Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544824.[MT7]-LRLNVDEAFEQLVR.3b6_1.heavy 616.015 / 855.517 20778.0 41.80780029296875 40 14 10 6 10 3.208365888989791 21.07432069630684 0.03839874267578125 3 0.9308888912809684 4.667183928371223 20778.0 420.5246859169199 0.0 - - - - - - - 120.92307692307692 41 13 RRAS related RAS viral (r-ras) oncogene homolog 3 1 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544824.[MT7]-LRLNVDEAFEQLVR.3y6_1.heavy 616.015 / 791.441 54865.0 41.80780029296875 40 14 10 6 10 3.208365888989791 21.07432069630684 0.03839874267578125 3 0.9308888912809684 4.667183928371223 54865.0 500.330415023759 0.0 - - - - - - - 211.27272727272728 109 11 RRAS related RAS viral (r-ras) oncogene homolog 5 1 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544824.[MT7]-LRLNVDEAFEQLVR.3y4_1.heavy 616.015 / 515.33 55556.0 41.80780029296875 40 14 10 6 10 3.208365888989791 21.07432069630684 0.03839874267578125 3 0.9308888912809684 4.667183928371223 55556.0 271.1398406374502 0.0 - - - - - - - 285.0 111 13 RRAS related RAS viral (r-ras) oncogene homolog 7 1 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544824.[MT7]-LRLNVDEAFEQLVR.3y5_1.heavy 616.015 / 644.373 74702.0 41.80780029296875 40 14 10 6 10 3.208365888989791 21.07432069630684 0.03839874267578125 3 0.9308888912809684 4.667183928371223 74702.0 298.97665813292474 0.0 - - - - - - - 263.6 149 10 RRAS related RAS viral (r-ras) oncogene homolog 9 2 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22883.[MT7]-YNQLQEQR.2b3_1.heavy 611.818 / 550.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSC1 tuberous sclerosis 1 11 2 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22883.[MT7]-YNQLQEQR.2y5_1.heavy 611.818 / 673.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSC1 tuberous sclerosis 1 13 2 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22883.[MT7]-YNQLQEQR.2b4_1.heavy 611.818 / 663.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSC1 tuberous sclerosis 1 15 2 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22883.[MT7]-YNQLQEQR.2y7_1.heavy 611.818 / 915.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSC1 tuberous sclerosis 1 17 3 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544431.[MT7]-GQTIPEDILGK[MT7].3y3_1.heavy 486.952 / 461.32 82757.0 34.0098991394043 46 16 10 10 10 2.451972856188505 40.78348573378828 0.0 3 0.9644217328257011 6.52339792598193 82757.0 77.94147833563912 0.0 - - - - - - - 314.0 165 1 MAP2K6 mitogen-activated protein kinase kinase 6 19 3 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544431.[MT7]-GQTIPEDILGK[MT7].3b4_1.heavy 486.952 / 544.321 60653.0 34.0098991394043 46 16 10 10 10 2.451972856188505 40.78348573378828 0.0 3 0.9644217328257011 6.52339792598193 60653.0 82.25952230987659 0.0 - - - - - - - 314.0 121 1 MAP2K6 mitogen-activated protein kinase kinase 6 21 3 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544431.[MT7]-GQTIPEDILGK[MT7].3y5_1.heavy 486.952 / 689.431 10371.0 34.0098991394043 46 16 10 10 10 2.451972856188505 40.78348573378828 0.0 3 0.9644217328257011 6.52339792598193 10371.0 22.60392255964689 0.0 - - - - - - - 681.125 20 8 MAP2K6 mitogen-activated protein kinase kinase 6 23 3 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544431.[MT7]-GQTIPEDILGK[MT7].3b7_1.heavy 486.952 / 885.443 20532.0 34.0098991394043 46 16 10 10 10 2.451972856188505 40.78348573378828 0.0 3 0.9644217328257011 6.52339792598193 20532.0 111.94080233494975 0.0 - - - - - - - 314.2857142857143 41 7 MAP2K6 mitogen-activated protein kinase kinase 6 25 4 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22747.[MT7]-LQDWAGSR.2b3_1.heavy 538.784 / 501.279 9773.0 28.063800811767578 45 15 10 10 10 1.6143715646051418 42.99760516611501 0.0 3 0.9554167254782796 5.823036508096411 9773.0 9.184539254823687 0.0 - - - - - - - 1187.7777777777778 19 9 BDKRB2 bradykinin receptor B2 27 4 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22747.[MT7]-LQDWAGSR.2y5_1.heavy 538.784 / 576.289 9188.0 28.063800811767578 45 15 10 10 10 1.6143715646051418 42.99760516611501 0.0 3 0.9554167254782796 5.823036508096411 9188.0 27.499577255744917 0.0 - - - - - - - 566.0 18 9 BDKRB2 bradykinin receptor B2 29 4 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22747.[MT7]-LQDWAGSR.2y6_1.heavy 538.784 / 691.316 2589.0 28.063800811767578 45 15 10 10 10 1.6143715646051418 42.99760516611501 0.0 3 0.9554167254782796 5.823036508096411 2589.0 7.048696376897607 0.0 - - - - - - - 256.3333333333333 5 15 BDKRB2 bradykinin receptor B2 31 4 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22747.[MT7]-LQDWAGSR.2y7_1.heavy 538.784 / 819.374 5513.0 28.063800811767578 45 15 10 10 10 1.6143715646051418 42.99760516611501 0.0 3 0.9554167254782796 5.823036508096411 5513.0 35.11829794594079 1.0 - - - - - - - 200.66666666666666 11 15 BDKRB2 bradykinin receptor B2 33 5 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23098.[MT7]-RLFPYSQYYR.3y3_1.heavy 512.941 / 501.246 56791.0 32.02629852294922 48 18 10 10 10 8.311394329166319 12.031675557623384 0.0 3 0.9899443381105093 12.296809336933691 56791.0 36.788833251843144 0.0 - - - - - - - 448.5 113 2 PRIM1 primase, DNA, polypeptide 1 (49kDa) 35 5 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23098.[MT7]-RLFPYSQYYR.3y4_1.heavy 512.941 / 629.304 43141.0 32.02629852294922 48 18 10 10 10 8.311394329166319 12.031675557623384 0.0 3 0.9899443381105093 12.296809336933691 43141.0 84.60770492817966 0.0 - - - - - - - 807.0 86 10 PRIM1 primase, DNA, polypeptide 1 (49kDa) 37 5 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23098.[MT7]-RLFPYSQYYR.3b3_1.heavy 512.941 / 561.363 56990.0 32.02629852294922 48 18 10 10 10 8.311394329166319 12.031675557623384 0.0 3 0.9899443381105093 12.296809336933691 56990.0 116.9683579377697 0.0 - - - - - - - 740.0 113 7 PRIM1 primase, DNA, polypeptide 1 (49kDa) 39 5 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23098.[MT7]-RLFPYSQYYR.3y5_1.heavy 512.941 / 716.336 83493.0 32.02629852294922 48 18 10 10 10 8.311394329166319 12.031675557623384 0.0 3 0.9899443381105093 12.296809336933691 83493.0 124.48652974353138 0.0 - - - - - - - 782.7142857142857 166 7 PRIM1 primase, DNA, polypeptide 1 (49kDa) 41 6 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542544.[MT7]-EDFGFK[MT7].2b3_1.heavy 515.776 / 536.247 2565.0 29.798075199127197 42 18 10 6 8 6.9189414283583615 14.453077979549644 0.03610038757324219 4 0.9849137690633486 10.03516433119932 2565.0 9.05631075560008 2.0 - - - - - - - 734.125 5 8 PRIM1 primase, DNA, polypeptide 1 (49kDa) 43 6 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542544.