavy 726.424 / 758.492 9359.0 44.96820068359375 46 16 10 10 10 3.1004884086329887 26.279764169311015 0.0 3 0.9652037827292246 6.596733267866679 9359.0 36.876310585965754 0.0 - - - - - - - 174.82608695652175 18 23 MCM7 minichromosome maintenance complex component 7 247 32 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544415.[MT7]-IAQPGDHVSVTGIFLPILR.3y11_1.heavy 726.424 / 1215.75 11526.0 44.96820068359375 46 16 10 10 10 3.1004884086329887 26.279764169311015 0.0 3 0.9652037827292246 6.596733267866679 11526.0 206.11275401880496 0.0 - - - - - - - 114.55 23 20 MCM7 minichromosome maintenance complex component 7 249 32 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544415.[MT7]-IAQPGDHVSVTGIFLPILR.3y8_1.heavy 726.424 / 928.598 10082.0 44.96820068359375 46 16 10 10 10 3.1004884086329887 26.279764169311015 0.0 3 0.9652037827292246 6.596733267866679 10082.0 86.06798268398269 0.0 - - - - - - - 116.41666666666667 20 24 MCM7 minichromosome maintenance complex component 7 251 32 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544415.[MT7]-IAQPGDHVSVTGIFLPILR.3y9_1.heavy 726.424 / 1029.65 12782.0 44.96820068359375 46 16 10 10 10 3.1004884086329887 26.279764169311015 0.0 3 0.9652037827292246 6.596733267866679 12782.0 210.70808988764043 0.0 - - - - - - - 154.0 25 21 MCM7 minichromosome maintenance complex component 7 253 33 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545009.[MT7]-VSHVSTGGGASLELLEGK[MT7].4y4_1.heavy 508.035 / 590.363 77518.0 32.15869903564453 42 12 10 10 10 2.2712262343088088 44.029079309412126 0.0 3 0.8954036659135567 3.7821949754052664 77518.0 52.96787918061804 0.0 - - - - - - - 111.0 155 1 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 255 33 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545009.[MT7]-VSHVSTGGGASLELLEGK[MT7].4b11_2.heavy 508.035 / 542.779 74741.0 32.15869903564453 42 12 10 10 10 2.2712262343088088 44.029079309412126 0.0 3 0.8954036659135567 3.7821949754052664 74741.0 60.340754204889606 0.0 - - - - - - - 333.0 149 5 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 257 33 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545009.[MT7]-VSHVSTGGGASLELLEGK[MT7].4b4_1.heavy 508.035 / 567.337 11106.0 32.15869903564453 42 12 10 10 10 2.2712262343088088 44.029079309412126 0.0 3 0.8954036659135567 3.7821949754052664 11106.0 14.947163534046144 1.0 - - - - - - - 317.14285714285717 25 7 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 259 33 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545009.[MT7]-VSHVSTGGGASLELLEGK[MT7].4y3_1.heavy 508.035 / 477.279 119942.0 32.15869903564453 42 12 10 10 10 2.2712262343088088 44.029079309412126 0.0 3 0.8954036659135567 3.7821949754052664 119942.0 58.53521264738905 0.0 - - - - - - - 1194.25 239 4 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 261 34 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543687.[MT7]-FIIPQIVK[MT7].3y3_1.heavy 415.944 / 503.367 52474.0 39.62049865722656 47 17 10 10 10 5.073402190868007 19.71063918015359 0.0 3 0.9790394207461957 8.509405288788173 52474.0 350.94574252733486 0.0 - - - - - - - 133.77777777777777 104 9 LDHB lactate dehydrogenase B 263 34 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543687.[MT7]-FIIPQIVK[MT7].3b5_1.heavy 415.944 / 743.457 11508.0 39.62049865722656 47 17 10 10 10 5.073402190868007 19.71063918015359 0.0 3 0.9790394207461957 8.509405288788173 11508.0 259.59906976744185 0.0 - - - - - - - 86.0 23 2 LDHB lactate dehydrogenase B 265 34 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543687.[MT7]-FIIPQIVK[MT7].3y4_1.heavy 415.944 / 631.426 4724.0 39.62049865722656 47 17 10 10 10 5.073402190868007 19.71063918015359 0.0 3 0.9790394207461957 8.509405288788173 4724.0 78.00093023255815 0.0 - - - - - - - 186.16666666666666 9 6 LDHB lactate dehydrogenase B 267 34 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543687.[MT7]-FIIPQIVK[MT7].3b3_1.heavy 415.944 / 518.346 94127.0 39.62049865722656 47 17 10 10 10 5.073402190868007 19.71063918015359 0.0 3 0.9790394207461957 8.509405288788173 94127.0 400.72719796215426 0.0 - - - - - - - 206.2 188 5 LDHB lactate dehydrogenase B 269 35 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37773.[MT7]-HTHDK[MT7].2y4_1.heavy 463.258 / 644.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 271 35 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37773.[MT7]-HTHDK[MT7].2y3_1.heavy 463.258 / 543.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 273 36 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23349.[MT7]-NHFQSVLEQLELQEK[MT7].4y4_1.heavy 533.291 / 661.4 39905.0 37.98392391204834 36 10 10 6 10 0.8599808307983581 71.87835984510194 0.033702850341796875 3 0.8347144168833601 2.992767650471291 39905.0 140.41331236897275 0.0 - - - - - - - 694.0 79 8 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 275 36 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23349.[MT7]-NHFQSVLEQLELQEK[MT7].4b4_1.heavy 533.291 / 671.338 21254.0 37.98392391204834 36 10 10 6 10 0.8599808307983581 71.87835984510194 0.033702850341796875 3 0.8347144168833601 2.992767650471291 21254.0 56.39777876302372 0.0 - - - - - - - 1252.0 42 7 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 277 36 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23349.[MT7]-NHFQSVLEQLELQEK[MT7].4b3_1.heavy 533.291 / 543.28 11017.0 37.98392391204834 36 10 10 6 10 0.8599808307983581 71.87835984510194 0.033702850341796875 3 0.8347144168833601 2.992767650471291 11017.0 41.90904899135447 0.0 - - - - - - - 629.125 22 8 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 279 36 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23349.[MT7]-NHFQSVLEQLELQEK[MT7].4b6_1.heavy 533.291 / 857.439 10670.0 37.98392391204834 36 10 10 6 10 0.8599808307983581 71.87835984510194 0.033702850341796875 3 0.8347144168833601 2.992767650471291 10670.0 175.99367816091953 0.0 - - - - - - - 198.5 21 14 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 281 37 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23200.[MT7]-STPTGLFGYWGNK[MT7].2y4_1.heavy 858.453 / 648.359 1556.0 39.06269836425781 39 13 10 6 10 0.7934302903806915 65.84836236424499 0.037200927734375 3 0.9050019582105797 3.971965359871302 1556.0 4.527275482326935 1.0 - - - - - - - 210.5625 3 16 INPP5K inositol polyphosphate-5-phosphatase K 283 37 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23200.[MT7]-STPTGLFGYWGNK[MT7].2y6_1.heavy 858.453 / 868.443 1643.0 39.06269836425781 39 13 10 6 10 0.7934302903806915 65.84836236424499 0.037200927734375 3 0.9050019582105797 3.971965359871302 1643.0 10.921676300578035 0.0 - - - - - - - 226.0 3 13 INPP5K inositol polyphosphate-5-phosphatase K 285 37 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23200.[MT7]-STPTGLFGYWGNK[MT7].2b5_1.heavy 858.453 / 588.311 1384.0 39.06269836425781 39 13 10 6 10 0.7934302903806915 65.84836236424499 0.037200927734375 3 0.9050019582105797 3.971965359871302 1384.0 3.7199999999999998 1.0 - - - - - - - 263.94444444444446 2 18 INPP5K inositol polyphosphate-5-phosphatase K 287 37 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23200.[MT7]-STPTGLFGYWGNK[MT7].2y7_1.heavy 858.453 / 1015.51 2075.0 39.06269836425781 39 13 10 6 10 0.7934302903806915 65.84836236424499 0.037200927734375 3 0.9050019582105797 3.971965359871302 2075.0 13.79335260115607 0.0 - - - - - - - 181.3 4 10 INPP5K inositol polyphosphate-5-phosphatase K 289 38 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37790.[MT7]-APADPGK[MT7].2y4_1.heavy 472.276 / 560.316 1418.0 15.487799644470215 40 14 10 6 10 2.0277372386822905 40.0129597777207 0.033599853515625 3 0.9350577318877162 4.8163696322649745 1418.0 5.4019047619047615 0.0 - - - - - - - 190.35 2 20 PLK1 polo-like kinase 1 291 38 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37790.[MT7]-APADPGK[MT7].2y5_1.heavy 472.276 / 631.353 970.0 15.487799644470215 40 14 10 6 10 2.0277372386822905 40.0129597777207 0.033599853515625 3 0.9350577318877162 4.8163696322649745 970.0 4.8444423223834985 0.0 - - - - - - - 0.0 1 0 PLK1 polo-like kinase 1 293 38 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37790.[MT7]-APADPGK[MT7].2b4_1.heavy 472.276 / 499.263 31316.0 15.487799644470215 40 14 10 6 10 2.0277372386822905 40.0129597777207 0.033599853515625 3 0.9350577318877162 4.8163696322649745 31316.0 182.17452014896867 0.0 - - - - - - - 227.65 62 20 PLK1 polo-like kinase 1 295 38 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37790.[MT7]-APADPGK[MT7].2y6_1.heavy 472.276 / 728.406 15565.0 15.487799644470215 40 14 10 6 10 2.0277372386822905 40.0129597777207 0.033599853515625 3 0.9350577318877162 4.8163696322649745 15565.0 82.55017479095002 0.0 - - - - - - - 151.42105263157896 31 19 PLK1 polo-like kinase 1 297 39 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38296.[MT7]-HINPVAASLIQK[MT7].2b3_1.heavy 789.982 / 509.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 299 39 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38296.[MT7]-HINPVAASLIQK[MT7].2y9_1.heavy 789.982 / 1070.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 301 39 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38296.[MT7]-HINPVAASLIQK[MT7].2y3_1.heavy 789.982 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 303 39 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38296.[MT7]-HINPVAASLIQK[MT7].2y6_1.heavy 789.982 / 803.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 305 40 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22779.[MT7]-VENLTLK[MT7].2y5_1.heavy 552.847 / 732.474 4723.0 28.677000045776367 46 16 10 10 10 2.062618957152485 43.061473255083584 0.0 3 0.9641482308115756 6.498317721409259 4723.0 17.321997165958155 0.0 - - - - - - - 240.05 9 20 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 307 40 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22779.[MT7]-VENLTLK[MT7].2b4_1.heavy 552.847 / 600.347 6969.0 28.677000045776367 46 16 10 10 10 2.062618957152485 43.061473255083584 0.0 3 0.9641482308115756 6.498317721409259 6969.0 17.940462696607618 2.0 - - - - - - - 358.1875 13 16 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 309 40 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22779.[MT7]-VENLTLK[MT7].2y3_1.heavy 552.847 / 505.347 10763.0 28.677000045776367 46 16 10 10 10 2.062618957152485 43.061473255083584 0.0 3 0.9641482308115756 6.498317721409259 10763.0 17.260657921705267 0.0 - - - - - - - 709.6666666666666 21 12 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 311 40 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22779.[MT7]-VENLTLK[MT7].2y6_1.heavy 552.847 / 861.516 8362.0 28.677000045776367 46 16 10 10 10 2.062618957152485 43.061473255083584 0.0 3 0.9641482308115756 6.498317721409259 8362.0 59.34322580645161 0.0 - - - - - - - 199.0 16 14 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 313 41 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38291.[MT7]-ALAQGPWWARK[MT7].3y7_1.heavy 524.64 / 1044.59 514.0 32.810598373413086 30 7 10 5 8 1.8443659620533748 46.85098529824745 0.046199798583984375 4 0.7121850474965717 2.242804993557241 514.0 6.9864077669902915 0.0 - - - - - - - 0.0 1 0 PLCD1 phospholipase C, delta 1 315 41 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38291.[MT7]-ALAQGPWWARK[MT7].3y7_2.heavy 524.64 / 522.797 6584.0 32.810598373413086 30 7 10 5 8 1.8443659620533748 46.85098529824745 0.046199798583984375 4 0.7121850474965717 2.242804993557241 6584.0 13.15377969762419 0.0 - - - - - - - 707.125 13 8 PLCD1 phospholipase C, delta 1 317 41 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38291.[MT7]-ALAQGPWWARK[MT7].3b5_1.heavy 524.64 / 585.348 4321.0 32.810598373413086 30 7 10 5 8 1.8443659620533748 46.85098529824745 0.046199798583984375 4 0.7121850474965717 2.242804993557241 4321.0 4.456495704666267 1.0 - - - - - - - 296.125 8 8 PLCD1 phospholipase C, delta 1 319 41 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38291.[MT7]-ALAQGPWWARK[MT7].3y4_1.heavy 524.64 / 704.432 2058.0 32.810598373413086 30 7 10 5 8 1.8443659620533748 46.85098529824745 0.046199798583984375 4 0.7121850474965717 2.242804993557241 2058.0 2.325662242920444 5.0 - - - - - - - 758.625 4 8 PLCD1 phospholipase C, delta 1 321 42 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 722666.0 17.908000946044922 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 722666.0 2509.5556725098227 0.0 - - - - - - - 113.5 1445 2 323 42 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 413995.0 17.908000946044922 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 413995.0 3651.9579057679407 0.0 - - - - - - - 284.0 827 4 325 42 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 448920.0 17.908000946044922 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 448920.0 2036.8337051270032 0.0 - - - - - - - 1225.0 897 7 327 43 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23092.[MT7]-MQGILLLVFAK[MT7].3b6_1.heavy 507.654 / 800.482 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP5K inositol polyphosphate-5-phosphatase K 329 43 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23092.[MT7]-MQGILLLVFAK[MT7].3y3_1.heavy 507.654 / 509.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP5K inositol polyphosphate-5-phosphatase K 331 43 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23092.[MT7]-MQGILLLVFAK[MT7].3b4_1.heavy 507.654 / 574.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP5K inositol polyphosphate-5-phosphatase K 333 43 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23092.[MT7]-MQGILLLVFAK[MT7].3b5_1.heavy 507.654 / 687.398 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP5K inositol polyphosphate-5-phosphatase K 335 44 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37900.[MT7]-SPGASNLK[MT7].2y4_1.heavy 531.313 / 605.374 1407.0 18.495325565338135 44 18 10 6 10 5.93857025886549 16.839069951342815 0.03709983825683594 3 0.9808242949437507 8.897956014202933 1407.0 7.646227452179981 0.0 - - - - - - - 217.66666666666666 2 15 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 337 44 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37900.[MT7]-SPGASNLK[MT7].2y3_1.heavy 531.313 / 518.342 844.0 18.495325565338135 44 18 10 6 10 5.93857025886549 16.839069951342815 0.03709983825683594 3 0.9808242949437507 8.897956014202933 844.0 2.166322156476003 6.0 - - - - - - - 0.0 1 0 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 339 44 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37900.[MT7]-SPGASNLK[MT7].2y6_1.heavy 531.313 / 733.432 957.0 18.495325565338135 44 18 10 6 10 5.93857025886549 16.839069951342815 0.03709983825683594 3 0.9808242949437507 8.897956014202933 957.0 8.763078028839676 0.0 - - - - - - - 0.0 1 0 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 341 44 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37900.[MT7]-SPGASNLK[MT7].2y7_1.heavy 531.313 / 830.485 10469.0 18.495325565338135 44 18 10 6 10 5.93857025886549 16.839069951342815 0.03709983825683594 3 0.9808242949437507 8.897956014202933 10469.0 31.63801508188846 0.0 - - - - - - - 129.92307692307693 20 13 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 343 45 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23333.[MT7]-ALENPVRPFLAILGGAK[MT7].4y5_1.heavy 514.315 / 589.379 65921.0 45.3924503326416 42 16 10 6 10 6.311666962578948 15.843674989964931 0.033901214599609375 3 0.9612650959727838 6.2502760936621975 65921.0 683.7556816295248 0.0 - - - - - - - 787.0 131 7 PGK2 phosphoglycerate kinase 2 345 45 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23333.[MT7]-ALENPVRPFLAILGGAK[MT7].4b11_2.heavy 514.315 / 676.894 312911.0 45.3924503326416 42 16 10 6 10 6.311666962578948 15.843674989964931 0.033901214599609375 3 0.9612650959727838 6.2502760936621975 312911.0 1009.956628494109 0.0 - - - - - - - 303.0 625 5 PGK2 phosphoglycerate kinase 2 347 45 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23333.[MT7]-ALENPVRPFLAILGGAK[MT7].4b9_2.heavy 514.315 / 584.833 36280.0 45.3924503326416 42 16 10 6 10 6.311666962578948 15.843674989964931 0.033901214599609375 3 0.9612650959727838 6.2502760936621975 36280.0 172.91329709496108 0.0 - - - - - - - 282.8666666666667 72 15 PGK2 phosphoglycerate kinase 2 349 45 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23333.[MT7]-ALENPVRPFLAILGGAK[MT7].4b10_2.heavy 514.315 / 641.375 89612.0 45.3924503326416 42 16 10 6 10 6.311666962578948 15.843674989964931 0.033901214599609375 3 0.9612650959727838 6.2502760936621975 89612.0 874.7296292534281 0.0 - - - - - - - 234.2 179 10 PGK2 phosphoglycerate kinase 2 351 46 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23334.[MT7]-ALENPVRPFLAILGGAK[MT7].3b4_1.heavy 685.417 / 572.316 5491.0 45.43435001373291 36 13 10 3 10 2.925996131954427 34.176395145541335 0.06589889526367188 3 0.9152858748661169 4.209880694902331 5491.0 3.0477335800185013 1.0 - - - - - - - 376.9166666666667 10 12 PGK2 phosphoglycerate kinase 2 353 46 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23334.[MT7]-ALENPVRPFLAILGGAK[MT7].3y14_2.heavy 685.417 / 798.989 5007.0 45.43435001373291 36 13 10 3 10 2.925996131954427 34.176395145541335 0.06589889526367188 3 0.9152858748661169 4.209880694902331 5007.0 143.81302786377708 0.0 - - - - - - - 153.15384615384616 10 13 PGK2 phosphoglycerate kinase 2 355 46 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23334.[MT7]-ALENPVRPFLAILGGAK[MT7].3y5_1.heavy 685.417 / 589.379 6401.0 45.43435001373291 36 13 10 3 10 2.925996131954427 34.176395145541335 0.06589889526367188 3 0.9152858748661169 4.209880694902331 6401.0 41.66885656351935 0.0 - - - - - - - 150.58823529411765 12 17 PGK2 phosphoglycerate kinase 2 357 46 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23334.[MT7]-ALENPVRPFLAILGGAK[MT7].3y10_1.heavy 685.417 / 1130.71 797.0 45.43435001373291 36 13 10 3 10 2.925996131954427 34.176395145541335 0.06589889526367188 3 0.9152858748661169 4.209880694902331 797.0 13.163724371168884 1.0 - - - - - - - 0.0 1 0 PGK2 phosphoglycerate kinase 2 359 47 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544409.[MT7]-GTHNFSEELK[MT7].3y3_1.heavy 483.924 / 533.341 9879.0 24.07430076599121 50 20 10 10 10 6.272731860361988 15.942017326120677 0.0 3 0.9960028220220881 19.513755444922936 9879.0 21.302248025175004 0.0 - - - - - - - 697.0 19 10 IRAK1 interleukin-1 receptor-associated kinase 1 361 47 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544409.[MT7]-GTHNFSEELK[MT7].3b4_1.heavy 483.924 / 554.28 8458.0 24.07430076599121 50 20 10 10 10 6.272731860361988 15.942017326120677 0.0 3 0.9960028220220881 19.513755444922936 8458.0 11.533636363636365 0.0 - - - - - - - 707.3636363636364 16 11 IRAK1 interleukin-1 receptor-associated kinase 1 363 47 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544409.[MT7]-GTHNFSEELK[MT7].3y4_1.heavy 483.924 / 662.384 8323.0 24.07430076599121 50 20 10 10 10 6.272731860361988 15.942017326120677 0.0 3 0.9960028220220881 19.513755444922936 8323.0 38.630469884537554 0.0 - - - - - - - 651.125 16 8 IRAK1 interleukin-1 receptor-associated kinase 1 365 47 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544409.[MT7]-GTHNFSEELK[MT7].3y5_1.heavy 483.924 / 749.416 14615.0 24.07430076599121 50 20 10 10 10 6.272731860361988 15.942017326120677 0.0 3 0.9960028220220881 19.513755444922936 14615.0 64.73579199461946 0.0 - - - - - - - 241.64285714285714 29 14 IRAK1 interleukin-1 receptor-associated kinase 1 367 48 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544174.[MT7]-SLLLK[MT7]PHQR.3b3_1.heavy 460.629 / 458.31 541.0 22.052725315093994 19 0 10 3 6 0.2521354180518029 161.63697435099954 0.05669975280761719 5 0.30964897153487086 1.3896237907677529 541.0 0.11532056619483766 37.0 - - - - - - - 622.8181818181819 4 11 PLK1 polo-like kinase 1 369 48 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544174.[MT7]-SLLLK[MT7]PHQR.3y4_1.heavy 460.629 / 537.289 1742.0 22.052725315093994 19 0 10 3 6 0.2521354180518029 161.63697435099954 0.05669975280761719 5 0.30964897153487086 1.3896237907677529 1742.0 1.7538602240079393 4.0 - - - - - - - 751.0 19 8 PLK1 polo-like kinase 1 371 48 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544174.[MT7]-SLLLK[MT7]PHQR.3y8_2.heavy 460.629 / 574.873 19162.0 22.052725315093994 19 0 10 3 6 0.2521354180518029 161.63697435099954 0.05669975280761719 5 0.30964897153487086 1.3896237907677529 19162.0 9.47465186680121 1.0 - - - - - - - 355.25 38 12 PLK1 polo-like kinase 1 373 48 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544174.[MT7]-SLLLK[MT7]PHQR.3y5_1.heavy 460.629 / 809.486 3844.0 22.052725315093994 19 0 10 3 6 0.2521354180518029 161.63697435099954 0.05669975280761719 5 0.30964897153487086 1.3896237907677529 3844.0 6.030955146100139 0.0 - - - - - - - 142.5 7 16 PLK1 polo-like kinase 1 375 49 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23482.[MT7]-VVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIK[MT7].4b7_1.heavy 1209.12 / 893.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 377 49 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23482.[MT7]-VVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIK[MT7].4b5_1.heavy 1209.12 / 723.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 379 49 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23482.[MT7]-VVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIK[MT7].4y3_1.heavy 1209.12 / 567.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 381 49 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23482.[MT7]-VVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIK[MT7].4b6_1.heavy 1209.12 / 822.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 383 50 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38495.[MT7]-NHFQSVLEQLELQEK[MT7].2y4_1.heavy 1065.58 / 661.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 385 50 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38495.[MT7]-NHFQSVLEQLELQEK[MT7].2y8_1.heavy 1065.58 / 1160.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 387 50 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38495.[MT7]-NHFQSVLEQLELQEK[MT7].2y5_1.heavy 1065.58 / 790.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 389 50 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38495.[MT7]-NHFQSVLEQLELQEK[MT7].2y3_1.heavy 1065.58 / 548.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 391 51 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23371.[MT7]-FLQEFYQDDELGK[MT7]K[MT7].4b4_1.heavy 548.795 / 662.363 34533.0 36.74440002441406 40 10 10 10 10 0.8697728319027991 79.18171677269699 0.0 3 0.8466748988391798 3.110597348539213 34533.0 69.52139865561251 0.0 - - - - - - - 677.1 69 10 MCM7 minichromosome maintenance complex component 7 393 51 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23371.[MT7]-FLQEFYQDDELGK[MT7]K[MT7].4y7_2.heavy 548.795 / 546.811 34361.0 36.74440002441406 40 10 10 10 10 0.8697728319027991 79.18171677269699 0.0 3 0.8466748988391798 3.110597348539213 34361.0 104.20834409138865 0.0 - - - - - - - 220.42857142857142 68 14 MCM7 minichromosome maintenance complex component 7 395 51 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23371.[MT7]-FLQEFYQDDELGK[MT7]K[MT7].4y3_1.heavy 548.795 / 620.433 7026.0 36.74440002441406 40 10 10 10 10 0.8697728319027991 79.18171677269699 0.0 3 0.8466748988391798 3.110597348539213 7026.0 21.4293 0.0 - - - - - - - 575.4285714285714 14 7 MCM7 minichromosome maintenance complex component 7 397 51 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23371.[MT7]-FLQEFYQDDELGK[MT7]K[MT7].4b3_1.heavy 548.795 / 533.32 19537.0 36.74440002441406 40 10 10 10 10 0.8697728319027991 79.18171677269699 0.0 3 0.8466748988391798 3.110597348539213 19537.0 35.2365894921003 0.0 - - - - - - - 1310.0 39 7 MCM7 minichromosome maintenance complex component 7 399 52 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38602.[MT7]-GFTPAQFQAALDEYEELNVWQVNASR.3y7_1.heavy 1043.18 / 860.437 4068.0 47.48509979248047 44 17 10 7 10 3.6210312424962514 21.670732482076502 0.026397705078125 3 0.9729909911646463 7.492481531884425 4068.0 32.69736564805058 0.0 - - - - - - - 99.27586206896552 8 29 MCM7 minichromosome maintenance complex component 7 401 52 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38602.[MT7]-GFTPAQFQAALDEYEELNVWQVNASR.3b6_1.heavy 1043.18 / 746.395 3075.0 47.48509979248047 44 17 10 7 10 3.6210312424962514 21.670732482076502 0.026397705078125 3 0.9729909911646463 7.492481531884425 3075.0 13.119238893867621 0.0 - - - - - - - 133.70967741935485 6 31 MCM7 minichromosome maintenance complex component 7 403 52 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38602.[MT7]-GFTPAQFQAALDEYEELNVWQVNASR.3b5_1.heavy 1043.18 / 618.337 1557.0 47.48509979248047 44 17 10 7 10 3.6210312424962514 21.670732482076502 0.026397705078125 3 0.9729909911646463 7.492481531884425 1557.0 48.573076923076925 0.0 - - - - - - - 95.11111111111111 3 27 MCM7 minichromosome maintenance complex component 7 405 52 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38602.[MT7]-GFTPAQFQAALDEYEELNVWQVNASR.3y9_1.heavy 1043.18 / 1073.55 1732.0 47.48509979248047 44 17 10 7 10 3.6210312424962514 21.670732482076502 0.026397705078125 3 0.9729909911646463 7.492481531884425 1732.0 21.42680412371134 0.0 - - - - - - - 62.30434782608695 3 23 MCM7 minichromosome maintenance complex component 7 407 53 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542282.[MT7]-YGNQLVR.2y5_1.heavy 497.284 / 629.373 2639.0 24.13907527923584 43 17 10 6 10 3.0125346741163455 33.194638673937455 0.037700653076171875 3 0.9726047588772534 7.43923574968391 2639.0 2.275 3.0 - - - - - - - 733.0833333333334 5 12 MCM7 minichromosome maintenance complex component 7 409 53 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542282.[MT7]-YGNQLVR.2b4_1.heavy 497.284 / 607.296 5819.0 24.13907527923584 43 17 10 6 10 3.0125346741163455 33.194638673937455 0.037700653076171875 3 0.9726047588772534 7.43923574968391 5819.0 8.599507389162563 0.0 - - - - - - - 691.6666666666666 11 9 MCM7 minichromosome maintenance complex component 7 411 53 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542282.[MT7]-YGNQLVR.2y6_1.heavy 497.284 / 686.394 13194.0 24.13907527923584 43 17 10 6 10 3.0125346741163455 33.194638673937455 0.037700653076171875 3 0.9726047588772534 7.43923574968391 13194.0 31.42367161272996 0.0 - - - - - - - 262.25 26 16 MCM7 minichromosome maintenance complex component 7 413 53 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542282.[MT7]-YGNQLVR.2b5_1.heavy 497.284 / 720.38 5481.0 24.13907527923584 43 17 10 6 10 3.0125346741163455 33.194638673937455 0.037700653076171875 3 0.9726047588772534 7.43923574968391 5481.0 38.339999999999996 0.0 - - - - - - - 667.0 10 7 MCM7 minichromosome maintenance complex component 7 415 54 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22585.[MT7]-DQTELR.2b3_1.heavy 453.244 / 489.242 706.0 17.02403386433919 34 14 10 6 4 2.3989951218792402 31.932632442859013 0.03730010986328125 7 0.9394298123136123 4.989029190037788 706.0 1.0382352941176471 7.0 - - - - - - - 245.52 4 25 IRAK1 interleukin-1 receptor-associated kinase 1 417 54 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22585.[MT7]-DQTELR.2y5_1.heavy 453.244 / 646.352 2226.0 17.02403386433919 34 14 10 6 4 2.3989951218792402 31.932632442859013 0.03730010986328125 7 0.9394298123136123 4.989029190037788 2226.0 24.730061912534474 1.0 - - - - - - - 175.85714285714286 8 21 IRAK1 interleukin-1 receptor-associated kinase 1 419 54 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22585.[MT7]-DQTELR.2b4_1.heavy 453.244 / 618.285 4453.0 17.02403386433919 34 14 10 6 4 2.3989951218792402 31.932632442859013 0.03730010986328125 7 0.9394298123136123 4.989029190037788 4453.0 22.606898358791028 0.0 - - - - - - - 217.33333333333334 8 15 IRAK1 interleukin-1 receptor-associated kinase 1 421 54 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22585.[MT7]-DQTELR.2y3_1.heavy 453.244 / 417.246 N/A 17.02403386433919 34 14 10 6 4 2.3989951218792402 31.932632442859013 0.03730010986328125 7 0.9394298123136123 4.989029190037788 1303.0 0.9240907905378305 21.0 - - - - - - - 1270.8 4 10 IRAK1 interleukin-1 receptor-associated kinase 1 423 55 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23370.[MT7]-K[MT7]FLQEFYQDDELGK[MT7].3b6_2.heavy 731.391 / 541.318 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 425 55 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23370.[MT7]-K[MT7]FLQEFYQDDELGK[MT7].3y6_1.heavy 731.391 / 820.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 427 55 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23370.[MT7]-K[MT7]FLQEFYQDDELGK[MT7].3b5_1.heavy 731.391 / 934.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 429 55 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23370.[MT7]-K[MT7]FLQEFYQDDELGK[MT7].3b3_1.heavy 731.391 / 677.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 431 56 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 1635180.0 36.87770080566406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1635180.0 1922.7141637094815 0.0 - - - - - - - 163.0 3270 9 433 56 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 813626.0 36.87770080566406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 813626.0 2127.68386393902 0.0 - - - - - - - 307.22222222222223 1627 9 435 56 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1112910.0 36.87770080566406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1112910.0 1275.723539646116 0.0 - - - - - - - 324.0 2225 4 437 57 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22583.[MT7]-LSGLPK[MT7].2y4_1.heavy 451.799 / 558.373 3371.0 26.713375091552734 34 20 0 6 8 6.013650720159444 16.628834073248044 0.038299560546875 4 0.9959697016540447 19.4333558099496 3371.0 8.726848980894625 0.0 - - - - - - - 772.625 6 8 LDHB lactate dehydrogenase B 439 57 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22583.[MT7]-LSGLPK[MT7].2y5_1.heavy 451.799 / 645.405 18782.0 26.713375091552734 34 20 0 6 8 6.013650720159444 16.628834073248044 0.038299560546875 4 0.9959697016540447 19.4333558099496 18782.0 18.6834008540573 1.0 - - - - - - - 642.125 163 8 LDHB lactate dehydrogenase B 441 57 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22583.[MT7]-LSGLPK[MT7].2b4_1.heavy 451.799 / 515.331 11077.0 26.713375091552734 34 20 0 6 8 6.013650720159444 16.628834073248044 0.038299560546875 4 0.9959697016540447 19.4333558099496 11077.0 19.067561396152627 0.0 - - - - - - - 834.8 22 10 LDHB lactate dehydrogenase B 443 57 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22583.[MT7]-LSGLPK[MT7].2y3_1.heavy 451.799 / 501.352 2007.0 26.713375091552734 34 20 0 6 8 6.013650720159444 16.628834073248044 0.038299560546875 4 0.9959697016540447 19.4333558099496 2007.0 1.7500979479163201 10.0 - - - - - - - 1227.0 10 7 LDHB lactate dehydrogenase B 445 58 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38286.[MT7]-FLVEDYDASSK[MT7].2b3_1.heavy 781.403 / 504.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD1 phospholipase C, delta 1 447 58 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38286.[MT7]-FLVEDYDASSK[MT7].2y4_1.heavy 781.403 / 536.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD1 phospholipase C, delta 1 449 58 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38286.[MT7]-FLVEDYDASSK[MT7].2y8_1.heavy 781.403 / 1058.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD1 phospholipase C, delta 1 451 58 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38286.[MT7]-FLVEDYDASSK[MT7].2y6_1.heavy 781.403 / 814.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD1 phospholipase C, delta 1 453 59 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23162.[MT7]-LSLLEEYGC[CAM]C[CAM]K[MT7].3b6_1.heavy 553.949 / 829.479 12096.0 36.38175010681152 43 17 10 6 10 2.727633350253418 30.351860371264348 0.03260040283203125 3 0.9768030856492007 8.087310968197315 12096.0 102.38690204655522 0.0 - - - - - - - 218.52941176470588 24 17 PLK1 polo-like kinase 1 455 59 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23162.[MT7]-LSLLEEYGC[CAM]C[CAM]K[MT7].3b4_1.heavy 553.949 / 571.394 10281.0 36.38175010681152 43 17 10 6 10 2.727633350253418 30.351860371264348 0.03260040283203125 3 0.9768030856492007 8.087310968197315 10281.0 4.9929652715939445 2.0 - - - - - - - 777.5555555555555 20 9 PLK1 polo-like kinase 1 457 59 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23162.[MT7]-LSLLEEYGC[CAM]C[CAM]K[MT7].3b5_1.heavy 553.949 / 700.436 10368.0 36.38175010681152 43 17 10 6 10 2.727633350253418 30.351860371264348 0.03260040283203125 3 0.9768030856492007 8.087310968197315 10368.0 15.623281125605704 0.0 - - - - - - - 328.3 20 10 PLK1 polo-like kinase 1 459 59 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23162.[MT7]-LSLLEEYGC[CAM]C[CAM]K[MT7].3y4_1.heavy 553.949 / 668.298 24450.0 36.38175010681152 43 17 10 6 10 2.727633350253418 30.351860371264348 0.03260040283203125 3 0.9768030856492007 8.087310968197315 24450.0 34.713591293417664 0.0 - - - - - - - 703.4285714285714 48 7 PLK1 polo-like kinase 1 461 60 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38288.[MT7]-ENADLEWTAVK[MT7].2y4_1.heavy 782.417 / 562.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK1 interleukin-1 receptor-associated kinase 1 463 60 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38288.[MT7]-ENADLEWTAVK[MT7].2b4_1.heavy 782.417 / 574.259 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK1 interleukin-1 receptor-associated kinase 1 465 60 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38288.[MT7]-ENADLEWTAVK[MT7].2b6_1.heavy 782.417 / 816.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK1 interleukin-1 receptor-associated kinase 1 467 60 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38288.[MT7]-ENADLEWTAVK[MT7].2b5_1.heavy 782.417 / 687.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK1 interleukin-1 receptor-associated kinase 1 469 61 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23272.[MT7]-SLADELALVDVLEDK[MT7].3b6_1.heavy 640.026 / 773.416 64715.0 46.456199645996094 45 15 10 10 10 2.4617664410073474 32.26506390625 0.0 3 0.9574200356918402 5.959454798265867 64715.0 660.7692288941253 0.0 - - - - - - - 178.11764705882354 129 17 LDHB lactate dehydrogenase B 471 61 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23272.[MT7]-SLADELALVDVLEDK[MT7].3b4_1.heavy 640.026 / 531.289 33214.0 46.456199645996094 45 15 10 10 10 2.4617664410073474 32.26506390625 0.0 3 0.9574200356918402 5.959454798265867 33214.0 99.36812972493286 0.0 - - - - - - - 222.38095238095238 66 21 LDHB lactate dehydrogenase B 473 61 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23272.[MT7]-SLADELALVDVLEDK[MT7].3b5_1.heavy 640.026 / 660.332 81396.0 46.456199645996094 45 15 10 10 10 2.4617664410073474 32.26506390625 0.0 3 0.9574200356918402 5.959454798265867 81396.0 548.1746949602123 0.0 - - - - - - - 269.9375 162 16 LDHB lactate dehydrogenase B 475 61 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23272.[MT7]-SLADELALVDVLEDK[MT7].3b7_1.heavy 640.026 / 844.453 118333.0 46.456199645996094 45 15 10 10 10 2.4617664410073474 32.26506390625 0.0 3 0.9574200356918402 5.959454798265867 118333.0 211.3100437101793 0.0 - - - - - - - 233.46666666666667 236 15 LDHB lactate dehydrogenase B 477 62 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542486.[MT7]-RSILDK[MT7].2y4_1.heavy 510.326 / 632.41 N/A 22.155733108520508 41 18 9 6 8 4.300745892613427 23.251780620601412 0.034000396728515625 4 0.9876334736960573 11.086384307985826 1017.0 0.6415243201838376 23.0 - - - - - - - 1170.5714285714287 28 7 INHBC inhibin, beta C 479 62 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542486.[MT7]-RSILDK[MT7].2y5_1.heavy 510.326 / 719.442 2656.0 22.155733108520508 41 18 9 6 8 4.300745892613427 23.251780620601412 0.034000396728515625 4 0.9876334736960573 11.086384307985826 2656.0 7.377777777777777 2.0 - - - - - - - 198.0 6 22 INHBC inhibin, beta C 481 62 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542486.[MT7]-RSILDK[MT7].2y3_1.heavy 510.326 / 519.326 1356.0 22.155733108520508 41 18 9 6 8 4.300745892613427 23.251780620601412 0.034000396728515625 4 0.9876334736960573 11.086384307985826 1356.0 1.2000000000000002 3.0 - - - - - - - 287.90909090909093 2 22 INHBC inhibin, beta C 483 62 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542486.[MT7]-RSILDK[MT7].2b5_1.heavy 510.326 / 729.438 11529.0 22.155733108520508 41 18 9 6 8 4.300745892613427 23.251780620601412 0.034000396728515625 4 0.9876334736960573 11.086384307985826 11529.0 46.707955577990916 0.0 - - - - - - - 235.05263157894737 23 19 INHBC inhibin, beta C 485 63 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22589.[MT7]-EFQEGR.2b3_1.heavy 455.231 / 549.279 7542.0 18.097124576568604 40 14 10 6 10 1.1167222279907152 55.46649404965775 0.03289985656738281 3 0.9417471651176796 5.088300047094868 7542.0 23.56875 0.0 - - - - - - - 196.58823529411765 15 17 INPP5K inositol polyphosphate-5-phosphatase K 487 63 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22589.[MT7]-EFQEGR.2y5_1.heavy 455.231 / 636.31 21820.0 18.097124576568604 40 14 10 6 10 1.1167222279907152 55.46649404965775 0.03289985656738281 3 0.9417471651176796 5.088300047094868 21820.0 124.783125 0.0 - - - - - - - 222.6 43 15 INPP5K inositol polyphosphate-5-phosphatase K 489 63 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22589.[MT7]-EFQEGR.2b4_1.heavy 455.231 / 678.321 12666.0 18.097124576568604 40 14 10 6 10 1.1167222279907152 55.46649404965775 0.03289985656738281 3 0.9417471651176796 5.088300047094868 12666.0 126.75993318784623 0.0 - - - - - - - 185.14285714285714 25 14 INPP5K inositol polyphosphate-5-phosphatase K 491 63 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22589.[MT7]-EFQEGR.2y3_1.heavy 455.231 / 361.183 2648.0 18.097124576568604 40 14 10 6 10 1.1167222279907152 55.46649404965775 0.03289985656738281 3 0.9417471651176796 5.088300047094868 2648.0 7.024381253291207 0.0 - - - - - - - 633.3 5 10 INPP5K inositol polyphosphate-5-phosphatase K 493 64 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38283.