[MT7]-EDFGFK[MT7].2y4_1.heavy 515.776 / 642.373 11499.0 29.798075199127197 42 18 10 6 8 6.9189414283583615 14.453077979549644 0.03610038757324219 4 0.9849137690633486 10.03516433119932 11499.0 24.695568199635915 0.0 - - - - - - - 699.4545454545455 22 11 PRIM1 primase, DNA, polypeptide 1 (49kDa) 45 6 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542544.[MT7]-EDFGFK[MT7].2y5_1.heavy 515.776 / 757.4 9017.0 29.798075199127197 42 18 10 6 8 6.9189414283583615 14.453077979549644 0.03610038757324219 4 0.9849137690633486 10.03516433119932 9017.0 42.69585968716499 1.0 - - - - - - - 780.0 24 7 PRIM1 primase, DNA, polypeptide 1 (49kDa) 47 6 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542544.[MT7]-EDFGFK[MT7].2b4_1.heavy 515.776 / 593.269 2068.0 29.798075199127197 42 18 10 6 8 6.9189414283583615 14.453077979549644 0.03610038757324219 4 0.9849137690633486 10.03516433119932 2068.0 3.8275593761077626 8.0 - - - - - - - 311.4117647058824 7 17 PRIM1 primase, DNA, polypeptide 1 (49kDa) 49 7 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541712.[MT7]-LTLDK[MT7].2y4_1.heavy 439.283 / 620.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK1;PGK2;ERAP2 phosphoglycerate kinase 1;phosphoglycerate kinase 2;endoplasmic reticulum aminopeptidase 2 51 7 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541712.[MT7]-LTLDK[MT7].2b4_1.heavy 439.283 / 587.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK1;PGK2;ERAP2 phosphoglycerate kinase 1;phosphoglycerate kinase 2;endoplasmic reticulum aminopeptidase 2 53 7 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541712.[MT7]-LTLDK[MT7].2y3_1.heavy 439.283 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGK1;PGK2;ERAP2 phosphoglycerate kinase 1;phosphoglycerate kinase 2;endoplasmic reticulum aminopeptidase 2 55 8 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23222.[MT7]-YQSFNNQSDLEK[MT7].2y8_1.heavy 880.938 / 1091.54 761.0 25.825700759887695 50 20 10 10 10 7.172522048978842 13.94209725911363 0.0 3 0.9919333064772998 13.731633866688238 761.0 11.20971806474069 0.0 - - - - - - - 0.0 1 0 PRIM1 primase, DNA, polypeptide 1 (49kDa) 57 8 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23222.[MT7]-YQSFNNQSDLEK[MT7].2b5_1.heavy 880.938 / 784.375 761.0 25.825700759887695 50 20 10 10 10 7.172522048978842 13.94209725911363 0.0 3 0.9919333064772998 13.731633866688238 761.0 16.921058823529414 0.0 - - - - - - - 0.0 1 0 PRIM1 primase, DNA, polypeptide 1 (49kDa) 59 8 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23222.[MT7]-YQSFNNQSDLEK[MT7].2y5_1.heavy 880.938 / 735.401 761.0 25.825700759887695 50 20 10 10 10 7.172522048978842 13.94209725911363 0.0 3 0.9919333064772998 13.731633866688238 761.0 8.594823529411764 0.0 - - - - - - - 0.0 1 0 PRIM1 primase, DNA, polypeptide 1 (49kDa) 61 8 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23222.[MT7]-YQSFNNQSDLEK[MT7].2y3_1.heavy 880.938 / 533.341 1860.0 25.825700759887695 50 20 10 10 10 7.172522048978842 13.94209725911363 0.0 3 0.9919333064772998 13.731633866688238 1860.0 23.209778890279516 0.0 - - - - - - - 208.3846153846154 3 13 PRIM1 primase, DNA, polypeptide 1 (49kDa) 63 9 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545325.[MT7]-K[MT7]YFEEYALVNQDILENK[MT7].4y4_1.heavy 637.847 / 647.385 9662.0 37.834800720214844 43 13 10 10 10 3.297596202288976 30.32511983443774 0.0 3 0.91678769160203 4.248249399190635 9662.0 24.909843749999997 0.0 - - - - - - - 704.0 19 8 PRIM1 primase, DNA, polypeptide 1 (49kDa) 65 9 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545325.[MT7]-K[MT7]YFEEYALVNQDILENK[MT7].4b7_2.heavy 637.847 / 610.315 18428.0 37.834800720214844 43 13 10 10 10 3.297596202288976 30.32511983443774 0.0 3 0.91678769160203 4.248249399190635 18428.0 40.63757916666667 0.0 - - - - - - - 728.6153846153846 36 13 PRIM1 primase, DNA, polypeptide 1 (49kDa) 67 9 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545325.[MT7]-K[MT7]YFEEYALVNQDILENK[MT7].4b5_1.heavy 637.847 / 985.523 2048.0 37.834800720214844 43 13 10 10 10 3.297596202288976 30.32511983443774 0.0 3 0.91678769160203 4.248249399190635 2048.0 20.8 1.0 - - - - - - - 142.76923076923077 4 13 PRIM1 primase, DNA, polypeptide 1 (49kDa) 69 9 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545325.[MT7]-K[MT7]YFEEYALVNQDILENK[MT7].4b6_2.heavy 637.847 / 574.797 5567.0 37.834800720214844 43 13 10 10 10 3.297596202288976 30.32511983443774 0.0 3 0.91678769160203 4.248249399190635 5567.0 39.142968749999994 0.0 - - - - - - - 232.42105263157896 11 19 PRIM1 primase, DNA, polypeptide 1 (49kDa) 71 10 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37754.[MT7]-GGQDVK[MT7].2y4_1.heavy 446.261 / 633.369 523.0 13.057000160217285 48 18 10 10 10 9.359047531223366 10.684847968383863 0.0 3 0.9858062611726875 10.346630371582421 523.0 -0.399236641221374 0.0 - - - - - - - 0.0 1 0 PRIM1 primase, DNA, polypeptide 1 (49kDa) 73 10 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37754.[MT7]-GGQDVK[MT7].2y5_1.heavy 446.261 / 690.39 610.0 13.057000160217285 48 18 10 10 10 9.359047531223366 10.684847968383863 0.0 3 0.9858062611726875 10.346630371582421 610.0 14.546153846153842 1.0 - - - - - - - 0.0 1 0 PRIM1 primase, DNA, polypeptide 1 (49kDa) 75 10 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37754.[MT7]-GGQDVK[MT7].2b4_1.heavy 446.261 / 502.238 8110.0 13.057000160217285 48 18 10 10 10 9.359047531223366 10.684847968383863 0.0 3 0.9858062611726875 10.346630371582421 8110.0 66.2552508178844 0.0 - - - - - - - 156.34782608695653 16 23 PRIM1 primase, DNA, polypeptide 1 (49kDa) 77 10 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37754.[MT7]-GGQDVK[MT7].2y3_1.heavy 446.261 / 505.31 105.0 13.057000160217285 48 18 10 10 10 9.359047531223366 10.684847968383863 0.0 3 0.9858062611726875 10.346630371582421 105.0 0.5163934426229507 17.0 - - - - - - - 0.0 0 0 PRIM1 primase, DNA, polypeptide 1 (49kDa) 79 11 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23329.[MT7]-TVDC[CAM]PFTVTFYGALFR.2b3_1.heavy 1019.51 / 460.252 1655.0 48.049150466918945 44 18 10 6 10 3.3014763409081707 30.28947951584956 0.03459930419921875 3 0.9875951202590987 11.069197045449103 1655.0 16.527151403589507 0.0 - - - - - - - 125.16666666666667 3 18 MAP2K6 mitogen-activated protein kinase kinase 6 81 11 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23329.[MT7]-TVDC[CAM]PFTVTFYGALFR.2y10_1.heavy 1019.51 / 1174.63 246.0 48.049150466918945 44 18 10 6 10 3.3014763409081707 30.28947951584956 0.03459930419921875 3 0.9875951202590987 11.069197045449103 246.0 4.992938005390835 0.0 - - - - - - - 0.0 0 0 MAP2K6 mitogen-activated protein kinase kinase 6 83 11 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23329.[MT7]-TVDC[CAM]PFTVTFYGALFR.2b4_1.heavy 1019.51 / 620.283 598.0 48.049150466918945 44 18 10 6 10 3.3014763409081707 30.28947951584956 0.03459930419921875 3 0.9875951202590987 11.069197045449103 598.0 9.064025157232704 0.0 - - - - - - - 0.0 1 0 MAP2K6 mitogen-activated protein kinase kinase 6 85 11 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23329.[MT7]-TVDC[CAM]PFTVTFYGALFR.2y7_1.heavy 1019.51 / 873.462 141.0 48.049150466918945 44 18 10 6 10 3.3014763409081707 30.28947951584956 0.03459930419921875 3 0.9875951202590987 11.069197045449103 141.0 1.6114285714285714 12.0 - - - - - - - 0.0 0 0 MAP2K6 mitogen-activated protein kinase kinase 6 87 12 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544286.[MT7]-QK[MT7]YPEQPGR.3b6_2.heavy 464.261 / 531.795 1633.0 16.637675285339355 40 18 10 6 6 3.4864671054575274 22.19280595450952 0.039699554443359375 5 0.9887174440470843 11.607787398213183 1633.0 4.644311926605504 1.0 - - - - - - - 171.78947368421052 3 19 RXRG retinoid X receptor, gamma 89 12 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544286.[MT7]-QK[MT7]YPEQPGR.3y7_1.heavy 464.261 / 846.41 708.0 16.637675285339355 40 18 10 6 6 3.4864671054575274 22.19280595450952 0.039699554443359375 5 0.9887174440470843 11.607787398213183 708.0 13.11111111111111 1.0 - - - - - - - 0.0 1 0 RXRG retinoid X receptor, gamma 91 12 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544286.[MT7]-QK[MT7]YPEQPGR.3y6_1.heavy 464.261 / 683.347 3212.0 16.637675285339355 40 18 10 6 6 3.4864671054575274 22.19280595450952 0.039699554443359375 5 0.9887174440470843 11.607787398213183 3212.0 75.94530071355759 0.0 - - - - - - - 118.54545454545455 6 11 RXRG retinoid X receptor, gamma 93 12 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544286.[MT7]-QK[MT7]YPEQPGR.3y5_1.heavy 464.261 / 586.294 1198.0 16.637675285339355 40 18 10 6 6 3.4864671054575274 22.19280595450952 0.039699554443359375 5 0.9887174440470843 11.607787398213183 1198.0 4.945871559633027 3.0 - - - - - - - 176.14285714285714 3 21 RXRG retinoid X receptor, gamma 95 13 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543428.[MT7]-LTVDEWK[MT7].2y4_1.heavy 589.837 / 721.364 6271.0 32.419898986816406 37 17 2 10 8 2.149213676076172 31.019096616014586 0.0 4 0.973477932640095 7.561259020475108 6271.0 7.405452261306532 0.0 - - - - - - - 291.0769230769231 12 13 MAPK13 mitogen-activated protein kinase 13 97 13 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543428.[MT7]-LTVDEWK[MT7].2b4_1.heavy 589.837 / 573.336 8162.0 32.419898986816406 37 17 2 10 8 2.149213676076172 31.019096616014586 0.0 4 0.973477932640095 7.561259020475108 8162.0 13.283265918634267 0.0 - - - - - - - 1206.75 16 8 MAPK13 mitogen-activated protein kinase 13 99 13 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543428.[MT7]-LTVDEWK[MT7].2y3_1.heavy 589.837 / 606.337 10352.0 32.419898986816406 37 17 2 10 8 2.149213676076172 31.019096616014586 0.0 4 0.973477932640095 7.561259020475108 10352.0 31.0887998224052 0.0 - - - - - - - 739.4285714285714 20 7 MAPK13 mitogen-activated protein kinase 13 101 13 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543428.[MT7]-LTVDEWK[MT7].2y6_1.heavy 589.837 / 921.48 8062.0 32.419898986816406 37 17 2 10 8 2.149213676076172 31.019096616014586 0.0 4 0.973477932640095 7.561259020475108 8062.0 34.0595254386933 1.0 - - - - - - - 298.75 52 12 MAPK13 mitogen-activated protein kinase 13 103 14 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23226.[MT7]-AC[CAM]ISIGNQNFEVK[MT7].2y4_1.heavy 884.469 / 666.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K6 mitogen-activated protein kinase kinase 6 105 14 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23226.[MT7]-AC[CAM]ISIGNQNFEVK[MT7].2y8_1.heavy 884.469 / 1079.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K6 mitogen-activated protein kinase kinase 6 107 14 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23226.[MT7]-AC[CAM]ISIGNQNFEVK[MT7].2y9_1.heavy 884.469 / 1192.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K6 mitogen-activated protein kinase kinase 6 109 14 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23226.[MT7]-AC[CAM]ISIGNQNFEVK[MT7].2b4_1.heavy 884.469 / 576.293 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K6 mitogen-activated protein kinase kinase 6 111 15 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544539.[MT7]-SGIVEYLSLVK[MT7].3b6_1.heavy 499.304 / 793.421 44378.0 42.09149932861328 45 15 10 10 10 3.1362460194349073 31.88525370149952 0.0 3 0.9585103264427319 6.037807263964387 44378.0 86.88623948453838 0.0 - - - - - - - 185.30769230769232 88 13 PRIM1 primase, DNA, polypeptide 1 (49kDa) 113 15 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544539.[MT7]-SGIVEYLSLVK[MT7].3b4_1.heavy 499.304 / 501.315 42032.0 42.09149932861328 45 15 10 10 10 3.1362460194349073 31.88525370149952 0.0 3 0.9585103264427319 6.037807263964387 42032.0 52.51371017830904 0.0 - - - - - - - 261.375 84 8 PRIM1 primase, DNA, polypeptide 1 (49kDa) 115 15 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544539.[MT7]-SGIVEYLSLVK[MT7].3b5_1.heavy 499.304 / 630.358 117030.0 42.09149932861328 45 15 10 10 10 3.1362460194349073 31.88525370149952 0.0 3 0.9585103264427319 6.037807263964387 117030.0 248.1723100682227 0.0 - - - - - - - 342.4 234 5 PRIM1 primase, DNA, polypeptide 1 (49kDa) 117 15 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544539.[MT7]-SGIVEYLSLVK[MT7].3y4_1.heavy 499.304 / 590.399 107838.0 42.09149932861328 45 15 10 10 10 3.1362460194349073 31.88525370149952 0.0 3 0.9585103264427319 6.037807263964387 107838.0 59.90946356884355 0.0 - - - - - - - 215.4 215 5 PRIM1 primase, DNA, polypeptide 1 (49kDa) 119 16 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23224.[MT7]-DRDDFPVVLVGNK[MT7].4b5_1.heavy 441.249 / 793.36 16395.0 33.63849894205729 40 15 10 5 10 2.162049146871285 46.25241759407302 0.045299530029296875 3 0.9564126954905195 5.889685802555648 16395.0 156.66157236504245 0.0 - - - - - - - 183.75 32 8 RRAS related RAS viral (r-ras) oncogene homolog 121 16 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23224.[MT7]-DRDDFPVVLVGNK[MT7].4b7_1.heavy 441.249 / 989.481 N/A 33.63849894205729 40 15 10 5 10 2.162049146871285 46.25241759407302 0.045299530029296875 3 0.9564126954905195 5.889685802555648 105.0 -0.0 0.0 - - - - - - - 0.0 0 0 RRAS related RAS viral (r-ras) oncogene homolog 123 16 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23224.[MT7]-DRDDFPVVLVGNK[MT7].4y3_1.heavy 441.249 / 462.279 89543.0 33.63849894205729 40 15 10 5 10 2.162049146871285 46.25241759407302 0.045299530029296875 3 0.9564126954905195 5.889685802555648 89543.0 97.66538350144313 0.0 - - - - - - - 105.0 179 1 RRAS related RAS viral (r-ras) oncogene homolog 125 16 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23224.