[MT7]-QIAEEDFYEK[MT7].2y4_1.heavy 780.395 / 730.389 2182.0 29.21769952774048 37 11 10 6 10 1.1529666210482261 55.473020327841496 0.03439903259277344 3 0.8628287756991596 3.2933408631786745 2182.0 5.675897435897436 0.0 - - - - - - - 234.0 4 16 MCM7 minichromosome maintenance complex component 7 495 64 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38283.[MT7]-QIAEEDFYEK[MT7].2y3_1.heavy 780.395 / 583.321 623.0 29.21769952774048 37 11 10 6 10 1.1529666210482261 55.473020327841496 0.03439903259277344 3 0.8628287756991596 3.2933408631786745 623.0 1.5974358974358975 5.0 - - - - - - - 0.0 1 0 MCM7 minichromosome maintenance complex component 7 497 64 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38283.[MT7]-QIAEEDFYEK[MT7].2b6_1.heavy 780.395 / 830.401 2494.0 29.21769952774048 37 11 10 6 10 1.1529666210482261 55.473020327841496 0.03439903259277344 3 0.8628287756991596 3.2933408631786745 2494.0 15.987179487179487 0.0 - - - - - - - 216.66666666666666 4 9 MCM7 minichromosome maintenance complex component 7 499 64 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38283.[MT7]-QIAEEDFYEK[MT7].2y7_1.heavy 780.395 / 1103.5 857.0 29.21769952774048 37 11 10 6 10 1.1529666210482261 55.473020327841496 0.03439903259277344 3 0.8628287756991596 3.2933408631786745 857.0 17.57948717948718 0.0 - - - - - - - 0.0 1 0 MCM7 minichromosome maintenance complex component 7 501 65 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38502.[MT7]-GPNQPVESDESLGGLSAALR.3y7_1.heavy 714.37 / 687.415 2952.0 35.4364013671875 46 20 10 6 10 31.994615716742477 3.1255258973987603 0.0391998291015625 3 0.9962713653496077 20.20470054120342 2952.0 4.859860200021508 0.0 - - - - - - - 626.3636363636364 5 11 IRAK1 interleukin-1 receptor-associated kinase 1 503 65 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38502.[MT7]-GPNQPVESDESLGGLSAALR.3y8_1.heavy 714.37 / 744.436 12026.0 35.4364013671875 46 20 10 6 10 31.994615716742477 3.1255258973987603 0.0391998291015625 3 0.9962713653496077 20.20470054120342 12026.0 41.71485852457046 0.0 - - - - - - - 753.2222222222222 24 9 IRAK1 interleukin-1 receptor-associated kinase 1 505 65 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38502.[MT7]-GPNQPVESDESLGGLSAALR.3b7_1.heavy 714.37 / 866.449 1640.0 35.4364013671875 46 20 10 6 10 31.994615716742477 3.1255258973987603 0.0391998291015625 3 0.9962713653496077 20.20470054120342 1640.0 11.764155251141553 0.0 - - - - - - - 163.75 3 12 IRAK1 interleukin-1 receptor-associated kinase 1 507 65 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38502.[MT7]-GPNQPVESDESLGGLSAALR.3y5_1.heavy 714.37 / 517.309 4701.0 35.4364013671875 46 20 10 6 10 31.994615716742477 3.1255258973987603 0.0391998291015625 3 0.9962713653496077 20.20470054120342 4701.0 22.940560959386115 0.0 - - - - - - - 640.5714285714286 9 7 IRAK1 interleukin-1 receptor-associated kinase 1 509 66 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23264.[MT7]-VADLVHILTHLQLLR.3y7_1.heavy 629.055 / 880.536 845.0 49.25665092468262 41 18 10 3 10 11.41658110790314 8.759189730695725 0.052700042724609375 3 0.9875590301703927 11.05309663809338 845.0 52.71836007130124 0.0 - - - - - - - 0.0 1 0 IRAK1 interleukin-1 receptor-associated kinase 1 511 66 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23264.[MT7]-VADLVHILTHLQLLR.3y8_1.heavy 629.055 / 993.62 829.0 49.25665092468262 41 18 10 3 10 11.41658110790314 8.759189730695725 0.052700042724609375 3 0.9875590301703927 11.05309663809338 829.0 44.51242352941176 0.0 - - - - - - - 0.0 1 0 IRAK1 interleukin-1 receptor-associated kinase 1 513 66 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23264.[MT7]-VADLVHILTHLQLLR.3b4_1.heavy 629.055 / 543.326 1607.0 49.25665092468262 41 18 10 3 10 11.41658110790314 8.759189730695725 0.052700042724609375 3 0.9875590301703927 11.05309663809338 1607.0 22.445384883315917 0.0 - - - - - - - 68.03448275862068 3 29 IRAK1 interleukin-1 receptor-associated kinase 1 515 66 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23264.[MT7]-VADLVHILTHLQLLR.3y4_1.heavy 629.055 / 529.346 398.0 49.25665092468262 41 18 10 3 10 11.41658110790314 8.759189730695725 0.052700042724609375 3 0.9875590301703927 11.05309663809338 398.0 3.4580208523870497 3.0 - - - - - - - 0.0 1 0 IRAK1 interleukin-1 receptor-associated kinase 1 517 67 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543663.[MT7]-VTVEIHGVSR.3b4_1.heavy 414.243 / 573.336 30988.0 25.55982542037964 46 20 10 6 10 14.601793570588947 6.848473751979402 0.03830146789550781 3 0.9983107304530957 30.02283763970681 30988.0 123.38605500621387 0.0 - - - - - - - 238.9375 61 16 PLCD1 phospholipase C, delta 1 519 67 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543663.[MT7]-VTVEIHGVSR.3b5_1.heavy 414.243 / 686.42 4381.0 25.55982542037964 46 20 10 6 10 14.601793570588947 6.848473751979402 0.03830146789550781 3 0.9983107304530957 30.02283763970681 4381.0 89.26287500000001 0.0 - - - - - - - 119.625 8 8 PLCD1 phospholipase C, delta 1 521 67 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543663.[MT7]-VTVEIHGVSR.3y4_1.heavy 414.243 / 418.241 44928.0 25.55982542037964 46 20 10 6 10 14.601793570588947 6.848473751979402 0.03830146789550781 3 0.9983107304530957 30.02283763970681 44928.0 132.0801403698205 0.0 - - - - - - - 324.2857142857143 89 14 PLCD1 phospholipase C, delta 1 523 67 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543663.[MT7]-VTVEIHGVSR.3y5_1.heavy 414.243 / 555.3 13542.0 25.55982542037964 46 20 10 6 10 14.601793570588947 6.848473751979402 0.03830146789550781 3 0.9983107304530957 30.02283763970681 13542.0 52.04329928877203 0.0 - - - - - - - 227.57142857142858 27 14 PLCD1 phospholipase C, delta 1 525 68 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38213.[MT7]-NEDVGAEDPSK[MT7].2b8_1.heavy 724.859 / 974.418 1116.0 17.510400136311848 38 12 10 6 10 1.2443770397411096 51.611861616288856 0.03209877014160156 3 0.8816487545716564 3.5513754469250665 1116.0 7.032328767123288 0.0 - - - - - - - 151.11111111111111 2 9 PITX2 paired-like homeodomain 2 527 68 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38213.[MT7]-NEDVGAEDPSK[MT7].2b3_1.heavy 724.859 / 503.222 970.0 17.510400136311848 38 12 10 6 10 1.2443770397411096 51.611861616288856 0.03209877014160156 3 0.8816487545716564 3.5513754469250665 970.0 13.5 0.0 - - - - - - - 0.0 1 0 PITX2 paired-like homeodomain 2 529 68 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38213.[MT7]-NEDVGAEDPSK[MT7].2b4_1.heavy 724.859 / 602.29 N/A 17.510400136311848 38 12 10 6 10 1.2443770397411096 51.611861616288856 0.03209877014160156 3 0.8816487545716564 3.5513754469250665 534.0 4.754794520547945 0.0 - - - - - - - 0.0 1 0 PITX2 paired-like homeodomain 2 531 68 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38213.[MT7]-NEDVGAEDPSK[MT7].2y7_1.heavy 724.859 / 847.428 485.0 17.510400136311848 38 12 10 6 10 1.2443770397411096 51.611861616288856 0.03209877014160156 3 0.8816487545716564 3.5513754469250665 485.0 18.60816326530612 0.0 - - - - - - - 0.0 0 0 PITX2 paired-like homeodomain 2 533 69 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22984.[MT7]-GSSGVGLTAAVLR.2y8_1.heavy 666.392 / 800.499 2831.0 32.8912992477417 41 16 10 5 10 6.256503894924173 15.983367337328568 0.046001434326171875 3 0.9657274713907064 6.647235475462589 2831.0 19.81036829776158 0.0 - - - - - - - 210.0 5 7 MCM7 minichromosome maintenance complex component 7 535 69 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22984.[MT7]-GSSGVGLTAAVLR.2b6_1.heavy 666.392 / 589.306 906.0 32.8912992477417 41 16 10 5 10 6.256503894924173 15.983367337328568 0.046001434326171875 3 0.9657274713907064 6.647235475462589 906.0 4.848877709280957 6.0 - - - - - - - 161.5 2 14 MCM7 minichromosome maintenance complex component 7 537 69 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22984.[MT7]-GSSGVGLTAAVLR.2y10_1.heavy 666.392 / 956.589 1472.0 32.8912992477417 41 16 10 5 10 6.256503894924173 15.983367337328568 0.046001434326171875 3 0.9657274713907064 6.647235475462589 1472.0 3.2523237414288224 0.0 - - - - - - - 203.6 2 5 MCM7 minichromosome maintenance complex component 7 539 69 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22984.[MT7]-GSSGVGLTAAVLR.2b5_1.heavy 666.392 / 532.285 1472.0 32.8912992477417 41 16 10 5 10 6.256503894924173 15.983367337328568 0.046001434326171875 3 0.9657274713907064 6.647235475462589 1472.0 4.546494283932654 0.0 - - - - - - - 235.83333333333334 2 12 MCM7 minichromosome maintenance complex component 7 541 70 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23057.[MT7]-AEPDK[MT7]IEAFR.3b4_1.heavy 488.608 / 557.269 29334.0 26.933700561523438 50 20 10 10 10 8.148798407357727 12.271747931536487 0.0 3 0.9926756437932696 14.411600251468698 29334.0 46.89531018745737 0.0 - - - - - - - 750.0 58 13 PGK2 phosphoglycerate kinase 2 543 70 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23057.[MT7]-AEPDK[MT7]IEAFR.3y4_1.heavy 488.608 / 522.267 9432.0 26.933700561523438 50 20 10 10 10 8.148798407357727 12.271747931536487 0.0 3 0.9926756437932696 14.411600251468698 9432.0 22.179193513934315 0.0 - - - - - - - 647.6 18 10 PGK2 phosphoglycerate kinase 2 545 70 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23057.[MT7]-AEPDK[MT7]IEAFR.3y8_2.heavy 488.608 / 560.318 38606.0 26.933700561523438 50 20 10 10 10 8.148798407357727 12.271747931536487 0.0 3 0.9926756437932696 14.411600251468698 38606.0 36.92413796821849 0.0 - - - - - - - 779.0 77 8 PGK2 phosphoglycerate kinase 2 547 70 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23057.[MT7]-AEPDK[MT7]IEAFR.3b7_2.heavy 488.608 / 536.3 14147.0 26.933700561523438 50 20 10 10 10 8.148798407357727 12.271747931536487 0.0 3 0.9926756437932696 14.411600251468698 14147.0 31.208629765806407 0.0 - - - - - - - 791.1 28 10 PGK2 phosphoglycerate kinase 2 549 71 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38378.[MT7]-HAVVEVEDVPLAAK[MT7].2b8_1.heavy 883.009 / 1023.52 1604.0 30.35349941253662 43 17 10 6 10 2.6174418920277573 38.205241653914634 0.030599594116210938 3 0.97585408695813 7.926159172433707 1604.0 9.498627125382978 0.0 - - - - - - - 184.1818181818182 3 11 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 551 71 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38378.[MT7]-HAVVEVEDVPLAAK[MT7].2y5_1.heavy 883.009 / 643.426 4137.0 30.35349941253662 43 17 10 6 10 2.6174418920277573 38.205241653914634 0.030599594116210938 3 0.97585408695813 7.926159172433707 4137.0 60.34974308300396 0.0 - - - - - - - 158.76470588235293 8 17 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 553 71 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38378.[MT7]-HAVVEVEDVPLAAK[MT7].2y9_1.heavy 883.009 / 1085.63 675.0 30.35349941253662 43 17 10 6 10 2.6174418920277573 38.205241653914634 0.030599594116210938 3 0.97585408695813 7.926159172433707 675.0 15.107142857142858 1.0 - - - - - - - 0.0 1 0 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 555 71 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38378.[MT7]-HAVVEVEDVPLAAK[MT7].2y10_1.heavy 883.009 / 1214.67 1182.0 30.35349941253662 43 17 10 6 10 2.6174418920277573 38.205241653914634 0.030599594116210938 3 0.97585408695813 7.926159172433707 1182.0 14.907387996618764 0.0 - - - - - - - 140.66666666666666 2 6 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 557 72 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23054.[MT7]-SITVLVEGENTR.2y8_1.heavy 731.405 / 917.469 8536.0 32.38100051879883 48 18 10 10 10 5.53068280797244 18.080950123527373 0.0 3 0.9815981084312242 9.083702268187121 8536.0 35.561486283322765 1.0 - - - - - - - 174.42857142857142 17 14 MCM7 minichromosome maintenance complex component 7 559 72 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23054.[MT7]-SITVLVEGENTR.2y5_1.heavy 731.405 / 576.274 5875.0 32.38100051879883 48 18 10 10 10 5.53068280797244 18.080950123527373 0.0 3 0.9815981084312242 9.083702268187121 5875.0 26.049780028335334 0.0 - - - - - - - 247.53846153846155 11 13 MCM7 minichromosome maintenance complex component 7 561 72 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23054.[MT7]-SITVLVEGENTR.2y10_1.heavy 731.405 / 1117.58 5654.0 32.38100051879883 48 18 10 10 10 5.53068280797244 18.080950123527373 0.0 3 0.9815981084312242 9.083702268187121 5654.0 44.56981981981983 0.0 - - - - - - - 190.28571428571428 11 7 MCM7 minichromosome maintenance complex component 7 563 72 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23054.[MT7]-SITVLVEGENTR.2y7_1.heavy 731.405 / 804.385 6319.0 32.38100051879883 48 18 10 10 10 5.53068280797244 18.080950123527373 0.0 3 0.9815981084312242 9.083702268187121 6319.0 73.94937837837838 0.0 - - - - - - - 249.75 12 8 MCM7 minichromosome maintenance complex component 7 565 73 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22988.[MT7]-SRELYLQER.3b4_1.heavy 446.581 / 630.369 4158.0 23.70949935913086 48 18 10 10 10 2.8265013220328767 27.786176231937766 0.0 3 0.9809594735504549 8.929587062521387 4158.0 21.02382133995037 0.0 - - - - - - - 260.88235294117646 8 17 PLCD1 phospholipase C, delta 1 567 73 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22988.[MT7]-SRELYLQER.3b5_1.heavy 446.581 / 793.432 6681.0 23.70949935913086 48 18 10 10 10 2.8265013220328767 27.786176231937766 0.0 3 0.9809594735504549 8.929587062521387 6681.0 125.75999999999999 0.0 - - - - - - - 121.11111111111111 13 9 PLCD1 phospholipase C, delta 1 569 73 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22988.[MT7]-SRELYLQER.3y4_1.heavy 446.581 / 545.304 18611.0 23.70949935913086 48 18 10 10 10 2.8265013220328767 27.786176231937766 0.0 3 0.9809594735504549 8.929587062521387 18611.0 37.31660136852395 0.0 - - - - - - - 630.625 37 8 PLCD1 phospholipase C, delta 1 571 73 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22988.[MT7]-SRELYLQER.3y5_1.heavy 446.581 / 708.367 8726.0 23.70949935913086 48 18 10 10 10 2.8265013220328767 27.786176231937766 0.0 3 0.9809594735504549 8.929587062521387 8726.0 41.379818310879116 0.0 - - - - - - - 172.21052631578948 17 19 PLCD1 phospholipase C, delta 1 573 74 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23059.[MT7]-SADTLWDIQK[MT7].2y4_1.heavy 732.9 / 647.385 2749.0 34.4359016418457 45 15 10 10 10 2.0882507096851968 34.07915690967347 0.0 3 0.9500117103531999 5.4967031355387395 2749.0 10.596145454545454 1.0 - - - - - - - 232.22222222222223 5 9 LDHB lactate dehydrogenase B 575 74 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23059.[MT7]-SADTLWDIQK[MT7].2b4_1.heavy 732.9 / 519.253 1540.0 34.4359016418457 45 15 10 10 10 2.0882507096851968 34.07915690967347 0.0 3 0.9500117103531999 5.4967031355387395 1540.0 6.673333333333334 1.0 - - - - - - - 290.0 3 11 LDHB lactate dehydrogenase B 577 74 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23059.[MT7]-SADTLWDIQK[MT7].2y3_1.heavy 732.9 / 532.357 1320.0 34.4359016418457 45 15 10 10 10 2.0882507096851968 34.07915690967347 0.0 3 0.9500117103531999 5.4967031355387395 1320.0 2.033684210526316 2.0 - - - - - - - 220.0 4 11 LDHB lactate dehydrogenase B 579 74 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23059.[MT7]-SADTLWDIQK[MT7].2b7_1.heavy 732.9 / 933.443 1980.0 34.4359016418457 45 15 10 10 10 2.0882507096851968 34.07915690967347 0.0 3 0.9500117103531999 5.4967031355387395 1980.0 20.160000000000004 0.0 - - - - - - - 151.25 3 8 LDHB lactate dehydrogenase B 581 75 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22599.[MT7]-SLDSSK[MT7].2b3_1.heavy 462.766 / 460.252 9910.0 16.430349826812744 42 16 10 6 10 4.257087838524308 23.490236469883214 0.03579902648925781 3 0.9660561235383543 6.679523216284308 9910.0 62.328027166173726 0.0 - - - - - - - 177.1764705882353 19 17 PITX2 paired-like homeodomain 2 583 75 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22599.[MT7]-SLDSSK[MT7].2y4_1.heavy 462.766 / 580.306 5466.0 16.430349826812744 42 16 10 6 10 4.257087838524308 23.490236469883214 0.03579902648925781 3 0.9660561235383543 6.679523216284308 5466.0 29.979474203089055 1.0 - - - - - - - 189.1764705882353 10 17 PITX2 paired-like homeodomain 2 585 75 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22599.[MT7]-SLDSSK[MT7].2y5_1.heavy 462.766 / 693.39 5517.0 16.430349826812744 42 16 10 6 10 4.257087838524308 23.490236469883214 0.03579902648925781 3 0.9660561235383543 6.679523216284308 5517.0 24.332141094199915 0.0 - - - - - - - 149.5 11 14 PITX2 paired-like homeodomain 2 587 75 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22599.[MT7]-SLDSSK[MT7].2y3_1.heavy 462.766 / 465.279 12413.0 16.430349826812744 42 16 10 6 10 4.257087838524308 23.490236469883214 0.03579902648925781 3 0.9660561235383543 6.679523216284308 12413.0 76.5456441208405 0.0 - - - - - - - 214.94736842105263 24 19 PITX2 paired-like homeodomain 2 589 76 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23072.[MT7]-TASVLWPWINR.2y6_1.heavy 743.918 / 871.457 2311.0 44.268850326538086 41 14 10 7 10 2.975822472938856 26.93197385838772 0.025302886962890625 3 0.9457729879242676 5.27560393318709 2311.0 25.28505882352941 0.0 - - - - - - - 148.75 4 24 IRAK1 interleukin-1 receptor-associated kinase 1 591 76 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23072.[MT7]-TASVLWPWINR.2y10_1.heavy 743.918 / 1241.68 1121.0 44.268850326538086 41 14 10 7 10 2.975822472938856 26.93197385838772 0.025302886962890625 3 0.9457729879242676 5.27560393318709 1121.0 6.280112044817928 0.0 - - - - - - - 128.15384615384616 2 13 IRAK1 interleukin-1 receptor-associated kinase 1 593 76 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23072.[MT7]-TASVLWPWINR.2b5_1.heavy 743.918 / 616.379 3500.0 44.268850326538086 41 14 10 7 10 2.975822472938856 26.93197385838772 0.025302886962890625 3 0.9457729879242676 5.27560393318709 3500.0 24.281045751633986 0.0 - - - - - - - 220.2608695652174 7 23 IRAK1 interleukin-1 receptor-associated kinase 1 595 76 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23072.[MT7]-TASVLWPWINR.2y7_1.heavy 743.918 / 984.541 2854.0 44.268850326538086 41 14 10 7 10 2.975822472938856 26.93197385838772 0.025302886962890625 3 0.9457729879242676 5.27560393318709 2854.0 24.34294117647059 0.0 - - - - - - - 111.91666666666667 5 24 IRAK1 interleukin-1 receptor-associated kinase 1 597 77 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23173.[MT7]-EEIAVWTNLTEAR.2b3_1.heavy 838.442 / 516.279 8481.0 39.44900131225586 44 14 10 10 10 1.5981859083796486 52.68650926419163 0.0 3 0.9399846134085046 5.012273201320066 8481.0 30.31332482993197 0.0 - - - - - - - 219.69230769230768 16 13 PITX2;PITX3 paired-like homeodomain 2;paired-like homeodomain 3 599 77 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23173.[MT7]-EEIAVWTNLTEAR.2y8_1.heavy 838.442 / 990.5 7306.0 39.44900131225586 44 14 10 10 10 1.5981859083796486 52.68650926419163 0.0 3 0.9399846134085046 5.012273201320066 7306.0 56.389563492063495 0.0 - - - - - - - 203.0 14 12 PITX2;PITX3 paired-like homeodomain 2;paired-like homeodomain 3 601 77 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23173.[MT7]-EEIAVWTNLTEAR.2b4_1.heavy 838.442 / 587.316 10581.0 39.44900131225586 44 14 10 10 10 1.5981859083796486 52.68650926419163 0.0 3 0.9399846134085046 5.012273201320066 10581.0 19.96336186008146 1.0 - - - - - - - 239.07692307692307 22 13 PITX2;PITX3 paired-like homeodomain 2;paired-like homeodomain 3 603 77 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23173.[MT7]-EEIAVWTNLTEAR.2b5_1.heavy 838.442 / 686.384 10413.0 39.44900131225586 44 14 10 10 10 1.5981859083796486 52.68650926419163 0.0 3 0.9399846134085046 5.012273201320066 10413.0 123.68880952380952 0.0 - - - - - - - 192.0 20 14 PITX2;PITX3 paired-like homeodomain 2;paired-like homeodomain 3 605 78 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543746.[MT7]-ELLC[CAM]VSEK[MT7].2b3_1.heavy 633.354 / 500.32 4081.0 29.302449703216553 41 15 10 6 10 2.0675937580597052 38.52567226900306 0.03339958190917969 3 0.9534822837897061 5.699740724906224 4081.0 19.064450298623264 0.0 - - - - - - - 193.33333333333334 8 15 INPP1 inositol polyphosphate-1-phosphatase 607 78 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543746.[MT7]-ELLC[CAM]VSEK[MT7].2y5_1.heavy 633.354 / 766.389 6828.0 29.302449703216553 41 15 10 6 10 2.0675937580597052 38.52567226900306 0.03339958190917969 3 0.9534822837897061 5.699740724906224 6828.0 35.719535980485155 0.0 - - - - - - - 189.5 13 12 INPP1 inositol polyphosphate-1-phosphatase 609 78 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543746.[MT7]-ELLC[CAM]VSEK[MT7].2y3_1.heavy 633.354 / 507.289 4160.0 29.302449703216553 41 15 10 6 10 2.0675937580597052 38.52567226900306 0.03339958190917969 3 0.9534822837897061 5.699740724906224 4160.0 16.339702760084926 0.0 - - - - - - - 222.11111111111111 8 18 INPP1 inositol polyphosphate-1-phosphatase 611 78 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543746.[MT7]-ELLC[CAM]VSEK[MT7].2y6_1.heavy 633.354 / 879.473 3061.0 29.302449703216553 41 15 10 6 10 2.0675937580597052 38.52567226900306 0.03339958190917969 3 0.9534822837897061 5.699740724906224 3061.0 41.065292177037406 0.0 - - - - - - - 205.07692307692307 6 13 INPP1 inositol polyphosphate-1-phosphatase 613 79 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23174.[MT7]-EEIAVWTNLTEAR.3y7_1.heavy 559.297 / 804.421 20281.0 39.44900131225586 48 18 10 10 10 3.408737213335418 29.33637700459488 0.0 3 0.9861363712090851 10.46937817065438 20281.0 93.64962652052252 0.0 - - - - - - - 210.76923076923077 40 13 PITX2;PITX3 paired-like homeodomain 2;paired-like homeodomain 3 615 79 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23174.[MT7]-EEIAVWTNLTEAR.3b4_1.heavy 559.297 / 587.316 76719.0 39.44900131225586 48 18 10 10 10 3.408737213335418 29.33637700459488 0.0 3 0.9861363712090851 10.46937817065438 76719.0 200.1753991743554 0.0 - - - - - - - 783.5714285714286 153 7 PITX2;PITX3 paired-like homeodomain 2;paired-like homeodomain 3 617 79 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23174.[MT7]-EEIAVWTNLTEAR.3b5_1.heavy 559.297 / 686.384 49290.0 39.44900131225586 48 18 10 10 10 3.408737213335418 29.33637700459488 0.0 3 0.9861363712090851 10.46937817065438 49290.0 83.48985539939994 0.0 - - - - - - - 799.875 98 8 PITX2;PITX3 paired-like homeodomain 2;paired-like homeodomain 3 619 79 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23174.[MT7]-EEIAVWTNLTEAR.3b3_1.heavy 559.297 / 516.279 22276.0 39.44900131225586 48 18 10 10 10 3.408737213335418 29.33637700459488 0.0 3 0.9861363712090851 10.46937817065438 22276.0 17.132854939351162 1.0 - - - - - - - 789.5 45 8 PITX2;PITX3 paired-like homeodomain 2;paired-like homeodomain 3 621 80 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22790.[MT7]-K[MT7]VPDVK[MT7].2y4_1.heavy 559.369 / 602.363 2766.0 19.282100677490234 42 16 10 10 6 4.427061621074048 22.588346076768413 0.0 5 0.9674507654812737 6.821924217941445 2766.0 30.546260869565216 1.0 - - - - - - - 199.6 5 15 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 623 80 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22790.[MT7]-K[MT7]VPDVK[MT7].2y5_1.heavy 559.369 / 701.431 980.0 19.282100677490234 42 16 10 10 6 4.427061621074048 22.588346076768413 0.0 5 0.9674507654812737 6.821924217941445 980.0 3.5784850614610075 3.0 - - - - - - - 209.54545454545453 4 22 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 625 80 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22790.[MT7]-K[MT7]VPDVK[MT7].2b4_1.heavy 559.369 / 728.455 6684.0 19.282100677490234 42 16 10 10 6 4.427061621074048 22.588346076768413 0.0 5 0.9674507654812737 6.821924217941445 6684.0 53.131634480526486 0.0 - - - - - - - 220.1764705882353 13 17 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 627 80 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22790.[MT7]-K[MT7]VPDVK[MT7].2b5_1.heavy 559.369 / 827.523 230.0 19.282100677490234 42 16 10 10 6 4.427061621074048 22.588346076768413 0.0 5 0.9674507654812737 6.821924217941445 230.0 1.6226115928066793 23.0 - - - - - - - 0.0 0 0 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 629 81 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38514.[MT7]-FLQEFYQDDELGK[MT7]K[MT7].3y6_1.heavy 731.391 / 977.587 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 631 81 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38514.[MT7]-FLQEFYQDDELGK[MT7]K[MT7].3y3_1.heavy 731.391 / 620.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 633 81 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38514.[MT7]-FLQEFYQDDELGK[MT7]K[MT7].3b4_1.heavy 731.391 / 662.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 635 81 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38514.[MT7]-FLQEFYQDDELGK[MT7]K[MT7].3b3_1.heavy 731.391 / 533.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 637 82 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22795.[MT7]-QGDEEEK[MT7].2y4_1.heavy 561.779 / 678.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD1;SMAD5;SMAD9 SMAD family member 1;SMAD family member 5;SMAD family member 9 639 82 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22795.[MT7]-QGDEEEK[MT7].2b4_1.heavy 561.779 / 574.259 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD1;SMAD5;SMAD9 SMAD family member 1;SMAD family member 5;SMAD family member 9 641 82 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22795.[MT7]-QGDEEEK[MT7].2b6_1.heavy 561.779 / 832.344 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD1;SMAD5;SMAD9 SMAD family member 1;SMAD family member 5;SMAD family member 9 643 82 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22795.[MT7]-QGDEEEK[MT7].2y6_1.heavy 561.779 / 850.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD1;SMAD5;SMAD9 SMAD family member 1;SMAD family member 5;SMAD family member 9 645 83 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37925.[MT7]-LQEDC[CAM]K[MT7].2y4_1.heavy 540.784 / 695.315 1384.0 17.715200424194336 37 11 10 6 10 0.7463184177838034 72.74391551790428 0.033599853515625 3 0.8666162745719067 3.3408813037397835 1384.0 17.224417475728153 0.0 - - - - - - - 193.72222222222223 2 18 PLCD1 phospholipase C, delta 1 647 83 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37925.[MT7]-LQEDC[CAM]K[MT7].2y5_1.heavy 540.784 / 823.374 3333.0 17.715200424194336 37 11 10 6 10 0.7463184177838034 72.74391551790428 0.033599853515625 3 0.8666162745719067 3.3408813037397835 3333.0 22.522098214285712 0.0 - - - - - - - 121.36842105263158 6 19 PLCD1 phospholipase C, delta 1 649 83 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37925.[MT7]-LQEDC[CAM]K[MT7].2b4_1.heavy 540.784 / 630.321 3435.0 17.715200424194336 37 11 10 6 10 0.7463184177838034 72.74391551790428 0.033599853515625 3 0.8666162745719067 3.3408813037397835 3435.0 13.016547319790746 0.0 - - - - - - - 148.47368421052633 6 19 PLCD1 phospholipase C, delta 1 651 83 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37925.[MT7]-LQEDC[CAM]K[MT7].2y3_1.heavy 540.784 / 566.273 974.0 17.715200424194336 37 11 10 6 10 0.7463184177838034 72.74391551790428 0.033599853515625 3 0.8666162745719067 3.3408813037397835 974.0 5.44157844663553 0.0 - - - - - - - 0.0 1 0 PLCD1 phospholipase C, delta 1 653 84 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543650.[MT7]-SQLLSYIDR.2y8_1.heavy 619.847 / 1007.55 6734.0 35.97949981689453 50 20 10 10 10 7.243941713149989 13.804638960370035 0.0 3 0.9963977395821733 20.55627222664703 6734.0 46.264365530303024 0.0 - - - - - - - 209.8181818181818 13 11 MCM7 minichromosome maintenance complex component 7 655 84 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543650.[MT7]-SQLLSYIDR.2y5_1.heavy 619.847 / 653.325 7408.0 35.97949981689453 50 20 10 10 10 7.243941713149989 13.804638960370035 0.0 3 0.9963977395821733 20.55627222664703 7408.0 20.5421143847487 0.0 - - - - - - - 249.0 14 17 MCM7 minichromosome maintenance complex component 7 657 84 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543650.[MT7]-SQLLSYIDR.2y6_1.heavy 619.847 / 766.409 9813.0 35.97949981689453 50 20 10 10 10 7.243941713149989 13.804638960370035 0.0 3 0.9963977395821733 20.55627222664703 9813.0 54.67375608766234 0.0 - - - - - - - 233.5 19 14 MCM7 minichromosome maintenance complex component 7 659 84 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543650.[MT7]-SQLLSYIDR.2y7_1.heavy 619.847 / 879.493 5965.0 35.97949981689453 50 20 10 10 10 7.243941713149989 13.804638960370035 0.0 3 0.9963977395821733 20.55627222664703 5965.0 29.841633733725928 0.0 - - - - - - - 192.25 11 16 MCM7 minichromosome maintenance complex component 7 661 85 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37723.[MT7]-AAHAAK[MT7].2y4_1.heavy 428.766 / 570.348 742.0 12.271900177001953 50 20 10 10 10 8.040136904894773 12.437599158183584 0.0 3 0.9972392373795461 23.482691395525777 742.0 2.987272727272727 0.0 - - - - - - - 0.0 1 0 PIP4K2A;PIP4K2C;PIP4K2B phosphatidylinositol-5-phosphate 4-kinase, type II, alpha;phosphatidylinositol-5-phosphate 4-kinase, type II, gamma;phosphatidylinositol-5-phosphate 4-kinase, type II, beta 663 85 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37723.[MT7]-AAHAAK[MT7].2b3_1.heavy 428.766 / 424.242 N/A 12.271900177001953 50 20 10 10 10 8.040136904894773 12.437599158183584 0.0 3 0.9972392373795461 23.482691395525777 612.0 2.0324723247232472 1.0 - - - - - - - 228.1 2 20 PIP4K2A;PIP4K2C;PIP4K2B phosphatidylinositol-5-phosphate 4-kinase, type II, alpha;phosphatidylinositol-5-phosphate 4-kinase, type II, gamma;phosphatidylinositol-5-phosphate 4-kinase, type II, beta 665 85 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37723.[MT7]-AAHAAK[MT7].2y5_1.heavy 428.766 / 641.385 742.0 12.271900177001953 50 20 10 10 10 8.040136904894773 12.437599158183584 0.0 3 0.9972392373795461 23.482691395525777 742.0 19.433333333333334 0.0 - - - - - - - 0.0 1 0 PIP4K2A;PIP4K2C;PIP4K2B phosphatidylinositol-5-phosphate 4-kinase, type II, alpha;phosphatidylinositol-5-phosphate 4-kinase, type II, gamma;phosphatidylinositol-5-phosphate 4-kinase, type II, beta 667 85 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37723.[MT7]-AAHAAK[MT7].2y3_1.heavy 428.766 / 433.289 1364.0 12.271900177001953 50 20 10 10 10 8.040136904894773 12.437599158183584 0.0 3 0.9972392373795461 23.482691395525777 1364.0 73.656 0.0 - - - - - - - 54.11764705882353 2 17 PIP4K2A;PIP4K2C;PIP4K2B phosphatidylinositol-5-phosphate 4-kinase, type II, alpha;phosphatidylinositol-5-phosphate 4-kinase, type II, gamma;phosphatidylinositol-5-phosphate 4-kinase, type II, beta 669 86 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542097.[MT7]-QQEGESR.2y5_1.heavy 489.242 / 577.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA;LDHB lactate dehydrogenase A;lactate dehydrogenase B 671 86 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542097.[MT7]-QQEGESR.2b4_1.heavy 489.242 / 587.291 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA;LDHB lactate dehydrogenase A;lactate dehydrogenase B 673 86 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542097.[MT7]-QQEGESR.2y6_1.heavy 489.242 / 705.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA;LDHB lactate dehydrogenase A;lactate dehydrogenase B 675 86 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542097.[MT7]-QQEGESR.2b5_1.heavy 489.242 / 716.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA;LDHB lactate dehydrogenase A;lactate dehydrogenase B 677 87 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23258.[MT7]-LGLQDDEDLQALLK[MT7].3b6_1.heavy 620.35 / 786.411 2232.0 40.94889831542969 42 12 10 10 10 1.1954559690801945 54.39806855985721 0.0 3 0.891615750578674 3.7142947860347673 2232.0 8.952 0.0 - - - - - - - 243.86666666666667 4 15 PLCD1 phospholipase C, delta 1 679 87 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23258.[MT7]-LGLQDDEDLQALLK[MT7].3b4_1.heavy 620.35 / 556.357 3100.0 40.94889831542969 42 12 10 10 10 1.1954559690801945 54.39806855985721 0.0 3 0.891615750578674 3.7142947860347673 3100.0 9.571428571428573 0.0 - - - - - - - 668.2222222222222 6 9 PLCD1 phospholipase C, delta 1 681 87 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23258.[MT7]-LGLQDDEDLQALLK[MT7].3y4_1.heavy 620.35 / 588.42 7316.0 40.94889831542969 42 12 10 10 10 1.1954559690801945 54.39806855985721 0.0 3 0.891615750578674 3.7142947860347673 7316.0 38.40057142857143 0.0 - - - - - - - 314.7692307692308 14 13 PLCD1 phospholipase C, delta 1 683 87 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23258.[MT7]-LGLQDDEDLQALLK[MT7].3b8_1.heavy 620.35 / 1030.48 5084.0 40.94889831542969 42 12 10 10 10 1.1954559690801945 54.39806855985721 0.0 3 0.891615750578674 3.7142947860347673 5084.0 49.2 0.0 - - - - - - - 132.26666666666668 10 15 PLCD1 phospholipase C, delta 1 685 88 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38204.[MT7]-WEVIAEDGTK[MT7].2b3_1.heavy 718.387 / 559.3 2483.0 31.89995002746582 40 15 10 5 10 2.8240939758447596 35.40958652768891 0.0402984619140625 3 0.9548834176972736 5.788256570104931 2483.0 10.88899581589958 0.0 - - - - - - - 286.6363636363636 4 11 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 687 88 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38204.[MT7]-WEVIAEDGTK[MT7].2y5_1.heavy 718.387 / 693.354 1051.0 31.89995002746582 40 15 10 5 10 2.8240939758447596 35.40958652768891 0.0402984619140625 3 0.9548834176972736 5.788256570104931 1051.0 4.4571204188481675 3.0 - - - - - - - 212.61111111111111 4 18 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 689 88 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38204.[MT7]-WEVIAEDGTK[MT7].2y6_1.heavy 718.387 / 764.391 1910.0 31.89995002746582 40 15 10 5 10 2.8240939758447596 35.40958652768891 0.0402984619140625 3 0.9548834176972736 5.788256570104931 1910.0 32.62916666666666 0.0 - - - - - - - 216.73333333333332 3 15 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 691 88 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38204.[MT7]-WEVIAEDGTK[MT7].2y7_1.heavy 718.387 / 877.475 1528.0 31.89995002746582 40 15 10 5 10 2.8240939758447596 35.40958652768891 0.0402984619140625 3 0.9548834176972736 5.788256570104931 1528.0 20.444320557491288 0.0 - - - - - - - 185.375 3 16 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 693 89 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23065.[MT7]-YSLAPVAVELK[MT7].3y3_1.heavy 493.3 / 533.341 144023.0 36.58452606201172 43 17 10 6 10 6.076546059731198 16.45671719049285 0.0348968505859375 3 0.9723735740868921 7.4078994973085495 144023.0 313.8040450200432 0.0 - - - - - - - 264.5 288 6 PGK2 phosphoglycerate kinase 2 695 89 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23065.[MT7]-YSLAPVAVELK[MT7].3b4_1.heavy 493.3 / 579.326 256403.0 36.58452606201172 43 17 10 6 10 6.076546059731198 16.45671719049285 0.0348968505859375 3 0.9723735740868921 7.4078994973085495 256403.0 466.84735943149235 0.0 - - - - - - - 251.57142857142858 512 7 PGK2 phosphoglycerate kinase 2 697 89 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23065.[MT7]-YSLAPVAVELK[MT7].3y4_1.heavy 493.3 / 632.41 72188.0 36.58452606201172 43 17 10 6 10 6.076546059731198 16.45671719049285 0.0348968505859375 3 0.9723735740868921 7.4078994973085495 72188.0 237.7970444216744 0.0 - - - - - - - 283.2857142857143 144 14 PGK2 phosphoglycerate kinase 2 699 89 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23065.[MT7]-YSLAPVAVELK[MT7].3b3_1.heavy 493.3 / 508.289 55353.0 36.58452606201172 43 17 10 6 10 6.076546059731198 16.45671719049285 0.0348968505859375 3 0.9723735740868921 7.4078994973085495 55353.0 92.33926991199732 0.0 - - - - - - - 727.0 110 8 PGK2 phosphoglycerate kinase 2 701 90 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23355.[MT7]-LILC[CAM]PLMAAVTYIDEK[MT7].3y3_1.heavy 713.4 / 535.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 703 90 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23355.[MT7]-LILC[CAM]PLMAAVTYIDEK[MT7].3b6_1.heavy 713.4 / 854.529 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 705 90 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23355.[MT7]-LILC[CAM]PLMAAVTYIDEK[MT7].3b4_1.heavy 713.4 / 644.392 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 707 90 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23355.[MT7]-LILC[CAM]PLMAAVTYIDEK[MT7].3y4_1.heavy 713.4 / 648.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 709 91 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38104.[MT7]-NQQAELC[CAM]K[MT7].2b3_1.heavy 639.839 / 515.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - PITX2 paired-like homeodomain 2 711 91 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38104.[MT7]-NQQAELC[CAM]K[MT7].2y5_1.heavy 639.839 / 764.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - PITX2 paired-like homeodomain 2 713 91 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38104.[MT7]-NQQAELC[CAM]K[MT7].2y3_1.heavy 639.839 / 564.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - PITX2 paired-like homeodomain 2 715 91 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38104.[MT7]-NQQAELC[CAM]K[MT7].2b5_1.heavy 639.839 / 715.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - PITX2 paired-like homeodomain 2 717 92 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 494048.0 33.925498962402344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 494048.0 124.20879323182395 0.0 - - - - - - - 171.0 988 6 719 92 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 131602.0 33.925498962402344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 131602.0 148.63499263793054 0.0 - - - - - - - 285.0 263 6 721 92 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 195751.0 33.925498962402344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 195751.0 319.1954505892378 1.0 - - - - - - - 304.0 417 9 723 93 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542091.[MT7]-GQDPSGK[MT7].2b3_1.heavy 488.769 / 445.216 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 725 93 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542091.[MT7]-GQDPSGK[MT7].2y4_1.heavy 488.769 / 532.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 727 93 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542091.