[MT7]-DRDDFPVVLVGNK[MT7].4b6_2.heavy 441.249 / 445.71 55807.0 33.63849894205729 40 15 10 5 10 2.162049146871285 46.25241759407302 0.045299530029296875 3 0.9564126954905195 5.889685802555648 55807.0 81.77064571835825 0.0 - - - - - - - 262.5 111 2 RRAS related RAS viral (r-ras) oncogene homolog 127 17 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23198.[MT7]-LSRPFQSEIFAK[MT7].2b8_2.heavy 855.993 / 545.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK13 mitogen-activated protein kinase 13 129 17 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23198.[MT7]-LSRPFQSEIFAK[MT7].2b3_1.heavy 855.993 / 501.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK13 mitogen-activated protein kinase 13 131 17 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23198.[MT7]-LSRPFQSEIFAK[MT7].2y9_1.heavy 855.993 / 1210.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK13 mitogen-activated protein kinase 13 133 17 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23198.[MT7]-LSRPFQSEIFAK[MT7].2y3_1.heavy 855.993 / 509.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK13 mitogen-activated protein kinase 13 135 18 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544836.[MT7]-VFSSAEALVQSFRK[MT7].3y8_1.heavy 619.687 / 1092.66 1129.0 40.571176528930664 44 18 10 6 10 7.253887552296034 13.785711355333532 0.03730010986328125 3 0.9890604310124269 11.788690106929154 1129.0 21.834021417179315 0.0 - - - - - - - 108.45454545454545 2 11 UBE3A ubiquitin protein ligase E3A 137 18 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544836.[MT7]-VFSSAEALVQSFRK[MT7].3y6_1.heavy 619.687 / 908.543 1926.0 40.571176528930664 44 18 10 6 10 7.253887552296034 13.785711355333532 0.03730010986328125 3 0.9890604310124269 11.788690106929154 1926.0 11.303625781320772 0.0 - - - - - - - 137.84615384615384 3 13 UBE3A ubiquitin protein ligase E3A 139 18 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544836.[MT7]-VFSSAEALVQSFRK[MT7].3b6_1.heavy 619.687 / 765.39 1661.0 40.571176528930664 44 18 10 6 10 7.253887552296034 13.785711355333532 0.03730010986328125 3 0.9890604310124269 11.788690106929154 1661.0 8.117669172932331 0.0 - - - - - - - 192.26315789473685 3 19 UBE3A ubiquitin protein ligase E3A 141 18 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544836.[MT7]-VFSSAEALVQSFRK[MT7].3b7_1.heavy 619.687 / 836.427 1329.0 40.571176528930664 44 18 10 6 10 7.253887552296034 13.785711355333532 0.03730010986328125 3 0.9890604310124269 11.788690106929154 1329.0 9.471265349302904 0.0 - - - - - - - 210.33333333333334 2 18 UBE3A ubiquitin protein ligase E3A 143 19 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544838.[MT7]-RLETHDVVIEC[CAM]AK[MT7].4y4_1.heavy 465.258 / 651.325 4846.0 23.976600646972656 45 15 10 10 10 3.3297221453251487 23.47890380162405 0.0 3 0.9523212220949526 5.629359380831048 4846.0 23.889146252728594 0.0 - - - - - - - 190.0 9 21 TSC1 tuberous sclerosis 1 145 19 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544838.[MT7]-RLETHDVVIEC[CAM]AK[MT7].4b7_2.heavy 465.258 / 498.273 12507.0 23.976600646972656 45 15 10 10 10 3.3297221453251487 23.47890380162405 0.0 3 0.9523212220949526 5.629359380831048 12507.0 29.123240077113227 0.0 - - - - - - - 663.0 25 8 TSC1 tuberous sclerosis 1 147 19 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544838.[MT7]-RLETHDVVIEC[CAM]AK[MT7].4y3_1.heavy 465.258 / 522.283 8513.0 23.976600646972656 45 15 10 10 10 3.3297221453251487 23.47890380162405 0.0 3 0.9523212220949526 5.629359380831048 8513.0 20.70227917121047 0.0 - - - - - - - 753.125 17 8 TSC1 tuberous sclerosis 1 149 19 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544838.[MT7]-RLETHDVVIEC[CAM]AK[MT7].4b3_1.heavy 465.258 / 543.337 1244.0 23.976600646972656 45 15 10 10 10 3.3297221453251487 23.47890380162405 0.0 3 0.9523212220949526 5.629359380831048 1244.0 0.37984732824427475 16.0 - - - - - - - 678.1428571428571 10 14 TSC1 tuberous sclerosis 1 151 20 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544587.[MT7]-DLK[MT7]PSNIVVK[MT7].3y6_2.heavy 515.663 / 402.259 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK8;MAPK9;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10 153 20 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544587.[MT7]-DLK[MT7]PSNIVVK[MT7].3b6_1.heavy 515.663 / 943.545 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK8;MAPK9;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10 155 20 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544587.[MT7]-DLK[MT7]PSNIVVK[MT7].3b3_1.heavy 515.663 / 645.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK8;MAPK9;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10 157 20 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544587.[MT7]-DLK[MT7]PSNIVVK[MT7].3b7_2.heavy 515.663 / 528.818 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK8;MAPK9;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10 159 21 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544834.[MT7]-GLTPTGTLPLGVLSGGK[MT7].3y7_1.heavy 619.375 / 761.464 16246.0 39.49409866333008 46 20 10 6 10 11.441650135182934 8.739998061337431 0.03459930419921875 3 0.9937610812311823 15.616426140248862 16246.0 186.96530520428016 0.0 - - - - - - - 151.28571428571428 32 14 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 161 21 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544834.[MT7]-GLTPTGTLPLGVLSGGK[MT7].3b8_1.heavy 619.375 / 885.516 17081.0 39.49409866333008 46 20 10 6 10 11.441650135182934 8.739998061337431 0.03459930419921875 3 0.9937610812311823 15.616426140248862 17081.0 124.87912216465169 0.0 - - - - - - - 164.4375 34 16 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 163 21 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544834.[MT7]-GLTPTGTLPLGVLSGGK[MT7].3b7_1.heavy 619.375 / 772.432 12779.0 39.49409866333008 46 20 10 6 10 11.441650135182934 8.739998061337431 0.03459930419921875 3 0.9937610812311823 15.616426140248862 12779.0 85.03145208765952 0.0 - - - - - - - 160.5 25 10 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 165 21 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544834.[MT7]-GLTPTGTLPLGVLSGGK[MT7].3y5_1.heavy 619.375 / 605.374 26456.0 39.49409866333008 46 20 10 6 10 11.441650135182934 8.739998061337431 0.03459930419921875 3 0.9937610812311823 15.616426140248862 26456.0 107.13572181089937 0.0 - - - - - - - 257.0 52 12 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 167 22 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23310.[MT7]-FSAEFVDFTSQC[CAM]LK[MT7].3b4_1.heavy 656.332 / 579.289 6950.0 40.32844924926758 42 16 10 6 10 2.8896388430362636 34.60640081060298 0.0373992919921875 3 0.9650240806706852 6.579665022879508 6950.0 15.018793653875807 0.0 - - - - - - - 268.6470588235294 13 17 MAP2K6 mitogen-activated protein kinase kinase 6 169 22 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23310.[MT7]-FSAEFVDFTSQC[CAM]LK[MT7].3b5_1.heavy 656.332 / 726.358 6221.0 40.32844924926758 42 16 10 6 10 2.8896388430362636 34.60640081060298 0.0373992919921875 3 0.9650240806706852 6.579665022879508 6221.0 29.14624685138539 0.0 - - - - - - - 222.78947368421052 12 19 MAP2K6 mitogen-activated protein kinase kinase 6 171 22 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23310.[MT7]-FSAEFVDFTSQC[CAM]LK[MT7].3y5_1.heavy 656.332 / 779.42 4170.0 40.32844924926758 42 16 10 6 10 2.8896388430362636 34.60640081060298 0.0373992919921875 3 0.9650240806706852 6.579665022879508 4170.0 31.4956601187757 0.0 - - - - - - - 194.13333333333333 8 15 MAP2K6 mitogen-activated protein kinase kinase 6 173 22 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23310.[MT7]-FSAEFVDFTSQC[CAM]LK[MT7].3b7_1.heavy 656.332 / 940.453 6023.0 40.32844924926758 42 16 10 6 10 2.8896388430362636 34.60640081060298 0.0373992919921875 3 0.9650240806706852 6.579665022879508 6023.0 30.4860318704483 0.0 - - - - - - - 264.77777777777777 12 18 MAP2K6 mitogen-activated protein kinase kinase 6 175 23 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1223700.0 29.555299758911133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1223700.0 4137.8627323221535 0.0 - - - - - - - 220.33333333333334 2447 3 177 23 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 380550.0 29.555299758911133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 380550.0 655.60520089165 0.0 - - - - - - - 248.33333333333334 761 3 179 23 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 280510.0 29.555299758911133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 280510.0 430.08482547937285 0.0 - - - - - - - 386.0 561 3 181 24 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541594.[MT7]-ISNLK[MT7].2b3_1.heavy 431.784 / 459.268 1449.0 23.186299800872803 41 18 10 7 6 6.330206226639145 15.797273646342536 0.026399612426757812 6 0.9863148872156204 10.537598596767365 1449.0 -0.8 9.0 - - - - - - - 654.9 3 10 ADH4;RAI14;ATP7B;SORL1;TCEA1;TCEA2;TCEA3;HOOK3;MYOM1 alcohol dehydrogenase 4 (class II), pi polypeptide;retinoic acid induced 14;ATPase, Cu++ transporting, beta polypeptide;sortilin-related receptor, L(DLR class) A repeats-containing;transcription elongation factor A (SII), 1;transcription elongation factor A (SII), 2;transcription elongation factor A (SII), 3;hook homolog 3 (Drosophila);myomesin 1, 185kDa 183 24 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541594.[MT7]-ISNLK[MT7].2y4_1.heavy 431.784 / 605.374 19646.0 23.186299800872803 41 18 10 7 6 6.330206226639145 15.797273646342536 0.026399612426757812 6 0.9863148872156204 10.537598596767365 19646.0 9.476705620478574 1.0 - - - - - - - 1268.5555555555557 39 9 ADH4;RAI14;ATP7B;SORL1;TCEA1;TCEA2;TCEA3;HOOK3;MYOM1 alcohol dehydrogenase 4 (class II), pi polypeptide;retinoic acid induced 14;ATPase, Cu++ transporting, beta polypeptide;sortilin-related receptor, L(DLR class) A repeats-containing;transcription elongation factor A (SII), 1;transcription elongation factor A (SII), 2;transcription elongation factor A (SII), 3;hook homolog 3 (Drosophila);myomesin 1, 185kDa 185 24 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541594.[MT7]-ISNLK[MT7].2b4_1.heavy 431.784 / 572.352 2318.0 23.186299800872803 41 18 10 7 6 6.330206226639145 15.797273646342536 0.026399612426757812 6 0.9863148872156204 10.537598596767365 2318.0 4.995689655172413 0.0 - - - - - - - 711.2727272727273 4 11 ADH4;RAI14;ATP7B;SORL1;TCEA1;TCEA2;TCEA3;HOOK3;MYOM1 alcohol dehydrogenase 4 (class II), pi polypeptide;retinoic acid induced 14;ATPase, Cu++ transporting, beta polypeptide;sortilin-related receptor, L(DLR class) A repeats-containing;transcription elongation factor A (SII), 1;transcription elongation factor A (SII), 2;transcription elongation factor A (SII), 3;hook homolog 3 (Drosophila);myomesin 1, 185kDa 187 24 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541594.[MT7]-ISNLK[MT7].2y3_1.heavy 431.784 / 518.342 3419.0 23.186299800872803 41 18 10 7 6 6.330206226639145 15.797273646342536 0.026399612426757812 6 0.9863148872156204 10.537598596767365 3419.0 8.507574872922106 3.0 - - - - - - - 703.1333333333333 19 15 ADH4;RAI14;ATP7B;SORL1;TCEA1;TCEA2;TCEA3;HOOK3;MYOM1 alcohol dehydrogenase 4 (class II), pi polypeptide;retinoic acid induced 14;ATPase, Cu++ transporting, beta polypeptide;sortilin-related receptor, L(DLR class) A repeats-containing;transcription elongation factor A (SII), 1;transcription elongation factor A (SII), 2;transcription elongation factor A (SII), 3;hook homolog 3 (Drosophila);myomesin 1, 185kDa 189 25 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23214.[MT7]-NIIGLLNVFTPQK[MT7].3y3_1.heavy 582.357 / 516.326 107081.0 47.590599060058594 44 14 10 10 10 1.9669988942135113 44.96036537197856 0.0 3 0.9345744020870214 4.798348238093596 107081.0 372.43733752145715 0.0 - - - - - - - 262.2857142857143 214 14 MAPK8 mitogen-activated protein kinase 8 191 25 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23214.[MT7]-NIIGLLNVFTPQK[MT7].3b4_1.heavy 582.357 / 542.342 32581.0 47.590599060058594 44 14 10 10 10 1.9669988942135113 44.96036537197856 0.0 3 0.9345744020870214 4.798348238093596 32581.0 228.30158568567614 0.0 - - - - - - - 197.11764705882354 65 17 MAPK8 mitogen-activated protein kinase 8 193 25 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23214.[MT7]-NIIGLLNVFTPQK[MT7].3b5_1.heavy 582.357 / 655.426 48693.0 47.590599060058594 44 14 10 10 10 1.9669988942135113 44.96036537197856 0.0 3 0.9345744020870214 4.798348238093596 48693.0 262.0893064022782 0.0 - - - - - - - 213.8235294117647 97 17 MAPK8 mitogen-activated protein kinase 8 195 25 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23214.[MT7]-NIIGLLNVFTPQK[MT7].3b7_1.heavy 582.357 / 882.553 25915.0 47.590599060058594 44 14 10 10 10 1.9669988942135113 44.96036537197856 0.0 3 0.9345744020870214 4.798348238093596 25915.0 370.6868211172949 0.0 - - - - - - - 151.0 51 17 MAPK8 mitogen-activated protein kinase 8 197 26 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544576.[MT7]-C[CAM]LEHLFFFK[MT7].3y3_1.heavy 510.279 / 585.352 14628.0 40.90639877319336 48 18 10 10 10 3.8225853855381366 21.909694783617073 0.0 3 0.9868432388453217 10.747576935363025 14628.0 41.42766917293233 0.0 - - - - - - - 286.5625 29 16 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 199 26 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544576.[MT7]-C[CAM]LEHLFFFK[MT7].3b4_1.heavy 510.279 / 684.326 10572.0 40.90639877319336 48 18 10 10 10 3.8225853855381366 21.909694783617073 0.0 3 0.9868432388453217 10.747576935363025 10572.0 29.26454573934837 0.0 - - - - - - - 208.06666666666666 21 15 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 201 26 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544576.