[MT7]-GQDPSGK[MT7].2y5_1.heavy 488.769 / 647.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 729 93 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542091.[MT7]-GQDPSGK[MT7].2y6_1.heavy 488.769 / 775.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 731 94 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38101.[MT7]-LNSSIVEPK[MT7].2b4_1.heavy 637.882 / 546.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 733 94 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38101.[MT7]-LNSSIVEPK[MT7].2b7_1.heavy 637.882 / 887.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 735 94 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38101.[MT7]-LNSSIVEPK[MT7].2b5_1.heavy 637.882 / 659.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 737 94 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38101.[MT7]-LNSSIVEPK[MT7].2y7_1.heavy 637.882 / 903.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 739 95 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23447.[MT7]-ITFPVDFVTGDK[MT7]FDENAQVGK[MT7].3y18_2.heavy 920.492 / 1127.58 3345.0 40.67947578430176 37 14 10 5 8 7.931028700749878 12.608704844372207 0.04450225830078125 4 0.932230268443617 4.713687245146568 3345.0 61.743324964131986 0.0 - - - - - - - 159.33333333333334 6 9 PGK2 phosphoglycerate kinase 2 741 95 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23447.[MT7]-ITFPVDFVTGDK[MT7]FDENAQVGK[MT7].3y10_2.heavy 920.492 / 712.393 1912.0 40.67947578430176 37 14 10 5 8 7.931028700749878 12.608704844372207 0.04450225830078125 4 0.932230268443617 4.713687245146568 1912.0 3.7091877496671106 0.0 - - - - - - - 246.0 3 15 PGK2 phosphoglycerate kinase 2 743 95 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23447.[MT7]-ITFPVDFVTGDK[MT7]FDENAQVGK[MT7].3b6_1.heavy 920.492 / 817.458 956.0 40.67947578430176 37 14 10 5 8 7.931028700749878 12.608704844372207 0.04450225830078125 4 0.932230268443617 4.713687245146568 956.0 2.6348292682926826 0.0 - - - - - - - 0.0 1 0 PGK2 phosphoglycerate kinase 2 745 95 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23447.[MT7]-ITFPVDFVTGDK[MT7]FDENAQVGK[MT7].3b3_1.heavy 920.492 / 506.31 4096.0 40.67947578430176 37 14 10 5 8 7.931028700749878 12.608704844372207 0.04450225830078125 4 0.932230268443617 4.713687245146568 4096.0 23.944382381845795 0.0 - - - - - - - 219.64285714285714 8 14 PGK2 phosphoglycerate kinase 2 747 96 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542261.[MT7]-ELPTLK[MT7].2y4_1.heavy 494.818 / 602.399 46093.0 28.702274322509766 44 18 10 6 10 2.890611608533187 34.594754862533755 0.03369903564453125 3 0.9897186732277872 12.160879677435815 46093.0 41.93810707022539 0.0 - - - - - - - 638.0 92 11 PIP4K2A;PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, alpha;phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 749 96 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542261.[MT7]-ELPTLK[MT7].2y5_1.heavy 494.818 / 715.483 15878.0 28.702274322509766 44 18 10 6 10 2.890611608533187 34.594754862533755 0.03369903564453125 3 0.9897186732277872 12.160879677435815 15878.0 31.114726364099944 0.0 - - - - - - - 741.3846153846154 31 13 PIP4K2A;PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, alpha;phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 751 96 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542261.[MT7]-ELPTLK[MT7].2b4_1.heavy 494.818 / 585.336 1542.0 28.702274322509766 44 18 10 6 10 2.890611608533187 34.594754862533755 0.03369903564453125 3 0.9897186732277872 12.160879677435815 1542.0 2.67012987012987 13.0 - - - - - - - 705.8461538461538 5 13 PIP4K2A;PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, alpha;phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 753 96 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542261.[MT7]-ELPTLK[MT7].2y3_1.heavy 494.818 / 505.347 6166.0 28.702274322509766 44 18 10 6 10 2.890611608533187 34.594754862533755 0.03369903564453125 3 0.9897186732277872 12.160879677435815 6166.0 7.789013323501463 0.0 - - - - - - - 646.6153846153846 12 13 PIP4K2A;PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, alpha;phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 755 97 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542463.[MT7]-FAVDFK[MT7].2y4_1.heavy 507.797 / 652.379 10030.0 33.1505012512207 44 14 10 10 10 2.572738382344515 38.86909010502298 0.0 3 0.9444575498979237 5.212174133671716 10030.0 16.27675438596491 0.0 - - - - - - - 1205.142857142857 20 7 INPP1 inositol polyphosphate-1-phosphatase 757 97 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542463.[MT7]-FAVDFK[MT7].2y5_1.heavy 507.797 / 723.416 26100.0 33.1505012512207 44 14 10 10 10 2.572738382344515 38.86909010502298 0.0 3 0.9444575498979237 5.212174133671716 26100.0 132.2171052631579 0.0 - - - - - - - 228.0 52 7 INPP1 inositol polyphosphate-1-phosphatase 759 97 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542463.[MT7]-FAVDFK[MT7].2b4_1.heavy 507.797 / 577.31 49124.0 33.1505012512207 44 14 10 10 10 2.572738382344515 38.86909010502298 0.0 3 0.9444575498979237 5.212174133671716 49124.0 82.05801002506266 0.0 - - - - - - - 250.8 98 5 INPP1 inositol polyphosphate-1-phosphatase 761 97 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542463.[MT7]-FAVDFK[MT7].2y3_1.heavy 507.797 / 553.31 19490.0 33.1505012512207 44 14 10 10 10 2.572738382344515 38.86909010502298 0.0 3 0.9444575498979237 5.212174133671716 19490.0 76.20150375939849 0.0 - - - - - - - 209.0 38 6 INPP1 inositol polyphosphate-1-phosphatase 763 98 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23446.[MT7]-ITFPVDFVTGDK[MT7]FDENAQVGK[MT7].4y4_1.heavy 690.621 / 575.363 4381.0 40.69060134887695 48 18 10 10 10 2.7798111693983567 32.15083973467862 0.0 3 0.9800053208094166 8.713223430834372 4381.0 9.588886827458257 0.0 - - - - - - - 279.9230769230769 8 13 PGK2 phosphoglycerate kinase 2 765 98 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23446.[MT7]-ITFPVDFVTGDK[MT7]FDENAQVGK[MT7].4y5_1.heavy 690.621 / 646.4 1752.0 40.69060134887695 48 18 10 10 10 2.7798111693983567 32.15083973467862 0.0 3 0.9800053208094166 8.713223430834372 1752.0 9.221620889211756 1.0 - - - - - - - 224.8 14 15 PGK2 phosphoglycerate kinase 2 767 98 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23446.[MT7]-ITFPVDFVTGDK[MT7]FDENAQVGK[MT7].4b3_1.heavy 690.621 / 506.31 13277.0 40.69060134887695 48 18 10 10 10 2.7798111693983567 32.15083973467862 0.0 3 0.9800053208094166 8.713223430834372 13277.0 26.93899997627045 0.0 - - - - - - - 719.0 26 9 PGK2 phosphoglycerate kinase 2 769 98 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23446.[MT7]-ITFPVDFVTGDK[MT7]FDENAQVGK[MT7].4b6_1.heavy 690.621 / 817.458 10514.0 40.69060134887695 48 18 10 10 10 2.7798111693983567 32.15083973467862 0.0 3 0.9800053208094166 8.713223430834372 10514.0 34.32534133550341 0.0 - - - - - - - 217.11111111111111 21 9 PGK2 phosphoglycerate kinase 2 771 99 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543715.[MT7]-VISGQQLPK[MT7].3b3_1.heavy 419.93 / 444.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCH1;PLCD1 phospholipase C, eta 1;phospholipase C, delta 1 773 100 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23441.[MT7]-GLVRQEEAEDPAC[CAM]IPIFWVSK[MT7].3y7_1.heavy 911.482 / 1020.6 2609.0 41.80630111694336 47 17 10 10 10 3.5457410022367624 22.24998951546477 0.0 3 0.9761555327847128 7.976305891852852 2609.0 24.05370731707317 0.0 - - - - - - - 147.77777777777777 5 18 PLK1 polo-like kinase 1 775 100 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23441.[MT7]-GLVRQEEAEDPAC[CAM]IPIFWVSK[MT7].3b10_2.heavy 911.482 / 636.321 3275.0 41.80630111694336 47 17 10 10 10 3.5457410022367624 22.24998951546477 0.0 3 0.9761555327847128 7.976305891852852 3275.0 11.037165042243485 0.0 - - - - - - - 214.28571428571428 6 21 PLK1 polo-like kinase 1 777 100 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23441.[MT7]-GLVRQEEAEDPAC[CAM]IPIFWVSK[MT7].3y5_1.heavy 911.482 / 810.463 1688.0 41.80630111694336 47 17 10 10 10 3.5457410022367624 22.24998951546477 0.0 3 0.9761555327847128 7.976305891852852 1688.0 6.237739439338945 0.0 - - - - - - - 220.1304347826087 3 23 PLK1 polo-like kinase 1 779 100 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23441.[MT7]-GLVRQEEAEDPAC[CAM]IPIFWVSK[MT7].3b12_2.heavy 911.482 / 720.366 1023.0 41.80630111694336 47 17 10 10 10 3.5457410022367624 22.24998951546477 0.0 3 0.9761555327847128 7.976305891852852 1023.0 2.4759157825778395 0.0 - - - - - - - 223.66666666666666 2 24 PLK1 polo-like kinase 1 781 101 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544909.[MT7]-LIAPVAEEEATVPNNK[MT7].3b6_1.heavy 661.705 / 709.473 19471.0 31.839500427246094 46 16 10 10 10 3.52449609288251 28.372850292540676 0.0 3 0.9637836001639761 6.465322988128477 19471.0 62.566869046341665 0.0 - - - - - - - 284.4 38 5 LDHB lactate dehydrogenase B 783 101 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544909.[MT7]-LIAPVAEEEATVPNNK[MT7].3b5_1.heavy 661.705 / 638.436 20455.0 31.839500427246094 46 16 10 10 10 3.52449609288251 28.372850292540676 0.0 3 0.9637836001639761 6.465322988128477 20455.0 43.143921627902984 0.0 - - - - - - - 765.5714285714286 40 7 LDHB lactate dehydrogenase B 785 101 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544909.[MT7]-LIAPVAEEEATVPNNK[MT7].3y4_1.heavy 661.705 / 616.354 100854.0 31.839500427246094 46 16 10 10 10 3.52449609288251 28.372850292540676 0.0 3 0.9637836001639761 6.465322988128477 100854.0 143.519151705845 0.0 - - - - - - - 672.0 201 7 LDHB lactate dehydrogenase B 787 101 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544909.[MT7]-LIAPVAEEEATVPNNK[MT7].3b7_1.heavy 661.705 / 838.516 13126.0 31.839500427246094 46 16 10 10 10 3.52449609288251 28.372850292540676 0.0 3 0.9637836001639761 6.465322988128477 13126.0 73.13954070772081 0.0 - - - - - - - 238.54545454545453 26 11 LDHB lactate dehydrogenase B 789 102 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23183.[MT7]-QFTYYPLVEDK[MT7].3y3_1.heavy 564.303 / 535.284 9249.0 35.837398529052734 43 17 10 6 10 2.0360725654762675 33.99726073614764 0.037200927734375 3 0.9705267663747206 7.170938429081836 9249.0 16.605426702590403 0.0 - - - - - - - 768.0 18 9 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 791 102 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23183.[MT7]-QFTYYPLVEDK[MT7].3b4_1.heavy 564.303 / 684.347 7789.0 35.837398529052734 43 17 10 6 10 2.0360725654762675 33.99726073614764 0.037200927734375 3 0.9705267663747206 7.170938429081836 7789.0 14.204255136986301 0.0 - - - - - - - 718.0 15 8 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 793 102 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23183.[MT7]-QFTYYPLVEDK[MT7].3b5_1.heavy 564.303 / 847.411 7010.0 35.837398529052734 43 17 10 6 10 2.0360725654762675 33.99726073614764 0.037200927734375 3 0.9705267663747206 7.170938429081836 7010.0 17.75619532502602 0.0 - - - - - - - 261.5625 14 16 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 795 102 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23183.[MT7]-QFTYYPLVEDK[MT7].3y4_1.heavy 564.303 / 634.353 7983.0 35.837398529052734 43 17 10 6 10 2.0360725654762675 33.99726073614764 0.037200927734375 3 0.9705267663747206 7.170938429081836 7983.0 6.1040610048839765 0.0 - - - - - - - 350.5 15 10 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 797 103 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23178.[MT7]-GTLAYLPEEYIK[MT7].2y3_1.heavy 842.974 / 567.362 778.0 37.949625968933105 40 14 10 6 10 3.582444939644527 27.913897264230567 0.034496307373046875 3 0.9378690261514399 4.925310719015381 778.0 1.7988439306358381 2.0 - - - - - - - 0.0 1 0 IRAK1 interleukin-1 receptor-associated kinase 1 799 103 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23178.[MT7]-GTLAYLPEEYIK[MT7].2y6_1.heavy 842.974 / 922.5 9163.0 37.949625968933105 40 14 10 6 10 3.582444939644527 27.913897264230567 0.034496307373046875 3 0.9378690261514399 4.925310719015381 9163.0 38.154645686148584 0.0 - - - - - - - 272.53846153846155 18 13 IRAK1 interleukin-1 receptor-associated kinase 1 801 103 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23178.[MT7]-GTLAYLPEEYIK[MT7].2b5_1.heavy 842.974 / 650.363 4063.0 37.949625968933105 40 14 10 6 10 3.582444939644527 27.913897264230567 0.034496307373046875 3 0.9378690261514399 4.925310719015381 4063.0 41.213224757293425 0.0 - - - - - - - 264.625 8 16 IRAK1 interleukin-1 receptor-associated kinase 1 803 103 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23178.[MT7]-GTLAYLPEEYIK[MT7].2y7_1.heavy 842.974 / 1035.58 1815.0 37.949625968933105 40 14 10 6 10 3.582444939644527 27.913897264230567 0.034496307373046875 3 0.9378690261514399 4.925310719015381 1815.0 12.300355250481697 0.0 - - - - - - - 216.0 3 20 IRAK1 interleukin-1 receptor-associated kinase 1 805 104 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37731.[MT7]-DLLSK[MT7].2b3_1.heavy 432.276 / 486.304 4506.0 25.68670082092285 38 17 9 10 2 5.820619380479411 17.180302208965873 0.0 15 0.978961299080446 8.493536155776724 4506.0 12.85302786377709 0.0 - - - - - - - 668.2 9 10 KIF3C;MAPK8;MAPK9;MAPK10;BLM;CAPRIN2;TTN;KIF3B kinesin family member 3C;mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10;Bloom syndrome, RecQ helicase-like;caprin family member 2;titin;kinesin family member 3B 807 104 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37731.[MT7]-DLLSK[MT7].2y4_1.heavy 432.276 / 604.415 N/A 25.68670082092285 38 17 9 10 2 5.820619380479411 17.180302208965873 0.0 15 0.978961299080446 8.493536155776724 5982.0 4.0131842691592725 2.0 - - - - - - - 711.0769230769231 18 13 KIF3C;MAPK8;MAPK9;MAPK10;BLM;CAPRIN2;TTN;KIF3B kinesin family member 3C;mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10;Bloom syndrome, RecQ helicase-like;caprin family member 2;titin;kinesin family member 3B 809 104 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37731.[MT7]-DLLSK[MT7].2y3_2.heavy 432.276 / 246.169 1398.0 25.68670082092285 38 17 9 10 2 5.820619380479411 17.180302208965873 0.0 15 0.978961299080446 8.493536155776724 1398.0 1.1261345233382516 22.0 - - - - - - - 1219.6 21 10 KIF3C;MAPK8;MAPK9;MAPK10;BLM;CAPRIN2;TTN;KIF3B kinesin family member 3C;mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10;Bloom syndrome, RecQ helicase-like;caprin family member 2;titin;kinesin family member 3B 811 104 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37731.[MT7]-DLLSK[MT7].2y3_1.heavy 432.276 / 491.331 6137.0 25.68670082092285 38 17 9 10 2 5.820619380479411 17.180302208965873 0.0 15 0.978961299080446 8.493536155776724 6137.0 8.855116091701458 1.0 - - - - - - - 737.9 18 10 KIF3C;MAPK8;MAPK9;MAPK10;BLM;CAPRIN2;TTN;KIF3B kinesin family member 3C;mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10;Bloom syndrome, RecQ helicase-like;caprin family member 2;titin;kinesin family member 3B 813 105 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544519.[MT7]-YSLAPVAVELK[MT7].2b3_1.heavy 739.447 / 508.289 9082.0 36.575801849365234 43 13 10 10 10 1.198510224654184 50.80362552663249 0.0 3 0.9222692728537344 4.397560924802281 9082.0 26.248554913294797 0.0 - - - - - - - 203.2941176470588 18 17 PGK2 phosphoglycerate kinase 2 815 105 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544519.[MT7]-YSLAPVAVELK[MT7].2b4_1.heavy 739.447 / 579.326 21969.0 36.575801849365234 43 13 10 10 10 1.198510224654184 50.80362552663249 0.0 3 0.9222692728537344 4.397560924802281 21969.0 59.762314498053556 0.0 - - - - - - - 277.7857142857143 43 14 PGK2 phosphoglycerate kinase 2 817 105 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544519.[MT7]-YSLAPVAVELK[MT7].2y3_1.heavy 739.447 / 533.341 3114.0 36.575801849365234 43 13 10 10 10 1.198510224654184 50.80362552663249 0.0 3 0.9222692728537344 4.397560924802281 3114.0 16.832432432432434 0.0 - - - - - - - 209.78571428571428 6 14 PGK2 phosphoglycerate kinase 2 819 105 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544519.[MT7]-YSLAPVAVELK[MT7].2y7_1.heavy 739.447 / 899.568 16434.0 36.575801849365234 43 13 10 10 10 1.198510224654184 50.80362552663249 0.0 3 0.9222692728537344 4.397560924802281 16434.0 62.98823331581713 0.0 - - - - - - - 704.1428571428571 32 7 PGK2 phosphoglycerate kinase 2 821 106 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38258.[MT7]-SRPQGLTEAEQR.3y6_1.heavy 505.938 / 733.347 18442.0 18.43199920654297 46 16 10 10 10 2.74093962055664 36.483839063806755 0.0 3 0.9688880320731675 6.9785656883224725 18442.0 101.50087036657791 0.0 - - - - - - - 147.64705882352942 36 17 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 823 106 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38258.[MT7]-SRPQGLTEAEQR.3y4_1.heavy 505.938 / 503.257 18613.0 18.43199920654297 46 16 10 10 10 2.74093962055664 36.483839063806755 0.0 3 0.9688880320731675 6.9785656883224725 18613.0 80.89141963615569 0.0 - - - - - - - 231.26315789473685 37 19 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 825 106 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38258.[MT7]-SRPQGLTEAEQR.3y5_1.heavy 505.938 / 632.3 11704.0 18.43199920654297 46 16 10 10 10 2.74093962055664 36.483839063806755 0.0 3 0.9688880320731675 6.9785656883224725 11704.0 141.57733333333334 0.0 - - - - - - - 177.44444444444446 23 18 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 827 106 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38258.[MT7]-SRPQGLTEAEQR.3b8_2.heavy 505.938 / 507.278 17585.0 18.43199920654297 46 16 10 10 10 2.74093962055664 36.483839063806755 0.0 3 0.9688880320731675 6.9785656883224725 17585.0 61.756684762156965 0.0 - - - - - - - 295.05555555555554 35 18 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 829 107 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544709.[MT7]-SQLLSYIDRLAPR.3y11_2.heavy 559.325 / 658.888 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 831 107 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544709.[MT7]-SQLLSYIDRLAPR.3b4_1.heavy 559.325 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 833 107 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544709.[MT7]-SQLLSYIDRLAPR.3b5_1.heavy 559.325 / 673.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 835 107 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544709.[MT7]-SQLLSYIDRLAPR.3y12_2.heavy 559.325 / 722.917 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 837 108 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37732.[MT7]-ADSVGK[MT7].2b3_1.heavy 432.755 / 418.205 N/A 15.11870002746582 43 15 10 10 8 2.139886376328788 39.24049681674755 0.0 4 0.9579896284864782 6.0000083548696255 1617.0 0.9226818830242511 14.0 - - - - - - - 1294.0 6 8 MCM7 minichromosome maintenance complex component 7 839 108 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37732.[MT7]-ADSVGK[MT7].2y4_1.heavy 432.755 / 534.337 7260.0 15.11870002746582 43 15 10 10 8 2.139886376328788 39.24049681674755 0.0 4 0.9579896284864782 6.0000083548696255 7260.0 107.45952380952382 0.0 - - - - - - - 176.69565217391303 14 23 MCM7 minichromosome maintenance complex component 7 841 108 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37732.[MT7]-ADSVGK[MT7].2y5_1.heavy 432.755 / 649.364 8231.0 15.11870002746582 43 15 10 10 8 2.139886376328788 39.24049681674755 0.0 4 0.9579896284864782 6.0000083548696255 8231.0 7.884222793885744 0.0 - - - - - - - 238.94117647058823 16 17 MCM7 minichromosome maintenance complex component 7 843 108 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37732.[MT7]-ADSVGK[MT7].2y3_1.heavy 432.755 / 447.305 2121.0 15.11870002746582 43 15 10 10 8 2.139886376328788 39.24049681674755 0.0 4 0.9579896284864782 6.0000083548696255 2121.0 8.042323728176651 2.0 - - - - - - - 278.5416666666667 4 24 MCM7 minichromosome maintenance complex component 7 845 109 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37733.[MT7]-EEPVVR.2b3_1.heavy 436.752 / 500.247 1044.0 18.592899322509766 38 14 10 6 8 0.6138575636040468 83.09922428455963 0.03840065002441406 4 0.9325232683277318 4.724028416408968 1044.0 2.025 4.0 - - - - - - - 262.5263157894737 2 19 PLK1 polo-like kinase 1 847 109 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37733.[MT7]-EEPVVR.2y4_1.heavy 436.752 / 470.309 6378.0 18.592899322509766 38 14 10 6 8 0.6138575636040468 83.09922428455963 0.03840065002441406 4 0.9325232683277318 4.724028416408968 6378.0 22.542931034482756 0.0 - - - - - - - 235.22222222222223 12 18 PLK1 polo-like kinase 1 849 109 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37733.[MT7]-EEPVVR.2b5_1.heavy 436.752 / 698.384 2145.0 18.592899322509766 38 14 10 6 8 0.6138575636040468 83.09922428455963 0.03840065002441406 4 0.9325232683277318 4.724028416408968 2145.0 7.044334975369459 0.0 - - - - - - - 183.1578947368421 4 19 PLK1 polo-like kinase 1 851 110 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545248.[MT7]-SSFTEYIESPDVENEVK[MT7].3b6_1.heavy 754.374 / 859.395 21060.0 34.97330093383789 50 20 10 10 10 12.811776737324307 7.805318657221984 0.0 3 0.9987172353047783 34.454220972338874 21060.0 55.622137169399934 0.0 - - - - - - - 653.7272727272727 42 11 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 853 110 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545248.[MT7]-SSFTEYIESPDVENEVK[MT7].3b5_1.heavy 754.374 / 696.332 25067.0 34.97330093383789 50 20 10 10 10 12.811776737324307 7.805318657221984 0.0 3 0.9987172353047783 34.454220972338874 25067.0 40.891162109536516 0.0 - - - - - - - 742.0 50 9 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 855 110 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545248.[MT7]-SSFTEYIESPDVENEVK[MT7].3y4_1.heavy 754.374 / 633.369 6986.0 34.97330093383789 50 20 10 10 10 12.811776737324307 7.805318657221984 0.0 3 0.9987172353047783 34.454220972338874 6986.0 17.10003695671417 0.0 - - - - - - - 298.8181818181818 13 11 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 857 110 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545248.[MT7]-SSFTEYIESPDVENEVK[MT7].3y8_1.heavy 754.374 / 1073.56 8219.0 34.97330093383789 50 20 10 10 10 12.811776737324307 7.805318657221984 0.0 3 0.9987172353047783 34.454220972338874 8219.0 48.875632532979026 0.0 - - - - - - - 230.91666666666666 16 12 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 859 111 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23039.[MT7]-WEVIAEDGTK[MT7].3b4_1.heavy 479.261 / 672.384 25141.0 31.92009925842285 50 20 10 10 10 28.432031025336016 3.5171599211779547 0.0 3 0.9983372755566194 30.2616103343244 25141.0 26.314444480908094 0.0 - - - - - - - 385.7142857142857 50 7 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 861 111 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23039.[MT7]-WEVIAEDGTK[MT7].3b5_1.heavy 479.261 / 743.421 13272.0 31.92009925842285 50 20 10 10 10 28.432031025336016 3.5171599211779547 0.0 3 0.9983372755566194 30.2616103343244 13272.0 55.67273583517292 0.0 - - - - - - - 245.45454545454547 26 11 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 863 111 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23039.[MT7]-WEVIAEDGTK[MT7].3y4_1.heavy 479.261 / 564.311 21041.0 31.92009925842285 50 20 10 10 10 28.432031025336016 3.5171599211779547 0.0 3 0.9983372755566194 30.2616103343244 21041.0 34.915391301714216 1.0 - - - - - - - 687.75 55 8 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 865 111 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23039.[MT7]-WEVIAEDGTK[MT7].3b3_1.heavy 479.261 / 559.3 71322.0 31.92009925842285 50 20 10 10 10 28.432031025336016 3.5171599211779547 0.0 3 0.9983372755566194 30.2616103343244 71322.0 240.47644341444573 0.0 - - - - - - - 354.85714285714283 142 7 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 867 112 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23385.[MT7]-AC[CAM]RQQEALFQLLIEEK[MT7].3y3_1.heavy 755.415 / 549.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 869 112 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23385.[MT7]-AC[CAM]RQQEALFQLLIEEK[MT7].3y4_1.heavy 755.415 / 662.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 871 112 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23385.[MT7]-AC[CAM]RQQEALFQLLIEEK[MT7].3y5_1.heavy 755.415 / 775.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 873 112 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23385.[MT7]-AC[CAM]RQQEALFQLLIEEK[MT7].3b8_2.heavy 755.415 / 551.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 875 113 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545246.[MT7]-RPLSLLYYDRDSNIVK[MT7].4y9_2.heavy 560.821 / 627.334 26133.0 33.10559844970703 44 14 10 10 10 2.2274149207014657 44.89509299349922 0.0 3 0.9439597182583858 5.188751643919471 26133.0 38.46455422383761 0.0 - - - - - - - 201.25 52 4 INHBC inhibin, beta C 877 113 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545246.[MT7]-RPLSLLYYDRDSNIVK[MT7].4y10_2.heavy 560.821 / 708.866 48927.0 33.10559844970703 44 14 10 10 10 2.2274149207014657 44.89509299349922 0.0 3 0.9439597182583858 5.188751643919471 48927.0 85.34204220870829 0.0 - - - - - - - 287.5 97 2 INHBC inhibin, beta C 879 113 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545246.[MT7]-RPLSLLYYDRDSNIVK[MT7].4b4_1.heavy 560.821 / 598.379 7713.0 33.10559844970703 44 14 10 10 10 2.2274149207014657 44.89509299349922 0.0 3 0.9439597182583858 5.188751643919471 7713.0 11.906475586824037 0.0 - - - - - - - 246.42857142857142 15 7 INHBC inhibin, beta C 881 113 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545246.[MT7]-RPLSLLYYDRDSNIVK[MT7].4b6_1.heavy 560.821 / 824.547 6447.0 33.10559844970703 44 14 10 10 10 2.2274149207014657 44.89509299349922 0.0 3 0.9439597182583858 5.188751643919471 6447.0 4.637796208530805 1.0 - - - - - - - 197.14285714285714 12 7 INHBC inhibin, beta C 883 114 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 262174.0 22.304100036621094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 262174.0 413.49435751665766 0.0 - - - - - - - 655.0 524 8 885 114 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 438782.0 22.304100036621094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 438782.0 787.0321789033405 0.0 - - - - - - - 223.22222222222223 877 18 887 114 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 1603720.0 22.304100036621094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1603720.0 4280.5719059281855 0.0 - - - - - - - 725.3636363636364 3207 11 889 115 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23033.[MT7]-GLENPLPERPR.3y3_1.heavy 474.604 / 428.273 N/A 25.823466618855793 45 20 10 5 10 3.855418097542705 25.937524146534496 0.04279899597167969 3 0.9908789757571153 12.91248739213597 6692.0 2.7894283542874514 2.0 - - - - - - - 484.0 19 1 PLK1 polo-like kinase 1 891 115 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23033.[MT7]-GLENPLPERPR.3y5_1.heavy 474.604 / 654.368 27815.0 25.823466618855793 45 20 10 5 10 3.855418097542705 25.937524146534496 0.04279899597167969 3 0.9908789757571153 12.91248739213597 27815.0 147.72244580932264 0.0 - - - - - - - 272.25 55 8 PLK1 polo-like kinase 1 893 115 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23033.[MT7]-GLENPLPERPR.3b3_1.heavy 474.604 / 444.258 12335.0 25.823466618855793 45 20 10 5 10 3.855418097542705 25.937524146534496 0.04279899597167969 3 0.9908789757571153 12.91248739213597 12335.0 10.910290134192653 0.0 - - - - - - - 833.0 24 3 PLK1 polo-like kinase 1 895 115 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23033.[MT7]-GLENPLPERPR.3y5_2.heavy 474.604 / 327.688 5724.0 25.823466618855793 45 20 10 5 10 3.855418097542705 25.937524146534496 0.04279899597167969 3 0.9908789757571153 12.91248739213597 5724.0 12.981533125378276 0.0 - - - - - - - 242.0 11 9 PLK1 polo-like kinase 1 897 116 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544911.[MT7]-QVVQGLLSETYLEAHR.3b6_1.heavy 663.029 / 769.469 14215.0 37.21780014038086 47 17 10 10 10 4.340074696950659 23.041078087955512 0.0 3 0.9790737367973902 8.516404071727003 14215.0 142.9812865497076 0.0 - - - - - - - 182.0625 28 16 MCM7 minichromosome maintenance complex component 7 899 116 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544911.[MT7]-QVVQGLLSETYLEAHR.3b5_1.heavy 663.029 / 656.385 20295.0 37.21780014038086 47 17 10 10 10 4.340074696950659 23.041078087955512 0.0 3 0.9790737367973902 8.516404071727003 20295.0 44.34084408196251 0.0 - - - - - - - 235.5625 40 16 MCM7 minichromosome maintenance complex component 7 901 116 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544911.[MT7]-QVVQGLLSETYLEAHR.3y5_1.heavy 663.029 / 625.342 11389.0 37.21780014038086 47 17 10 10 10 4.340074696950659 23.041078087955512 0.0 3 0.9790737367973902 8.516404071727003 11389.0 49.80612244897959 0.0 - - - - - - - 241.0 22 16 MCM7 minichromosome maintenance complex component 7 903 116 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544911.[MT7]-QVVQGLLSETYLEAHR.3y9_1.heavy 663.029 / 1105.53 8563.0 37.21780014038086 47 17 10 10 10 4.340074696950659 23.041078087955512 0.0 3 0.9790737367973902 8.516404071727003 8563.0 114.54877618821615 0.0 - - - - - - - 171.57142857142858 17 7 MCM7 minichromosome maintenance complex component 7 905 117 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38390.[MT7]-LGNLFLNEDLEVK[MT7].2y4_1.heavy 896.508 / 632.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 907 117 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38390.[MT7]-LGNLFLNEDLEVK[MT7].2b4_1.heavy 896.508 / 542.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 909 117 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38390.[MT7]-LGNLFLNEDLEVK[MT7].2b5_1.heavy 896.508 / 689.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 911 117 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38390.[MT7]-LGNLFLNEDLEVK[MT7].2b9_1.heavy 896.508 / 1160.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 913 118 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543431.[MT7]-ILFC[CAM]DVLR.2y5_1.heavy 590.337 / 662.329 4458.0 41.11240005493164 48 18 10 10 10 4.116872254073372 24.290284912546564 0.0 3 0.9882480462145813 11.373158602537627 4458.0 4.291696750902527 0.0 - - - - - - - 712.4285714285714 8 7 PLCD1 phospholipase C, delta 1 915 118 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543431.[MT7]-ILFC[CAM]DVLR.2y6_1.heavy 590.337 / 809.397 4987.0 41.11240005493164 48 18 10 10 10 4.116872254073372 24.290284912546564 0.0 3 0.9882480462145813 11.373158602537627 4987.0 20.2562472406181 0.0 - - - - - - - 201.66666666666666 9 12 PLCD1 phospholipase C, delta 1 917 118 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543431.[MT7]-ILFC[CAM]DVLR.2b5_1.heavy 590.337 / 793.404 3703.0 41.11240005493164 48 18 10 10 10 4.116872254073372 24.290284912546564 0.0 3 0.9882480462145813 11.373158602537627 3703.0 29.918278145695364 0.0 - - - - - - - 199.27272727272728 7 11 PLCD1 phospholipase C, delta 1 919 118 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543431.[MT7]-ILFC[CAM]DVLR.2y7_1.heavy 590.337 / 922.482 8539.0 41.11240005493164 48 18 10 10 10 4.116872254073372 24.290284912546564 0.0 3 0.9882480462145813 11.373158602537627 8539.0 131.5003023701638 0.0 - - - - - - - 129.85714285714286 17 7 PLCD1 phospholipase C, delta 1 921 119 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23240.[MT7]-SLEQNIQLPAALLSR.2y8_1.heavy 899.021 / 840.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 923 119 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23240.[MT7]-SLEQNIQLPAALLSR.2y9_1.heavy 899.021 / 968.589 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 925 119 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23240.[MT7]-SLEQNIQLPAALLSR.2b5_1.heavy 899.021 / 716.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 927 119 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23240.[MT7]-SLEQNIQLPAALLSR.2y7_1.heavy 899.021 / 727.446 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 929 120 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23187.[MT7]-ALLLLLVGGVDQSPR.2y8_1.heavy 848.018 / 815.401 13365.0 49.77790069580078 45 15 10 10 10 2.1725532562580416 37.78301697712756 0.0 3 0.9521438750955596 5.618834430339875 13365.0 133.41965020173137 0.0 - - - - - - - 98.29629629629629 26 27 MCM7 minichromosome maintenance complex component 7 931 120 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23187.[MT7]-ALLLLLVGGVDQSPR.2b4_1.heavy 848.018 / 555.399 12454.0 49.77790069580078 45 15 10 10 10 2.1725532562580416 37.78301697712756 0.0 3 0.9521438750955596 5.618834430339875 12454.0 116.49670059670059 0.0 - - - - - - - 118.36666666666666 24 30 MCM7 minichromosome maintenance complex component 7 933 120 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23187.[MT7]-ALLLLLVGGVDQSPR.2y10_1.heavy 848.018 / 1027.55 5616.0 49.77790069580078 45 15 10 10 10 2.1725532562580416 37.78301697712756 0.0 3 0.9521438750955596 5.618834430339875 5616.0 97.47067669172932 0.0 - - - - - - - 98.45454545454545 11 22 MCM7 minichromosome maintenance complex component 7 935 120 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23187.[MT7]-ALLLLLVGGVDQSPR.2y11_1.heavy 848.018 / 1140.64 4721.0 49.77790069580078 45 15 10 10 10 2.1725532562580416 37.78301697712756 0.0 3 0.9521438750955596 5.618834430339875 4721.0 54.93548766745962 1.0 - - - - - - - 90.4 9 20 MCM7 minichromosome maintenance complex component 7 937 121 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23186.[MT7]-ALLLLLVGGVDQSPR.3b4_1.heavy 565.681 / 555.399 61155.0 49.78450012207031 44 17 10 7 10 4.183763906287757 23.901922345501024 0.026397705078125 3 0.9759358667560716 7.939670511263975 61155.0 240.05181977492725 0.0 - - - - - - - 188.8181818181818 122 22 MCM7 minichromosome maintenance complex component 7 939 121 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23186.[MT7]-ALLLLLVGGVDQSPR.3b5_1.heavy 565.681 / 668.483 41732.0 49.78450012207031 44 17 10 7 10 4.183763906287757 23.901922345501024 0.026397705078125 3 0.9759358667560716 7.939670511263975 41732.0 414.70664579256356 0.0 - - - - - - - 158.1 83 20 MCM7 minichromosome maintenance complex component 7 941 121 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23186.[MT7]-ALLLLLVGGVDQSPR.3y8_1.heavy 565.681 / 815.401 59423.0 49.78450012207031 44 17 10 7 10 4.183763906287757 23.901922345501024 0.026397705078125 3 0.9759358667560716 7.939670511263975 59423.0 954.8085883222468 0.0 - - - - - - - 153.4090909090909 118 22 MCM7 minichromosome maintenance complex component 7 943 121 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23186.[MT7]-ALLLLLVGGVDQSPR.3y9_1.heavy 565.681 / 914.469 12399.0 49.78450012207031 44 17 10 7 10 4.183763906287757 23.901922345501024 0.026397705078125 3 0.9759358667560716 7.939670511263975 12399.0 201.64030303030304 0.0 - - - - - - - 134.04761904761904 24 21 MCM7 minichromosome maintenance complex component 7 945 122 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543017.[MT7]-ELYLQER.2y4_1.heavy 547.802 / 545.304 5109.0 27.723100662231445 50 20 10 10 10 17.394956283767563 5.748792832168077 0.0 3 0.9927904309260274 14.52601364022693 5109.0 12.481606717169043 1.0 - - - - - - - 729.8571428571429 13 7 PLCD1 phospholipase C, delta 1 947 122 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543017.[MT7]-ELYLQER.2b3_1.heavy 547.802 / 550.299 5987.0 27.723100662231445 50 20 10 10 10 17.394956283767563 5.748792832168077 0.0 3 0.9927904309260274 14.52601364022693 5987.0 11.554444709689397 0.0 - - - - - - - 297.45454545454544 11 11 PLCD1 phospholipase C, delta 1 949 122 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543017.[MT7]-ELYLQER.2y5_1.heavy 547.802 / 708.367 5827.0 27.723100662231445 50 20 10 10 10 17.394956283767563 5.748792832168077 0.0 3 0.9927904309260274 14.52601364022693 5827.0 28.668766691129516 0.0 - - - - - - - 234.375 11 16 PLCD1 phospholipase C, delta 1 951 122 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543017.[MT7]-ELYLQER.2y6_1.heavy 547.802 / 821.452 11894.0 27.723100662231445 50 20 10 10 10 17.394956283767563 5.748792832168077 0.0 3 0.9927904309260274 14.52601364022693 11894.0 34.112103571586594 0.0 - - - - - - - 313.0 23 13 PLCD1 phospholipase C, delta 1 953 123 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37947.[MT7]-GPLHLEHR.2y4_1.heavy 551.816 / 554.305 795.0 21.037799835205078 30 8 10 6 6 0.6862258751167665 80.26317749378453 0.032100677490234375 5 0.7574964208820282 2.4536253899344396 795.0 3.7411764705882358 3.0 - - - - - - - 0.0 1 0 PITX2 paired-like homeodomain 2 955 123 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37947.[MT7]-GPLHLEHR.2b4_1.heavy 551.816 / 549.326 5909.0 21.037799835205078 30 8 10 6 6 0.6862258751167665 80.26317749378453 0.032100677490234375 5 0.7574964208820282 2.4536253899344396 5909.0 19.07373334874644 0.0 - - - - - - - 300.8235294117647 11 17 PITX2 paired-like homeodomain 2 957 123 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37947.[MT7]-GPLHLEHR.2b6_1.heavy 551.816 / 791.453 682.0 21.037799835205078 30 8 10 6 6 0.6862258751167665 80.26317749378453 0.032100677490234375 5 0.7574964208820282 2.4536253899344396 682.0 12.781341589267287 2.0 - - - - - - - 189.46666666666667 2 15 PITX2 paired-like homeodomain 2 959 123 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37947.[MT7]-GPLHLEHR.2y7_1.heavy 551.816 / 901.5 N/A 21.037799835205078 30 8 10 6 6 0.6862258751167665 80.26317749378453 0.032100677490234375 5 0.7574964208820282 2.4536253899344396 57.0 0.2008810572687225 35.0 - - - - - - - 0.0 1 0 PITX2 paired-like homeodomain 2 961 124 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37744.[MT7]-GSADIK[MT7].2y4_1.heavy 439.763 / 590.363 1460.0 16.324699878692627 46 20 10 6 10 17.79203658128528 5.620492041095843 0.03479957580566406 3 0.9998124233719256 90.10859510470233 1460.0 18.971097867649593 0.0 - - - - - - - 161.72727272727272 2 22 INPP1 inositol polyphosphate-1-phosphatase 963 124 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37744.