[MT7]-C[CAM]LEHLFFFK[MT7].3y4_1.heavy 510.279 / 732.42 13432.0 40.90639877319336 48 18 10 10 10 3.8225853855381366 21.909694783617073 0.0 3 0.9868432388453217 10.747576935363025 13432.0 84.87402433856026 0.0 - - - - - - - 207.0 26 17 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 203 26 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544576.[MT7]-C[CAM]LEHLFFFK[MT7].3b3_1.heavy 510.279 / 547.267 14429.0 40.90639877319336 48 18 10 10 10 3.8225853855381366 21.909694783617073 0.0 3 0.9868432388453217 10.747576935363025 14429.0 64.16215880243382 0.0 - - - - - - - 212.4 28 15 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 205 27 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22864.[MT7]-QSFNEVGK[MT7].2y4_1.heavy 598.829 / 576.347 N/A 21.94219970703125 43 17 10 10 6 2.6949433277667767 37.106531692029 0.0 5 0.9751256348623424 7.80875865245065 1656.0 1.693099955240406 9.0 - - - - - - - 712.3333333333334 6 12 RRAS related RAS viral (r-ras) oncogene homolog 207 27 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22864.[MT7]-QSFNEVGK[MT7].2b4_1.heavy 598.829 / 621.311 694.0 21.94219970703125 43 17 10 10 6 2.6949433277667767 37.106531692029 0.0 5 0.9751256348623424 7.80875865245065 694.0 3.554800561797753 2.0 - - - - - - - 151.68421052631578 2 19 RRAS related RAS viral (r-ras) oncogene homolog 209 27 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22864.[MT7]-QSFNEVGK[MT7].2b5_1.heavy 598.829 / 750.354 2136.0 21.94219970703125 43 17 10 10 6 2.6949433277667767 37.106531692029 0.0 5 0.9751256348623424 7.80875865245065 2136.0 6.345283333518628 0.0 - - - - - - - 199.13636363636363 4 22 RRAS related RAS viral (r-ras) oncogene homolog 211 27 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22864.[MT7]-QSFNEVGK[MT7].2y7_1.heavy 598.829 / 924.491 3044.0 21.94219970703125 43 17 10 10 6 2.6949433277667767 37.106531692029 0.0 5 0.9751256348623424 7.80875865245065 3044.0 69.78226415094339 0.0 - - - - - - - 123.07692307692308 6 13 RRAS related RAS viral (r-ras) oncogene homolog 213 28 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542976.[MT7]-DLIYTC[CAM]R.2y4_1.heavy 542.783 / 599.261 7352.0 27.421300888061523 45 15 10 10 10 2.761340436878202 28.89163004189904 0.0 3 0.9504816925906601 5.522946691834357 7352.0 28.62469663543726 0.0 - - - - - - - 560.8571428571429 14 7 RXRG retinoid X receptor, gamma 215 28 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542976.[MT7]-DLIYTC[CAM]R.2y5_1.heavy 542.783 / 712.345 5263.0 27.421300888061523 45 15 10 10 10 2.761340436878202 28.89163004189904 0.0 3 0.9504816925906601 5.522946691834357 5263.0 9.800932178196799 0.0 - - - - - - - 644.4285714285714 10 7 RXRG retinoid X receptor, gamma 217 28 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542976.[MT7]-DLIYTC[CAM]R.2b4_1.heavy 542.783 / 649.368 752.0 27.421300888061523 45 15 10 10 10 2.761340436878202 28.89163004189904 0.0 3 0.9504816925906601 5.522946691834357 752.0 -0.26365614798694226 15.0 - - - - - - - 250.86666666666667 3 15 RXRG retinoid X receptor, gamma 219 28 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542976.[MT7]-DLIYTC[CAM]R.2y6_1.heavy 542.783 / 825.429 6015.0 27.421300888061523 45 15 10 10 10 2.761340436878202 28.89163004189904 0.0 3 0.9504816925906601 5.522946691834357 6015.0 34.217065868263475 0.0 - - - - - - - 193.0 12 13 RXRG retinoid X receptor, gamma 221 29 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544572.[MT7]-QLFTLVEWAK[MT7].3y3_1.heavy 508.301 / 548.331 84204.0 44.428951263427734 42 15 10 7 10 4.549731035337862 21.979321244112626 0.02809906005859375 3 0.9570051362480178 5.930422468640907 84204.0 394.1860786905173 0.0 - - - - - - - 699.5714285714286 168 7 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 223 29 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544572.[MT7]-QLFTLVEWAK[MT7].3b4_1.heavy 508.301 / 634.368 43647.0 44.428951263427734 42 15 10 7 10 4.549731035337862 21.979321244112626 0.02809906005859375 3 0.9570051362480178 5.930422468640907 43647.0 116.79198212054216 0.0 - - - - - - - 689.5 87 8 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 225 29 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544572.[MT7]-QLFTLVEWAK[MT7].3b5_1.heavy 508.301 / 747.452 41983.0 44.428951263427734 42 15 10 7 10 4.549731035337862 21.979321244112626 0.02809906005859375 3 0.9570051362480178 5.930422468640907 41983.0 886.8724614035089 0.0 - - - - - - - 169.92857142857142 83 14 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 227 29 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544572.[MT7]-QLFTLVEWAK[MT7].3b3_1.heavy 508.301 / 533.32 24772.0 44.428951263427734 42 15 10 7 10 4.549731035337862 21.979321244112626 0.02809906005859375 3 0.9570051362480178 5.930422468640907 24772.0 180.57484210526314 0.0 - - - - - - - 174.42857142857142 49 21 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 229 30 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 448632.0 15.3125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 448632.0 841.2436808040945 0.0 - - - - - - - 286.3333333333333 897 6 231 30 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 885949.0 15.3125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 885949.0 3500.148258675775 0.0 - - - - - - - 1180.75 1771 8 233 30 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 355318.0 15.3125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 355318.0 2415.3243467349353 0.0 - - - - - - - 327.875 710 8 235 31 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23086.[MT7]-FWQAHSGIC[CAM]TR.3y7_1.heavy 502.918 / 830.394 7379.0 28.460899353027344 48 18 10 10 10 6.975130162209524 14.336650022932737 0.0 3 0.9868355636217097 10.744436508567153 7379.0 31.657830435276736 0.0 - - - - - - - 205.0 14 18 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 237 31 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23086.[MT7]-FWQAHSGIC[CAM]TR.3y6_1.heavy 502.918 / 693.335 47541.0 28.460899353027344 48 18 10 10 10 6.975130162209524 14.336650022932737 0.0 3 0.9868355636217097 10.744436508567153 47541.0 104.2256332871595 0.0 - - - - - - - 212.92307692307693 95 13 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 239 31 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23086.[MT7]-FWQAHSGIC[CAM]TR.3b4_1.heavy 502.918 / 677.353 26412.0 28.460899353027344 48 18 10 10 10 6.975130162209524 14.336650022932737 0.0 3 0.9868355636217097 10.744436508567153 26412.0 23.85779926251619 0.0 - - - - - - - 363.1111111111111 52 9 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 241 31 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23086.