[MT7]-GSADIK[MT7].2b4_1.heavy 439.763 / 475.227 22036.0 16.324699878692627 46 20 10 6 10 17.79203658128528 5.620492041095843 0.03479957580566406 3 0.9998124233719256 90.10859510470233 22036.0 58.69911655851959 0.0 - - - - - - - 734.0 44 11 INPP1 inositol polyphosphate-1-phosphatase 965 124 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37744.[MT7]-GSADIK[MT7].2y3_1.heavy 439.763 / 519.326 2099.0 16.324699878692627 46 20 10 6 10 17.79203658128528 5.620492041095843 0.03479957580566406 3 0.9998124233719256 90.10859510470233 2099.0 8.838889016009581 0.0 - - - - - - - 210.2608695652174 4 23 INPP1 inositol polyphosphate-1-phosphatase 967 124 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37744.[MT7]-GSADIK[MT7].2b5_1.heavy 439.763 / 588.311 1825.0 16.324699878692627 46 20 10 6 10 17.79203658128528 5.620492041095843 0.03479957580566406 3 0.9998124233719256 90.10859510470233 1825.0 2.756192261346901 1.0 - - - - - - - 664.0 3 9 INPP1 inositol polyphosphate-1-phosphatase 969 125 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 590501.0 31.36910057067871 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 590501.0 1491.1608628693355 0.0 - - - - - - - 215.23529411764707 1181 17 971 125 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 617975.0 31.36910057067871 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 617975.0 2353.2936448770483 0.0 - - - - - - - 240.78571428571428 1235 14 973 125 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1136320.0 31.36910057067871 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1136320.0 1150.807473200563 0.0 - - - - - - - 708.9090909090909 2272 11 975 126 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544715.[MT7]-GTLAYLPEEYIK[MT7].3y6_1.heavy 562.318 / 922.5 17160.0 37.941001892089844 48 18 10 10 10 8.282233650691898 12.074037538369375 0.0 3 0.9870839547585617 10.847484365865972 17160.0 186.28421765635585 0.0 - - - - - - - 153.28571428571428 34 14 IRAK1 interleukin-1 receptor-associated kinase 1 977 126 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544715.[MT7]-GTLAYLPEEYIK[MT7].3y3_1.heavy 562.318 / 567.362 22136.0 37.941001892089844 48 18 10 10 10 8.282233650691898 12.074037538369375 0.0 3 0.9870839547585617 10.847484365865972 22136.0 28.85516138283485 0.0 - - - - - - - 674.0 44 7 IRAK1 interleukin-1 receptor-associated kinase 1 979 126 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544715.[MT7]-GTLAYLPEEYIK[MT7].3b5_1.heavy 562.318 / 650.363 59802.0 37.941001892089844 48 18 10 10 10 8.282233650691898 12.074037538369375 0.0 3 0.9870839547585617 10.847484365865972 59802.0 48.56661552316091 0.0 - - - - - - - 718.5 119 8 IRAK1 interleukin-1 receptor-associated kinase 1 981 126 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544715.[MT7]-GTLAYLPEEYIK[MT7].3y4_1.heavy 562.318 / 696.405 23080.0 37.941001892089844 48 18 10 10 10 8.282233650691898 12.074037538369375 0.0 3 0.9870839547585617 10.847484365865972 23080.0 57.143559493420256 0.0 - - - - - - - 686.5555555555555 46 9 IRAK1 interleukin-1 receptor-associated kinase 1 983 127 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23373.[MT7]-THFTSQQLQELEATFQR.3y7_1.heavy 736.71 / 864.457 10516.0 36.83649826049805 46 20 10 6 10 12.61655105167887 7.926096410214511 0.033599853515625 3 0.9939080561617909 15.80387925250883 10516.0 61.92791898419203 0.0 - - - - - - - 243.85714285714286 21 14 PITX1;PITX2;PITX3 paired-like homeodomain 1;paired-like homeodomain 2;paired-like homeodomain 3 985 127 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23373.[MT7]-THFTSQQLQELEATFQR.3y6_1.heavy 736.71 / 751.373 11285.0 36.83649826049805 46 20 10 6 10 12.61655105167887 7.926096410214511 0.033599853515625 3 0.9939080561617909 15.80387925250883 11285.0 40.43571428571428 0.0 - - - - - - - 272.1875 22 16 PITX1;PITX2;PITX3 paired-like homeodomain 1;paired-like homeodomain 2;paired-like homeodomain 3 987 127 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23373.[MT7]-THFTSQQLQELEATFQR.3y8_1.heavy 736.71 / 993.5 10259.0 36.83649826049805 46 20 10 6 10 12.61655105167887 7.926096410214511 0.033599853515625 3 0.9939080561617909 15.80387925250883 10259.0 84.86360288742691 0.0 - - - - - - - 186.27272727272728 20 11 PITX1;PITX2;PITX3 paired-like homeodomain 1;paired-like homeodomain 2;paired-like homeodomain 3 989 127 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23373.[MT7]-THFTSQQLQELEATFQR.3y9_1.heavy 736.71 / 1121.56 6497.0 36.83649826049805 46 20 10 6 10 12.61655105167887 7.926096410214511 0.033599853515625 3 0.9939080561617909 15.80387925250883 6497.0 131.46870588235294 0.0 - - - - - - - 170.6153846153846 12 13 PITX1;PITX2;PITX3 paired-like homeodomain 1;paired-like homeodomain 2;paired-like homeodomain 3 991 128 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544717.[MT7]-HRVIGSGC[CAM]NLDSAR.4y4_1.heavy 422.221 / 448.215 10861.0 18.92530059814453 45 15 10 10 10 2.600013246322558 38.461342511019645 0.0 3 0.95432504411192 5.75249501154396 10861.0 31.931125915391043 0.0 - - - - - - - 245.5 21 16 LDHB lactate dehydrogenase B 993 128 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544717.[MT7]-HRVIGSGC[CAM]NLDSAR.4b8_2.heavy 422.221 / 506.267 4391.0 18.92530059814453 45 15 10 10 10 2.600013246322558 38.461342511019645 0.0 3 0.95432504411192 5.75249501154396 4391.0 8.115894024956567 0.0 - - - - - - - 775.8571428571429 8 7 LDHB lactate dehydrogenase B 995 128 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544717.[MT7]-HRVIGSGC[CAM]NLDSAR.4b7_2.heavy 422.221 / 426.252 5835.0 18.92530059814453 45 15 10 10 10 2.600013246322558 38.461342511019645 0.0 3 0.95432504411192 5.75249501154396 5835.0 23.686633663366337 0.0 - - - - - - - 231.1 11 20 LDHB lactate dehydrogenase B 997 128 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544717.[MT7]-HRVIGSGC[CAM]NLDSAR.4b5_1.heavy 422.221 / 707.443 751.0 18.92530059814453 45 15 10 10 10 2.600013246322558 38.461342511019645 0.0 3 0.95432504411192 5.75249501154396 751.0 7.563140322902133 0.0 - - - - - - - 0.0 1 0 LDHB lactate dehydrogenase B 999 129 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37808.[MT7]-TEGLEK[MT7].2y4_1.heavy 482.781 / 590.363 3129.0 19.04400062561035 36 17 10 3 6 3.8853572807382055 19.504872352988798 0.07200050354003906 6 0.9723356189975255 7.402792338529432 3129.0 -0.5 1.0 - - - - - - - 746.8888888888889 6 9 PLCD1 phospholipase C, delta 1 1001 129 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37808.[MT7]-TEGLEK[MT7].2y5_1.heavy 482.781 / 719.406 4114.0 19.04400062561035 36 17 10 3 6 3.8853572807382055 19.504872352988798 0.07200050354003906 6 0.9723356189975255 7.402792338529432 4114.0 17.572189465706707 0.0 - - - - - - - 238.44444444444446 8 18 PLCD1 phospholipase C, delta 1 1003 129 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37808.[MT7]-TEGLEK[MT7].2b4_1.heavy 482.781 / 545.305 1159.0 19.04400062561035 36 17 10 3 6 3.8853572807382055 19.504872352988798 0.07200050354003906 6 0.9723356189975255 7.402792338529432 1159.0 2.953697318007663 9.0 - - - - - - - 269.7 2 20 PLCD1 phospholipase C, delta 1 1005 129 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37808.[MT7]-TEGLEK[MT7].2b5_1.heavy 482.781 / 674.348 1159.0 19.04400062561035 36 17 10 3 6 3.8853572807382055 19.504872352988798 0.07200050354003906 6 0.9723356189975255 7.402792338529432 1159.0 0.7270195627157652 5.0 - - - - - - - 761.2857142857143 4 7 PLCD1 phospholipase C, delta 1 1007 130 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23012.[MT7]-TRTEVFEISR.3b4_1.heavy 461.257 / 632.348 5210.0 27.472299575805664 45 15 10 10 10 2.8092289580944825 35.5969561369717 0.0 3 0.959832957535535 6.1370960912899495 5210.0 15.07414104882459 0.0 - - - - - - - 261.6875 10 16 PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 1009 130 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23012.[MT7]-TRTEVFEISR.3b5_1.heavy 461.257 / 731.417 4737.0 27.472299575805664 45 15 10 10 10 2.8092289580944825 35.5969561369717 0.0 3 0.959832957535535 6.1370960912899495 4737.0 27.78240506329114 0.0 - - - - - - - 184.33333333333334 9 15 PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 1011 130 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23012.[MT7]-TRTEVFEISR.3b7_1.heavy 461.257 / 1007.53 N/A 27.472299575805664 45 15 10 10 10 2.8092289580944825 35.5969561369717 0.0 3 0.959832957535535 6.1370960912899495 0.0 0.0 1.0 - - - - - - - 0.0 0 0 PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 1013 130 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23012.[MT7]-TRTEVFEISR.3y5_1.heavy 461.257 / 651.346 15473.0 27.472299575805664 45 15 10 10 10 2.8092289580944825 35.5969561369717 0.0 3 0.959832957535535 6.1370960912899495 15473.0 66.45275768535262 1.0 - - - - - - - 212.3125 30 16 PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 1015 131 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22947.[MT7]-K[MT7]FAVDFK[MT7].3y3_1.heavy 429.599 / 553.31 14178.0 29.269124507904053 43 17 10 6 10 25.092868438678668 3.98519604262771 0.03330039978027344 3 0.9797350081142598 8.654719521700219 14178.0 53.73285020804438 0.0 - - - - - - - 698.1428571428571 28 7 INPP1 inositol polyphosphate-1-phosphatase 1017 131 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22947.[MT7]-K[MT7]FAVDFK[MT7].3b5_1.heavy 429.599 / 849.507 80.0 29.269124507904053 43 17 10 6 10 25.092868438678668 3.98519604262771 0.03330039978027344 3 0.9797350081142598 8.654719521700219 80.0 -0.1766666666666667 14.0 - - - - - - - 0.0 0 0 INPP1 inositol polyphosphate-1-phosphatase 1019 131 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22947.[MT7]-K[MT7]FAVDFK[MT7].3b3_1.heavy 429.599 / 635.412 3044.0 29.269124507904053 43 17 10 6 10 25.092868438678668 3.98519604262771 0.03330039978027344 3 0.9797350081142598 8.654719521700219 3044.0 10.651031981279251 0.0 - - - - - - - 240.0 6 14 INPP1 inositol polyphosphate-1-phosphatase 1021 131 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22947.[MT7]-K[MT7]FAVDFK[MT7].3y4_1.heavy 429.599 / 652.379 5847.0 29.269124507904053 43 17 10 6 10 25.092868438678668 3.98519604262771 0.03330039978027344 3 0.9797350081142598 8.654719521700219 5847.0 56.6428125 0.0 - - - - - - - 172.30769230769232 11 13 INPP1 inositol polyphosphate-1-phosphatase 1023 132 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23119.[MT7]-ELNIQVDDSYAR.2b3_1.heavy 783.898 / 501.279 2464.0 30.750674724578857 41 15 10 6 10 2.1096896202930546 39.04964874312748 0.03510093688964844 3 0.9592835257596779 6.0952648952989295 2464.0 18.43089793084294 0.0 - - - - - - - 183.0 4 14 PLCD1 phospholipase C, delta 1 1025 132 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23119.[MT7]-ELNIQVDDSYAR.2y8_1.heavy 783.898 / 953.432 1516.0 30.750674724578857 41 15 10 6 10 2.1096896202930546 39.04964874312748 0.03510093688964844 3 0.9592835257596779 6.0952648952989295 1516.0 14.901527057079319 0.0 - - - - - - - 166.0 3 8 PLCD1 phospholipase C, delta 1 1027 132 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23119.[MT7]-ELNIQVDDSYAR.2y5_1.heavy 783.898 / 611.278 1327.0 30.750674724578857 41 15 10 6 10 2.1096896202930546 39.04964874312748 0.03510093688964844 3 0.9592835257596779 6.0952648952989295 1327.0 6.499554228579363 0.0 - - - - - - - 168.66666666666666 2 18 PLCD1 phospholipase C, delta 1 1029 132 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23119.[MT7]-ELNIQVDDSYAR.2b4_1.heavy 783.898 / 614.363 2369.0 30.750674724578857 41 15 10 6 10 2.1096896202930546 39.04964874312748 0.03510093688964844 3 0.9592835257596779 6.0952648952989295 2369.0 10.591566669144152 0.0 - - - - - - - 189.78947368421052 4 19 PLCD1 phospholipase C, delta 1 1031 133 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37861.[MT7]-DATYTSAR.2y5_1.heavy 514.76 / 597.299 1663.0 16.146499633789062 43 15 10 10 8 3.074430808003567 32.5263459303339 0.0 4 0.9554021124231136 5.822075226636843 1663.0 12.551136924342105 1.0 - - - - - - - 191.95 3 20 MCM7 minichromosome maintenance complex component 7 1033 133 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37861.[MT7]-DATYTSAR.2b4_1.heavy 514.76 / 595.284 682.0 16.146499633789062 43 15 10 10 8 3.074430808003567 32.5263459303339 0.0 4 0.9554021124231136 5.822075226636843 682.0 0.9 2.0 - - - - - - - 0.0 1 0 MCM7 minichromosome maintenance complex component 7 1035 133 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37861.[MT7]-DATYTSAR.2y6_1.heavy 514.76 / 698.347 2261.0 16.146499633789062 43 15 10 10 8 3.074430808003567 32.5263459303339 0.0 4 0.9554021124231136 5.822075226636843 2261.0 8.224308509905967 0.0 - - - - - - - 126.28 4 25 MCM7 minichromosome maintenance complex component 7 1037 133 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37861.[MT7]-DATYTSAR.2y7_1.heavy 514.76 / 769.384 3370.0 16.146499633789062 43 15 10 10 8 3.074430808003567 32.5263459303339 0.0 4 0.9554021124231136 5.822075226636843 3370.0 25.898560855263156 0.0 - - - - - - - 157.08 6 25 MCM7 minichromosome maintenance complex component 7 1039 134 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 354940.0 26.029499053955078 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 354940.0 896.7987647015432 0.0 - - - - - - - 1304.8333333333333 709 6 1041 134 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 435322.0 26.029499053955078 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 435322.0 1772.897934133227 0.0 - - - - - - - 1231.0 870 4 1043 134 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 534400.0 26.029499053955078 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 534400.0 1082.390145848967 0.0 - - - - - - - 1533.0 1068 1 1045 135 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37863.[MT7]-ALTEPEAR.2b4_1.heavy 515.786 / 559.321 28184.0 20.64579963684082 43 13 10 10 10 1.7298877917473947 57.80721759934959 0.0 3 0.9290007501622334 4.603962997428676 28184.0 105.50005648267009 0.0 - - - - - - - 691.1428571428571 56 7 PLK1 polo-like kinase 1 1047 135 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37863.[MT7]-ALTEPEAR.2b6_1.heavy 515.786 / 785.416 19701.0 20.64579963684082 43 13 10 10 10 1.7298877917473947 57.80721759934959 0.0 3 0.9290007501622334 4.603962997428676 19701.0 201.3303947368421 0.0 - - - - - - - 177.7058823529412 39 17 PLK1 polo-like kinase 1 1049 135 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37863.[MT7]-ALTEPEAR.2y6_1.heavy 515.786 / 702.342 18790.0 20.64579963684082 43 13 10 10 10 1.7298877917473947 57.80721759934959 0.0 3 0.9290007501622334 4.603962997428676 18790.0 103.01535087719297 0.0 - - - - - - - 244.28571428571428 37 14 PLK1 polo-like kinase 1 1051 135 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37863.[MT7]-ALTEPEAR.2y7_1.heavy 515.786 / 815.426 23288.0 20.64579963684082 43 13 10 10 10 1.7298877917473947 57.80721759934959 0.0 3 0.9290007501622334 4.603962997428676 23288.0 160.1351852474637 0.0 - - - - - - - 238.05882352941177 46 17 PLK1 polo-like kinase 1 1053 136 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23115.[MT7]-DVQPVAYEEPK[MT7].3y6_1.heavy 521.615 / 880.453 11158.0 24.82550048828125 46 16 10 10 10 9.558277292756326 10.462136317784408 0.0 3 0.9692750619910683 7.022610351115998 11158.0 85.64254385964912 0.0 - - - - - - - 191.8095238095238 22 21 SMAD5 SMAD family member 5 1055 136 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23115.[MT7]-DVQPVAYEEPK[MT7].3b6_1.heavy 521.615 / 754.422 23606.0 24.82550048828125 46 16 10 10 10 9.558277292756326 10.462136317784408 0.0 3 0.9692750619910683 7.022610351115998 23606.0 61.133302885753906 0.0 - - - - - - - 269.3636363636364 47 11 SMAD5 SMAD family member 5 1057 136 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23115.[MT7]-DVQPVAYEEPK[MT7].3b4_1.heavy 521.615 / 584.316 5845.0 24.82550048828125 46 16 10 10 10 9.558277292756326 10.462136317784408 0.0 3 0.9692750619910683 7.022610351115998 5845.0 3.58092885375494 0.0 - - - - - - - 255.14285714285714 11 14 SMAD5 SMAD family member 5 1059 136 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23115.[MT7]-DVQPVAYEEPK[MT7].3b5_1.heavy 521.615 / 683.385 16471.0 24.82550048828125 46 16 10 10 10 9.558277292756326 10.462136317784408 0.0 3 0.9692750619910683 7.022610351115998 16471.0 51.57456342668864 0.0 - - - - - - - 607.0 32 9 SMAD5 SMAD family member 5 1061 137 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38125.[MT7]-DC[CAM]VGAEVEK[MT7].2y8_1.heavy 647.831 / 1035.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1063 137 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38125.[MT7]-DC[CAM]VGAEVEK[MT7].2y5_1.heavy 647.831 / 719.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1065 137 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38125.[MT7]-DC[CAM]VGAEVEK[MT7].2b4_1.heavy 647.831 / 576.257 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1067 137 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38125.[MT7]-DC[CAM]VGAEVEK[MT7].2b5_1.heavy 647.831 / 647.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1069 138 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23116.[MT7]-ENADLEWTAVK[MT7].3b6_1.heavy 521.947 / 816.386 15106.0 32.38100051879883 42 12 10 10 10 1.4918243317833724 60.485516894630635 0.0 3 0.8885269397945431 3.661491120429902 15106.0 36.12717198544655 0.0 - - - - - - - 233.33333333333334 30 12 IRAK1 interleukin-1 receptor-associated kinase 1 1071 138 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23116.[MT7]-ENADLEWTAVK[MT7].3b4_1.heavy 521.947 / 574.259 19470.0 32.38100051879883 42 12 10 10 10 1.4918243317833724 60.485516894630635 0.0 3 0.8885269397945431 3.661491120429902 19470.0 29.66407766215048 0.0 - - - - - - - 298.6666666666667 38 6 IRAK1 interleukin-1 receptor-associated kinase 1 1073 138 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23116.[MT7]-ENADLEWTAVK[MT7].3b5_1.heavy 521.947 / 687.343 8952.0 32.38100051879883 42 12 10 10 10 1.4918243317833724 60.485516894630635 0.0 3 0.8885269397945431 3.661491120429902 8952.0 21.55375210556669 0.0 - - - - - - - 364.0 17 8 IRAK1 interleukin-1 receptor-associated kinase 1 1075 138 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23116.[MT7]-ENADLEWTAVK[MT7].3y4_1.heavy 521.947 / 562.368 17232.0 32.38100051879883 42 12 10 10 10 1.4918243317833724 60.485516894630635 0.0 3 0.8885269397945431 3.661491120429902 17232.0 14.841974743573326 0.0 - - - - - - - 336.0 34 2 IRAK1 interleukin-1 receptor-associated kinase 1 1077 139 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23110.[MT7]-LVDLPC[CAM]VIESLR.2y8_1.heavy 779.443 / 973.513 25105.0 46.36022472381592 36 10 10 6 10 0.6913416837625759 94.91038134698964 0.035701751708984375 3 0.8469004939944073 3.112950300747974 25105.0 207.0061403508772 0.0 - - - - - - - 194.33333333333334 50 15 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1079 139 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23110.[MT7]-LVDLPC[CAM]VIESLR.2b4_1.heavy 779.443 / 585.373 21504.0 46.36022472381592 36 10 10 6 10 0.6913416837625759 94.91038134698964 0.035701751708984375 3 0.8469004939944073 3.112950300747974 21504.0 131.24075315048185 0.0 - - - - - - - 224.93333333333334 43 15 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1081 139 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23110.[MT7]-LVDLPC[CAM]VIESLR.2y9_1.heavy 779.443 / 1086.6 10955.0 46.36022472381592 36 10 10 6 10 0.6913416837625759 94.91038134698964 0.035701751708984375 3 0.8469004939944073 3.112950300747974 10955.0 112.20816514711976 0.0 - - - - - - - 147.7058823529412 21 17 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1083 139 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23110.[MT7]-LVDLPC[CAM]VIESLR.2y10_1.heavy 779.443 / 1201.62 6923.0 46.36022472381592 36 10 10 6 10 0.6913416837625759 94.91038134698964 0.035701751708984375 3 0.8469004939944073 3.112950300747974 6923.0 201.56131042516017 0.0 - - - - - - - 94.6 13 15 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1085 140 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544624.[MT7]-LK[MT7]DDEVAQLK[MT7].3y3_1.heavy 530.986 / 532.357 12469.0 26.246999740600586 37 13 4 10 10 1.2890459093480613 50.25883385346746 0.0 3 0.9216814187188036 4.3808049803026785 12469.0 31.06025466589703 0.0 - - - - - - - 758.4285714285714 24 7 LDHB lactate dehydrogenase B 1087 140 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544624.[MT7]-LK[MT7]DDEVAQLK[MT7].3b4_1.heavy 530.986 / 760.444 4264.0 26.246999740600586 37 13 4 10 10 1.2890459093480613 50.25883385346746 0.0 3 0.9216814187188036 4.3808049803026785 4264.0 4.558809376710919 2.0 - - - - - - - 311.75 90 8 LDHB lactate dehydrogenase B 1089 140 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544624.[MT7]-LK[MT7]DDEVAQLK[MT7].3b5_1.heavy 530.986 / 889.487 10217.0 26.246999740600586 37 13 4 10 10 1.2890459093480613 50.25883385346746 0.0 3 0.9216814187188036 4.3808049803026785 10217.0 51.70585275974146 0.0 - - - - - - - 187.53333333333333 20 15 LDHB lactate dehydrogenase B 1091 140 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544624.[MT7]-LK[MT7]DDEVAQLK[MT7].3y4_1.heavy 530.986 / 603.395 25662.0 26.246999740600586 37 13 4 10 10 1.2890459093480613 50.25883385346746 0.0 3 0.9216814187188036 4.3808049803026785 25662.0 64.50944751381216 0.0 - - - - - - - 712.5714285714286 51 7 LDHB lactate dehydrogenase B 1093 141 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22806.[MT7]-ELEQEAK[MT7].2b3_1.heavy 567.816 / 516.279 2363.0 19.017200469970703 40 14 10 6 10 2.568643192709214 31.02859027161462 0.036800384521484375 3 0.9478452241471439 5.380336913224412 2363.0 4.316876400017708 0.0 - - - - - - - 230.66666666666666 4 18 MFAP1;NFKB2 microfibrillar-associated protein 1;nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1095 141 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22806.[MT7]-ELEQEAK[MT7].2y5_1.heavy 567.816 / 748.396 1556.0 19.017200469970703 40 14 10 6 10 2.568643192709214 31.02859027161462 0.036800384521484375 3 0.9478452241471439 5.380336913224412 1556.0 17.972048936570676 1.0 - - - - - - - 152.42857142857142 3 14 MFAP1;NFKB2 microfibrillar-associated protein 1;nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1097 141 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22806.[MT7]-ELEQEAK[MT7].2b4_1.heavy 567.816 / 644.337 634.0 19.017200469970703 40 14 10 6 10 2.568643192709214 31.02859027161462 0.036800384521484375 3 0.9478452241471439 5.380336913224412 634.0 4.75768492377188 3.0 - - - - - - - 0.0 1 0 MFAP1;NFKB2 microfibrillar-associated protein 1;nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1099 141 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22806.[MT7]-ELEQEAK[MT7].2y6_1.heavy 567.816 / 861.48 2824.0 19.017200469970703 40 14 10 6 10 2.568643192709214 31.02859027161462 0.036800384521484375 3 0.9478452241471439 5.380336913224412 2824.0 18.826666666666668 0.0 - - - - - - - 134.71428571428572 5 21 MFAP1;NFKB2 microfibrillar-associated protein 1;nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1101 142 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22558.[MT7]-LTINK[MT7].2b3_1.heavy 438.791 / 472.325 2072.0 25.005399703979492 36 18 8 6 4 3.404329949081502 29.3743560394257 0.03659820556640625 10 0.9887650244179633 11.632387361940824 2072.0 7.09104659396686 5.0 - - - - - - - 733.3333333333334 6 9 LCK;SOCS2 lymphocyte-specific protein tyrosine kinase;suppressor of cytokine signaling 2 1103 142 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22558.[MT7]-LTINK[MT7].2y4_1.heavy 438.791 / 619.39 7904.0 25.005399703979492 36 18 8 6 4 3.404329949081502 29.3743560394257 0.03659820556640625 10 0.9887650244179633 11.632387361940824 7904.0 18.697854579583723 3.0 - - - - - - - 684.3333333333334 19 12 LCK;SOCS2 lymphocyte-specific protein tyrosine kinase;suppressor of cytokine signaling 2 1105 142 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22558.[MT7]-LTINK[MT7].2y3_1.heavy 438.791 / 518.342 3069.0 25.005399703979492 36 18 8 6 4 3.404329949081502 29.3743560394257 0.03659820556640625 10 0.9887650244179633 11.632387361940824 3069.0 6.762228631739851 1.0 - - - - - - - 683.8181818181819 6 11 LCK;SOCS2 lymphocyte-specific protein tyrosine kinase;suppressor of cytokine signaling 2 1107 143 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38130.[MT7]-IHPVSTMVK[MT7].2y5_1.heavy 650.388 / 709.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHB lactate dehydrogenase B 1109 143 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38130.[MT7]-IHPVSTMVK[MT7].2y3_1.heavy 650.388 / 521.324 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHB lactate dehydrogenase B 1111 143 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38130.[MT7]-IHPVSTMVK[MT7].2y6_1.heavy 650.388 / 808.472 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHB lactate dehydrogenase B 1113 143 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38130.[MT7]-IHPVSTMVK[MT7].2y7_1.heavy 650.388 / 905.525 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHB lactate dehydrogenase B 1115 144 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23412.[MT7]-RLETFLSLLVQNLAPAETHT.3b9_1.heavy 799.78 / 1217.74 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 1117 144 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23412.[MT7]-RLETFLSLLVQNLAPAETHT.3y6_1.heavy 799.78 / 655.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 1119 144 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23412.[MT7]-RLETFLSLLVQNLAPAETHT.3b8_1.heavy 799.78 / 1104.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 1121 144 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23412.[MT7]-RLETFLSLLVQNLAPAETHT.3b7_1.heavy 799.78 / 991.569 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 1123 145 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38034.[MT7]-WVDYSDK[MT7].2y4_1.heavy 600.811 / 656.337 2721.0 28.157649993896484 41 15 10 6 10 1.4952442888290185 44.37472768008173 0.03459930419921875 3 0.9563899132994613 5.888135835907432 2721.0 18.597298283439756 0.0 - - - - - - - 215.88888888888889 5 18 PLK1 polo-like kinase 1 1125 145 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38034.[MT7]-WVDYSDK[MT7].2b3_1.heavy 600.811 / 545.284 3342.0 28.157649993896484 41 15 10 6 10 1.4952442888290185 44.37472768008173 0.03459930419921875 3 0.9563899132994613 5.888135835907432 3342.0 7.422842877499221 0.0 - - - - - - - 260.92857142857144 6 14 PLK1 polo-like kinase 1 1127 145 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38034.[MT7]-WVDYSDK[MT7].2y5_1.heavy 600.811 / 771.364 1555.0 28.157649993896484 41 15 10 6 10 1.4952442888290185 44.37472768008173 0.03459930419921875 3 0.9563899132994613 5.888135835907432 1555.0 7.02258064516129 0.0 - - - - - - - 177.57142857142858 3 14 PLK1 polo-like kinase 1 1129 145 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38034.[MT7]-WVDYSDK[MT7].2y6_1.heavy 600.811 / 870.432 2954.0 28.157649993896484 41 15 10 6 10 1.4952442888290185 44.37472768008173 0.03459930419921875 3 0.9563899132994613 5.888135835907432 2954.0 2.535622317596567 0.0 - - - - - - - 163.15 5 20 PLK1 polo-like kinase 1 1131 146 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38453.[MT7]-ANTAAGTTGGGSC[CAM]C[CAM]VPTAR.3b6_1.heavy 651.639 / 630.333 3886.0 19.449224948883057 46 20 10 6 10 9.65826236617746 10.35382931304422 0.03510093688964844 3 0.9902101555840641 12.462912068946409 3886.0 8.997142857142858 0.0 - - - - - - - 242.54545454545453 7 22 INHBC inhibin, beta C 1133 146 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38453.[MT7]-ANTAAGTTGGGSC[CAM]C[CAM]VPTAR.3y6_1.heavy 651.639 / 703.356 4350.0 19.449224948883057 46 20 10 6 10 9.65826236617746 10.35382931304422 0.03510093688964844 3 0.9902101555840641 12.462912068946409 4350.0 93.5 0.0 - - - - - - - 137.0909090909091 8 11 INHBC inhibin, beta C 1135 146 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38453.[MT7]-ANTAAGTTGGGSC[CAM]C[CAM]VPTAR.3y11_1.heavy 651.639 / 1121.48 1972.0 19.449224948883057 46 20 10 6 10 9.65826236617746 10.35382931304422 0.03510093688964844 3 0.9902101555840641 12.462912068946409 1972.0 59.16 0.0 - - - - - - - 161.11111111111111 3 9 INHBC inhibin, beta C 1137 146 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38453.[MT7]-ANTAAGTTGGGSC[CAM]C[CAM]VPTAR.3b5_1.heavy 651.639 / 573.311 5627.0 19.449224948883057 46 20 10 6 10 9.65826236617746 10.35382931304422 0.03510093688964844 3 0.9902101555840641 12.462912068946409 5627.0 63.25524137931035 0.0 - - - - - - - 182.28571428571428 11 14 INHBC inhibin, beta C 1139 147 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23418.[MT7]-QRTHFTSQQLQELEATFQR.4y5_1.heavy 623.825 / 622.331 5090.0 34.25360107421875 40 10 10 10 10 1.13373214016028 57.978496177743075 0.0 3 0.825267927549765 2.908301075995146 5090.0 8.619271629063777 0.0 - - - - - - - 261.8333333333333 10 12 PITX1;PITX2;PITX3 paired-like homeodomain 1;paired-like homeodomain 2;paired-like homeodomain 3 1141 147 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23418.[MT7]-QRTHFTSQQLQELEATFQR.4y7_1.heavy 623.825 / 864.457 3466.0 34.25360107421875 40 10 10 10 10 1.13373214016028 57.978496177743075 0.0 3 0.825267927549765 2.908301075995146 3466.0 44.37651305683564 0.0 - - - - - - - 216.5 6 12 PITX1;PITX2;PITX3 paired-like homeodomain 1;paired-like homeodomain 2;paired-like homeodomain 3 1143 147 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23418.[MT7]-QRTHFTSQQLQELEATFQR.4y6_1.heavy 623.825 / 751.373 4224.0 34.25360107421875 40 10 10 10 10 1.13373214016028 57.978496177743075 0.0 3 0.825267927549765 2.908301075995146 4224.0 17.852009237875286 0.0 - - - - - - - 236.45454545454547 8 11 PITX1;PITX2;PITX3 paired-like homeodomain 1;paired-like homeodomain 2;paired-like homeodomain 3 1145 147 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23418.[MT7]-QRTHFTSQQLQELEATFQR.4b9_2.heavy 623.825 / 629.824 15921.0 34.25360107421875 40 10 10 10 10 1.13373214016028 57.978496177743075 0.0 3 0.825267927549765 2.908301075995146 15921.0 35.6415592749461 0.0 - - - - - - - 252.88888888888889 31 9 PITX1;PITX2;PITX3 paired-like homeodomain 1;paired-like homeodomain 2;paired-like homeodomain 3 1147 148 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543213.[MT7]-LDILLGTAR.2y8_1.heavy 558.349 / 858.504 5903.0 39.071998596191406 46 20 10 6 10 5.941299010505458 16.83133601308049 0.037200927734375 3 0.9916670213941527 13.510150718332898 5903.0 36.35134840247263 0.0 - - - - - - - 197.45454545454547 11 11 IRAK1 interleukin-1 receptor-associated kinase 1 1149 148 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543213.[MT7]-LDILLGTAR.2b4_1.heavy 558.349 / 599.388 3212.0 39.071998596191406 46 20 10 6 10 5.941299010505458 16.83133601308049 0.037200927734375 3 0.9916670213941527 13.510150718332898 3212.0 9.851108502033894 0.0 - - - - - - - 266.64285714285717 6 14 IRAK1 interleukin-1 receptor-associated kinase 1 1151 148 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543213.[MT7]-LDILLGTAR.2y6_1.heavy 558.349 / 630.393 3820.0 39.071998596191406 46 20 10 6 10 5.941299010505458 16.83133601308049 0.037200927734375 3 0.9916670213941527 13.510150718332898 3820.0 16.13900814088719 0.0 - - - - - - - 296.5833333333333 7 12 IRAK1 interleukin-1 receptor-associated kinase 1 1153 148 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543213.[MT7]-LDILLGTAR.2y7_1.heavy 558.349 / 743.477 3993.0 39.071998596191406 46 20 10 6 10 5.941299010505458 16.83133601308049 0.037200927734375 3 0.9916670213941527 13.510150718332898 3993.0 17.8780045769969 0.0 - - - - - - - 268.9 7 10 IRAK1 interleukin-1 receptor-associated kinase 1 1155 149 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22555.[MT7]-ITLLK[MT7].2b3_1.heavy 438.312 / 472.325 1500.0 32.334800720214844 42 18 10 10 4 4.55074552987132 21.974421409326233 0.0 7 0.9893724834507421 11.960824017605287 1500.0 0.22283187995285048 6.0 - - - - - - - 707.2 9 10 PLK1 polo-like kinase 1 1157 149 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22555.[MT7]-ITLLK[MT7].2y4_1.heavy 438.312 / 618.431 9966.0 32.334800720214844 42 18 10 10 4 4.55074552987132 21.974421409326233 0.0 7 0.9893724834507421 11.960824017605287 9966.0 16.68978190669371 1.0 - - - - - - - 214.33333333333334 19 6 PLK1 polo-like kinase 1 1159 149 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22555.[MT7]-ITLLK[MT7].2y3_1.heavy 438.312 / 517.383 1607.0 32.334800720214844 42 18 10 10 4 4.55074552987132 21.974421409326233 0.0 7 0.9893724834507421 11.960824017605287 1607.0 2.9674404550186164 8.0 - - - - - - - 597.1428571428571 9 7 PLK1 polo-like kinase 1 1161 150 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23416.[MT7]-FDLLWLIQDRPDRDNDLR.4y5_1.heavy 611.826 / 632.3 1857.0 44.770999908447266 44 14 10 10 10 2.2528849921538288 34.11383380568041 0.0 3 0.9401992681489367 5.0213527648935905 1857.0 0.04048966883350652 1.0 - - - - - - - 196.56521739130434 8 23 MCM7 minichromosome maintenance complex component 7 1163 150 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23416.[MT7]-FDLLWLIQDRPDRDNDLR.4y4_1.heavy 611.826 / 517.273 2352.0 44.770999908447266 44 14 10 10 10 2.2528849921538288 34.11383380568041 0.0 3 0.9401992681489367 5.0213527648935905 2352.0 6.912143628958525 1.0 - - - - - - - 232.23076923076923 4 26 MCM7 minichromosome maintenance complex component 7 1165 150 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23416.[MT7]-FDLLWLIQDRPDRDNDLR.4b4_1.heavy 611.826 / 633.373 8791.0 44.770999908447266 44 14 10 10 10 2.2528849921538288 34.11383380568041 0.0 3 0.9401992681489367 5.0213527648935905 8791.0 47.626341137386724 0.0 - - - - - - - 252.45 17 20 MCM7 minichromosome maintenance complex component 7 1167 150 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23416.[MT7]-FDLLWLIQDRPDRDNDLR.4b3_1.heavy 611.826 / 520.289 7553.0 44.770999908447266 44 14 10 10 10 2.2528849921538288 34.11383380568041 0.0 3 0.9401992681489367 5.0213527648935905 7553.0 43.123347751710654 0.0 - - - - - - - 251.54166666666666 15 24 MCM7 minichromosome maintenance complex component 7 1169 151 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22553.[MT7]-DVPEDR.2y4_1.heavy 437.723 / 516.241 11538.0 15.727100372314453 43 13 10 10 10 1.8751589754209097 53.328811749176296 0.0 3 0.9220413101052899 4.391040780889044 11538.0 51.827540500736376 0.0 - - - - - - - 248.05882352941177 23 17 PLCD1 phospholipase C, delta 1 1171 151 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22553.[MT7]-DVPEDR.2y5_1.heavy 437.723 / 615.31 9453.0 15.727100372314453 43 13 10 10 10 1.8751589754209097 53.328811749176296 0.0 3 0.9220413101052899 4.391040780889044 9453.0 33.889592804776015 0.0 - - - - - - - 193.76470588235293 18 17 PLCD1 phospholipase C, delta 1 1173 151 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22553.[MT7]-DVPEDR.2b4_1.heavy 437.723 / 585.3 7756.0 15.727100372314453 43 13 10 10 10 1.8751589754209097 53.328811749176296 0.0 3 0.9220413101052899 4.391040780889044 7756.0 26.180892192370305 0.0 - - - - - - - 216.76190476190476 15 21 PLCD1 phospholipase C, delta 1 1175 151 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22553.[MT7]-DVPEDR.2b5_1.heavy 437.723 / 700.327 4993.0 15.727100372314453 43 13 10 10 10 1.8751589754209097 53.328811749176296 0.0 3 0.9220413101052899 4.391040780889044 4993.0 18.397415592291274 0.0 - - - - - - - 189.70833333333334 9 24 PLCD1 phospholipase C, delta 1 1177 152 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22952.[MT7]-QTTSPSGSLLR.2y8_1.heavy 645.86 / 816.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1179 152 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22952.[MT7]-QTTSPSGSLLR.2y9_1.heavy 645.86 / 917.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1181 152 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22952.[MT7]-QTTSPSGSLLR.2y10_1.heavy 645.86 / 1018.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1183 152 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22952.[MT7]-QTTSPSGSLLR.2y7_1.heavy 645.86 / 729.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1185 153 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23027.[MT7]-ALLDYGVTADAR.2y8_1.heavy 704.881 / 852.421 7715.0 33.33089828491211 46 16 10 10 10 2.780310477725383 28.429446765701833 0.0 3 0.9665254138062044 6.7264477236166895 7715.0 63.73260869565216 0.0 - - - - - - - 197.14285714285714 15 7 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1187 153 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23027.[MT7]-ALLDYGVTADAR.2y9_1.heavy 704.881 / 967.448 5412.0 33.33089828491211 46 16 10 10 10 2.780310477725383 28.429446765701833 0.0 3 0.9665254138062044 6.7264477236166895 5412.0 65.86168695652174 0.0 - - - - - - - 153.33333333333334 10 9 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1189 153 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23027.[MT7]-ALLDYGVTADAR.2b4_1.heavy 704.881 / 557.341 9097.0 33.33089828491211 46 16 10 10 10 2.780310477725383 28.429446765701833 0.0 3 0.9665254138062044 6.7264477236166895 9097.0 35.20765059157766 0.0 - - - - - - - 209.1818181818182 18 11 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1191 153 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23027.[MT7]-ALLDYGVTADAR.2y10_1.heavy 704.881 / 1080.53 4491.0 33.33089828491211 46 16 10 10 10 2.780310477725383 28.429446765701833 0.0 3 0.9665254138062044 6.7264477236166895 4491.0 23.431304347826085 0.0 - - - - - - - 164.28571428571428 8 7 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1193 154 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22957.[MT7]-DC[CAM]VGAEVEK[MT7].3b4_1.heavy 432.223 / 576.257 N/A 21.1919002532959 35 14 9 10 2 0.9993195954122468 63.25562419711815 0.0 14 0.9423192931354711 5.113722010640277 15143.0 9.451753224841834 2.0 - - - - - - - 770.0 37 9 PGK2 phosphoglycerate kinase 2 1195 154 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22957.[MT7]-DC[CAM]VGAEVEK[MT7].3b5_1.heavy 432.223 / 647.294 9835.0 21.1919002532959 35 14 9 10 2 0.9993195954122468 63.25562419711815 0.0 14 0.9423192931354711 5.113722010640277 9835.0 58.76924552429668 0.0 - - - - - - - 220.9047619047619 19 21 PGK2 phosphoglycerate kinase 2 1197 154 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22957.[MT7]-DC[CAM]VGAEVEK[MT7].3y4_1.heavy 432.223 / 648.369 3297.0 21.1919002532959 35 14 9 10 2 0.9993195954122468 63.25562419711815 0.0 14 0.9423192931354711 5.113722010640277 3297.0 20.32559139784946 1.0 - - - - - - - 193.5 22 26 PGK2 phosphoglycerate kinase 2 1199 154 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22957.[MT7]-DC[CAM]VGAEVEK[MT7].3y5_1.heavy 432.223 / 719.406 2626.0 21.1919002532959 35 14 9 10 2 0.9993195954122468 63.25562419711815 0.0 14 0.9423192931354711 5.113722010640277 2626.0 1.3393689577698455 13.0 - - - - - - - 1780.0 27 7 PGK2 phosphoglycerate kinase 2 1201 155 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38039.[MT7]-ALMDEIVK[MT7].2y5_1.heavy 603.854 / 747.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1203 155 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38039.[MT7]-ALMDEIVK[MT7].2b4_1.heavy 603.854 / 575.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1205 155 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38039.[MT7]-ALMDEIVK[MT7].2b5_1.heavy 603.854 / 704.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1207 155 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38039.[MT7]-ALMDEIVK[MT7].2y7_1.heavy 603.854 / 991.561 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1209 156 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23396.[MT7]-NIFGEESNEFTNDWGEK[MT7].3b6_1.heavy 768.693 / 834.411 5848.0 38.11705017089844 43 17 10 6 10 3.049804984301634 32.788981759402134 0.0337982177734375 3 0.9721884992135006 7.383094948227865 5848.0 17.97544653207638 0.0 - - - - - - - 266.72222222222223 11 18 INPP1 inositol polyphosphate-1-phosphatase 1211 156 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23396.[MT7]-NIFGEESNEFTNDWGEK[MT7].3b5_1.heavy 768.693 / 705.369 7419.0 38.11705017089844 43 17 10 6 10 3.049804984301634 32.788981759402134 0.0337982177734375 3 0.9721884992135006 7.383094948227865 7419.0 26.80223758174938 0.0 - - - - - - - 705.6666666666666 14 12 INPP1 inositol polyphosphate-1-phosphatase 1213 156 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23396.[MT7]-NIFGEESNEFTNDWGEK[MT7].3b3_1.heavy 768.693 / 519.305 8641.0 38.11705017089844 43 17 10 6 10 3.049804984301634 32.788981759402134 0.0337982177734375 3 0.9721884992135006 7.383094948227865 8641.0 12.867468499427263 0.0 - - - - - - - 720.25 17 12 INPP1 inositol polyphosphate-1-phosphatase 1215 156 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23396.[MT7]-NIFGEESNEFTNDWGEK[MT7].3y4_1.heavy 768.693 / 663.358 14838.0 38.11705017089844 43 17 10 6 10 3.049804984301634 32.788981759402134 0.0337982177734375 3 0.9721884992135006 7.383094948227865 14838.0 32.985143266475646 0.0 - - - - - - - 671.5384615384615 29 13 INPP1 inositol polyphosphate-1-phosphatase 1217 157 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38358.[MT7]-STPTGLFGYWGNK[MT7].3b6_1.heavy 572.638 / 701.395 40519.0 39.071998596191406 46 20 10 6 10 6.009337983750078 16.640768129602826 0.037200927734375 3 0.9921177884379546 13.891612047157842 40519.0 59.89722095950765 0.0 - - - - - - - 837.4285714285714 81 7 INPP5K inositol polyphosphate-5-phosphatase K 1219 157 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38358.[MT7]-STPTGLFGYWGNK[MT7].3b5_1.heavy 572.638 / 588.311 38191.0 39.071998596191406 46 20 10 6 10 6.009337983750078 16.640768129602826 0.037200927734375 3 0.9921177884379546 13.891612047157842 38191.0 121.77643130827046 0.0 - - - - - - - 291.0 76 8 INPP5K inositol polyphosphate-5-phosphatase K 1221 157 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38358.[MT7]-STPTGLFGYWGNK[MT7].3y4_1.heavy 572.638 / 648.359 43105.0 39.071998596191406 46 20 10 6 10 6.009337983750078 16.640768129602826 0.037200927734375 3 0.9921177884379546 13.891612047157842 43105.0 85.03528746706516 0.0 - - - - - - - 732.75 86 8 INPP5K inositol polyphosphate-5-phosphatase K 1223 157 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38358.[MT7]-STPTGLFGYWGNK[MT7].3b8_1.heavy 572.638 / 905.485 18621.0 39.071998596191406 46 20 10 6 10 6.009337983750078 16.640768129602826 0.037200927734375 3 0.9921177884379546 13.891612047157842 18621.0 231.64397604998263 0.0 - - - - - - - 209.21428571428572 37 14 INPP5K inositol polyphosphate-5-phosphatase K 1225 158 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 131248.0 35.84049860636393 23 -3 10 6 10 null 0.0 0.037200927734375 3 0.0 0.0 131248.0 143.1725395563367 0.0 - - - - - - - 251.88888888888889 262 9 1227 158 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 273354.0 35.84049860636393 23 -3 10 6 10 null 0.0 0.037200927734375 3 0.0 0.0 273354.0 244.2729054582452 0.0 - - - - - - - 220.33333333333334 546 12 1229 158 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 238323.0 35.84049860636393 23 -3 10 6 10 null 0.0 0.037200927734375 3 0.0 0.0 238323.0 189.9739728419352 0.0 - - - - - - - 204.33333333333334 476 12 1231 159 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23124.[MT7]-HINPVAASLIQK[MT7].3b6_1.heavy 526.99 / 776.453 6074.0 30.277000427246094 48 18 10 10 10 6.1712440739662 16.204188134748485 0.0 3 0.9869600651499852 10.795719592612933 6074.0 4.94404609475032 1.0 - - - - - - - 686.9166666666666 12 12 PLK1 polo-like kinase 1 1233 159 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23124.[MT7]-HINPVAASLIQK[MT7].3y3_1.heavy 526.99 / 532.357 36617.0 30.277000427246094 48 18 10 10 10 6.1712440739662 16.204188134748485 0.0 3 0.9869600651499852 10.795719592612933 36617.0 36.77777716794731 0.0 - - - - - - - 1667.888888888889 73 9 PLK1 polo-like kinase 1 1235 159 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23124.[MT7]-HINPVAASLIQK[MT7].3b5_1.heavy 526.99 / 705.416 8677.0 30.277000427246094 48 18 10 10 10 6.1712440739662 16.204188134748485 0.0 3 0.9869600651499852 10.795719592612933 8677.0 7.557726822589191 0.0 - - - - - - - 1127.857142857143 17 7 PLK1 polo-like kinase 1 1237 159 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23124.[MT7]-HINPVAASLIQK[MT7].3b3_1.heavy 526.99 / 509.295 N/A 30.277000427246094 48 18 10 10 10 6.1712440739662 16.204188134748485 0.0 3 0.9869600651499852 10.795719592612933 38265.0 21.59584826333446 0.0 - - - - - - - 2819.875 76 8 PLK1 polo-like kinase 1 1239 160 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22690.[MT7]-DYALEK[MT7].2y4_1.heavy 513.789 / 604.379 6290.0 24.03279972076416 46 20 10 6 10 8.599304943946098 11.628846825626283 0.033199310302734375 3 0.9970539443118838 22.731872677635042 6290.0 17.568669527896994 0.0 - - - - - - - 316.5882352941176 12 17 MCM7 minichromosome maintenance complex component 7 1241 160 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22690.[MT7]-DYALEK[MT7].2y5_1.heavy 513.789 / 767.442 9994.0 24.03279972076416 46 20 10 6 10 8.599304943946098 11.628846825626283 0.033199310302734375 3 0.9970539443118838 22.731872677635042 9994.0 58.609921408104796 0.0 - - - - - - - 275.77777777777777 19 18 MCM7 minichromosome maintenance complex component 7 1243 160 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22690.[MT7]-DYALEK[MT7].2b4_1.heavy 513.789 / 607.321 4822.0 24.03279972076416 46 20 10 6 10 8.599304943946098 11.628846825626283 0.033199310302734375 3 0.9970539443118838 22.731872677635042 4822.0 23.26301562956471 0.0 - - - - - - - 275.5882352941176 9 17 MCM7 minichromosome maintenance complex component 7 1245 160 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22690.[MT7]-DYALEK[MT7].2y3_1.heavy 513.789 / 533.341 6849.0 24.03279972076416 46 20 10 6 10 8.599304943946098 11.628846825626283 0.033199310302734375 3 0.9970539443118838 22.731872677635042 6849.0 16.291021373677395 0.0 - - - - - - - 706.7777777777778 13 9 MCM7 minichromosome maintenance complex component 7 1247 161 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22818.[MT7]-K[MT7]LTLDK[MT7].2y4_1.heavy 575.382 / 620.374 865.0 23.00362491607666 42 16 10 6 10 2.964817430175893 33.72888967199148 0.031299591064453125 3 0.961078012456742 6.235138008535181 865.0 3.6391585760517797 1.0 - - - - - - - 0.0 1 0 PGK2 phosphoglycerate kinase 2 1249 161 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22818.[MT7]-K[MT7]LTLDK[MT7].2y5_1.heavy 575.382 / 733.458 1422.0 23.00362491607666 42 16 10 6 10 2.964817430175893 33.72888967199148 0.031299591064453125 3 0.961078012456742 6.235138008535181 1422.0 14.128893689935184 0.0 - - - - - - - 167.41176470588235 2 17 PGK2 phosphoglycerate kinase 2 1251 161 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22818.[MT7]-K[MT7]LTLDK[MT7].2y3_1.heavy 575.382 / 519.326 494.0 23.00362491607666 42 16 10 6 10 2.964817430175893 33.72888967199148 0.031299591064453125 3 0.961078012456742 6.235138008535181 494.0 -0.2718244803695151 34.0 - - - - - - - 303.69565217391306 2 23 PGK2 phosphoglycerate kinase 2 1253 161 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22818.[MT7]-K[MT7]LTLDK[MT7].2b5_1.heavy 575.382 / 859.549 3152.0 23.00362491607666 42 16 10 6 10 2.964817430175893 33.72888967199148 0.031299591064453125 3 0.961078012456742 6.235138008535181 3152.0 27.329519641098585 0.0 - - - - - - - 156.21052631578948 6 19 PGK2 phosphoglycerate kinase 2 1255 162 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22817.[MT7]-GGVNIC[CAM]LK[MT7].2y5_1.heavy 574.839 / 791.457 774.0 30.74150021870931 27 12 10 3 2 1.7309432406598644 52.994127489242416 0.07139968872070312 11 0.8836590830723899 3.5825545308606435 774.0 3.0476724137931033 11.0 - - - - - - - 685.5714285714286 4 7 INPP5K inositol polyphosphate-5-phosphatase K 1257 162 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22817.[MT7]-GGVNIC[CAM]LK[MT7].2b6_1.heavy 574.839 / 745.378 851.0 30.74150021870931 27 12 10 3 2 1.7309432406598644 52.994127489242416 0.07139968872070312 11 0.8836590830723899 3.5825545308606435 851.0 2.456776263031275 10.0 - - - - - - - 294.6190476190476 4 21 INPP5K inositol polyphosphate-5-phosphatase K 1259 162 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22817.[MT7]-GGVNIC[CAM]LK[MT7].2y3_1.heavy 574.839 / 564.33 5029.0 30.74150021870931 27 12 10 3 2 1.7309432406598644 52.994127489242416 0.07139968872070312 11 0.8836590830723899 3.5825545308606435 5029.0 6.579568212868226 1.0 - - - - - - - 351.54545454545456 10 11 INPP5K inositol polyphosphate-5-phosphatase K 1261 162 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22817.[MT7]-GGVNIC[CAM]LK[MT7].2y7_1.heavy 574.839 / 947.546 N/A 30.74150021870931 27 12 10 3 2 1.7309432406598644 52.994127489242416 0.07139968872070312 11 0.8836590830723899 3.5825545308606435 0.0 0.0 33.0 - - - - - - - 0.0 0 0 INPP5K inositol polyphosphate-5-phosphatase K 1263 163 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22685.[MT7]-DVLFLK[MT7].2y4_1.heavy 511.828 / 664.451 17869.0 36.30839920043945 36 18 0 10 8 5.965099211258029 13.365549427773749 0.0 4 0.9831309018729407 9.488641262208867 17869.0 40.87022374395302 1.0 - - - - - - - 244.125 35 16 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 1265 163 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22685.[MT7]-DVLFLK[MT7].2y5_1.heavy 511.828 / 763.52 18064.0 36.30839920043945 36 18 0 10 8 5.965099211258029 13.365549427773749 0.0 4 0.9831309018729407 9.488641262208867 18064.0 199.19352291736368 0.0 - - - - - - - 293.0 36 19 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 1267 163 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22685.[MT7]-DVLFLK[MT7].2b4_1.heavy 511.828 / 619.357 15623.0 36.30839920043945 36 18 0 10 8 5.965099211258029 13.365549427773749 0.0 4 0.9831309018729407 9.488641262208867 15623.0 10.913238058304911 2.0 - - - - - - - 793.375 475 8 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 1269 163 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22685.[MT7]-DVLFLK[MT7].2y3_1.heavy 511.828 / 551.367 38765.0 36.30839920043945 36 18 0 10 8 5.965099211258029 13.365549427773749 0.0 4 0.9831309018729407 9.488641262208867 38765.0 26.749884419269545 1.0 - - - - - - - 664.1 148 10 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 1271 164 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38556.[MT7]-QRTHFTSQQLQELEATFQR.3b9_2.heavy 831.43 / 629.824 5393.0 34.25360107421875 38 8 10 10 10 0.649416481331266 79.7449985349215 0.0 3 0.7639598761958915 2.4884626505726555 5393.0 15.043677578802367 0.0 - - - - - - - 306.0833333333333 10 12 PITX1;PITX2;PITX3 paired-like homeodomain 1;paired-like homeodomain 2;paired-like homeodomain 3 1273 164 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38556.[MT7]-QRTHFTSQQLQELEATFQR.3b4_1.heavy 831.43 / 667.376 1033.0 34.25360107421875 38 8 10 10 10 0.649416481331266 79.7449985349215 0.0 3 0.7639598761958915 2.4884626505726555 1033.0 7.01426845298281 1.0 - - - - - - - 246.14285714285714 2 14 PITX1;PITX2;PITX3 paired-like homeodomain 1;paired-like homeodomain 2;paired-like homeodomain 3 1275 164 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38556.[MT7]-QRTHFTSQQLQELEATFQR.3y5_1.heavy 831.43 / 622.331 1836.0 34.25360107421875 38 8 10 10 10 0.649416481331266 79.7449985349215 0.0 3 0.7639598761958915 2.4884626505726555 1836.0 9.92720930232558 0.0 - - - - - - - 248.75 3 12 PITX1;PITX2;PITX3 paired-like homeodomain 1;paired-like homeodomain 2;paired-like homeodomain 3 1277 164 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38556.[MT7]-QRTHFTSQQLQELEATFQR.3y9_1.heavy 831.43 / 1121.56 1721.0 34.25360107421875 38 8 10 10 10 0.649416481331266 79.7449985349215 0.0 3 0.7639598761958915 2.4884626505726555 1721.0 14.291782608695652 0.0 - - - - - - - 213.42857142857142 3 14 PITX1;PITX2;PITX3 paired-like homeodomain 1;paired-like homeodomain 2;paired-like homeodomain 3 1279 165 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22687.[MT7]-SFDDLQR.2y4_1.heavy 512.763 / 531.289 15504.0 25.569400787353516 50 20 10 10 10 9.096580927298834 10.99314135708946 0.0 3 0.9977777124178946 26.174704051603737 15504.0 49.301400688863374 0.0 - - - - - - - 768.7142857142857 31 7 PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 1281 165 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22687.[MT7]-SFDDLQR.2b4_1.heavy 512.763 / 609.264 24501.0 25.569400787353516 50 20 10 10 10 9.096580927298834 10.99314135708946 0.0 3 0.9977777124178946 26.174704051603737 24501.0 70.59292548716519 0.0 - - - - - - - 241.0909090909091 49 11 PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 1283 165 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22687.[MT7]-SFDDLQR.2y6_1.heavy 512.763 / 793.384 10202.0 25.569400787353516 50 20 10 10 10 9.096580927298834 10.99314135708946 0.0 3 0.9977777124178946 26.174704051603737 10202.0 58.79657320872275 0.0 - - - - - - - 246.57142857142858 20 14 PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 1285 165 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22687.[MT7]-SFDDLQR.2b5_1.heavy 512.763 / 722.348 5623.0 25.569400787353516 50 20 10 10 10 9.096580927298834 10.99314135708946 0.0 3 0.9977777124178946 26.174704051603737 5623.0 28.98677310067564 1.0 - - - - - - - 267.8333333333333 11 12 PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 1287 166 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545197.[MT7]-SGDRPSYVELTFSQHVR.4y5_1.heavy 531.275 / 626.337 23351.0 30.634199142456055 44 16 10 10 8 3.5883329639955637 22.220200729771115 0.0 4 0.966941618298381 6.768895885827194 23351.0 41.14019030079804 0.0 - - - - - - - 724.2307692307693 46 13 PGF placental growth factor 1289 166 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545197.[MT7]-SGDRPSYVELTFSQHVR.4b8_2.heavy 531.275 / 503.757 11314.0 30.634199142456055 44 16 10 10 8 3.5883329639955637 22.220200729771115 0.0 4 0.966941618298381 6.768895885827194 11314.0 7.344723756906077 1.0 - - - - - - - 1747.0 26 10 PGF placental growth factor 1291 166 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545197.[MT7]-SGDRPSYVELTFSQHVR.4y6_1.heavy 531.275 / 773.405 9594.0 30.634199142456055 44 16 10 10 8 3.5883329639955637 22.220200729771115 0.0 4 0.966941618298381 6.768895885827194 9594.0 19.258674033149173 0.0 - - - - - - - 646.7142857142857 19 7 PGF placental growth factor 1293 166 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545197.[MT7]-SGDRPSYVELTFSQHVR.4b9_2.heavy 531.275 / 568.279 33308.0 30.634199142456055 44 16 10 10 8 3.5883329639955637 22.220200729771115 0.0 4 0.966941618298381 6.768895885827194 33308.0 37.361020292249705 0.0 - - - - - - - 704.1111111111111 66 9 PGF placental growth factor 1295 167 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22541.[MT7]-FLASK[MT7].2b3_1.heavy 427.273 / 476.299 3148.0 25.894699096679688 34 8 10 10 6 1.0823952114927615 55.03797190011762 0.0 5 0.795654796619055 2.682198142213299 3148.0 3.5861110990494964 3.0 - - - - - - - 282.4 8 10 RICTOR;SDF4;NUP107 RPTOR independent companion of MTOR, complex 2;stromal cell derived factor 4;nucleoporin 107kDa 1297 167 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22541.[MT7]-FLASK[MT7].2y4_1.heavy 427.273 / 562.368 48267.0 25.894699096679688 34 8 10 10 6 1.0823952114927615 55.03797190011762 0.0 5 0.795654796619055 2.682198142213299 48267.0 5.437210825550931 0.0 - - - - - - - 376.6666666666667 96 3 RICTOR;SDF4;NUP107 RPTOR independent companion of MTOR, complex 2;stromal cell derived factor 4;nucleoporin 107kDa 1299 167 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22541.[MT7]-FLASK[MT7].2y3_1.heavy 427.273 / 449.284 8152.0 25.894699096679688 34 8 10 10 6 1.0823952114927615 55.03797190011762 0.0 5 0.795654796619055 2.682198142213299 8152.0 20.160892269436115 0.0 - - - - - - - 784.1428571428571 16 7 RICTOR;SDF4;NUP107 RPTOR independent companion of MTOR, complex 2;stromal cell derived factor 4;nucleoporin 107kDa 1301 168 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38460.[MT7]-LILYNDGDSLQYIER.3y6_1.heavy 652.678 / 821.452 1744.0 38.97869873046875 44 14 10 10 10 1.7303840735094027 45.66907718380517 0.0 3 0.9387849171858045 4.9624073320559825 1744.0 10.017239181556448 0.0 - - - - - - - 210.66666666666666 3 12 PLK1 polo-like kinase 1 1303 168 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38460.[MT7]-LILYNDGDSLQYIER.3b4_1.heavy 652.678 / 647.425 4186.0 38.97869873046875 44 14 10 10 10 1.7303840735094027 45.66907718380517 0.0 3 0.9387849171858045 4.9624073320559825 4186.0 8.99570200573066 0.0 - - - - - - - 225.33333333333334 8 12 PLK1 polo-like kinase 1 1305 168 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38460.[MT7]-LILYNDGDSLQYIER.3y4_1.heavy 652.678 / 580.309 10901.0 38.97869873046875 44 14 10 10 10 1.7303840735094027 45.66907718380517 0.0 3 0.9387849171858045 4.9624073320559825 10901.0 44.741307489089664 0.0 - - - - - - - 270.2 21 10 PLK1 polo-like kinase 1 1307 168 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38460.[MT7]-LILYNDGDSLQYIER.3y5_1.heavy 652.678 / 708.367 7587.0 38.97869873046875 44 14 10 10 10 1.7303840735094027 45.66907718380517 0.0 3 0.9387849171858045 4.9624073320559825 7587.0 16.731890630609072 0.0 - - - - - - - 747.4285714285714 15 7 PLK1 polo-like kinase 1 1309 169 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544399.[MT7]-NEDVGAEDPSK[MT7].3b6_1.heavy 483.575 / 730.349 7279.0 17.53179931640625 47 17 10 10 10 3.520736461574801 28.403148344500256 0.0 3 0.9786729189126038 8.435712521079713 7279.0 20.270595794392523 0.0 - - - - - - - 233.1764705882353 14 17 PITX2 paired-like homeodomain 2 1311 169 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544399.[MT7]-NEDVGAEDPSK[MT7].3b4_1.heavy 483.575 / 602.29 5031.0 17.53179931640625 47 17 10 10 10 3.520736461574801 28.403148344500256 0.0 3 0.9786729189126038 8.435712521079713 5031.0 27.366132336448594 0.0 - - - - - - - 242.42105263157896 10 19 PITX2 paired-like homeodomain 2 1313 169 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544399.[MT7]-NEDVGAEDPSK[MT7].3b5_1.heavy 483.575 / 659.312 10008.0 17.53179931640625 47 17 10 10 10 3.520736461574801 28.403148344500256 0.0 3 0.9786729189126038 8.435712521079713 10008.0 20.175137550171385 0.0 - - - - - - - 642.1428571428571 20 7 PITX2 paired-like homeodomain 2 1315 169 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544399.[MT7]-NEDVGAEDPSK[MT7].3b3_1.heavy 483.575 / 503.222 12524.0 17.53179931640625 47 17 10 10 10 3.520736461574801 28.403148344500256 0.0 3 0.9786729189126038 8.435712521079713 12524.0 27.21336448598131 0.0 - - - - - - - 717.9166666666666 25 12 PITX2 paired-like homeodomain 2 1317 170 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544730.[MT7]-RVESPVLPPVLVPR.3y7_1.heavy 568.021 / 777.498 73157.0 36.30839920043945 50 20 10 10 10 13.077491597025201 7.646726381590447 0.0 3 0.9938984264577797 15.791390526471098 73157.0 290.1860454445744 0.0 - - - - - - - 263.375 146 8 SMAD1;SMAD5 SMAD family member 1;SMAD family member 5 1319 170 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544730.[MT7]-RVESPVLPPVLVPR.3b6_1.heavy 568.021 / 812.475 44000.0 36.30839920043945 50 20 10 10 10 13.077491597025201 7.646726381590447 0.0 3 0.9938984264577797 15.791390526471098 44000.0 289.1851418543434 0.0 - - - - - - - 263.4 88 10 SMAD1;SMAD5 SMAD family member 1;SMAD family member 5 1321 170 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544730.[MT7]-RVESPVLPPVLVPR.3y6_1.heavy 568.021 / 680.445 80271.0 36.30839920043945 50 20 10 10 10 13.077491597025201 7.646726381590447 0.0 3 0.9938984264577797 15.791390526471098 80271.0 110.55407734184345 0.0 - - - - - - - 363.7142857142857 160 7 SMAD1;SMAD5 SMAD family member 1;SMAD family member 5 1323 170 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544730.[MT7]-RVESPVLPPVLVPR.3b7_1.heavy 568.021 / 925.559 42595.0 36.30839920043945 50 20 10 10 10 13.077491597025201 7.646726381590447 0.0 3 0.9938984264577797 15.791390526471098 42595.0 402.6795549602489 0.0 - - - - - - - 272.1 85 10 SMAD1;SMAD5 SMAD family member 1;SMAD family member 5 1325 171 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37707.[MT7]-ETYLR.2b3_1.heavy 413.233 / 538.263 7517.0 22.08139991760254 46 18 10 10 8 5.142046202624689 19.447510982876103 0.0 4 0.9858380807820604 10.358275086862252 7517.0 19.705307600375605 1.0 - - - - - - - 658.1428571428571 15 14 PLK1 polo-like kinase 1 1327 171 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37707.[MT7]-ETYLR.2y4_1.heavy 413.233 / 552.314 10795.0 22.08139991760254 46 18 10 10 8 5.142046202624689 19.447510982876103 0.0 4 0.9858380807820604 10.358275086862252 10795.0 39.00365602931974 0.0 - - - - - - - 239.22727272727272 21 22 PLK1 polo-like kinase 1 1329 171 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37707.[MT7]-ETYLR.2y3_1.heavy 413.233 / 451.266 1865.0 22.08139991760254 46 18 10 10 8 5.142046202624689 19.447510982876103 0.0 4 0.9858380807820604 10.358275086862252 1865.0 13.827593016004988 1.0 - - - - - - - 613.7142857142857 3 7 PLK1 polo-like kinase 1 1331 172 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543359.[MT7]-EREVVNK[MT7].2y4_1.heavy 581.345 / 603.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 1333 172 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543359.[MT7]-EREVVNK[MT7].2y5_1.heavy 581.345 / 732.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 1335 172 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543359.[MT7]-EREVVNK[MT7].2b6_1.heavy 581.345 / 871.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 1337 172 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543359.[MT7]-EREVVNK[MT7].2y3_1.heavy 581.345 / 504.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 1339 173 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22961.[MT7]-C[CAM]YGGLWEK[MT7].3y3_1.heavy 434.225 / 606.337 3907.0 31.51205015182495 46 20 10 6 10 12.481360453795004 8.011947124689812 0.03740119934082031 3 0.9940408638260179 15.97919183276295 3907.0 14.540618662923528 0.0 - - - - - - - 191.91666666666666 7 12 INPP5K inositol polyphosphate-5-phosphatase K 1341 173 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22961.[MT7]-C[CAM]YGGLWEK[MT7].3b4_1.heavy 434.225 / 582.246 9417.0 31.51205015182495 46 20 10 6 10 12.481360453795004 8.011947124689812 0.03740119934082031 3 0.9940408638260179 15.97919183276295 9417.0 52.500705379408615 0.0 - - - - - - - 250.5 18 12 INPP5K inositol polyphosphate-5-phosphatase K 1343 173 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22961.[MT7]-C[CAM]YGGLWEK[MT7].3b5_1.heavy 434.225 / 695.33 4308.0 31.51205015182495 46 20 10 6 10 12.481360453795004 8.011947124689812 0.03740119934082031 3 0.9940408638260179 15.97919183276295 4308.0 25.096604651162785 0.0 - - - - - - - 211.33333333333334 8 9 INPP5K inositol polyphosphate-5-phosphatase K 1345 173 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22961.[MT7]-C[CAM]YGGLWEK[MT7].3b3_1.heavy 434.225 / 525.225 1403.0 31.51205015182495 46 20 10 6 10 12.481360453795004 8.011947124689812 0.03740119934082031 3 0.9940408638260179 15.97919183276295 1403.0 1.9602794411177644 2.0 - - - - - - - 211.55555555555554 2 9 INPP5K inositol polyphosphate-5-phosphatase K 1347 174 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544882.[MT7]-FLQEFYQDDELGK[MT7].3y6_1.heavy 640.659 / 820.417 5131.0 39.70759963989258 48 18 10 10 10 3.4424456572568767 22.832043253061062 0.0 3 0.9878207950153604 11.171490797575236 5131.0 71.34346507103429 0.0 - - - - - - - 191.47058823529412 10 17 MCM7 minichromosome maintenance complex component 7 1349 174 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544882.[MT7]-FLQEFYQDDELGK[MT7].3b4_1.heavy 640.659 / 662.363 15822.0 39.70759963989258 48 18 10 10 10 3.4424456572568767 22.832043253061062 0.0 3 0.9878207950153604 11.171490797575236 15822.0 69.86817757009345 0.0 - - - - - - - 250.64285714285714 31 14 MCM7 minichromosome maintenance complex component 7 1351 174 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544882.[MT7]-FLQEFYQDDELGK[MT7].3b5_1.heavy 640.659 / 809.431 10177.0 39.70759963989258 48 18 10 10 10 3.4424456572568767 22.832043253061062 0.0 3 0.9878207950153604 11.171490797575236 10177.0 47.71088693957115 0.0 - - - - - - - 289.61538461538464 20 13 MCM7 minichromosome maintenance complex component 7 1353 174 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544882.[MT7]-FLQEFYQDDELGK[MT7].3b3_1.heavy 640.659 / 533.32 6756.0 39.70759963989258 48 18 10 10 10 3.4424456572568767 22.832043253061062 0.0 3 0.9878207950153604 11.171490797575236 6756.0 33.54146130566364 0.0 - - - - - - - 574.2857142857143 13 7 MCM7 minichromosome maintenance complex component 7 1355 175 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544605.[MT7]-FLVEDYDASSK[MT7].3b4_1.heavy 521.271 / 633.373 12467.0 32.83369827270508 36 18 0 10 8 3.870059386694978 25.839396765794792 0.0 4 0.9862187121988992 10.500680441665656 12467.0 32.58772381664288 2.0 - - - - - - - 269.5 37 10 PLCD1 phospholipase C, delta 1 1357 175 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544605.[MT7]-FLVEDYDASSK[MT7].3b5_1.heavy 521.271 / 748.4 23475.0 32.83369827270508 36 18 0 10 8 3.870059386694978 25.839396765794792 0.0 4 0.9862187121988992 10.500680441665656 23475.0 75.40705453698796 0.0 - - - - - - - 299.5 46 6 PLCD1 phospholipase C, delta 1 1359 175 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544605.[MT7]-FLVEDYDASSK[MT7].3y4_1.heavy 521.271 / 536.316 10670.0 32.83369827270508 36 18 0 10 8 3.870059386694978 25.839396765794792 0.0 4 0.9862187121988992 10.500680441665656 10670.0 9.340176697039261 3.0 - - - - - - - 336.6666666666667 183 3 PLCD1 phospholipase C, delta 1 1361 175 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544605.[MT7]-FLVEDYDASSK[MT7].3b3_1.heavy 521.271 / 504.33 13928.0 32.83369827270508 36 18 0 10 8 3.870059386694978 25.839396765794792 0.0 4 0.9862187121988992 10.500680441665656 13928.0 6.962466130718573 0.0 - - - - - - - 1698.75 27 8 PLCD1 phospholipase C, delta 1 1363 176 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 291181.0 38.823299407958984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 291181.0 207.85901995772923 0.0 - - - - - - - 672.1428571428571 582 7 1365 176 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 552979.0 38.823299407958984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 552979.0 326.319111384629 0.0 - - - - - - - 305.0 1105 4 1367 176 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 642283.0 38.823299407958984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 642283.0 347.7150693875145 0.0 - - - - - - - 659.7142857142857 1284 7 1369 177 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38155.[MT7]-TIWQESRK[MT7].2y4_1.heavy 668.385 / 663.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD1 phospholipase C, delta 1 1371 177 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38155.[MT7]-TIWQESRK[MT7].2y5_1.heavy 668.385 / 791.449 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD1 phospholipase C, delta 1 1373 177 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38155.[MT7]-TIWQESRK[MT7].2y3_1.heavy 668.385 / 534.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD1 phospholipase C, delta 1 1375 177 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38155.[MT7]-TIWQESRK[MT7].2y6_1.heavy 668.385 / 977.529 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD1 phospholipase C, delta 1 1377 178 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22671.[MT7]-FSEAEQR.2y4_1.heavy 505.755 / 503.257 5411.0 19.343700885772705 44 20 10 6 8 21.732367308840097 4.601431522801609 0.03520011901855469 4 0.990535471300064 12.675635579911567 5411.0 19.19705912255307 1.0 - - - - - - - 268.6190476190476 16 21 MCM7 minichromosome maintenance complex component 7 1379 178 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22671.[MT7]-FSEAEQR.2b3_1.heavy 505.755 / 508.252 4375.0 19.343700885772705 44 20 10 6 8 21.732367308840097 4.601431522801609 0.03520011901855469 4 0.990535471300064 12.675635579911567 4375.0 16.758362524898686 0.0 - - - - - - - 236.1 8 20 MCM7 minichromosome maintenance complex component 7 1381 178 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22671.[MT7]-FSEAEQR.2b4_1.heavy 505.755 / 579.289 4720.0 19.343700885772705 44 20 10 6 8 21.732367308840097 4.601431522801609 0.03520011901855469 4 0.990535471300064 12.675635579911567 4720.0 10.567353067353068 0.0 - - - - - - - 235.76190476190476 9 21 MCM7 minichromosome maintenance complex component 7 1383 178 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22671.[MT7]-FSEAEQR.2y6_1.heavy 505.755 / 719.332 14218.0 19.343700885772705 44 20 10 6 8 21.732367308840097 4.601431522801609 0.03520011901855469 4 0.990535471300064 12.675635579911567 14218.0 230.66798371647513 0.0 - - - - - - - 186.23076923076923 28 13 MCM7 minichromosome maintenance complex component 7 1385 179 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23293.[MT7]-AC[CAM]ANPAPGSVILLENLR.2b3_1.heavy 970.031 / 447.214 1455.0 39.88180160522461 42 12 10 10 10 1.5775422717592091 50.974177321846874 0.0 3 0.8977182588078876 3.8255173513754626 1455.0 3.7832319222634334 0.0 - - - - - - - 155.6153846153846 2 13 PGK2 phosphoglycerate kinase 2 1387 179 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23293.[MT7]-AC[CAM]ANPAPGSVILLENLR.2b5_1.heavy 970.031 / 658.31 N/A 39.88180160522461 42 12 10 10 10 1.5775422717592091 50.974177321846874 0.0 3 0.8977182588078876 3.8255173513754626 323.0 2.014160249358269 16.0 - - - - - - - 0.0 1 0 PGK2 phosphoglycerate kinase 2 1389 179 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23293.[MT7]-AC[CAM]ANPAPGSVILLENLR.2y11_1.heavy 970.031 / 1210.72 1051.0 39.88180160522461 42 12 10 10 10 1.5775422717592091 50.974177321846874 0.0 3 0.8977182588078876 3.8255173513754626 1051.0 15.78662551440329 0.0 - - - - - - - 192.25 2 8 PGK2 phosphoglycerate kinase 2 1391 179 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23293.[MT7]-AC[CAM]ANPAPGSVILLENLR.2y3_1.heavy 970.031 / 402.246 647.0 39.88180160522461 42 12 10 10 10 1.5775422717592091 50.974177321846874 0.0 3 0.8977182588078876 3.8255173513754626 647.0 4.419175935481405 4.0 - - - - - - - 0.0 1 0 PGK2 phosphoglycerate kinase 2 1393 180 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22672.[MT7]-VEYDGER.2b3_1.heavy 506.247 / 536.284 1082.0 19.756699562072754 40 14 10 6 10 2.0517698789635044 40.355453098415026 0.03800010681152344 3 0.9457327024135576 5.273627323984313 1082.0 6.835685875497179 1.0 - - - - - - - 560.8571428571429 3 7 PLK1 polo-like kinase 1 1395 180 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22672.[MT7]-VEYDGER.2y5_1.heavy 506.247 / 639.273 3188.0 19.756699562072754 40 14 10 6 10 2.0517698789635044 40.355453098415026 0.03800010681152344 3 0.9457327024135576 5.273627323984313 3188.0 0.8173553719008266 1.0 - - - - - - - 177.33333333333334 6 18 PLK1 polo-like kinase 1 1397 180 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22672.[MT7]-VEYDGER.2b4_1.heavy 506.247 / 651.311 9053.0 19.756699562072754 40 14 10 6 10 2.0517698789635044 40.355453098415026 0.03800010681152344 3 0.9457327024135576 5.273627323984313 9053.0 29.250270224319127 1.0 - - - - - - - 188.53846153846155 18 13 PLK1 polo-like kinase 1 1399 180 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22672.[MT7]-VEYDGER.2y6_1.heavy 506.247 / 768.316 7345.0 19.756699562072754 40 14 10 6 10 2.0517698789635044 40.355453098415026 0.03800010681152344 3 0.9457327024135576 5.273627323984313 7345.0 33.09357283398834 1.0 - - - - - - - 217.88235294117646 14 17 PLK1 polo-like kinase 1 1401 181 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542627.[MT7]-QIAEEDFYEK[MT7].3y3_1.heavy 520.599 / 583.321 76334.0 29.226299285888672 45 15 10 10 10 2.4662150061704367 31.94095045121822 0.0 3 0.9576536012109691 5.97598532085906 76334.0 97.5484173775965 0.0 - - - - - - - 721.0 152 11 MCM7 minichromosome maintenance complex component 7 1403 181 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542627.[MT7]-QIAEEDFYEK[MT7].3b6_1.heavy 520.599 / 830.401 57511.0 29.226299285888672 45 15 10 10 10 2.4662150061704367 31.94095045121822 0.0 3 0.9576536012109691 5.97598532085906 57511.0 142.5999788214003 0.0 - - - - - - - 765.4444444444445 115 9 MCM7 minichromosome maintenance complex component 7 1405 181 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542627.[MT7]-QIAEEDFYEK[MT7].3b4_1.heavy 520.599 / 586.332 31319.0 29.226299285888672 45 15 10 10 10 2.4662150061704367 31.94095045121822 0.0 3 0.9576536012109691 5.97598532085906 31319.0 39.93916621514197 0.0 - - - - - - - 400.0 62 1 MCM7 minichromosome maintenance complex component 7 1407 181 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542627.[MT7]-QIAEEDFYEK[MT7].3b5_1.heavy 520.599 / 715.374 17462.0 29.226299285888672 45 15 10 10 10 2.4662150061704367 31.94095045121822 0.0 3 0.9576536012109691 5.97598532085906 17462.0 30.277705406844753 0.0 - - - - - - - 757.3636363636364 34 11 MCM7 minichromosome maintenance complex component 7 1409 182 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545082.[MT7]-SEDDESGAGELTREELR.3y14_2.heavy 679.654 / 781.376 2011.0 25.737324714660645 36 15 10 5 6 2.1800239513411306 30.731290482948406 0.040500640869140625 5 0.9589566877623815 6.070779469389658 2011.0 6.411884057971014 0.0 - - - - - - - 241.375 4 16 MCM7 minichromosome maintenance complex component 7 1411 182 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545082.[MT7]-SEDDESGAGELTREELR.3b5_1.heavy 679.654 / 720.28 1046.0 25.737324714660645 36 15 10 5 6 2.1800239513411306 30.731290482948406 0.040500640869140625 5 0.9589566877623815 6.070779469389658 1046.0 9.210223963299914 0.0 - - - - - - - 154.53846153846155 2 13 MCM7 minichromosome maintenance complex component 7 1413 182 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545082.[MT7]-SEDDESGAGELTREELR.3b15_2.heavy 679.654 / 875.38 1770.0 25.737324714660645 36 15 10 5 6 2.1800239513411306 30.731290482948406 0.040500640869140625 5 0.9589566877623815 6.070779469389658 1770.0 12.129813664596274 1.0 - - - - - - - 212.5 4 14 MCM7 minichromosome maintenance complex component 7 1415 182 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB545082.[MT7]-SEDDESGAGELTREELR.3y13_2.heavy 679.654 / 723.863 1609.0 25.737324714660645 36 15 10 5 6 2.1800239513411306 30.731290482948406 0.040500640869140625 5 0.9589566877623815 6.070779469389658 1609.0 2.214431892148318 1.0 - - - - - - - 225.2 3 15 MCM7 minichromosome maintenance complex component 7 1417 183 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38523.[MT7]-VLNNMEIGASLFDEEGAK[MT7].3y7_1.heavy 742.384 / 939.454 2693.0 41.033199310302734 42 12 10 10 10 0.9252435437216229 66.906698360207 0.0 3 0.882770030361789 3.5686676230578316 2693.0 13.578843317143372 0.0 - - - - - - - 176.0 5 12 PGK2 phosphoglycerate kinase 2 1419 183 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38523.[MT7]-VLNNMEIGASLFDEEGAK[MT7].3b6_1.heavy 742.384 / 845.431 3203.0 41.033199310302734 42 12 10 10 10 0.9252435437216229 66.906698360207 0.0 3 0.882770030361789 3.5686676230578316 3203.0 18.045828518560477 0.0 - - - - - - - 201.76923076923077 6 13 PGK2 phosphoglycerate kinase 2 1421 183 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38523.[MT7]-VLNNMEIGASLFDEEGAK[MT7].3b4_1.heavy 742.384 / 585.348 2111.0 41.033199310302734 42 12 10 10 10 0.9252435437216229 66.906698360207 0.0 3 0.882770030361789 3.5686676230578316 2111.0 16.926451151588136 0.0 - - - - - - - 198.22222222222223 4 18 PGK2 phosphoglycerate kinase 2 1423 183 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38523.[MT7]-VLNNMEIGASLFDEEGAK[MT7].3b5_1.heavy 742.384 / 716.388 1383.0 41.033199310302734 42 12 10 10 10 0.9252435437216229 66.906698360207 0.0 3 0.882770030361789 3.5686676230578316 1383.0 5.951313274825861 1.0 - - - - - - - 241.31578947368422 2 19 PGK2 phosphoglycerate kinase 2 1425 184 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22576.[MT7]-GGLIAYR.2y4_1.heavy 447.27 / 522.304 7468.0 27.357799530029297 44 14 10 10 10 2.130732598930808 36.978035720018845 0.0 3 0.9396980096146089 5.000225701444752 7468.0 6.511660089473311 0.0 - - - - - - - 293.3076923076923 14 13 INPP1 inositol polyphosphate-1-phosphatase 1427 184 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22576.