[MT7]-FWQAHSGIC[CAM]TR.3y4_1.heavy 502.918 / 549.281 6708.0 28.460899353027344 48 18 10 10 10 6.975130162209524 14.336650022932737 0.0 3 0.9868355636217097 10.744436508567153 6708.0 8.911388070708073 0.0 - - - - - - - 677.2307692307693 13 13 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 243 32 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544570.[MT7]-LWC[CAM]VETGEIK[MT7].3b4_1.heavy 508.277 / 703.372 21820.0 35.44850158691406 50 20 10 10 10 6.3257799102312635 15.808327418767895 0.0 3 0.9934914323987847 15.289167031046713 21820.0 29.39563601053255 0.0 - - - - - - - 748.2857142857143 43 7 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 245 32 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544570.[MT7]-LWC[CAM]VETGEIK[MT7].3y4_1.heavy 508.277 / 590.363 47325.0 35.44850158691406 50 20 10 10 10 6.3257799102312635 15.808327418767895 0.0 3 0.9934914323987847 15.289167031046713 47325.0 50.27542157843607 0.0 - - - - - - - 797.5555555555555 94 9 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 247 32 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544570.[MT7]-LWC[CAM]VETGEIK[MT7].3b3_1.heavy 508.277 / 604.303 48101.0 35.44850158691406 50 20 10 10 10 6.3257799102312635 15.808327418767895 0.0 3 0.9934914323987847 15.289167031046713 48101.0 74.38298969072166 0.0 - - - - - - - 800.25 96 8 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 249 32 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544570.[MT7]-LWC[CAM]VETGEIK[MT7].3y5_1.heavy 508.277 / 691.411 41215.0 35.44850158691406 50 20 10 10 10 6.3257799102312635 15.808327418767895 0.0 3 0.9934914323987847 15.289167031046713 41215.0 108.53081001472755 0.0 - - - - - - - 278.875 82 16 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 251 33 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544807.[MT7]-EVYLSGSFNNWSK[MT7].3b6_1.heavy 606.98 / 793.421 3678.0 35.49100112915039 43 13 10 10 10 1.9064317494204372 46.7372485211997 0.0 3 0.9281415884901926 4.576020538011261 3678.0 2.6780709219858156 1.0 - - - - - - - 705.2222222222222 10 9 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 253 33 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544807.[MT7]-EVYLSGSFNNWSK[MT7].3y3_1.heavy 606.98 / 564.326 14711.0 35.49100112915039 43 13 10 10 10 1.9064317494204372 46.7372485211997 0.0 3 0.9281415884901926 4.576020538011261 14711.0 15.392575275824008 0.0 - - - - - - - 322.0 29 4 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 255 33 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544807.[MT7]-EVYLSGSFNNWSK[MT7].3b4_1.heavy 606.98 / 649.368 11401.0 35.49100112915039 43 13 10 10 10 1.9064317494204372 46.7372485211997 0.0 3 0.9281415884901926 4.576020538011261 11401.0 20.747481599514376 0.0 - - - - - - - 276.0 22 10 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 257 33 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544807.[MT7]-EVYLSGSFNNWSK[MT7].3b3_1.heavy 606.98 / 536.284 18389.0 35.49100112915039 43 13 10 10 10 1.9064317494204372 46.7372485211997 0.0 3 0.9281415884901926 4.576020538011261 18389.0 21.965599276386712 0.0 - - - - - - - 368.0 36 6 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 259 34 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23082.[MT7]-ADDLEPIMELGR.2b4_1.heavy 751.886 / 559.284 2738.0 38.53579902648926 39 13 10 6 10 0.9908920468281095 51.4020935785246 0.030200958251953125 3 0.9197045027524617 4.32580593276788 2738.0 21.750006749156356 0.0 - - - - - - - 165.6 5 20 MAP2K6 mitogen-activated protein kinase kinase 6 261 34 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23082.[MT7]-ADDLEPIMELGR.2y9_1.heavy 751.886 / 1057.57 3438.0 38.53579902648926 39 13 10 6 10 0.9908920468281095 51.4020935785246 0.030200958251953125 3 0.9197045027524617 4.32580593276788 3438.0 73.78502952755906 0.0 - - - - - - - 147.42105263157896 6 19 MAP2K6 mitogen-activated protein kinase kinase 6 263 34 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23082.[MT7]-ADDLEPIMELGR.2b5_1.heavy 751.886 / 688.327 7386.0 38.53579902648926 39 13 10 6 10 0.9908920468281095 51.4020935785246 0.030200958251953125 3 0.9197045027524617 4.32580593276788 7386.0 10.807094620229153 0.0 - - - - - - - 279.0 14 21 MAP2K6 mitogen-activated protein kinase kinase 6 265 34 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23082.[MT7]-ADDLEPIMELGR.2y7_1.heavy 751.886 / 815.444 7131.0 38.53579902648926 39 13 10 6 10 0.9908920468281095 51.4020935785246 0.030200958251953125 3 0.9197045027524617 4.32580593276788 7131.0 32.07999012150548 0.0 - - - - - - - 203.7 14 20 MAP2K6 mitogen-activated protein kinase kinase 6 267 35 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22766.[MT7]-AIASIAEK[MT7].2y4_1.heavy 545.839 / 604.379 2366.0 26.083374977111816 40 14 10 6 10 2.251968537536151 34.90593329727699 0.037700653076171875 3 0.9409828381041171 5.054914494183381 2366.0 4.152142088266954 0.0 - - - - - - - 675.9090909090909 4 11 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 269 35 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22766.[MT7]-AIASIAEK[MT7].2y5_1.heavy 545.839 / 691.411 5746.0 26.083374977111816 40 14 10 6 10 2.251968537536151 34.90593329727699 0.037700653076171875 3 0.9409828381041171 5.054914494183381 5746.0 10.060731211916046 0.0 - - - - - - - 246.76923076923077 11 13 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 271 35 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22766.[MT7]-AIASIAEK[MT7].2y6_1.heavy 545.839 / 762.448 4816.0 26.083374977111816 40 14 10 6 10 2.251968537536151 34.90593329727699 0.037700653076171875 3 0.9409828381041171 5.054914494183381 4816.0 11.769799625968474 0.0 - - - - - - - 253.21428571428572 9 14 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 273 35 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22766.[MT7]-AIASIAEK[MT7].2y7_1.heavy 545.839 / 875.532 2281.0 26.083374977111816 40 14 10 6 10 2.251968537536151 34.90593329727699 0.037700653076171875 3 0.9409828381041171 5.054914494183381 2281.0 17.5621582430947 2.0 - - - - - - - 688.0 6 7 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 275 36 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545003.[MT7]-LFPDVLFPADSEHNK[MT7].3y3_1.heavy 673.026 / 542.317 1928.0 40.96444892883301 42 16 10 6 10 2.6971621265727457 29.610495425601528 0.038700103759765625 3 0.9690392844642836 6.995680306442924 1928.0 1.1596992481203008 0.0 - - - - - - - 702.8571428571429 3 7 MAPK8 mitogen-activated protein kinase 8 277 36 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545003.[MT7]-LFPDVLFPADSEHNK[MT7].3b4_1.heavy 673.026 / 617.341 3058.0 40.96444892883301 42 16 10 6 10 2.6971621265727457 29.610495425601528 0.038700103759765625 3 0.9690392844642836 6.995680306442924 3058.0 10.72982456140351 0.0 - - - - - - - 234.8 6 15 MAPK8 mitogen-activated protein kinase 8 279 36 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545003.