[MT7]-GGLIAYR.2b4_1.heavy 447.27 / 485.32 14460.0 27.357799530029297 44 14 10 10 10 2.130732598930808 36.978035720018845 0.0 3 0.9396980096146089 5.000225701444752 14460.0 10.651201094559706 0.0 - - - - - - - 685.125 28 8 INPP1 inositol polyphosphate-1-phosphatase 1429 184 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22576.[MT7]-GGLIAYR.2y6_1.heavy 447.27 / 692.409 10885.0 27.357799530029297 44 14 10 10 10 2.130732598930808 36.978035720018845 0.0 3 0.9396980096146089 5.000225701444752 10885.0 57.152666102412184 0.0 - - - - - - - 192.78571428571428 21 14 INPP1 inositol polyphosphate-1-phosphatase 1431 184 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22576.[MT7]-GGLIAYR.2b5_1.heavy 447.27 / 556.357 18353.0 27.357799530029297 44 14 10 10 10 2.130732598930808 36.978035720018845 0.0 3 0.9396980096146089 5.000225701444752 18353.0 53.075126445739244 0.0 - - - - - - - 317.90909090909093 36 11 INPP1 inositol polyphosphate-1-phosphatase 1433 185 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 638728.0 34.06850051879883 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 638728.0 426.75529914820356 0.0 - - - - - - - 701.2857142857143 1277 7 1435 185 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 91880.0 34.06850051879883 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 91880.0 149.19804658665947 0.0 - - - - - - - 309.7142857142857 183 7 1437 185 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 72705.0 34.06850051879883 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 72705.0 86.51085365298266 0.0 - - - - - - - 710.3333333333334 145 9 1439 186 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38012.[MT7]-AGILTTLNAR.2y5_1.heavy 587.357 / 574.331 N/A 33.1505012512207 48 18 10 10 10 3.144114886867973 31.805453553135123 0.0 3 0.9833394670340067 9.548015373816947 1431.0 0.17120622568093385 7.0 - - - - - - - 709.4444444444445 3 9 MCM7 minichromosome maintenance complex component 7 1441 186 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38012.[MT7]-AGILTTLNAR.2y9_1.heavy 587.357 / 958.568 2202.0 33.1505012512207 48 18 10 10 10 3.144114886867973 31.805453553135123 0.0 3 0.9833394670340067 9.548015373816947 2202.0 19.858036363636366 0.0 - - - - - - - 183.33333333333334 4 15 MCM7 minichromosome maintenance complex component 7 1443 186 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38012.[MT7]-AGILTTLNAR.2y6_1.heavy 587.357 / 675.378 2422.0 33.1505012512207 48 18 10 10 10 3.144114886867973 31.805453553135123 0.0 3 0.9833394670340067 9.548015373816947 2422.0 23.113586363636365 0.0 - - - - - - - 231.0 4 10 MCM7 minichromosome maintenance complex component 7 1445 186 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38012.[MT7]-AGILTTLNAR.2y7_1.heavy 587.357 / 788.463 4293.0 33.1505012512207 48 18 10 10 10 3.144114886867973 31.805453553135123 0.0 3 0.9833394670340067 9.548015373816947 4293.0 12.414333379177556 0.0 - - - - - - - 620.3636363636364 8 11 MCM7 minichromosome maintenance complex component 7 1447 187 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38478.[MT7]-VSHVSTGGGASLELLEGK[MT7].3b4_1.heavy 677.044 / 567.337 2418.0 32.148749351501465 37 11 10 6 10 1.3276403801876147 61.1344507507027 0.039798736572265625 3 0.8644232799398806 3.313114112123361 2418.0 9.49214876033058 0.0 - - - - - - - 309.4 4 10 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 1449 187 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38478.[MT7]-VSHVSTGGGASLELLEGK[MT7].3b10_1.heavy 677.044 / 997.518 1354.0 32.148749351501465 37 11 10 6 10 1.3276403801876147 61.1344507507027 0.039798736572265625 3 0.8644232799398806 3.313114112123361 1354.0 20.20621334330431 0.0 - - - - - - - 154.9 2 10 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 1451 187 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38478.[MT7]-VSHVSTGGGASLELLEGK[MT7].3y4_1.heavy 677.044 / 590.363 12670.0 32.148749351501465 37 11 10 6 10 1.3276403801876147 61.1344507507027 0.039798736572265625 3 0.8644232799398806 3.313114112123361 12670.0 21.15652949072909 0.0 - - - - - - - 821.75 25 8 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 1453 187 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38478.[MT7]-VSHVSTGGGASLELLEGK[MT7].3y5_1.heavy 677.044 / 703.447 4546.0 32.148749351501465 37 11 10 6 10 1.3276403801876147 61.1344507507027 0.039798736572265625 3 0.8644232799398806 3.313114112123361 4546.0 16.451553951706316 0.0 - - - - - - - 209.58333333333334 9 12 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 1455 188 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23004.[MT7]-LISLQEQLQR.2y8_1.heavy 686.407 / 1001.54 15458.0 34.52360153198242 46 16 10 10 10 2.4925571624945957 40.119440992044574 0.0 3 0.9611978426006935 6.244821632168773 15458.0 107.60764103204676 0.0 - - - - - - - 241.0 30 5 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1457 188 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23004.[MT7]-LISLQEQLQR.2y9_1.heavy 686.407 / 1114.62 15568.0 34.52360153198242 46 16 10 10 10 2.4925571624945957 40.119440992044574 0.0 3 0.9611978426006935 6.244821632168773 15568.0 199.8636513075965 0.0 - - - - - - - 188.14285714285714 31 7 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1459 188 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23004.[MT7]-LISLQEQLQR.2y6_1.heavy 686.407 / 801.421 11731.0 34.52360153198242 46 16 10 10 10 2.4925571624945957 40.119440992044574 0.0 3 0.9611978426006935 6.244821632168773 11731.0 36.255441255806 0.0 - - - - - - - 230.4 23 10 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1461 188 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23004.[MT7]-LISLQEQLQR.2y7_1.heavy 686.407 / 914.505 3837.0 34.52360153198242 46 16 10 10 10 2.4925571624945957 40.119440992044574 0.0 3 0.9611978426006935 6.244821632168773 3837.0 27.54879835116792 0.0 - - - - - - - 201.0 7 12 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1463 189 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37970.[MT7]-NQITNNQR.2b3_1.heavy 566.303 / 500.295 3360.0 14.453499794006348 48 18 10 10 10 4.852110829483432 20.609586943554266 0.0 3 0.9859811113262423 10.411106922867422 3360.0 24.579941780297226 0.0 - - - - - - - 179.13636363636363 6 22 PGK2 phosphoglycerate kinase 2 1465 189 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37970.[MT7]-NQITNNQR.2y5_1.heavy 566.303 / 632.311 6322.0 14.453499794006348 48 18 10 10 10 4.852110829483432 20.609586943554266 0.0 3 0.9859811113262423 10.411106922867422 6322.0 72.54754098360655 0.0 - - - - - - - 123.6086956521739 12 23 PGK2 phosphoglycerate kinase 2 1467 189 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37970.[MT7]-NQITNNQR.2y6_1.heavy 566.303 / 745.395 4001.0 14.453499794006348 48 18 10 10 10 4.852110829483432 20.609586943554266 0.0 3 0.9859811113262423 10.411106922867422 4001.0 39.66704489446052 0.0 - - - - - - - 95.05263157894737 8 19 PGK2 phosphoglycerate kinase 2 1469 189 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB37970.[MT7]-NQITNNQR.2y7_1.heavy 566.303 / 873.454 5131.0 14.453499794006348 48 18 10 10 10 4.852110829483432 20.609586943554266 0.0 3 0.9859811113262423 10.411106922867422 5131.0 66.92608695652174 0.0 - - - - - - - 96.88888888888889 10 18 PGK2 phosphoglycerate kinase 2 1471 190 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544892.[MT7]-AC[CAM]ANPAPGSVILLENLR.3y7_1.heavy 647.023 / 870.541 7276.0 39.88180160522461 40 10 10 10 10 0.7118578561898532 78.25228018148458 0.0 3 0.8340209737992327 2.9863255408687106 7276.0 36.9597609561753 0.0 - - - - - - - 160.33333333333334 14 12 PGK2 phosphoglycerate kinase 2 1473 190 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544892.[MT7]-AC[CAM]ANPAPGSVILLENLR.3b6_1.heavy 647.023 / 729.347 14133.0 39.88180160522461 40 10 10 10 10 0.7118578561898532 78.25228018148458 0.0 3 0.8340209737992327 2.9863255408687106 14133.0 50.48300895595633 0.0 - - - - - - - 242.8 28 10 PGK2 phosphoglycerate kinase 2 1475 190 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544892.[MT7]-AC[CAM]ANPAPGSVILLENLR.3y6_1.heavy 647.023 / 757.457 6523.0 39.88180160522461 40 10 10 10 10 0.7118578561898532 78.25228018148458 0.0 3 0.8340209737992327 2.9863255408687106 6523.0 12.28421052631579 1.0 - - - - - - - 237.08333333333334 13 12 PGK2 phosphoglycerate kinase 2 1477 190 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544892.[MT7]-AC[CAM]ANPAPGSVILLENLR.3y11_1.heavy 647.023 / 1210.72 6858.0 39.88180160522461 40 10 10 10 10 0.7118578561898532 78.25228018148458 0.0 3 0.8340209737992327 2.9863255408687106 6858.0 80.64004455186068 1.0 - - - - - - - 125.75 14 8 PGK2 phosphoglycerate kinase 2 1479 191 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38540.[MT7]-QEEAEDPAC[CAM]IPIFWVSK[MT7].2b3_1.heavy 1154.08 / 531.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 1481 191 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38540.[MT7]-QEEAEDPAC[CAM]IPIFWVSK[MT7].2b6_1.heavy 1154.08 / 846.36 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 1483 191 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38540.[MT7]-QEEAEDPAC[CAM]IPIFWVSK[MT7].2b9_1.heavy 1154.08 / 1174.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 1485 191 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38540.[MT7]-QEEAEDPAC[CAM]IPIFWVSK[MT7].2y7_1.heavy 1154.08 / 1020.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 1487 192 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543763.[MT7]-DYSVTANSK[MT7].3y3_1.heavy 424.894 / 492.29 47565.0 19.930999755859375 37 17 4 10 6 4.390899119824978 22.774378839290215 0.0 5 0.9759943499559929 7.949375132527514 47565.0 9.724183479012058 3.0 - - - - - - - 1228.0 164 8 LDHB lactate dehydrogenase B 1489 192 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543763.[MT7]-DYSVTANSK[MT7].3y4_1.heavy 424.894 / 563.327 14333.0 19.930999755859375 37 17 4 10 6 4.390899119824978 22.774378839290215 0.0 5 0.9759943499559929 7.949375132527514 14333.0 84.69356194903914 0.0 - - - - - - - 197.41666666666666 28 12 LDHB lactate dehydrogenase B 1491 192 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543763.[MT7]-DYSVTANSK[MT7].3b3_1.heavy 424.894 / 510.232 26296.0 19.930999755859375 37 17 4 10 6 4.390899119824978 22.774378839290215 0.0 5 0.9759943499559929 7.949375132527514 26296.0 66.98970310564313 0.0 - - - - - - - 726.4285714285714 52 7 LDHB lactate dehydrogenase B 1493 193 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB541950.[MT7]-LYLQTR.2b3_1.heavy 469.283 / 534.341 8826.0 28.13170051574707 50 20 10 10 10 24.89554468536667 4.016782973171056 0.0 3 0.997267660478249 23.604570442785448 8826.0 11.881581156798342 0.0 - - - - - - - 308.09090909090907 17 11 MCM7 minichromosome maintenance complex component 7 1495 193 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB541950.[MT7]-LYLQTR.2y4_1.heavy 469.283 / 517.309 17101.0 28.13170051574707 50 20 10 10 10 24.89554468536667 4.016782973171056 0.0 3 0.997267660478249 23.604570442785448 17101.0 21.620191023243386 0.0 - - - - - - - 742.0 34 12 MCM7 minichromosome maintenance complex component 7 1497 193 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB541950.[MT7]-LYLQTR.2y5_1.heavy 469.283 / 680.373 73288.0 28.13170051574707 50 20 10 10 10 24.89554468536667 4.016782973171056 0.0 3 0.997267660478249 23.604570442785448 73288.0 178.89586936686322 0.0 - - - - - - - 778.125 146 8 MCM7 minichromosome maintenance complex component 7 1499 193 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB541950.[MT7]-LYLQTR.2b4_1.heavy 469.283 / 662.399 10717.0 28.13170051574707 50 20 10 10 10 24.89554468536667 4.016782973171056 0.0 3 0.997267660478249 23.604570442785448 10717.0 31.716402779054448 0.0 - - - - - - - 305.3125 21 16 MCM7 minichromosome maintenance complex component 7 1501 194 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23278.[MT7]-FLQEFYQDDELGK[MT7].2b3_1.heavy 960.485 / 533.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 1503 194 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23278.[MT7]-FLQEFYQDDELGK[MT7].2y8_1.heavy 960.485 / 1111.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 1505 194 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23278.[MT7]-FLQEFYQDDELGK[MT7].2y5_1.heavy 960.485 / 705.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 1507 194 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23278.[MT7]-FLQEFYQDDELGK[MT7].2b4_1.heavy 960.485 / 662.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - MCM7 minichromosome maintenance complex component 7 1509 195 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22973.[MT7]-EIPEVLVDPR.2b8_1.heavy 655.875 / 1039.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 1511 195 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22973.[MT7]-EIPEVLVDPR.2b4_1.heavy 655.875 / 613.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 1513 195 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22973.[MT7]-EIPEVLVDPR.2b6_1.heavy 655.875 / 825.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 1515 195 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22973.[MT7]-EIPEVLVDPR.2b5_1.heavy 655.875 / 712.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 1517 196 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544618.[MT7]-QSFLTEVEQLSR.3b6_1.heavy 527.618 / 850.443 13052.0 42.105424880981445 46 20 10 6 10 13.65854356184513 7.321424831806226 0.03350067138671875 3 0.9979277037128207 27.1057493411916 13052.0 70.32327586206897 0.0 - - - - - - - 689.5555555555555 26 9 IRAK1 interleukin-1 receptor-associated kinase 1 1519 196 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544618.[MT7]-QSFLTEVEQLSR.3y6_1.heavy 527.618 / 731.405 21521.0 42.105424880981445 46 20 10 6 10 13.65854356184513 7.321424831806226 0.03350067138671875 3 0.9979277037128207 27.1057493411916 21521.0 69.45327144120247 0.0 - - - - - - - 194.47058823529412 43 17 IRAK1 interleukin-1 receptor-associated kinase 1 1521 196 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544618.[MT7]-QSFLTEVEQLSR.3b4_1.heavy 527.618 / 620.352 22681.0 42.105424880981445 46 20 10 6 10 13.65854356184513 7.321424831806226 0.03350067138671875 3 0.9979277037128207 27.1057493411916 22681.0 103.3493842364532 0.0 - - - - - - - 216.73684210526315 45 19 IRAK1 interleukin-1 receptor-associated kinase 1 1523 196 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544618.[MT7]-QSFLTEVEQLSR.3y5_1.heavy 527.618 / 632.336 42345.0 42.105424880981445 46 20 10 6 10 13.65854356184513 7.321424831806226 0.03350067138671875 3 0.9979277037128207 27.1057493411916 42345.0 253.76026645768025 0.0 - - - - - - - 214.94117647058823 84 17 IRAK1 interleukin-1 receptor-associated kinase 1 1525 197 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23147.[MT7]-TQRPADVIFATVR.3y7_1.heavy 539.978 / 805.493 21779.0 33.3765983581543 43 13 10 10 10 2.086832269710995 37.48661672248753 0.0 3 0.9216372859370047 4.379554617556145 21779.0 30.944132321041216 0.0 - - - - - - - 279.7142857142857 43 7 MCM7 minichromosome maintenance complex component 7 1527 197 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23147.[MT7]-TQRPADVIFATVR.3b6_1.heavy 539.978 / 813.433 15326.0 33.3765983581543 43 13 10 10 10 2.086832269710995 37.48661672248753 0.0 3 0.9216372859370047 4.379554617556145 15326.0 30.7194504952797 1.0 - - - - - - - 257.0 30 13 MCM7 minichromosome maintenance complex component 7 1529 197 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23147.[MT7]-TQRPADVIFATVR.3y5_1.heavy 539.978 / 593.341 70984.0 33.3765983581543 43 13 10 10 10 2.086832269710995 37.48661672248753 0.0 3 0.9216372859370047 4.379554617556145 70984.0 119.96665586099934 0.0 - - - - - - - 674.8571428571429 141 7 MCM7 minichromosome maintenance complex component 7 1531 197 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23147.[MT7]-TQRPADVIFATVR.3b8_2.heavy 539.978 / 513.297 43904.0 33.3765983581543 43 13 10 10 10 2.086832269710995 37.48661672248753 0.0 3 0.9216372859370047 4.379554617556145 43904.0 72.71773104129191 0.0 - - - - - - - 461.0 87 2 MCM7 minichromosome maintenance complex component 7 1533 198 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544370.[MT7]-NHFQSVLEQLELQEK[MT7].3b4_1.heavy 710.719 / 671.338 3538.0 38.00077533721924 43 17 10 6 10 4.006783050414705 24.957677703475845 0.033702850341796875 3 0.9784299820853262 8.387902358989784 3538.0 6.5578609233302165 0.0 - - - - - - - 591.8571428571429 7 7 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1535 198 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544370.[MT7]-NHFQSVLEQLELQEK[MT7].3b3_1.heavy 710.719 / 543.28 2848.0 38.00077533721924 43 17 10 6 10 4.006783050414705 24.957677703475845 0.033702850341796875 3 0.9784299820853262 8.387902358989784 2848.0 16.94606577047942 0.0 - - - - - - - 727.2857142857143 5 7 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1537 198 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544370.[MT7]-NHFQSVLEQLELQEK[MT7].3y4_1.heavy 710.719 / 661.4 7335.0 38.00077533721924 43 17 10 6 10 4.006783050414705 24.957677703475845 0.033702850341796875 3 0.9784299820853262 8.387902358989784 7335.0 19.06 1.0 - - - - - - - 258.88235294117646 14 17 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1539 198 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544370.[MT7]-NHFQSVLEQLELQEK[MT7].3y5_1.heavy 710.719 / 790.443 7853.0 38.00077533721924 43 17 10 6 10 4.006783050414705 24.957677703475845 0.033702850341796875 3 0.9784299820853262 8.387902358989784 7853.0 60.57082152342268 0.0 - - - - - - - 213.23529411764707 15 17 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1541 199 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23283.[MT7]-LFADAVQELLPQYK[MT7].3b6_1.heavy 641.699 / 761.431 23519.0 46.447824478149414 38 12 10 6 10 1.8708705965283692 41.86040300964752 0.03350067138671875 3 0.8879184331948866 3.651345099817815 23519.0 146.65254489525375 0.0 - - - - - - - 182.06666666666666 47 15 MCM7 minichromosome maintenance complex component 7 1543 199 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23283.[MT7]-LFADAVQELLPQYK[MT7].3b4_1.heavy 641.699 / 591.326 14721.0 46.447824478149414 38 12 10 6 10 1.8708705965283692 41.86040300964752 0.03350067138671875 3 0.8879184331948866 3.651345099817815 14721.0 147.7406777217015 0.0 - - - - - - - 194.8421052631579 29 19 MCM7 minichromosome maintenance complex component 7 1545 199 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23283.[MT7]-LFADAVQELLPQYK[MT7].3b5_1.heavy 641.699 / 662.363 34584.0 46.447824478149414 38 12 10 6 10 1.8708705965283692 41.86040300964752 0.03350067138671875 3 0.8879184331948866 3.651345099817815 34584.0 191.21814598880596 0.0 - - - - - - - 219.375 69 16 MCM7 minichromosome maintenance complex component 7 1547 199 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23283.[MT7]-LFADAVQELLPQYK[MT7].3y4_1.heavy 641.699 / 679.39 73505.0 46.447824478149414 38 12 10 6 10 1.8708705965283692 41.86040300964752 0.03350067138671875 3 0.8879184331948866 3.651345099817815 73505.0 707.5205205278593 0.0 - - - - - - - 196.69230769230768 147 13 MCM7 minichromosome maintenance complex component 7 1549 200 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544899.[MT7]-FELYFQGPSSNK[MT7]PR.3y7_1.heavy 653.351 / 929.529 2051.0 34.39099884033203 48 18 10 10 10 4.883973540449053 20.47513140106111 0.0 3 0.9886656997593258 11.581210524461895 2051.0 12.14407894736842 0.0 - - - - - - - 155.45454545454547 4 11 MCM7 minichromosome maintenance complex component 7 1551 200 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544899.[MT7]-FELYFQGPSSNK[MT7]PR.3b4_1.heavy 653.351 / 697.368 5127.0 34.39099884033203 48 18 10 10 10 4.883973540449053 20.47513140106111 0.0 3 0.9886656997593258 11.581210524461895 5127.0 19.04324732563115 0.0 - - - - - - - 171.0 10 6 MCM7 minichromosome maintenance complex component 7 1553 200 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544899.[MT7]-FELYFQGPSSNK[MT7]PR.3b3_1.heavy 653.351 / 534.304 5697.0 34.39099884033203 48 18 10 10 10 4.883973540449053 20.47513140106111 0.0 3 0.9886656997593258 11.581210524461895 5697.0 31.983157894736845 0.0 - - - - - - - 247.0 11 12 MCM7 minichromosome maintenance complex component 7 1555 200 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544899.[MT7]-FELYFQGPSSNK[MT7]PR.3y8_1.heavy 653.351 / 986.55 3532.0 34.39099884033203 48 18 10 10 10 4.883973540449053 20.47513140106111 0.0 3 0.9886656997593258 11.581210524461895 3532.0 46.318771929824564 0.0 - - - - - - - 296.4 7 5 MCM7 minichromosome maintenance complex component 7 1557 201 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38160.[MT7]-FK[MT7]HTHDK[MT7].3y6_2.heavy 448.93 / 527.306 521.0 13.692999839782715 46 18 10 10 8 2.3543626702852016 32.14716293632826 0.0 4 0.9895845641799751 12.082198795264503 521.0 2.6969817249648558 2.0 - - - - - - - 0.0 1 0 PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 1559 201 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38160.[MT7]-FK[MT7]HTHDK[MT7].3y3_1.heavy 448.93 / 543.301 1495.0 13.692999839782715 46 18 10 10 8 2.3543626702852016 32.14716293632826 0.0 4 0.9895845641799751 12.082198795264503 1495.0 8.491817580418424 0.0 - - - - - - - 156.5 2 24 PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 1561 201 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38160.[MT7]-FK[MT7]HTHDK[MT7].3y5_1.heavy 448.93 / 781.407 N/A 13.692999839782715 46 18 10 10 8 2.3543626702852016 32.14716293632826 0.0 4 0.9895845641799751 12.082198795264503 209.0 3.795302197802198 3.0 - - - - - - - 0.0 0 0 PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 1563 201 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38160.[MT7]-FK[MT7]HTHDK[MT7].3y4_1.heavy 448.93 / 644.348 417.0 13.692999839782715 46 18 10 10 8 2.3543626702852016 32.14716293632826 0.0 4 0.9895845641799751 12.082198795264503 417.0 5.686279840848806 2.0 - - - - - - - 0.0 1 0 PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 1565 202 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23400.[MT7]-TFAGNTPLHLAAGLGYPTLTR.3b6_1.heavy 772.426 / 736.375 4669.0 38.96004867553711 41 15 10 6 10 7.188801045634272 13.910525463871275 0.03730010986328125 3 0.9588036129075622 6.0594117876420475 4669.0 4.762281808622502 0.0 - - - - - - - 691.8571428571429 9 7 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1567 202 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23400.[MT7]-TFAGNTPLHLAAGLGYPTLTR.3y11_1.heavy 772.426 / 1119.62 6312.0 38.96004867553711 41 15 10 6 10 7.188801045634272 13.910525463871275 0.03730010986328125 3 0.9588036129075622 6.0594117876420475 6312.0 66.7685549132948 0.0 - - - - - - - 207.4 12 10 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1569 202 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23400.[MT7]-TFAGNTPLHLAAGLGYPTLTR.3y12_1.heavy 772.426 / 1232.7 1211.0 38.96004867553711 41 15 10 6 10 7.188801045634272 13.910525463871275 0.03730010986328125 3 0.9588036129075622 6.0594117876420475 1211.0 10.36 0.0 - - - - - - - 192.0 2 9 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1571 202 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23400.[MT7]-TFAGNTPLHLAAGLGYPTLTR.3b8_1.heavy 772.426 / 946.511 5275.0 38.96004867553711 41 15 10 6 10 7.188801045634272 13.910525463871275 0.03730010986328125 3 0.9588036129075622 6.0594117876420475 5275.0 30.704358376233372 0.0 - - - - - - - 192.53846153846155 10 13 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1573 203 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22567.[MT7]-LNLVQR.2y4_1.heavy 443.783 / 515.33 12034.0 27.405949592590332 44 18 10 6 10 3.7577118406627217 26.61193945684874 0.038600921630859375 3 0.9890305119584398 11.772572953819953 12034.0 15.205415162454873 0.0 - - - - - - - 771.9166666666666 24 12 LDHA;LDHB;LDHAL6B lactate dehydrogenase A;lactate dehydrogenase B;lactate dehydrogenase A-like 6B 1575 203 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22567.[MT7]-LNLVQR.2b3_1.heavy 443.783 / 485.32 21771.0 27.405949592590332 44 18 10 6 10 3.7577118406627217 26.61193945684874 0.038600921630859375 3 0.9890305119584398 11.772572953819953 21771.0 23.3853940692299 0.0 - - - - - - - 1147.875 43 8 LDHA;LDHB;LDHAL6B lactate dehydrogenase A;lactate dehydrogenase B;lactate dehydrogenase A-like 6B 1577 203 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22567.[MT7]-LNLVQR.2y5_1.heavy 443.783 / 629.373 58268.0 27.405949592590332 44 18 10 6 10 3.7577118406627217 26.61193945684874 0.038600921630859375 3 0.9890305119584398 11.772572953819953 58268.0 85.13858483499638 0.0 - - - - - - - 803.0 116 7 LDHA;LDHB;LDHAL6B lactate dehydrogenase A;lactate dehydrogenase B;lactate dehydrogenase A-like 6B 1579 203 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22567.[MT7]-LNLVQR.2b4_1.heavy 443.783 / 584.389 19950.0 27.405949592590332 44 18 10 6 10 3.7577118406627217 26.61193945684874 0.038600921630859375 3 0.9890305119584398 11.772572953819953 19950.0 24.361623964601478 0.0 - - - - - - - 1176.4285714285713 39 7 LDHA;LDHB;LDHAL6B lactate dehydrogenase A;lactate dehydrogenase B;lactate dehydrogenase A-like 6B 1581 204 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23280.[MT7]-LFADAVQELLPQYK[MT7].2b8_1.heavy 962.045 / 1018.53 1068.0 46.447824478149414 39 13 10 6 10 2.0864136071835313 47.929135266228876 0.03350067138671875 3 0.9132254589219344 4.158862299136844 1068.0 15.847741935483873 0.0 - - - - - - - 87.63157894736842 2 19 MCM7 minichromosome maintenance complex component 7 1583 204 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23280.[MT7]-LFADAVQELLPQYK[MT7].2y4_1.heavy 962.045 / 679.39 7403.0 46.447824478149414 39 13 10 6 10 2.0864136071835313 47.929135266228876 0.03350067138671875 3 0.9132254589219344 4.158862299136844 7403.0 49.39202353025661 0.0 - - - - - - - 158.26315789473685 14 19 MCM7 minichromosome maintenance complex component 7 1585 204 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23280.[MT7]-LFADAVQELLPQYK[MT7].2b4_1.heavy 962.045 / 591.326 2385.0 46.447824478149414 39 13 10 6 10 2.0864136071835313 47.929135266228876 0.03350067138671875 3 0.9132254589219344 4.158862299136844 2385.0 21.28892617449664 0.0 - - - - - - - 133.27272727272728 4 22 MCM7 minichromosome maintenance complex component 7 1587 204 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23280.[MT7]-LFADAVQELLPQYK[MT7].2b5_1.heavy 962.045 / 662.363 2186.0 46.447824478149414 39 13 10 6 10 2.0864136071835313 47.929135266228876 0.03350067138671875 3 0.9132254589219344 4.158862299136844 2186.0 36.76873969849247 0.0 - - - - - - - 110.14285714285714 4 21 MCM7 minichromosome maintenance complex component 7 1589 205 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23151.[MT7]-ITFPVDFVTGDK[MT7].2y4_1.heavy 813.953 / 564.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1591 205 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23151.[MT7]-ITFPVDFVTGDK[MT7].2y9_1.heavy 813.953 / 1121.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1593 205 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23151.[MT7]-ITFPVDFVTGDK[MT7].2b6_1.heavy 813.953 / 817.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1595 205 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23151.[MT7]-ITFPVDFVTGDK[MT7].2y6_1.heavy 813.953 / 810.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1597 206 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22665.[MT7]-ASIPSIK[MT7].2b3_1.heavy 502.323 / 416.263 19179.0 27.182700157165527 36 14 10 6 6 3.670535089154412 27.24398420695583 0.03819847106933594 5 0.9494193888283033 5.464149136623688 19179.0 14.571725742012239 1.0 - - - - - - - 477.0 38 1 PGK2 phosphoglycerate kinase 2 1599 206 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22665.[MT7]-ASIPSIK[MT7].2y4_1.heavy 502.323 / 588.384 32549.0 27.182700157165527 36 14 10 6 6 3.670535089154412 27.24398420695583 0.03819847106933594 5 0.9494193888283033 5.464149136623688 32549.0 41.02003719855778 0.0 - - - - - - - 1193.75 65 8 PGK2 phosphoglycerate kinase 2 1601 206 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22665.[MT7]-ASIPSIK[MT7].2y5_1.heavy 502.323 / 701.468 2387.0 27.182700157165527 36 14 10 6 6 3.670535089154412 27.24398420695583 0.03819847106933594 5 0.9494193888283033 5.464149136623688 2387.0 6.049043194245397 1.0 - - - - - - - 670.7142857142857 4 7 PGK2 phosphoglycerate kinase 2 1603 206 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22665.[MT7]-ASIPSIK[MT7].2y6_1.heavy 502.323 / 788.5 3820.0 27.182700157165527 36 14 10 6 6 3.670535089154412 27.24398420695583 0.03819847106933594 5 0.9494193888283033 5.464149136623688 3820.0 4.042717739430358 1.0 - - - - - - - 807.1428571428571 13 7 PGK2 phosphoglycerate kinase 2 1605 207 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38481.[MT7]-TPESQLFSIEDIQEVR.2y5_1.heavy 1018.03 / 644.373 2402.0 40.28310012817383 44 14 10 10 10 2.7441310682371154 36.441408049886626 0.0 3 0.9356589877097551 4.839069738348107 2402.0 28.93975903614458 0.0 - - - - - - - 165.8 4 10 PLCD1 phospholipase C, delta 1 1607 207 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38481.[MT7]-TPESQLFSIEDIQEVR.2y9_1.heavy 1018.03 / 1088.56 1160.0 40.28310012817383 44 14 10 10 10 2.7441310682371154 36.441408049886626 0.0 3 0.9356589877097551 4.839069738348107 1160.0 20.055421686746985 0.0 - - - - - - - 201.28571428571428 2 7 PLCD1 phospholipase C, delta 1 1609 207 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38481.[MT7]-TPESQLFSIEDIQEVR.2y10_1.heavy 1018.03 / 1235.63 497.0 40.28310012817383 44 14 10 10 10 2.7441310682371154 36.441408049886626 0.0 3 0.9356589877097551 4.839069738348107 497.0 3.059691063249196 0.0 - - - - - - - 0.0 0 0 PLCD1 phospholipase C, delta 1 1611 207 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38481.[MT7]-TPESQLFSIEDIQEVR.2y7_1.heavy 1018.03 / 888.442 1160.0 40.28310012817383 44 14 10 10 10 2.7441310682371154 36.441408049886626 0.0 3 0.9356589877097551 4.839069738348107 1160.0 6.363394826792078 0.0 - - - - - - - 223.0 2 13 PLCD1 phospholipase C, delta 1 1613 208 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23406.[MT7]-LIVWNGPLGVFEWDAFAK[MT7].3y6_1.heavy 784.099 / 881.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1615 208 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23406.[MT7]-LIVWNGPLGVFEWDAFAK[MT7].3y3_1.heavy 784.099 / 509.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1617 208 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23406.[MT7]-LIVWNGPLGVFEWDAFAK[MT7].3b6_1.heavy 784.099 / 827.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1619 208 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23406.[MT7]-LIVWNGPLGVFEWDAFAK[MT7].3y4_1.heavy 784.099 / 580.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1621 209 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB541631.[MT7]-ALLAGQR.2b3_1.heavy 436.775 / 442.315 3889.0 23.19332456588745 46 20 10 6 10 42.996761677214096 2.325756547684252 0.03249931335449219 3 0.9989473782726404 38.03540996744867 3889.0 6.782300556586271 0.0 - - - - - - - 718.1428571428571 7 7 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1623 209 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB541631.[MT7]-ALLAGQR.2y5_1.heavy 436.775 / 544.32 6642.0 23.19332456588745 46 20 10 6 10 42.996761677214096 2.325756547684252 0.03249931335449219 3 0.9989473782726404 38.03540996744867 6642.0 12.290736207870458 0.0 - - - - - - - 698.0 13 9 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1625 209 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB541631.[MT7]-ALLAGQR.2b4_1.heavy 436.775 / 513.352 1616.0 23.19332456588745 46 20 10 6 10 42.996761677214096 2.325756547684252 0.03249931335449219 3 0.9989473782726404 38.03540996744867 1616.0 5.0263545150501665 3.0 - - - - - - - 260.35 3 20 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1627 209 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB541631.[MT7]-ALLAGQR.2y6_1.heavy 436.775 / 657.404 8676.0 23.19332456588745 46 20 10 6 10 42.996761677214096 2.325756547684252 0.03249931335449219 3 0.9989473782726404 38.03540996744867 8676.0 77.01460445682451 1.0 - - - - - - - 247.46666666666667 17 15 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1629 210 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22566.[MT7]-FSAFLR.2y4_1.heavy 442.759 / 506.309 5842.0 35.82809829711914 44 14 10 10 10 2.2999845049759364 43.47855378314657 0.0 3 0.9433572240597656 5.160817579783864 5842.0 19.96845711132135 0.0 - - - - - - - 237.28571428571428 11 14 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1631 210 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22566.[MT7]-FSAFLR.2b3_1.heavy 442.759 / 450.247 11785.0 35.82809829711914 44 14 10 10 10 2.2999845049759364 43.47855378314657 0.0 3 0.9433572240597656 5.160817579783864 11785.0 93.81094527363184 0.0 - - - - - - - 241.53333333333333 23 15 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1633 210 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22566.[MT7]-FSAFLR.2y3_1.heavy 442.759 / 435.271 2015.0 35.82809829711914 44 14 10 10 10 2.2999845049759364 43.47855378314657 0.0 3 0.9433572240597656 5.160817579783864 2015.0 1.8352649006622515 1.0 - - - - - - - 226.5 4 12 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1635 210 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22566.[MT7]-FSAFLR.2b5_1.heavy 442.759 / 710.399 4231.0 35.82809829711914 44 14 10 10 10 2.2999845049759364 43.47855378314657 0.0 3 0.9433572240597656 5.160817579783864 4231.0 69.95811881188118 0.0 - - - - - - - 212.55555555555554 8 9 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1637 211 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22669.[MT7]-IYPAGWR.2y5_1.heavy 503.783 / 586.31 20916.0 31.12970034281413 42 20 10 6 6 9.369986052614657 10.672374477237925 0.03750038146972656 6 0.9980462735588019 27.916422313730003 20916.0 24.967492353871844 0.0 - - - - - - - 1200.375 41 8 PLCD1 phospholipase C, delta 1 1639 211 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22669.[MT7]-IYPAGWR.2y3_1.heavy 503.783 / 418.22 N/A 31.12970034281413 42 20 10 6 6 9.369986052614657 10.672374477237925 0.03750038146972656 6 0.9980462735588019 27.916422313730003 3708.0 4.965565952623299 1.0 - - - - - - - 720.0 7 7 PLCD1 phospholipase C, delta 1 1641 211 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22669.[MT7]-IYPAGWR.2y6_1.heavy 503.783 / 749.373 23673.0 31.12970034281413 42 20 10 6 6 9.369986052614657 10.672374477237925 0.03750038146972656 6 0.9980462735588019 27.916422313730003 23673.0 77.64676297338437 1.0 - - - - - - - 720.1428571428571 50 7 PLCD1 phospholipase C, delta 1 1643 211 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22669.[MT7]-IYPAGWR.2b5_1.heavy 503.783 / 646.368 3518.0 31.12970034281413 42 20 10 6 6 9.369986052614657 10.672374477237925 0.03750038146972656 6 0.9980462735588019 27.916422313730003 3518.0 4.4379500657030215 2.0 - - - - - - - 713.25 22 8 PLCD1 phospholipase C, delta 1 1645 212 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38539.[MT7]-NIFGEESNEFTNDWGEK[MT7].2y4_1.heavy 1152.54 / 663.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 1647 212 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38539.[MT7]-NIFGEESNEFTNDWGEK[MT7].2y5_1.heavy 1152.54 / 778.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 1649 212 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38539.[MT7]-NIFGEESNEFTNDWGEK[MT7].2y3_1.heavy 1152.54 / 477.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 1651 212 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38539.[MT7]-NIFGEESNEFTNDWGEK[MT7].2y7_1.heavy 1152.54 / 993.476 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 1653 213 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544862.[MT7]-LC[CAM]STEEETAELLSK[MT7].3b6_1.heavy 633.327 / 864.389 8564.0 35.79090118408203 43 13 10 10 10 0.9134228287802961 66.25477397832664 0.0 3 0.9048967200722673 3.9697310517896462 8564.0 107.92431178569815 0.0 - - - - - - - 217.07692307692307 17 13 INPP1 inositol polyphosphate-1-phosphatase 1655 213 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544862.[MT7]-LC[CAM]STEEETAELLSK[MT7].3b5_1.heavy 633.327 / 735.346 12799.0 35.79090118408203 43 13 10 10 10 0.9134228287802961 66.25477397832664 0.0 3 0.9048967200722673 3.9697310517896462 12799.0 93.04237588652482 0.0 - - - - - - - 237.88235294117646 25 17 INPP1 inositol polyphosphate-1-phosphatase 1657 213 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544862.[MT7]-LC[CAM]STEEETAELLSK[MT7].3y4_1.heavy 633.327 / 604.415 13081.0 35.79090118408203 43 13 10 10 10 0.9134228287802961 66.25477397832664 0.0 3 0.9048967200722673 3.9697310517896462 13081.0 37.04353982300885 0.0 - - - - - - - 253.30769230769232 26 13 INPP1 inositol polyphosphate-1-phosphatase 1659 213 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544862.[MT7]-LC[CAM]STEEETAELLSK[MT7].3b7_1.heavy 633.327 / 993.432 5364.0 35.79090118408203 43 13 10 10 10 0.9134228287802961 66.25477397832664 0.0 3 0.9048967200722673 3.9697310517896462 5364.0 66.33670212765958 0.0 - - - - - - - 180.16666666666666 10 12 INPP1 inositol polyphosphate-1-phosphatase 1661 214 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22906.[MT7]-FIIPQIVK[MT7].2b3_1.heavy 623.412 / 518.346 16617.0 39.62049865722656 44 14 10 10 10 2.476854969173212 40.37378096198364 0.0 3 0.933105331176861 4.744772195934911 16617.0 52.96143338954468 0.0 - - - - - - - 642.8333333333334 33 12 LDHB lactate dehydrogenase B 1663 214 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22906.[MT7]-FIIPQIVK[MT7].2y5_1.heavy 623.412 / 728.479 28572.0 39.62049865722656 44 14 10 10 10 2.476854969173212 40.37378096198364 0.0 3 0.933105331176861 4.744772195934911 28572.0 113.67736113849614 0.0 - - - - - - - 208.27272727272728 57 11 LDHB lactate dehydrogenase B 1665 214 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22906.[MT7]-FIIPQIVK[MT7].2y3_1.heavy 623.412 / 503.367 2204.0 39.62049865722656 44 14 10 10 10 2.476854969173212 40.37378096198364 0.0 3 0.933105331176861 4.744772195934911 2204.0 6.2136710873749745 0.0 - - - - - - - 315.0 4 14 LDHB lactate dehydrogenase B 1667 214 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22906.[MT7]-FIIPQIVK[MT7].2y6_1.heavy 623.412 / 841.563 4239.0 39.62049865722656 44 14 10 10 10 2.476854969173212 40.37378096198364 0.0 3 0.933105331176861 4.744772195934911 4239.0 31.191184279021343 0.0 - - - - - - - 215.8181818181818 8 11 LDHB lactate dehydrogenase B 1669 215 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22659.[MT7]-SLVDTYR.2y4_1.heavy 499.275 / 554.257 3146.0 26.029499053955078 41 17 6 10 8 3.243996211164086 30.82617657069201 0.0 4 0.9780422476040419 8.313244083162601 3146.0 6.5825656322242345 0.0 - - - - - - - 379.1 6 10 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1671 215 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22659.[MT7]-SLVDTYR.2y5_1.heavy 499.275 / 653.325 3630.0 26.029499053955078 41 17 6 10 8 3.243996211164086 30.82617657069201 0.0 4 0.9780422476040419 8.313244083162601 3630.0 6.064272001822131 0.0 - - - - - - - 268.9166666666667 7 12 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1673 215 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22659.[MT7]-SLVDTYR.2b4_1.heavy 499.275 / 559.321 N/A 26.029499053955078 41 17 6 10 8 3.243996211164086 30.82617657069201 0.0 4 0.9780422476040419 8.313244083162601 12179.0 10.110504544689446 2.0 - - - - - - - 790.6 38 5 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1675 215 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22659.[MT7]-SLVDTYR.2y6_1.heavy 499.275 / 766.409 4436.0 26.029499053955078 41 17 6 10 8 3.243996211164086 30.82617657069201 0.0 4 0.9780422476040419 8.313244083162601 4436.0 15.413760204346826 1.0 - - - - - - - 176.0 11 11 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1677 216 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22658.[MT7]-TYPTVK[MT7].2y4_1.heavy 498.802 / 588.384 12502.0 21.569649696350098 41 20 10 3 8 7.406093423482882 13.502395160574784 0.065399169921875 4 0.9960460898558239 19.620305776319135 12502.0 30.658342382780575 0.0 - - - - - - - 622.1428571428571 25 7 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1679 216 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22658.[MT7]-TYPTVK[MT7].2y5_1.heavy 498.802 / 751.447 4299.0 21.569649696350098 41 20 10 3 8 7.406093423482882 13.502395160574784 0.065399169921875 4 0.9960460898558239 19.620305776319135 4299.0 14.279363957597171 1.0 - - - - - - - 185.95238095238096 8 21 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1681 216 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22658.[MT7]-TYPTVK[MT7].2b4_1.heavy 498.802 / 607.321 509.0 21.569649696350098 41 20 10 3 8 7.406093423482882 13.502395160574784 0.065399169921875 4 0.9960460898558239 19.620305776319135 509.0 -0.5 29.0 - - - - - - - 697.75 5 12 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1683 216 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22658.[MT7]-TYPTVK[MT7].2y3_1.heavy 498.802 / 491.331 2432.0 21.569649696350098 41 20 10 3 8 7.406093423482882 13.502395160574784 0.065399169921875 4 0.9960460898558239 19.620305776319135 2432.0 0.7163475699558173 1.0 - - - - - - - 654.5714285714286 5 14 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1685 217 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38074.[MT7]-GQDPSGK[MT7]K[MT7].2y4_1.heavy 624.867 / 707.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1687 217 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38074.[MT7]-GQDPSGK[MT7]K[MT7].2y5_1.heavy 624.867 / 804.518 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1689 217 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38074.[MT7]-GQDPSGK[MT7]K[MT7].2y3_1.heavy 624.867 / 620.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1691 217 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38074.[MT7]-GQDPSGK[MT7]K[MT7].2y6_1.heavy 624.867 / 919.545 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK2 phosphoglycerate kinase 2 1693 218 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22654.[MT7]-LGDFGLAR.2y5_1.heavy 496.786 / 563.33 10253.0 34.11520004272461 42 14 10 10 8 1.9864894691770627 39.66394966584032 0.0 4 0.9311814041891112 4.677209303531464 10253.0 32.48876634418543 0.0 - - - - - - - 330.6 20 10 IRAK1;NEK2 interleukin-1 receptor-associated kinase 1;NIMA (never in mitosis gene a)-related kinase 2 1695 218 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22654.[MT7]-LGDFGLAR.2b6_1.heavy 496.786 / 747.416 2620.0 34.11520004272461 42 14 10 10 8 1.9864894691770627 39.66394966584032 0.0 4 0.9311814041891112 4.677209303531464 2620.0 5.747725149050099 1.0 - - - - - - - 290.1818181818182 5 11 IRAK1;NEK2 interleukin-1 receptor-associated kinase 1;NIMA (never in mitosis gene a)-related kinase 2 1697 218 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22654.[MT7]-LGDFGLAR.2b5_1.heavy 496.786 / 634.332 3190.0 34.11520004272461 42 14 10 10 8 1.9864894691770627 39.66394966584032 0.0 4 0.9311814041891112 4.677209303531464 3190.0 12.276819872768495 1.0 - - - - - - - 278.6666666666667 7 9 IRAK1;NEK2 interleukin-1 receptor-associated kinase 1;NIMA (never in mitosis gene a)-related kinase 2 1699 218 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22654.[MT7]-LGDFGLAR.2y7_1.heavy 496.786 / 735.378 13557.0 34.11520004272461 42 14 10 10 8 1.9864894691770627 39.66394966584032 0.0 4 0.9311814041891112 4.677209303531464 13557.0 22.821415864159395 1.0 - - - - - - - 260.57142857142856 27 7 IRAK1;NEK2 interleukin-1 receptor-associated kinase 1;NIMA (never in mitosis gene a)-related kinase 2 1701 219 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22846.[MT7]-SSNVLLDER.2b3_1.heavy 588.821 / 433.216 2877.0 26.972000122070312 35 5 10 10 10 0.38908191972983575 114.5468419900701 0.0 3 0.6059577510294394 1.8974537244648484 2877.0 1.3092150170648464 0.0 - - - - - - - 739.0 5 8 IRAK1 interleukin-1 receptor-associated kinase 1 1703 219 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22846.[MT7]-SSNVLLDER.2b3_2.heavy 588.821 / 217.112 799.0 26.972000122070312 35 5 10 10 10 0.38908191972983575 114.5468419900701 0.0 3 0.6059577510294394 1.8974537244648484 799.0 2.868722730189284 11.0 - - - - - - - 243.95 3 20 IRAK1 interleukin-1 receptor-associated kinase 1 1705 219 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22846.[MT7]-SSNVLLDER.2y8_1.heavy 588.821 / 945.5 3356.0 26.972000122070312 35 5 10 10 10 0.38908191972983575 114.5468419900701 0.0 3 0.6059577510294394 1.8974537244648484 3356.0 30.749350000000003 0.0 - - - - - - - 189.9375 6 16 IRAK1 interleukin-1 receptor-associated kinase 1 1707 219 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22846.[MT7]-SSNVLLDER.2b7_1.heavy 588.821 / 873.48 10628.0 26.972000122070312 35 5 10 10 10 0.38908191972983575 114.5468419900701 0.0 3 0.6059577510294394 1.8974537244648484 10628.0 76.455175 0.0 - - - - - - - 173.33333333333334 21 6 IRAK1 interleukin-1 receptor-associated kinase 1 1709 220 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544660.[MT7]-ITFPVDFVTGDK[MT7].3b6_1.heavy 542.971 / 817.458 18848.0 41.79742622375488 44 18 10 6 10 3.979430798562825 25.129222007357207 0.03549957275390625 3 0.9819339187464652 9.167995268135044 18848.0 83.10434782608695 0.0 - - - - - - - 299.6666666666667 37 12 PGK2 phosphoglycerate kinase 2 1711 220 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544660.[MT7]-ITFPVDFVTGDK[MT7].3b3_1.heavy 542.971 / 506.31 25419.0 41.79742622375488 44 18 10 6 10 3.979430798562825 25.129222007357207 0.03549957275390625 3 0.9819339187464652 9.167995268135044 25419.0 54.095094086021504 0.0 - - - - - - - 330.6666666666667 50 9 PGK2 phosphoglycerate kinase 2 1713 220 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544660.[MT7]-ITFPVDFVTGDK[MT7].3y4_1.heavy 542.971 / 564.311 37385.0 41.79742622375488 44 18 10 6 10 3.979430798562825 25.129222007357207 0.03549957275390625 3 0.9819339187464652 9.167995268135044 37385.0 149.21458013312852 0.0 - - - - - - - 341.0 74 12 PGK2 phosphoglycerate kinase 2 1715 220 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544660.[MT7]-ITFPVDFVTGDK[MT7].3b7_1.heavy 542.971 / 964.526 3534.0 41.79742622375488 44 18 10 6 10 3.979430798562825 25.129222007357207 0.03549957275390625 3 0.9819339187464652 9.167995268135044 3534.0 13.8225 0.0 - - - - - - - 124.0 7 8 PGK2 phosphoglycerate kinase 2 1717 221 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22842.[MT7]-ELDYFAK[MT7].2y4_1.heavy 587.323 / 672.384 15011.0 32.24399948120117 47 17 10 10 10 3.142523719853931 25.154477942165617 0.0 3 0.9768813646096132 8.101044384073916 15011.0 34.29018126888218 0.0 - - - - - - - 709.5714285714286 30 7 PGK2 phosphoglycerate kinase 2 1719 221 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22842.[MT7]-ELDYFAK[MT7].2b3_1.heavy 587.323 / 502.263 14459.0 32.24399948120117 47 17 10 10 10 3.142523719853931 25.154477942165617 0.0 3 0.9768813646096132 8.101044384073916 14459.0 30.325713578750694 0.0 - - - - - - - 640.2 28 10 PGK2 phosphoglycerate kinase 2 1721 221 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22842.[MT7]-ELDYFAK[MT7].2y3_1.heavy 587.323 / 509.32 6953.0 32.24399948120117 47 17 10 10 10 3.142523719853931 25.154477942165617 0.0 3 0.9768813646096132 8.101044384073916 6953.0 14.53723468230309 0.0 - - - - - - - 330.9166666666667 13 12 PGK2 phosphoglycerate kinase 2 1723 221 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22842.[MT7]-ELDYFAK[MT7].2y6_1.heavy 587.323 / 900.495 6733.0 32.24399948120117 47 17 10 10 10 3.142523719853931 25.154477942165617 0.0 3 0.9768813646096132 8.101044384073916 6733.0 35.43285934216457 0.0 - - - - - - - 140.27272727272728 13 11 PGK2 phosphoglycerate kinase 2 1725 222 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544440.[MT7]-SADTLWDIQK[MT7].3y3_1.heavy 488.936 / 532.357 61756.0 34.4359016418457 47 17 10 10 10 2.6640121164518376 29.876705373168456 0.0 3 0.9733111366466103 7.537488583349649 61756.0 76.27656524215286 0.0 - - - - - - - 399.0 123 4 LDHB lactate dehydrogenase B 1727 222 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544440.[MT7]-SADTLWDIQK[MT7].3b4_1.heavy 488.936 / 519.253 67909.0 34.4359016418457 47 17 10 10 10 2.6640121164518376 29.876705373168456 0.0 3 0.9733111366466103 7.537488583349649 67909.0 80.55412413793104 0.0 - - - - - - - 732.8571428571429 135 7 LDHB lactate dehydrogenase B 1729 222 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544440.[MT7]-SADTLWDIQK[MT7].3b5_1.heavy 488.936 / 632.337 85684.0 34.4359016418457 47 17 10 10 10 2.6640121164518376 29.876705373168456 0.0 3 0.9733111366466103 7.537488583349649 85684.0 97.17214543253553 0.0 - - - - - - - 285.0 171 4 LDHB lactate dehydrogenase B 1731 222 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544440.[MT7]-SADTLWDIQK[MT7].3y4_1.heavy 488.936 / 647.385 60275.0 34.4359016418457 47 17 10 10 10 2.6640121164518376 29.876705373168456 0.0 3 0.9733111366466103 7.537488583349649 60275.0 210.16940789473682 0.0 - - - - - - - 342.0 120 10 LDHB lactate dehydrogenase B 1733 223 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 228772.0 42.36883417765299 24 -3 10 7 10 null 0.0 0.029201507568359375 3 0.0 0.0 228772.0 588.298968278907 0.0 - - - - - - - 320.625 457 8 1735 223 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 461103.0 42.36883417765299 24 -3 10 7 10 null 0.0 0.029201507568359375 3 0.0 0.0 461103.0 455.6216636396514 0.0 - - - - - - - 427.75 922 4 1737 223 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 322659.0 42.36883417765299 24 -3 10 7 10 null 0.0 0.029201507568359375 3 0.0 0.0 322659.0 1325.5180540540541 0.0 - - - - - - - 332.125 645 8 1739 224 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB541550.[MT7]-ELVSGGR.2b3_1.heavy 431.249 / 486.304 3434.0 19.19399929046631 46 20 10 6 10 9.878435496319396 10.123060482326274 0.03520011901855469 3 0.9969422224646475 22.31252397774879 3434.0 13.046200873362446 0.0 - - - - - - - 295.2631578947368 6 19 MCM7 minichromosome maintenance complex component 7 1741 224 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB541550.[MT7]-ELVSGGR.2y5_1.heavy 431.249 / 475.262 6639.0 19.19399929046631 46 20 10 6 10 9.878435496319396 10.123060482326274 0.03520011901855469 3 0.9969422224646475 22.31252397774879 6639.0 3.1867825577442614 0.0 - - - - - - - 291.0833333333333 13 12 MCM7 minichromosome maintenance complex component 7 1743 224 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB541550.[MT7]-ELVSGGR.2y6_1.heavy 431.249 / 588.346 13048.0 19.19399929046631 46 20 10 6 10 9.878435496319396 10.123060482326274 0.03520011901855469 3 0.9969422224646475 22.31252397774879 13048.0 60.52189526184539 0.0 - - - - - - - 302.94117647058823 26 17 MCM7 minichromosome maintenance complex component 7 1745 224 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB541550.[MT7]-ELVSGGR.2b5_1.heavy 431.249 / 630.358 2575.0 19.19399929046631 46 20 10 6 10 9.878435496319396 10.123060482326274 0.03520011901855469 3 0.9969422224646475 22.31252397774879 2575.0 14.569868995633186 0.0 - - - - - - - 234.94736842105263 5 19 MCM7 minichromosome maintenance complex component 7 1747 225 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22911.[MT7]-GLTSVINQK[MT7].2y4_1.heavy 624.382 / 646.4 2831.0 28.96019983291626 44 18 10 6 10 4.682847217401287 21.354529703297537 0.03560066223144531 3 0.9876416175252962 11.090044075951882 2831.0 8.225977154820733 0.0 - - - - - - - 144.33333333333334 5 18 LDHB lactate dehydrogenase B 1749 225 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22911.[MT7]-GLTSVINQK[MT7].2b4_1.heavy 624.382 / 503.295 1966.0 28.96019983291626 44 18 10 6 10 4.682847217401287 21.354529703297537 0.03560066223144531 3 0.9876416175252962 11.090044075951882 1966.0 2.1879173290937994 0.0 - - - - - - - 329.375 3 16 LDHB lactate dehydrogenase B 1751 225 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22911.[MT7]-GLTSVINQK[MT7].2y3_1.heavy 624.382 / 533.316 3303.0 28.96019983291626 44 18 10 6 10 4.682847217401287 21.354529703297537 0.03560066223144531 3 0.9876416175252962 11.090044075951882 3303.0 7.560560874628024 0.0 - - - - - - - 322.94736842105266 6 19 LDHB lactate dehydrogenase B 1753 225 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22911.[MT7]-GLTSVINQK[MT7].2b5_1.heavy 624.382 / 602.363 2674.0 28.96019983291626 44 18 10 6 10 4.682847217401287 21.354529703297537 0.03560066223144531 3 0.9876416175252962 11.090044075951882 2674.0 5.345681167798816 0.0 - - - - - - - 597.3 5 10 LDHB lactate dehydrogenase B 1755 226 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22913.[MT7]-GQDPSGK[MT7]K[MT7].3y3_1.heavy 416.914 / 620.433 1044.0 12.938899993896484 45 15 10 10 10 3.7835363812208564 26.43029957273264 0.0 3 0.9599952783287216 6.149618673036634 1044.0 10.337142857142858 2.0 - - - - - - - 82.85714285714286 3 21 PGK2 phosphoglycerate kinase 2 1757 226 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22913.[MT7]-GQDPSGK[MT7]K[MT7].3y4_1.heavy 416.914 / 707.465 2088.0 12.938899993896484 45 15 10 10 10 3.7835363812208564 26.43029957273264 0.0 3 0.9599952783287216 6.149618673036634 2088.0 91.2 0.0 - - - - - - - 127.6 4 15 PGK2 phosphoglycerate kinase 2 1759 226 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22913.[MT7]-GQDPSGK[MT7]K[MT7].3b3_1.heavy 416.914 / 445.216 43829.0 12.938899993896484 45 15 10 10 10 3.7835363812208564 26.43029957273264 0.0 3 0.9599952783287216 6.149618673036634 43829.0 505.796735632184 0.0 - - - - - - - 228.13333333333333 87 15 PGK2 phosphoglycerate kinase 2 1761 226 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22913.[MT7]-GQDPSGK[MT7]K[MT7].3y5_2.heavy 416.914 / 402.763 82148.0 12.938899993896484 45 15 10 10 10 3.7835363812208564 26.43029957273264 0.0 3 0.9599952783287216 6.149618673036634 82148.0 284.44925287356324 0.0 - - - - - - - 733.7 164 10 PGK2 phosphoglycerate kinase 2 1763 227 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38411.[MT7]-AGVPGVAAPGAPAAAPPAK[MT7].2y4_1.heavy 929.543 / 556.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 1765 227 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38411.[MT7]-AGVPGVAAPGAPAAAPPAK[MT7].2b6_1.heavy 929.543 / 625.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 1767 227 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38411.[MT7]-AGVPGVAAPGAPAAAPPAK[MT7].2b11_1.heavy 929.543 / 992.565 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 1769 227 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38411.[MT7]-AGVPGVAAPGAPAAAPPAK[MT7].2b7_1.heavy 929.543 / 696.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLK1 polo-like kinase 1 1771 228 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544159.[MT7]-LISLQEQLQR.3b4_1.heavy 457.941 / 571.394 32301.0 34.52360153198242 48 18 10 10 10 5.685916406297311 17.587314489753528 0.0 3 0.9822966011109857 9.261711426140014 32301.0 73.19961338533781 0.0 - - - - - - - 266.25 64 12 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1773 228 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544159.[MT7]-LISLQEQLQR.3b5_1.heavy 457.941 / 699.452 19631.0 34.52360153198242 48 18 10 10 10 5.685916406297311 17.587314489753528 0.0 3 0.9822966011109857 9.261711426140014 19631.0 121.68923976608187 0.0 - - - - - - - 228.0 39 11 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1775 228 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544159.[MT7]-LISLQEQLQR.3y4_1.heavy 457.941 / 544.32 84233.0 34.52360153198242 48 18 10 10 10 5.685916406297311 17.587314489753528 0.0 3 0.9822966011109857 9.261711426140014 84233.0 138.05057843996497 0.0 - - - - - - - 342.0 168 2 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1777 228 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544159.[MT7]-LISLQEQLQR.3y5_1.heavy 457.941 / 673.363 84689.0 34.52360153198242 48 18 10 10 10 5.685916406297311 17.587314489753528 0.0 3 0.9822966011109857 9.261711426140014 84689.0 206.89978473091367 0.0 - - - - - - - 228.0 169 6 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1779 229 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22850.[MT7]-ELQNFLK[MT7].2b3_1.heavy 590.352 / 515.295 2735.0 33.949350357055664 42 17 10 5 10 2.933587173585538 27.25970807800558 0.047702789306640625 3 0.9745026669708344 7.712370205042228 2735.0 10.07779022842444 2.0 - - - - - - - 228.0 5 11 PLCD1 phospholipase C, delta 1 1781 229 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22850.[MT7]-ELQNFLK[MT7].2y3_1.heavy 590.352 / 551.367 1481.0 33.949350357055664 42 17 10 5 10 2.933587173585538 27.25970807800558 0.047702789306640625 3 0.9745026669708344 7.712370205042228 1481.0 2.8410146525531705 5.0 - - - - - - - 316.6666666666667 2 9 PLCD1 phospholipase C, delta 1 1783 229 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22850.[MT7]-ELQNFLK[MT7].2y6_1.heavy 590.352 / 906.553 3304.0 33.949350357055664 42 17 10 5 10 2.933587173585538 27.25970807800558 0.047702789306640625 3 0.9745026669708344 7.712370205042228 3304.0 16.133567251461987 0.0 - - - - - - - 217.63636363636363 6 11 PLCD1 phospholipase C, delta 1 1785 229 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22850.[MT7]-ELQNFLK[MT7].2b5_1.heavy 590.352 / 776.406 2735.0 33.949350357055664 42 17 10 5 10 2.933587173585538 27.25970807800558 0.047702789306640625 3 0.9745026669708344 7.712370205042228 2735.0 6.043343372780363 0.0 - - - - - - - 273.6 5 10 PLCD1 phospholipase C, delta 1 1787 230 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22916.[MT7]-GLTSASLSTK[MT7].3b6_1.heavy 418.25 / 661.364 22484.0 25.1658992767334 48 18 10 10 10 8.035033204750219 12.445499284418784 0.0 3 0.9800417808097635 8.72120522230133 22484.0 83.83389846842196 0.0 - - - - - - - 252.0 44 13 PITX2 paired-like homeodomain 2 1789 230 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22916.[MT7]-GLTSASLSTK[MT7].3y3_1.heavy 418.25 / 479.295 68389.0 25.1658992767334 48 18 10 10 10 8.035033204750219 12.445499284418784 0.0 3 0.9800417808097635 8.72120522230133 68389.0 64.69290236524195 0.0 - - - - - - - 273.0 136 6 PITX2 paired-like homeodomain 2 1791 230 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22916.[MT7]-GLTSASLSTK[MT7].3b4_1.heavy 418.25 / 503.295 12569.0 25.1658992767334 48 18 10 10 10 8.035033204750219 12.445499284418784 0.0 3 0.9800417808097635 8.72120522230133 12569.0 17.58149223221833 0.0 - - - - - - - 711.4444444444445 25 9 PITX2 paired-like homeodomain 2 1793 230 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22916.[MT7]-GLTSASLSTK[MT7].3b5_1.heavy 418.25 / 574.332 16317.0 25.1658992767334 48 18 10 10 10 8.035033204750219 12.445499284418784 0.0 3 0.9800417808097635 8.72120522230133 16317.0 43.22563235696687 0.0 - - - - - - - 312.0 32 13 PITX2 paired-like homeodomain 2 1795 231 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22713.[MT7]-QYAIVFR.2b3_1.heavy 520.804 / 507.268 6795.0 33.2859992980957 48 18 10 10 10 1.7518878676855372 36.44066858640768 0.0 3 0.9820991337871852 9.210333494529428 6795.0 7.973582534231895 0.0 - - - - - - - 857.1111111111111 13 9 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1797 231 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22713.[MT7]-QYAIVFR.2y5_1.heavy 520.804 / 605.377 6334.0 33.2859992980957 48 18 10 10 10 1.7518878676855372 36.44066858640768 0.0 3 0.9820991337871852 9.210333494529428 6334.0 12.749072583915193 0.0 - - - - - - - 723.8571428571429 12 7 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1799 231 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22713.[MT7]-QYAIVFR.2b4_1.heavy 520.804 / 620.352 6910.0 33.2859992980957 48 18 10 10 10 1.7518878676855372 36.44066858640768 0.0 3 0.9820991337871852 9.210333494529428 6910.0 3.443117106450158 2.0 - - - - - - - 734.125 17 8 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1801 231 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22713.[MT7]-QYAIVFR.2y6_1.heavy 520.804 / 768.44 16815.0 33.2859992980957 48 18 10 10 10 1.7518878676855372 36.44066858640768 0.0 3 0.9820991337871852 9.210333494529428 16815.0 40.05558312655087 0.0 - - - - - - - 256.0 33 9 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1803 232 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22919.[MT7]-VISGQQLPK[MT7].2y6_1.heavy 629.392 / 814.49 725.0 25.6471004486084 50 20 10 10 10 21.87746656580963 4.570913167627975 0.0 3 0.9990571651248183 40.189298180476754 725.0 8.35884093459851 1.0 - - - - - - - 0.0 1 0 PLCH1;PLCD1 phospholipase C, eta 1;phospholipase C, delta 1 1805 232 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22919.[MT7]-VISGQQLPK[MT7].2y8_1.heavy 629.392 / 1014.61 N/A 25.6471004486084 50 20 10 10 10 21.87746656580963 4.570913167627975 0.0 3 0.9990571651248183 40.189298180476754 1530.0 9.503105590062113 0.0 - - - - - - - 177.4 3 15 PLCH1;PLCD1 phospholipase C, eta 1;phospholipase C, delta 1 1807 232 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22919.[MT7]-VISGQQLPK[MT7].2b7_1.heavy 629.392 / 870.516 1288.0 25.6471004486084 50 20 10 10 10 21.87746656580963 4.570913167627975 0.0 3 0.9990571651248183 40.189298180476754 1288.0 28.940246913580246 0.0 - - - - - - - 161.3 2 10 PLCH1;PLCD1 phospholipase C, eta 1;phospholipase C, delta 1 1809 232 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22919.[MT7]-VISGQQLPK[MT7].2y7_1.heavy 629.392 / 901.522 1771.0 25.6471004486084 50 20 10 10 10 21.87746656580963 4.570913167627975 0.0 3 0.9990571651248183 40.189298180476754 1771.0 13.529999999999998 0.0 - - - - - - - 145.2 3 10 PLCH1;PLCD1 phospholipase C, eta 1;phospholipase C, delta 1 1811 233 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22716.[MT7]-IDLLPDGR.2y5_1.heavy 521.804 / 557.304 25052.0 33.925498962402344 39 9 10 10 10 0.6317913764146528 82.07551592664043 0.0 3 0.8173138123033353 2.84226506698831 25052.0 20.27674277499291 0.0 - - - - - - - 320.4 50 5 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1813 233 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22716.[MT7]-IDLLPDGR.2b4_1.heavy 521.804 / 599.388 61885.0 33.925498962402344 39 9 10 10 10 0.6317913764146528 82.07551592664043 0.0 3 0.8173138123033353 2.84226506698831 61885.0 38.60290508565123 0.0 - - - - - - - 709.0 123 5 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1815 233 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22716.[MT7]-IDLLPDGR.2y6_1.heavy 521.804 / 670.388 26882.0 33.925498962402344 39 9 10 10 10 0.6317913764146528 82.07551592664043 0.0 3 0.8173138123033353 2.84226506698831 26882.0 34.872498002727895 1.0 - - - - - - - 257.25 53 4 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1817 233 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22716.[MT7]-IDLLPDGR.2y7_1.heavy 521.804 / 785.415 36147.0 33.925498962402344 39 9 10 10 10 0.6317913764146528 82.07551592664043 0.0 3 0.8173138123033353 2.84226506698831 36147.0 8.203684146936657 1.0 - - - - - - - 343.0 75 3 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1819 234 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542611.[MT7]-DSLLGDK[MT7].2y4_1.heavy 518.3 / 576.347 3299.0 26.368499755859375 38 10 10 10 8 1.7729182267673795 44.94626745591354 0.0 4 0.8499212867726244 3.144961575457945 3299.0 3.455444290976059 2.0 - - - - - - - 747.0 8 7 MCM7 minichromosome maintenance complex component 7 1821 234 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542611.[MT7]-DSLLGDK[MT7].2b4_1.heavy 518.3 / 573.336 4183.0 26.368499755859375 38 10 10 10 8 1.7729182267673795 44.94626745591354 0.0 4 0.8499212867726244 3.144961575457945 4183.0 7.562015961505155 1.0 - - - - - - - 744.25 9 8 MCM7 minichromosome maintenance complex component 7 1823 234 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542611.[MT7]-DSLLGDK[MT7].2b6_1.heavy 518.3 / 745.385 6034.0 26.368499755859375 38 10 10 10 8 1.7729182267673795 44.94626745591354 0.0 4 0.8499212867726244 3.144961575457945 6034.0 19.238840579710143 0.0 - - - - - - - 228.57894736842104 12 19 MCM7 minichromosome maintenance complex component 7 1825 234 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542611.[MT7]-DSLLGDK[MT7].2y6_1.heavy 518.3 / 776.463 4264.0 26.368499755859375 38 10 10 10 8 1.7729182267673795 44.94626745591354 0.0 4 0.8499212867726244 3.144961575457945 4264.0 16.420372670807453 1.0 - - - - - - - 254.66666666666666 8 18 MCM7 minichromosome maintenance complex component 7 1827 235 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38184.[MT7]-SHSGGELESLAR.2y9_1.heavy 693.858 / 931.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 1829 235 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38184.[MT7]-SHSGGELESLAR.2y6_1.heavy 693.858 / 688.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 1831 235 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38184.[MT7]-SHSGGELESLAR.2y10_1.heavy 693.858 / 1018.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 1833 235 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38184.[MT7]-SHSGGELESLAR.2y11_1.heavy 693.858 / 1155.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) 1835 236 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22854.[MT7]-C[CAM]FSIVFK[MT7].2b3_1.heavy 594.838 / 539.24 685.0 37.12062358856201 38 12 10 6 10 0.9644430513928662 62.93146141658055 0.035701751708984375 3 0.8848557736642041 3.6014982498100774 685.0 0.5601635514018691 25.0 - - - - - - - 669.4545454545455 3 11 PLCD1 phospholipase C, delta 1 1837 236 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22854.[MT7]-C[CAM]FSIVFK[MT7].2y5_1.heavy 594.838 / 737.468 1798.0 37.12062358856201 38 12 10 6 10 0.9644430513928662 62.93146141658055 0.035701751708984375 3 0.8848557736642041 3.6014982498100774 1798.0 4.1935860058309045 0.0 - - - - - - - 218.94444444444446 3 18 PLCD1 phospholipase C, delta 1 1839 236 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22854.[MT7]-C[CAM]FSIVFK[MT7].2y3_1.heavy 594.838 / 537.352 2055.0 37.12062358856201 38 12 10 6 10 0.9644430513928662 62.93146141658055 0.035701751708984375 3 0.8848557736642041 3.6014982498100774 2055.0 3.119977090076003 1.0 - - - - - - - 628.0 4 15 PLCD1 phospholipase C, delta 1 1841 236 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22854.[MT7]-C[CAM]FSIVFK[MT7].2y6_1.heavy 594.838 / 884.536 2655.0 37.12062358856201 38 12 10 6 10 0.9644430513928662 62.93146141658055 0.035701751708984375 3 0.8848557736642041 3.6014982498100774 2655.0 10.324715544917245 0.0 - - - - - - - 199.91666666666666 5 12 PLCD1 phospholipase C, delta 1 1843 237 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542816.[MT7]-IVVVTAGVR.2y8_1.heavy 529.346 / 800.499 77405.0 30.106300354003906 43 17 10 6 10 4.5497861427327635 21.979055028713162 0.03079986572265625 3 0.9735427395348484 7.570555271639205 77405.0 460.2022512822882 0.0 - - - - - - - 233.375 154 8 LDHB lactate dehydrogenase B 1845 237 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542816.[MT7]-IVVVTAGVR.2y5_1.heavy 529.346 / 503.294 28687.0 30.106300354003906 43 17 10 6 10 4.5497861427327635 21.979055028713162 0.03079986572265625 3 0.9735427395348484 7.570555271639205 28687.0 4.6868230767961725 0.0 - - - - - - - 764.0 57 3 LDHB lactate dehydrogenase B 1847 237 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542816.[MT7]-IVVVTAGVR.2y6_1.heavy 529.346 / 602.362 39466.0 30.106300354003906 43 17 10 6 10 4.5497861427327635 21.979055028713162 0.03079986572265625 3 0.9735427395348484 7.570555271639205 39466.0 27.092596931514457 0.0 - - - - - - - 745.1111111111111 78 9 LDHB lactate dehydrogenase B 1849 237 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542816.[MT7]-IVVVTAGVR.2y7_1.heavy 529.346 / 701.43 54149.0 30.106300354003906 43 17 10 6 10 4.5497861427327635 21.979055028713162 0.03079986572265625 3 0.9735427395348484 7.570555271639205 54149.0 94.01826284628106 0.0 - - - - - - - 266.57142857142856 108 7 LDHB lactate dehydrogenase B 1851 238 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542111.[MT7]-FPGLEK[MT7].2b3_1.heavy 489.797 / 446.252 2645.0 30.26935052871704 34 14 8 6 6 5.047407448669448 19.81215129092879 0.030599594116210938 6 0.9328479837611883 4.735567621758404 2645.0 0.5819581958195819 2.0 - - - - - - - 1198.125 31 8 INPP1 inositol polyphosphate-1-phosphatase 1853 238 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542111.[MT7]-FPGLEK[MT7].2y4_1.heavy 489.797 / 590.363 3967.0 30.26935052871704 34 14 8 6 6 5.047407448669448 19.81215129092879 0.030599594116210938 6 0.9328479837611883 4.735567621758404 3967.0 0.8204407468820452 2.0 - - - - - - - 1251.5714285714287 95 7 INPP1 inositol polyphosphate-1-phosphatase 1855 238 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542111.[MT7]-FPGLEK[MT7].2y5_1.heavy 489.797 / 687.416 35952.0 30.26935052871704 34 14 8 6 6 5.047407448669448 19.81215129092879 0.030599594116210938 6 0.9328479837611883 4.735567621758404 35952.0 135.32716811226976 0.0 - - - - - - - 279.84615384615387 71 13 INPP1 inositol polyphosphate-1-phosphatase 1857 238 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542111.[MT7]-FPGLEK[MT7].2y3_1.heavy 489.797 / 533.341 2232.0 30.26935052871704 34 14 8 6 6 5.047407448669448 19.81215129092879 0.030599594116210938 6 0.9328479837611883 4.735567621758404 2232.0 2.79 6.0 - - - - - - - 793.6 6 10 INPP1 inositol polyphosphate-1-phosphatase 1859 239 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544840.[MT7]-AGVPGVAAPGAPAAAPPAK[MT7].3b6_1.heavy 620.031 / 625.379 3989.0 26.287900924682617 50 20 10 10 10 4.335126751171466 23.06737628213001 0.0 3 0.9901517214711317 12.425822398944842 3989.0 7.109638301882841 0.0 - - - - - - - 223.5 7 10 PLK1 polo-like kinase 1 1861 239 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544840.[MT7]-AGVPGVAAPGAPAAAPPAK[MT7].3b5_1.heavy 620.031 / 526.311 3590.0 26.287900924682617 50 20 10 10 10 4.335126751171466 23.06737628213001 0.0 3 0.9901517214711317 12.425822398944842 3590.0 16.921343532169516 0.0 - - - - - - - 208.84615384615384 7 13 PLK1 polo-like kinase 1 1863 239 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544840.[MT7]-AGVPGVAAPGAPAAAPPAK[MT7].3y4_1.heavy 620.031 / 556.357 21782.0 26.287900924682617 50 20 10 10 10 4.335126751171466 23.06737628213001 0.0 3 0.9901517214711317 12.425822398944842 21782.0 59.24312301173475 0.0 - - - - - - - 285.9166666666667 43 12 PLK1 polo-like kinase 1 1865 239 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544840.[MT7]-AGVPGVAAPGAPAAAPPAK[MT7].3b8_1.heavy 620.031 / 767.453 7979.0 26.287900924682617 50 20 10 10 10 4.335126751171466 23.06737628213001 0.0 3 0.9901517214711317 12.425822398944842 7979.0 48.02407523510972 0.0 - - - - - - - 190.3846153846154 15 13 PLK1 polo-like kinase 1 1867 240 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB541926.[MT7]-DVLDVYIEHR.3b4_1.heavy 468.253 / 587.316 139146.0 34.299400329589844 48 18 10 10 10 5.677944152035618 17.61200838232068 0.0 3 0.9870610535654247 10.83785961984295 139146.0 249.82380692746747 0.0 - - - - - - - 279.3333333333333 278 9 MCM7 minichromosome maintenance complex component 7 1869 240 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB541926.[MT7]-DVLDVYIEHR.3b5_1.heavy 468.253 / 686.384 36930.0 34.299400329589844 48 18 10 10 10 5.677944152035618 17.61200838232068 0.0 3 0.9870610535654247 10.83785961984295 36930.0 74.97200446707286 1.0 - - - - - - - 259.72727272727275 81 11 MCM7 minichromosome maintenance complex component 7 1871 240 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB541926.[MT7]-DVLDVYIEHR.3y4_1.heavy 468.253 / 554.305 78891.0 34.299400329589844 48 18 10 10 10 5.677944152035618 17.61200838232068 0.0 3 0.9870610535654247 10.83785961984295 78891.0 175.37373194419573 0.0 - - - - - - - 285.6 157 10 MCM7 minichromosome maintenance complex component 7 1873 240 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB541926.[MT7]-DVLDVYIEHR.3y5_1.heavy 468.253 / 717.368 31900.0 34.299400329589844 48 18 10 10 10 5.677944152035618 17.61200838232068 0.0 3 0.9870610535654247 10.83785961984295 31900.0 310.9397473275024 0.0 - - - - - - - 214.375 63 8 MCM7 minichromosome maintenance complex component 7 1875 241 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543497.[MT7]-IGDFGLATK[MT7].2y8_1.heavy 605.358 / 952.522 1606.0 33.315931955973305 38 13 10 5 10 1.1529355333643854 49.99886694069582 0.04489898681640625 3 0.9266074280788391 4.527345830118016 1606.0 13.971315739510157 0.0 - - - - - - - 177.45454545454547 3 11 PLK1 polo-like kinase 1 1877 241 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543497.[MT7]-IGDFGLATK[MT7].2y5_1.heavy 605.358 / 633.405 2524.0 33.315931955973305 38 13 10 5 10 1.1529355333643854 49.99886694069582 0.04489898681640625 3 0.9266074280788391 4.527345830118016 2524.0 13.945311036789297 1.0 - - - - - - - 229.33333333333334 5 9 PLK1 polo-like kinase 1 1879 241 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543497.[MT7]-IGDFGLATK[MT7].2b4_1.heavy 605.358 / 577.31 N/A 33.315931955973305 38 13 10 5 10 1.1529355333643854 49.99886694069582 0.04489898681640625 3 0.9266074280788391 4.527345830118016 3098.0 3.386135198993525 9.0 - - - - - - - 1290.625 8 8 PLK1 polo-like kinase 1 1881 241 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB543497.[MT7]-IGDFGLATK[MT7].2y6_1.heavy 605.358 / 780.474 4130.0 33.315931955973305 38 13 10 5 10 1.1529355333643854 49.99886694069582 0.04489898681640625 3 0.9266074280788391 4.527345830118016 4130.0 13.219799033636711 0.0 - - - - - - - 305.75 8 12 PLK1 polo-like kinase 1 1883 242 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38422.[MT7]-YQHLPYIQILSTK[MT7].3b4_1.heavy 631.368 / 686.374 2412.0 37.45759963989258 43 20 10 3 10 17.37015585412829 5.757000733889987 0.06780242919921875 3 0.9979974533016441 27.573921975576976 2412.0 17.24269631466336 1.0 - - - - - - - 676.8571428571429 4 7 INPP5K inositol polyphosphate-5-phosphatase K 1885 242 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38422.[MT7]-YQHLPYIQILSTK[MT7].3b3_1.heavy 631.368 / 573.29 3532.0 37.45759963989258 43 20 10 3 10 17.37015585412829 5.757000733889987 0.06780242919921875 3 0.9979974533016441 27.573921975576976 3532.0 12.868527131782944 1.0 - - - - - - - 243.91666666666666 7 12 INPP5K inositol polyphosphate-5-phosphatase K 1887 242 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38422.[MT7]-YQHLPYIQILSTK[MT7].3y4_1.heavy 631.368 / 592.379 4308.0 37.45759963989258 43 20 10 3 10 17.37015585412829 5.757000733889987 0.06780242919921875 3 0.9979974533016441 27.573921975576976 4308.0 5.280774193548387 1.0 - - - - - - - 205.3846153846154 8 13 INPP5K inositol polyphosphate-5-phosphatase K 1889 242 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38422.[MT7]-YQHLPYIQILSTK[MT7].3y5_1.heavy 631.368 / 705.463 1637.0 37.45759963989258 43 20 10 3 10 17.37015585412829 5.757000733889987 0.06780242919921875 3 0.9979974533016441 27.573921975576976 1637.0 5.964263565891472 0.0 - - - - - - - 224.83333333333334 3 18 INPP5K inositol polyphosphate-5-phosphatase K 1891 243 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22924.[MT7]-FHVEEEGK[MT7].3y3_1.heavy 421.559 / 477.279 41668.0 21.762100219726562 48 20 10 10 8 14.55290868098252 6.871478560892655 0.0 4 0.9942690731837764 16.29454774221171 41668.0 81.88462833577589 0.0 - - - - - - - 685.7777777777778 83 9 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 1893 243 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22924.[MT7]-FHVEEEGK[MT7].3b3_1.heavy 421.559 / 528.305 13078.0 21.762100219726562 48 20 10 10 8 14.55290868098252 6.871478560892655 0.0 4 0.9942690731837764 16.29454774221171 13078.0 78.33710886601831 1.0 - - - - - - - 242.61904761904762 42 21 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 1895 243 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22924.[MT7]-FHVEEEGK[MT7].3y4_1.heavy 421.559 / 606.321 35837.0 21.762100219726562 48 20 10 10 8 14.55290868098252 6.871478560892655 0.0 4 0.9942690731837764 16.29454774221171 35837.0 192.11318375845912 0.0 - - - - - - - 215.05 71 20 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 1897 243 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22924.[MT7]-FHVEEEGK[MT7].3y5_1.heavy 421.559 / 735.364 10134.0 21.762100219726562 48 20 10 10 8 14.55290868098252 6.871478560892655 0.0 4 0.9942690731837764 16.29454774221171 10134.0 135.55609786569497 0.0 - - - - - - - 100.77777777777777 20 18 PGK1;PGK2 phosphoglycerate kinase 1;phosphoglycerate kinase 2 1899 244 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38424.[MT7]-LC[CAM]STEEETAELLSK[MT7].2b8_1.heavy 949.487 / 1094.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 1901 244 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38424.[MT7]-LC[CAM]STEEETAELLSK[MT7].2y4_1.heavy 949.487 / 604.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 1903 244 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38424.[MT7]-LC[CAM]STEEETAELLSK[MT7].2b6_1.heavy 949.487 / 864.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 1905 244 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38424.[MT7]-LC[CAM]STEEETAELLSK[MT7].2b7_1.heavy 949.487 / 993.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - INPP1 inositol polyphosphate-1-phosphatase 1907 245 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22921.[MT7]-ALSSPGQPSK[MT7].2y8_1.heavy 630.364 / 931.497 2196.0 19.282100677490234 46 16 10 10 10 3.0053017043332084 33.27452942771587 0.0 3 0.9650837510752747 6.585317980032583 2196.0 20.563699421965318 0.0 - - - - - - - 115.75 4 12 SMAD5 SMAD family member 5 1909 245 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22921.[MT7]-ALSSPGQPSK[MT7].2b4_1.heavy 630.364 / 503.295 2601.0 19.282100677490234 46 16 10 10 10 3.0053017043332084 33.27452942771587 0.0 3 0.9650837510752747 6.585317980032583 2601.0 13.503347763347765 0.0 - - - - - - - 155.5 5 16 SMAD5 SMAD family member 5 1911 245 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22921.[MT7]-ALSSPGQPSK[MT7].2y6_1.heavy 630.364 / 757.432 5664.0 19.282100677490234 46 16 10 10 10 3.0053017043332084 33.27452942771587 0.0 3 0.9650837510752747 6.585317980032583 5664.0 53.16900532993019 0.0 - - - - - - - 165.21428571428572 11 14 SMAD5 SMAD family member 5 1913 245 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22921.[MT7]-ALSSPGQPSK[MT7].2y7_1.heavy 630.364 / 844.464 1560.0 19.282100677490234 46 16 10 10 10 3.0053017043332084 33.27452942771587 0.0 3 0.9650837510752747 6.585317980032583 1560.0 21.51724137931035 0.0 - - - - - - - 96.66666666666667 3 9 SMAD5 SMAD family member 5 1915 246 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542014.[MT7]-LFGLAQR.2y5_1.heavy 474.791 / 544.32 14045.0 34.06850051879883 50 20 10 10 10 9.522869878304853 10.501036061389595 0.0 3 0.9970457270894345 22.700221087703916 14045.0 31.871278494488976 0.0 - - - - - - - 641.7142857142857 28 7 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1917 246 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542014.[MT7]-LFGLAQR.2b4_1.heavy 474.791 / 575.367 8979.0 34.06850051879883 50 20 10 10 10 9.522869878304853 10.501036061389595 0.0 3 0.9970457270894345 22.700221087703916 8979.0 20.790738060781475 0.0 - - - - - - - 641.7142857142857 17 7 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1919 246 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542014.[MT7]-LFGLAQR.2y6_1.heavy 474.791 / 691.389 59748.0 34.06850051879883 50 20 10 10 10 9.522869878304853 10.501036061389595 0.0 3 0.9970457270894345 22.700221087703916 59748.0 207.7063487069779 0.0 - - - - - - - 217.22222222222223 119 9 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1921 246 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542014.[MT7]-LFGLAQR.2b5_1.heavy 474.791 / 646.404 7022.0 34.06850051879883 50 20 10 10 10 9.522869878304853 10.501036061389595 0.0 3 0.9970457270894345 22.700221087703916 7022.0 27.477391304347826 0.0 - - - - - - - 264.5 14 10 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1923 247 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22920.[MT7]-GLPHVIYC[CAM]R.3y3_1.heavy 420.233 / 498.213 10226.0 28.05660057067871 43 20 10 3 10 6.449479531562452 15.50512712081962 0.0764007568359375 3 0.9927750523012941 14.510527124184513 10226.0 37.7369537601626 0.0 - - - - - - - 236.28571428571428 20 14 SMAD1;SMAD2;SMAD3;SMAD5;SMAD9 SMAD family member 1;SMAD family member 2;SMAD family member 3;SMAD family member 5;SMAD family member 9 1925 247 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22920.[MT7]-GLPHVIYC[CAM]R.3b4_1.heavy 420.233 / 549.326 5690.0 28.05660057067871 43 20 10 3 10 6.449479531562452 15.50512712081962 0.0764007568359375 3 0.9927750523012941 14.510527124184513 5690.0 20.838571394011726 0.0 - - - - - - - 666.3333333333334 11 9 SMAD1;SMAD2;SMAD3;SMAD5;SMAD9 SMAD family member 1;SMAD family member 2;SMAD family member 3;SMAD family member 5;SMAD family member 9 1927 247 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22920.[MT7]-GLPHVIYC[CAM]R.3y4_1.heavy 420.233 / 611.297 14762.0 28.05660057067871 43 20 10 3 10 6.449479531562452 15.50512712081962 0.0764007568359375 3 0.9927750523012941 14.510527124184513 14762.0 40.58908294562715 0.0 - - - - - - - 252.71428571428572 29 14 SMAD1;SMAD2;SMAD3;SMAD5;SMAD9 SMAD family member 1;SMAD family member 2;SMAD family member 3;SMAD family member 5;SMAD family member 9 1929 247 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22920.[MT7]-GLPHVIYC[CAM]R.3y5_1.heavy 420.233 / 710.365 7151.0 28.05660057067871 43 20 10 3 10 6.449479531562452 15.50512712081962 0.0764007568359375 3 0.9927750523012941 14.510527124184513 7151.0 60.03908786525974 0.0 - - - - - - - 161.6 14 10 SMAD1;SMAD2;SMAD3;SMAD5;SMAD9 SMAD family member 1;SMAD family member 2;SMAD family member 3;SMAD family member 5;SMAD family member 9 1931 248 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544784.[MT7]-DLVEEEAEEAGVALR.3b6_1.heavy 591.971 / 859.417 14867.0 37.84639930725098 44 18 10 6 10 10.625775339511936 9.411077950062626 0.03440093994140625 3 0.982756926695207 9.384886025003354 14867.0 68.51247429697659 0.0 - - - - - - - 170.76923076923077 29 13 IRAK1 interleukin-1 receptor-associated kinase 1 1933 248 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544784.[MT7]-DLVEEEAEEAGVALR.3y6_1.heavy 591.971 / 586.367 24864.0 37.84639930725098 44 18 10 6 10 10.625775339511936 9.411077950062626 0.03440093994140625 3 0.982756926695207 9.384886025003354 24864.0 12.882273834659737 0.0 - - - - - - - 1184.0 49 7 IRAK1 interleukin-1 receptor-associated kinase 1 1935 248 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544784.[MT7]-DLVEEEAEEAGVALR.3b4_1.heavy 591.971 / 601.331 26146.0 37.84639930725098 44 18 10 6 10 10.625775339511936 9.411077950062626 0.03440093994140625 3 0.982756926695207 9.384886025003354 26146.0 56.192878048780486 0.0 - - - - - - - 736.875 52 8 IRAK1 interleukin-1 receptor-associated kinase 1 1937 248 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544784.[MT7]-DLVEEEAEEAGVALR.3y5_1.heavy 591.971 / 515.33 42295.0 37.84639930725098 44 18 10 6 10 10.625775339511936 9.411077950062626 0.03440093994140625 3 0.982756926695207 9.384886025003354 42295.0 86.75979275586305 0.0 - - - - - - - 658.0 84 10 IRAK1 interleukin-1 receptor-associated kinase 1 1939 249 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22533.[MT7]-SQSVK[MT7].2b3_1.heavy 418.758 / 447.232 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1941 249 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22533.[MT7]-SQSVK[MT7].2y4_1.heavy 418.758 / 605.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1943 249 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22533.[MT7]-SQSVK[MT7].2y4_2.heavy 418.758 / 303.191 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1945 249 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22533.[MT7]-SQSVK[MT7].2y3_1.heavy 418.758 / 477.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 1947 250 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22530.[MT7]-IVADK[MT7].2b3_1.heavy 417.27 / 428.299 4301.0 20.218599319458008 42 12 10 10 10 1.346729293073019 62.59373185570173 0.0 3 0.8993895739872374 3.857718858097192 4301.0 20.272190354337706 2.0 - - - - - - - 703.4285714285714 9 7 THEMIS;LDHB thymocyte selection associated;lactate dehydrogenase B 1949 250 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22530.[MT7]-IVADK[MT7].2y4_1.heavy 417.27 / 576.347 34525.0 20.218599319458008 42 12 10 10 10 1.346729293073019 62.59373185570173 0.0 3 0.8993895739872374 3.857718858097192 34525.0 135.6899310630307 0.0 - - - - - - - 694.5454545454545 69 11 THEMIS;LDHB thymocyte selection associated;lactate dehydrogenase B 1951 250 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22530.[MT7]-IVADK[MT7].2b4_1.heavy 417.27 / 543.326 16470.0 20.218599319458008 42 12 10 10 10 1.346729293073019 62.59373185570173 0.0 3 0.8993895739872374 3.857718858097192 16470.0 32.940564636395024 0.0 - - - - - - - 745.25 32 12 THEMIS;LDHB thymocyte selection associated;lactate dehydrogenase B 1953 250 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22530.[MT7]-IVADK[MT7].2y3_1.heavy 417.27 / 477.279 18112.0 20.218599319458008 42 12 10 10 10 1.346729293073019 62.59373185570173 0.0 3 0.8993895739872374 3.857718858097192 18112.0 40.13042051996106 0.0 - - - - - - - 618.3076923076923 36 13 THEMIS;LDHB thymocyte selection associated;lactate dehydrogenase B 1955 251 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22927.[MT7]-LLFPPTYK[MT7].2b3_1.heavy 633.889 / 518.346 5315.0 36.558401107788086 30 10 10 6 4 0.8961886130363745 72.24607449022584 0.034801483154296875 8 0.8280067819349948 2.9320807634272965 5315.0 9.595370838024005 0.0 - - - - - - - 1245.875 10 8 INPP5K inositol polyphosphate-5-phosphatase K 1957 251 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22927.[MT7]-LLFPPTYK[MT7].2y4_1.heavy 633.889 / 652.379 664.0 36.558401107788086 30 10 10 6 4 0.8961886130363745 72.24607449022584 0.034801483154296875 8 0.8280067819349948 2.9320807634272965 664.0 0.2798735511064278 19.0 - - - - - - - 332.5 2 14 INPP5K inositol polyphosphate-5-phosphatase K 1959 251 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22927.[MT7]-LLFPPTYK[MT7].2y5_1.heavy 633.889 / 749.431 6643.0 36.558401107788086 30 10 10 6 4 0.8961886130363745 72.24607449022584 0.034801483154296875 8 0.8280067819349948 2.9320807634272965 6643.0 33.6662181724541 0.0 - - - - - - - 2724.8571428571427 13 7 INPP5K inositol polyphosphate-5-phosphatase K 1961 251 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22927.[MT7]-LLFPPTYK[MT7].2y3_1.heavy 633.889 / 555.326 759.0 36.558401107788086 30 10 10 6 4 0.8961886130363745 72.24607449022584 0.034801483154296875 8 0.8280067819349948 2.9320807634272965 759.0 0.4572289156626506 17.0 - - - - - - - 279.72222222222223 2 18 INPP5K inositol polyphosphate-5-phosphatase K 1963 252 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542310.[MT7]-AVDALVK[MT7].2y4_1.heavy 502.323 / 574.404 15569.0 26.89539909362793 48 20 10 10 8 7.521676000021136 13.29490927284278 0.0 4 0.9951055010766567 17.633192720190436 15569.0 24.80863674467905 0.0 - - - - - - - 758.1111111111111 31 9 SMAD1;SMAD5 SMAD family member 1;SMAD family member 5 1965 252 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542310.[MT7]-AVDALVK[MT7].2y5_1.heavy 502.323 / 689.431 9309.0 26.89539909362793 48 20 10 10 8 7.521676000021136 13.29490927284278 0.0 4 0.9951055010766567 17.633192720190436 9309.0 44.84748753542008 0.0 - - - - - - - 722.2857142857143 18 7 SMAD1;SMAD5 SMAD family member 1;SMAD family member 5 1967 252 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542310.[MT7]-AVDALVK[MT7].2b4_1.heavy 502.323 / 501.279 9710.0 26.89539909362793 48 20 10 10 8 7.521676000021136 13.29490927284278 0.0 4 0.9951055010766567 17.633192720190436 9710.0 6.80607476635514 1.0 - - - - - - - 482.0 19 1 SMAD1;SMAD5 SMAD family member 1;SMAD family member 5 1969 252 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542310.[MT7]-AVDALVK[MT7].2y6_1.heavy 502.323 / 788.5 7142.0 26.89539909362793 48 20 10 10 8 7.521676000021136 13.29490927284278 0.0 4 0.9951055010766567 17.633192720190436 7142.0 13.8712470903659 0.0 - - - - - - - 240.77777777777777 14 9 SMAD1;SMAD5 SMAD family member 1;SMAD family member 5 1971 253 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544849.[MT7]-QQEALFQLLIEEK[MT7].3y3_1.heavy 626.359 / 549.3 40235.0 44.59980010986328 40 13 10 7 10 3.6973578051116793 27.046341001065077 0.026397705078125 3 0.9254399795985587 4.491312574644265 40235.0 191.22594005138453 0.0 - - - - - - - 230.36363636363637 80 22 INPP1 inositol polyphosphate-1-phosphatase 1973 253 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544849.[MT7]-QQEALFQLLIEEK[MT7].3b4_1.heavy 626.359 / 601.306 29191.0 44.59980010986328 40 13 10 7 10 3.6973578051116793 27.046341001065077 0.026397705078125 3 0.9254399795985587 4.491312574644265 29191.0 195.37730290157677 0.0 - - - - - - - 161.47619047619048 58 21 INPP1 inositol polyphosphate-1-phosphatase 1975 253 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544849.[MT7]-QQEALFQLLIEEK[MT7].3b5_1.heavy 626.359 / 714.39 54443.0 44.59980010986328 40 13 10 7 10 3.6973578051116793 27.046341001065077 0.026397705078125 3 0.9254399795985587 4.491312574644265 54443.0 217.08860696252043 0.0 - - - - - - - 149.6315789473684 108 19 INPP1 inositol polyphosphate-1-phosphatase 1977 253 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544849.[MT7]-QQEALFQLLIEEK[MT7].3y4_1.heavy 626.359 / 662.384 44077.0 44.59980010986328 40 13 10 7 10 3.6973578051116793 27.046341001065077 0.026397705078125 3 0.9254399795985587 4.491312574644265 44077.0 402.98397172822627 0.0 - - - - - - - 176.1818181818182 88 22 INPP1 inositol polyphosphate-1-phosphatase 1979 254 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544643.[MT7]-TLADVLVQEVIK[MT7].3y3_1.heavy 539.334 / 503.367 339157.0 45.8911018371582 42 12 10 10 10 1.0407064338661156 56.95529146625931 0.0 3 0.8845105829993047 3.5960038578262394 339157.0 627.1392254174855 0.0 - - - - - - - 387.7142857142857 678 7 INPP1 inositol polyphosphate-1-phosphatase 1981 254 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544643.[MT7]-TLADVLVQEVIK[MT7].3b6_1.heavy 539.334 / 757.458 478594.0 45.8911018371582 42 12 10 10 10 1.0407064338661156 56.95529146625931 0.0 3 0.8845105829993047 3.5960038578262394 478594.0 2745.8451398767183 0.0 - - - - - - - 153.0909090909091 957 11 INPP1 inositol polyphosphate-1-phosphatase 1983 254 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544643.[MT7]-TLADVLVQEVIK[MT7].3b4_1.heavy 539.334 / 545.305 445740.0 45.8911018371582 42 12 10 10 10 1.0407064338661156 56.95529146625931 0.0 3 0.8845105829993047 3.5960038578262394 445740.0 3048.670241433021 0.0 - - - - - - - 119.36363636363636 891 11 INPP1 inositol polyphosphate-1-phosphatase 1985 254 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544643.[MT7]-TLADVLVQEVIK[MT7].3b5_1.heavy 539.334 / 644.374 658690.0 45.8911018371582 42 12 10 10 10 1.0407064338661156 56.95529146625931 0.0 3 0.8845105829993047 3.5960038578262394 658690.0 2836.052059031814 0.0 - - - - - - - 140.1818181818182 1317 11 INPP1 inositol polyphosphate-1-phosphatase 1987 255 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38566.[MT7]-QFTYYPLVEDK[MT7]EEVQRK[MT7].4b4_1.heavy 651.856 / 684.347 4155.0 31.78922462463379 35 10 10 5 10 0.7505878019556034 70.04714189675207 0.0402984619140625 3 0.8288721662564454 2.93971145035544 4155.0 14.674210555835996 0.0 - - - - - - - 188.64705882352942 8 17 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1989 255 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38566.[MT7]-QFTYYPLVEDK[MT7]EEVQRK[MT7].4b5_1.heavy 651.856 / 847.411 1511.0 31.78922462463379 35 10 10 5 10 0.7505878019556034 70.04714189675207 0.0402984619140625 3 0.8288721662564454 2.93971145035544 1511.0 19.968124577099463 0.0 - - - - - - - 181.78571428571428 3 14 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1991 255 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38566.[MT7]-QFTYYPLVEDK[MT7]EEVQRK[MT7].4y7_2.heavy 651.856 / 602.866 1417.0 31.78922462463379 35 10 10 5 10 0.7505878019556034 70.04714189675207 0.0402984619140625 3 0.8288721662564454 2.93971145035544 1417.0 6.5349482506063445 0.0 - - - - - - - 188.8 2 10 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1993 255 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38566.[MT7]-QFTYYPLVEDK[MT7]EEVQRK[MT7].4b3_1.heavy 651.856 / 521.284 1322.0 31.78922462463379 35 10 10 5 10 0.7505878019556034 70.04714189675207 0.0402984619140625 3 0.8288721662564454 2.93971145035544 1322.0 1.6652557319223988 1.0 - - - - - - - 232.46153846153845 2 13 NFKB2 nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) 1995 256 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22824.[MT7]-LQVSHRK[MT7].2y4_1.heavy 578.364 / 671.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD1;SMAD2;SMAD3;SMAD5;SMAD9 SMAD family member 1;SMAD family member 2;SMAD family member 3;SMAD family member 5;SMAD family member 9 1997 256 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22824.[MT7]-LQVSHRK[MT7].2y5_1.heavy 578.364 / 770.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD1;SMAD2;SMAD3;SMAD5;SMAD9 SMAD family member 1;SMAD family member 2;SMAD family member 3;SMAD family member 5;SMAD family member 9 1999 256 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22824.[MT7]-LQVSHRK[MT7].2y3_1.heavy 578.364 / 584.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD1;SMAD2;SMAD3;SMAD5;SMAD9 SMAD family member 1;SMAD family member 2;SMAD family member 3;SMAD family member 5;SMAD family member 9 2001 256 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22824.[MT7]-LQVSHRK[MT7].2y6_1.heavy 578.364 / 898.534 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD1;SMAD2;SMAD3;SMAD5;SMAD9 SMAD family member 1;SMAD family member 2;SMAD family member 3;SMAD family member 5;SMAD family member 9 2003 257 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544657.[MT7]-Y[MT7]SLAPVAVELK[MT7].4b4_1.heavy 406.253 / 723.428 2061.0 32.569973945617676 22 7 2 5 8 0.5879190414395981 103.57334911641675 0.045902252197265625 4 0.7224031189157766 2.285883804956099 2061.0 33.08447368421052 0.0 - - - - - - - 133.16666666666666 4 6 PGK2 phosphoglycerate kinase 2 2005 257 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544657.[MT7]-Y[MT7]SLAPVAVELK[MT7].4y3_1.heavy 406.253 / 533.341 4465.0 32.569973945617676 22 7 2 5 8 0.5879190414395981 103.57334911641675 0.045902252197265625 4 0.7224031189157766 2.285883804956099 4465.0 24.472886297376093 1.0 - - - - - - - 259.8181818181818 48 11 PGK2 phosphoglycerate kinase 2 2007 257 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544657.[MT7]-Y[MT7]SLAPVAVELK[MT7].4b3_1.heavy 406.253 / 652.391 572.0 32.569973945617676 22 7 2 5 8 0.5879190414395981 103.57334911641675 0.045902252197265625 4 0.7224031189157766 2.285883804956099 572.0 5.997543859649122 1.0 - - - - - - - 0.0 1 0 PGK2 phosphoglycerate kinase 2 2009 257 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544657.[MT7]-Y[MT7]SLAPVAVELK[MT7].4b6_2.heavy 406.253 / 460.278 8472.0 32.569973945617676 22 7 2 5 8 0.5879190414395981 103.57334911641675 0.045902252197265625 4 0.7224031189157766 2.285883804956099 8472.0 59.28217298490983 0.0 - - - - - - - 228.77777777777777 16 9 PGK2 phosphoglycerate kinase 2 2011 258 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23305.[MT7]-FELYFQGPSSNK[MT7]PR.4b4_1.heavy 490.265 / 697.368 31722.0 34.39099884033203 43 13 10 10 10 1.6364833889426615 53.76661909829409 0.0 3 0.9044976639638417 3.96129209121042 31722.0 73.95484391743523 0.0 - - - - - - - 241.0 63 7 MCM7 minichromosome maintenance complex component 7 2013 258 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23305.[MT7]-FELYFQGPSSNK[MT7]PR.4y7_2.heavy 490.265 / 465.268 33522.0 34.39099884033203 43 13 10 10 10 1.6364833889426615 53.76661909829409 0.0 3 0.9044976639638417 3.96129209121042 33522.0 40.02640046490004 0.0 - - - - - - - 179.6 67 5 MCM7 minichromosome maintenance complex component 7 2015 258 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23305.[MT7]-FELYFQGPSSNK[MT7]PR.4y6_1.heavy 490.265 / 832.476 4387.0 34.39099884033203 43 13 10 10 10 1.6364833889426615 53.76661909829409 0.0 3 0.9044976639638417 3.96129209121042 4387.0 -0.3301896003788979 2.0 - - - - - - - 206.0 11 6 MCM7 minichromosome maintenance complex component 7 2017 258 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23305.[MT7]-FELYFQGPSSNK[MT7]PR.4b3_1.heavy 490.265 / 534.304 47021.0 34.39099884033203 43 13 10 10 10 1.6364833889426615 53.76661909829409 0.0 3 0.9044976639638417 3.96129209121042 47021.0 53.515305275637225 0.0 - - - - - - - 281.25 94 4 MCM7 minichromosome maintenance complex component 7 2019 259 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23304.[MT7]-LILYNDGDSLQYIER.2b3_1.heavy 978.513 / 484.362 3180.0 38.97869873046875 40 10 10 10 10 1.977061874504796 50.580106414245364 0.0 3 0.8214429394715838 2.876001163724294 3180.0 16.463455149501662 0.0 - - - - - - - 200.66666666666666 6 12 PLK1 polo-like kinase 1 2021 259 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23304.[MT7]-LILYNDGDSLQYIER.2y9_1.heavy 978.513 / 1080.53 859.0 38.97869873046875 40 10 10 10 10 1.977061874504796 50.580106414245364 0.0 3 0.8214429394715838 2.876001163724294 859.0 8.485122093023257 2.0 - - - - - - - 0.0 1 0 PLK1 polo-like kinase 1 2023 259 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23304.[MT7]-LILYNDGDSLQYIER.2y10_1.heavy 978.513 / 1195.56 773.0 38.97869873046875 40 10 10 10 10 1.977061874504796 50.580106414245364 0.0 3 0.8214429394715838 2.876001163724294 773.0 9.887209302325582 0.0 - - - - - - - 0.0 1 0 PLK1 polo-like kinase 1 2025 259 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23304.[MT7]-LILYNDGDSLQYIER.2y7_1.heavy 978.513 / 908.484 773.0 38.97869873046875 40 10 10 10 10 1.977061874504796 50.580106414245364 0.0 3 0.8214429394715838 2.876001163724294 773.0 3.4455426356589145 0.0 - - - - - - - 0.0 1 0 PLK1 polo-like kinase 1 2027 260 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23109.[MT7]-LVDLPC[CAM]VIESLR.3y6_1.heavy 519.965 / 716.43 66643.0 46.35129928588867 50 20 10 10 10 5.844221202492699 17.11091975049603 0.0 3 0.9924056070086223 14.152742417366834 66643.0 508.3357728578983 0.0 - - - - - - - 214.0 133 11 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 2029 260 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23109.[MT7]-LVDLPC[CAM]VIESLR.3b4_1.heavy 519.965 / 585.373 164382.0 46.35129928588867 50 20 10 10 10 5.844221202492699 17.11091975049603 0.0 3 0.9924056070086223 14.152742417366834 164382.0 531.67303125 0.0 - - - - - - - 285.8333333333333 328 6 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 2031 260 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23109.[MT7]-LVDLPC[CAM]VIESLR.3y4_1.heavy 519.965 / 504.278 122512.0 46.35129928588867 50 20 10 10 10 5.844221202492699 17.11091975049603 0.0 3 0.9924056070086223 14.152742417366834 122512.0 569.9293927375646 0.0 - - - - - - - 284.875 245 8 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 2033 260 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23109.[MT7]-LVDLPC[CAM]VIESLR.3y5_1.heavy 519.965 / 617.362 150690.0 46.35129928588867 50 20 10 10 10 5.844221202492699 17.11091975049603 0.0 3 0.9924056070086223 14.152742417366834 150690.0 634.373608509772 0.0 - - - - - - - 303.875 301 8 TAF7L TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 2035 261 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23107.[MT7]-MVVESAYEVIK[MT7].3y3_1.heavy 519.293 / 503.367 19616.0 35.45597553253174 39 13 10 6 10 1.8432753214313655 43.36153308782227 0.039096832275390625 3 0.9297317852275945 4.628139143753103 19616.0 19.8704585639924 0.0 - - - - - - - 632.4285714285714 39 7 LDHB lactate dehydrogenase B 2037 261 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23107.[MT7]-MVVESAYEVIK[MT7].3b4_1.heavy 519.293 / 603.329 8048.0 35.45597553253174 39 13 10 6 10 1.8432753214313655 43.36153308782227 0.039096832275390625 3 0.9297317852275945 4.628139143753103 8048.0 15.826251042535446 0.0 - - - - - - - 583.6 16 10 LDHB lactate dehydrogenase B 2039 261 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23107.[MT7]-MVVESAYEVIK[MT7].3b5_1.heavy 519.293 / 690.361 6438.0 35.45597553253174 39 13 10 6 10 1.8432753214313655 43.36153308782227 0.039096832275390625 3 0.9297317852275945 4.628139143753103 6438.0 8.320152866162523 0.0 - - - - - - - 234.66666666666666 12 12 LDHB lactate dehydrogenase B 2041 261 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23107.[MT7]-MVVESAYEVIK[MT7].3y4_1.heavy 519.293 / 632.41 9255.0 35.45597553253174 39 13 10 6 10 1.8432753214313655 43.36153308782227 0.039096832275390625 3 0.9297317852275945 4.628139143753103 9255.0 18.69725294147351 0.0 - - - - - - - 637.2222222222222 18 9 LDHB lactate dehydrogenase B 2043 262 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544994.[MT7]-HNEFNPQHSLLVQFR.4y4_1.heavy 503.266 / 549.314 13922.0 33.10559844970703 43 13 10 10 10 2.0237919774392736 39.4313503381326 0.0 3 0.902735616045372 3.9246490376520358 13922.0 31.656284468728202 0.0 - - - - - - - 325.8333333333333 27 6 SMAD5 SMAD family member 5 2045 262 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544994.[MT7]-HNEFNPQHSLLVQFR.4y5_1.heavy 503.266 / 662.398 6788.0 33.10559844970703 43 13 10 10 10 2.0237919774392736 39.4313503381326 0.0 3 0.902735616045372 3.9246490376520358 6788.0 27.264430641821946 0.0 - - - - - - - 250.9090909090909 13 11 SMAD5 SMAD family member 5 2047 262 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544994.[MT7]-HNEFNPQHSLLVQFR.4y7_1.heavy 503.266 / 862.515 5983.0 33.10559844970703 43 13 10 10 10 2.0237919774392736 39.4313503381326 0.0 3 0.902735616045372 3.9246490376520358 5983.0 21.498926724861505 0.0 - - - - - - - 276.0 11 10 SMAD5 SMAD family member 5 2049 262 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB544994.[MT7]-HNEFNPQHSLLVQFR.4b3_1.heavy 503.266 / 525.254 14957.0 33.10559844970703 43 13 10 10 10 2.0237919774392736 39.4313503381326 0.0 3 0.902735616045372 3.9246490376520358 14957.0 53.455017391304345 0.0 - - - - - - - 258.75 29 8 SMAD5 SMAD family member 5 2051 263 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23302.[MT7]-SVVGISRPFQIPPGSLR.3y15_2.heavy 652.05 / 812.47 5059.0 34.74407386779785 35 11 10 6 8 2.1521705814964873 37.64472991250949 0.03910064697265625 4 0.8785146210137387 3.504308411782109 5059.0 9.390255220417634 1.0 - - - - - - - 230.71428571428572 10 7 INPP5K inositol polyphosphate-5-phosphatase K 2053 263 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23302.[MT7]-SVVGISRPFQIPPGSLR.3y6_1.heavy 652.05 / 626.362 4306.0 34.74407386779785 35 11 10 6 8 2.1521705814964873 37.64472991250949 0.03910064697265625 4 0.8785146210137387 3.504308411782109 4306.0 -0.19999999999999996 2.0 - - - - - - - 150.8 9 5 INPP5K inositol polyphosphate-5-phosphatase K 2055 263 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23302.[MT7]-SVVGISRPFQIPPGSLR.3y16_2.heavy 652.05 / 862.004 3552.0 34.74407386779785 35 11 10 6 8 2.1521705814964873 37.64472991250949 0.03910064697265625 4 0.8785146210137387 3.504308411782109 3552.0 1.4138876603272887 1.0 - - - - - - - 1183.7142857142858 7 7 INPP5K inositol polyphosphate-5-phosphatase K 2057 263 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB23302.[MT7]-SVVGISRPFQIPPGSLR.3y10_1.heavy 652.05 / 1111.63 861.0 34.74407386779785 35 11 10 6 8 2.1521705814964873 37.64472991250949 0.03910064697265625 4 0.8785146210137387 3.504308411782109 861.0 -0.13328173374613 6.0 - - - - - - - 699.625 5 8 INPP5K inositol polyphosphate-5-phosphatase K 2059 264 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542003.[MT7]-TLLAILR.2y5_1.heavy 472.325 / 585.408 15685.0 41.80630111694336 47 17 10 10 10 7.0500106866188315 14.184375661983536 0.0 3 0.9762822835992688 7.997675962551007 15685.0 109.53678309904325 0.0 - - - - - - - 207.33333333333334 31 15 MCM7 minichromosome maintenance complex component 7 2061 264 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542003.[MT7]-TLLAILR.2b4_1.heavy 472.325 / 543.362 19218.0 41.80630111694336 47 17 10 10 10 7.0500106866188315 14.184375661983536 0.0 3 0.9762822835992688 7.997675962551007 19218.0 106.66540952730182 0.0 - - - - - - - 260.625 38 16 MCM7 minichromosome maintenance complex component 7 2063 264 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542003.[MT7]-TLLAILR.2y6_1.heavy 472.325 / 698.492 29038.0 41.80630111694336 47 17 10 10 10 7.0500106866188315 14.184375661983536 0.0 3 0.9762822835992688 7.997675962551007 29038.0 241.4393322628128 0.0 - - - - - - - 259.0833333333333 58 12 MCM7 minichromosome maintenance complex component 7 2065 264 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB542003.[MT7]-TLLAILR.2b5_1.heavy 472.325 / 656.446 11375.0 41.80630111694336 47 17 10 10 10 7.0500106866188315 14.184375661983536 0.0 3 0.9762822835992688 7.997675962551007 11375.0 112.80928125704834 0.0 - - - - - - - 194.35 22 20 MCM7 minichromosome maintenance complex component 7 2067 265 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38061.[MT7]-NHAQVVAQAR.3y6_1.heavy 413.234 / 643.389 24642.0 15.273200273513794 44 18 10 6 10 3.964621768119556 19.767401330764827 0.03200054168701172 3 0.980231526983303 8.763099756354817 24642.0 111.63001834862385 0.0 - - - - - - - 174.0625 49 16 PGK2 phosphoglycerate kinase 2 2069 265 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38061.[MT7]-NHAQVVAQAR.3b3_1.heavy 413.234 / 467.248 27548.0 15.273200273513794 44 18 10 6 10 3.964621768119556 19.767401330764827 0.03200054168701172 3 0.980231526983303 8.763099756354817 27548.0 72.11518324607329 0.0 - - - - - - - 249.4090909090909 55 22 PGK2 phosphoglycerate kinase 2 2071 265 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38061.[MT7]-NHAQVVAQAR.3y4_1.heavy 413.234 / 445.252 79369.0 15.273200273513794 44 18 10 6 10 3.964621768119556 19.767401330764827 0.03200054168701172 3 0.980231526983303 8.763099756354817 79369.0 241.78604357777084 0.0 - - - - - - - 731.875 158 8 PGK2 phosphoglycerate kinase 2 2073 265 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38061.[MT7]-NHAQVVAQAR.3y5_1.heavy 413.234 / 544.32 56160.0 15.273200273513794 44 18 10 6 10 3.964621768119556 19.767401330764827 0.03200054168701172 3 0.980231526983303 8.763099756354817 56160.0 208.01402243874054 0.0 - - - - - - - 272.8888888888889 112 18 PGK2 phosphoglycerate kinase 2 2075 266 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22733.[MT7]-DQLSIAK[MT7].2b3_1.heavy 531.823 / 501.279 8310.0 25.091899871826172 36 18 0 10 8 5.744176692362508 17.40893523226063 0.0 4 0.9883559080849342 11.425816396429056 8310.0 5.965929020575194 1.0 - - - - - - - 1753.142857142857 114 7 INPP5K inositol polyphosphate-5-phosphatase K 2077 266 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22733.[MT7]-DQLSIAK[MT7].2y4_1.heavy 531.823 / 562.368 14290.0 25.091899871826172 36 18 0 10 8 5.744176692362508 17.40893523226063 0.0 4 0.9883559080849342 11.425816396429056 14290.0 29.199743418468962 0.0 - - - - - - - 649.6363636363636 28 11 INPP5K inositol polyphosphate-5-phosphatase K 2079 266 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22733.[MT7]-DQLSIAK[MT7].2y5_1.heavy 531.823 / 675.452 5126.0 25.091899871826172 36 18 0 10 8 5.744176692362508 17.40893523226063 0.0 4 0.9883559080849342 11.425816396429056 5126.0 14.518018018018019 0.0 - - - - - - - 786.5 10 8 INPP5K inositol polyphosphate-5-phosphatase K 2081 266 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22733.[MT7]-DQLSIAK[MT7].2y6_1.heavy 531.823 / 803.511 5980.0 25.091899871826172 36 18 0 10 8 5.744176692362508 17.40893523226063 0.0 4 0.9883559080849342 11.425816396429056 5980.0 13.884471962288044 0.0 - - - - - - - 271.85714285714283 11 14 INPP5K inositol polyphosphate-5-phosphatase K 2083 267 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22629.[MT7]-SQYTTGR.2y4_1.heavy 478.75 / 434.236 1783.0 14.876899719238281 35 17 4 10 4 5.724080562496936 17.470054606704974 0.0 8 0.9793178386155715 8.566689804756335 1783.0 4.576984109233642 2.0 - - - - - - - 335.2857142857143 5 21 MCM7 minichromosome maintenance complex component 7 2085 267 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22629.[MT7]-SQYTTGR.2b3_1.heavy 478.75 / 523.263 802.0 14.876899719238281 35 17 4 10 4 5.724080562496936 17.470054606704974 0.0 8 0.9793178386155715 8.566689804756335 802.0 6.892923025322823 5.0 - - - - - - - 154.125 3 24 MCM7 minichromosome maintenance complex component 7 2087 267 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22629.[MT7]-SQYTTGR.2y5_1.heavy 478.75 / 597.299 2006.0 14.876899719238281 35 17 4 10 4 5.724080562496936 17.470054606704974 0.0 8 0.9793178386155715 8.566689804756335 2006.0 12.977450302506483 0.0 - - - - - - - 172.3181818181818 4 22 MCM7 minichromosome maintenance complex component 7 2089 267 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22629.[MT7]-SQYTTGR.2y3_1.heavy 478.75 / 333.188 490.0 14.876899719238281 35 17 4 10 4 5.724080562496936 17.470054606704974 0.0 8 0.9793178386155715 8.566689804756335 490.0 2.202247191011236 11.0 - - - - - - - 183.95833333333334 7 24 MCM7 minichromosome maintenance complex component 7 2091 268 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22734.[MT7]-TIWQESR.2y4_1.heavy 532.286 / 519.252 3457.0 28.05660057067871 43 13 10 10 10 1.651129572992579 60.56459870605772 0.0 3 0.9152415852110924 4.208764601875954 3457.0 4.717366074509641 0.0 - - - - - - - 681.2666666666667 6 15 PLCD1 phospholipase C, delta 1 2093 268 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22734.[MT7]-TIWQESR.2y5_1.heavy 532.286 / 705.331 5839.0 28.05660057067871 43 13 10 10 10 1.651129572992579 60.56459870605772 0.0 3 0.9152415852110924 4.208764601875954 5839.0 18.425343808969544 0.0 - - - - - - - 336.0625 11 16 PLCD1 phospholipase C, delta 1 2095 268 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22734.[MT7]-TIWQESR.2y6_1.heavy 532.286 / 818.416 3918.0 28.05660057067871 43 13 10 10 10 1.651129572992579 60.56459870605772 0.0 3 0.9152415852110924 4.208764601875954 3918.0 9.918271171649122 0.0 - - - - - - - 239.52941176470588 7 17 PLCD1 phospholipase C, delta 1 2097 268 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22734.[MT7]-TIWQESR.2b5_1.heavy 532.286 / 802.422 3918.0 28.05660057067871 43 13 10 10 10 1.651129572992579 60.56459870605772 0.0 3 0.9152415852110924 4.208764601875954 3918.0 7.2000199740713935 0.0 - - - - - - - 757.2857142857143 7 7 PLCD1 phospholipase C, delta 1 2099 269 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22731.[MT7]-RLLGWK[MT7].2y4_1.heavy 530.847 / 647.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD1;SMAD2;SMAD3;SMAD5;SMAD9 SMAD family member 1;SMAD family member 2;SMAD family member 3;SMAD family member 5;SMAD family member 9 2101 269 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22731.[MT7]-RLLGWK[MT7].2y5_1.heavy 530.847 / 760.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD1;SMAD2;SMAD3;SMAD5;SMAD9 SMAD family member 1;SMAD family member 2;SMAD family member 3;SMAD family member 5;SMAD family member 9 2103 269 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22731.[MT7]-RLLGWK[MT7].2y3_1.heavy 530.847 / 534.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD1;SMAD2;SMAD3;SMAD5;SMAD9 SMAD family member 1;SMAD family member 2;SMAD family member 3;SMAD family member 5;SMAD family member 9 2105 270 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22836.[MT7]-K[MT7]HDPLLR.2y4_1.heavy 583.866 / 498.34 5632.0 19.211599349975586 39 18 10 3 8 6.734019958005624 14.849970838164314 0.07040023803710938 4 0.9801537687163805 8.745858746750129 5632.0 32.763977634652136 0.0 - - - - - - - 207.64705882352942 11 17 INPP5K inositol polyphosphate-5-phosphatase K 2107 270 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22836.[MT7]-K[MT7]HDPLLR.2b3_1.heavy 583.866 / 669.392 4721.0 19.211599349975586 39 18 10 3 8 6.734019958005624 14.849970838164314 0.07040023803710938 4 0.9801537687163805 8.745858746750129 4721.0 22.068673902982876 0.0 - - - - - - - 202.44444444444446 9 9 INPP5K inositol polyphosphate-5-phosphatase K 2109 270 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22836.[MT7]-K[MT7]HDPLLR.2y5_1.heavy 583.866 / 613.367 284.0 19.211599349975586 39 18 10 3 8 6.734019958005624 14.849970838164314 0.07040023803710938 4 0.9801537687163805 8.745858746750129 284.0 2.958205484385451 11.0 - - - - - - - 0.0 1 0 INPP5K inositol polyphosphate-5-phosphatase K 2111 270 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB22836.[MT7]-K[MT7]HDPLLR.2y6_1.heavy 583.866 / 750.426 512.0 19.211599349975586 39 18 10 3 8 6.734019958005624 14.849970838164314 0.07040023803710938 4 0.9801537687163805 8.745858746750129 512.0 4.131929824561404 5.0 - - - - - - - 128.2 4 20 INPP5K inositol polyphosphate-5-phosphatase K 2113 271 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38578.[MT7]-FSIAPSSLDPSNRK[MT7]PLTVLNK[MT7].4b7_1.heavy 679.898 / 834.448 229.0 33.973201751708984 26 16 0 10 0 2.4122788711670378 34.308079555107355 0.0 22 0.9616123122907124 6.278663589376967 229.0 0.6294479382280125 22.0 - - - - - - - 262.0 5 7 PLK1 polo-like kinase 1 2115 271 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38578.[MT7]-FSIAPSSLDPSNRK[MT7]PLTVLNK[MT7].4y12_2.heavy 679.898 / 828.014 1949.0 33.973201751708984 26 16 0 10 0 2.4122788711670378 34.308079555107355 0.0 22 0.9616123122907124 6.278663589376967 1949.0 21.652325834175933 0.0 - - - - - - - 271.0 3 11 PLK1 polo-like kinase 1 2117 271 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38578.[MT7]-FSIAPSSLDPSNRK[MT7]PLTVLNK[MT7].4b4_1.heavy 679.898 / 563.331 N/A 33.973201751708984 26 16 0 10 0 2.4122788711670378 34.308079555107355 0.0 22 0.9616123122907124 6.278663589376967 2063.0 1.5105619864563569 4.0 - - - - - - - 300.75 34 8 PLK1 polo-like kinase 1 2119 271 B20140227_KEGG1700_set05_03 B20140227_KEGG1700_set05_03 TB38578.[MT7]-FSIAPSSLDPSNRK[MT7]PLTVLNK[MT7].4y3_1.heavy 679.898 / 518.342 1375.0 33.973201751708984 26 16 0 10 0 2.4122788711670378 34.308079555107355 0.0 22 0.9616123122907124 6.278663589376967 1375.0 5.396075581395349 0.0 - - - - - - - 219.66666666666666 2 12 PLK1 polo-like kinase 1