[MT7]-LFPDVLFPADSEHNK[MT7].3b5_1.heavy 673.026 / 716.41 3391.0 40.96444892883301 42 16 10 6 10 2.6971621265727457 29.610495425601528 0.038700103759765625 3 0.9690392844642836 6.995680306442924 3391.0 8.482358166189112 0.0 - - - - - - - 250.11764705882354 6 17 MAPK8 mitogen-activated protein kinase 8 281 36 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545003.[MT7]-LFPDVLFPADSEHNK[MT7].3y8_1.heavy 673.026 / 1041.51 2261.0 40.96444892883301 42 16 10 6 10 2.6971621265727457 29.610495425601528 0.038700103759765625 3 0.9690392844642836 6.995680306442924 2261.0 7.354036144578313 0.0 - - - - - - - 199.16666666666666 4 12 MAPK8 mitogen-activated protein kinase 8 283 37 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22768.[MT7]-RDSSGGTK[MT7].2y4_1.heavy 548.303 / 506.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 285 37 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22768.[MT7]-RDSSGGTK[MT7].2y6_1.heavy 548.303 / 680.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 287 37 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22768.[MT7]-RDSSGGTK[MT7].2b7_1.heavy 548.303 / 805.392 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 289 37 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22768.[MT7]-RDSSGGTK[MT7].2y7_1.heavy 548.303 / 795.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 291 38 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544417.[MT7]-LIQQGADAHSK[MT7].3y3_1.heavy 485.943 / 515.306 4617.0 19.97960090637207 43 15 10 10 8 1.5362355251233335 43.573972968588315 0.0 4 0.9588628447843137 6.063802970966555 4617.0 14.109556936647953 0.0 - - - - - - - 646.3 9 10 TSC1 tuberous sclerosis 1 293 38 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544417.[MT7]-LIQQGADAHSK[MT7].3b4_1.heavy 485.943 / 627.395 1629.0 19.97960090637207 43 15 10 10 8 1.5362355251233335 43.573972968588315 0.0 4 0.9588628447843137 6.063802970966555 1629.0 3.500482725217953 0.0 - - - - - - - 253.61904761904762 3 21 TSC1 tuberous sclerosis 1 295 38 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544417.[MT7]-LIQQGADAHSK[MT7].3b3_1.heavy 485.943 / 499.336 4182.0 19.97960090637207 43 15 10 10 8 1.5362355251233335 43.573972968588315 0.0 4 0.9588628447843137 6.063802970966555 4182.0 3.3015789473684207 2.0 - - - - - - - 271.70588235294116 8 17 TSC1 tuberous sclerosis 1 297 38 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544417.[MT7]-LIQQGADAHSK[MT7].3b7_1.heavy 485.943 / 870.48 2227.0 19.97960090637207 43 15 10 10 8 1.5362355251233335 43.573972968588315 0.0 4 0.9588628447843137 6.063802970966555 2227.0 42.55639627357419 0.0 - - - - - - - 121.07692307692308 4 13 TSC1 tuberous sclerosis 1 299 39 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545203.[MT7]-TVQHQDSQVNALEVTPDR.3y7_1.heavy 727.705 / 829.441 5433.0 25.465075492858887 44 18 10 6 10 3.3314868834707174 23.899138618840695 0.038700103759765625 3 0.9807668177371077 8.884607705986147 5433.0 45.945740740740746 0.0 - - - - - - - 214.07142857142858 10 14 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 301 39 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545203.[MT7]-TVQHQDSQVNALEVTPDR.3y6_1.heavy 727.705 / 716.357 9812.0 25.465075492858887 44 18 10 6 10 3.3314868834707174 23.899138618840695 0.038700103759765625 3 0.9807668177371077 8.884607705986147 9812.0 24.018913941800584 0.0 - - - - - - - 280.09090909090907 19 11 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 303 39 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545203.[MT7]-TVQHQDSQVNALEVTPDR.3y5_1.heavy 727.705 / 587.315 5271.0 25.465075492858887 44 18 10 6 10 3.3314868834707174 23.899138618840695 0.038700103759765625 3 0.9807668177371077 8.884607705986147 5271.0 25.769333333333336 0.0 - - - - - - - 238.23529411764707 10 17 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 305 39 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545203.[MT7]-TVQHQDSQVNALEVTPDR.3y9_1.heavy 727.705 / 1014.52 6487.0 25.465075492858887 44 18 10 6 10 3.3314868834707174 23.899138618840695 0.038700103759765625 3 0.9807668177371077 8.884607705986147 6487.0 29.193943951776504 0.0 - - - - - - - 162.0 12 14 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 307 40 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23078.[MT7]-ILEAELAVEPK[MT7].2b3_1.heavy 750.45 / 500.32 5175.0 35.49100112915039 43 13 10 10 10 0.9512513024455073 64.99407266795971 0.0 3 0.9043006594401922 3.9571453406283497 5175.0 19.43718697043871 0.0 - - - - - - - 232.23529411764707 10 17 RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 309 40 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23078.[MT7]-ILEAELAVEPK[MT7].2b4_1.heavy 750.45 / 571.357 4704.0 35.49100112915039 43 13 10 10 10 0.9512513024455073 64.99407266795971 0.0 3 0.9043006594401922 3.9571453406283497 4704.0 30.22980273141123 0.0 - - - - - - - 211.5 9 12 RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 311 40 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23078.[MT7]-ILEAELAVEPK[MT7].2b6_1.heavy 750.45 / 813.484 6210.0 35.49100112915039 43 13 10 10 10 0.9512513024455073 64.99407266795971 0.0 3 0.9043006594401922 3.9571453406283497 6210.0 56.81489361702128 0.0 - - - - - - - 166.30769230769232 12 13 RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 313 40 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23078.[MT7]-ILEAELAVEPK[MT7].2b5_1.heavy 750.45 / 700.4 5363.0 35.49100112915039 43 13 10 10 10 0.9512513024455073 64.99407266795971 0.0 3 0.9043006594401922 3.9571453406283497 5363.0 15.030299603746355 1.0 - - - - - - - 261.85714285714283 11 14 RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 315 41 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23346.[MT7]-EDSHPFDLGLYNEAVK[MT7].4b8_2.heavy 531.273 / 543.255 13914.0 35.119598388671875 40 10 10 10 10 0.6598786715898796 97.85435086718792 0.0 3 0.8451349129358711 3.0946715959198756 13914.0 19.098023159636064 0.0 - - - - - - - 710.4 27 10 RPA3 replication protein A3, 14kDa 317 41 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23346.[MT7]-EDSHPFDLGLYNEAVK[MT7].4b4_1.heavy 531.273 / 613.27 15929.0 35.119598388671875 40 10 10 10 10 0.6598786715898796 97.85435086718792 0.0 3 0.8451349129358711 3.0946715959198756 15929.0 28.420417811821395 0.0 - - - - - - - 288.0 31 4 RPA3 replication protein A3, 14kDa 319 41 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23346.[MT7]-EDSHPFDLGLYNEAVK[MT7].4b10_2.heavy 531.273 / 628.307 37137.0 35.119598388671875 40 10 10 10 10 0.6598786715898796 97.85435086718792 0.0 3 0.8451349129358711 3.0946715959198756 37137.0 44.689653844869056 0.0 - - - - - - - 780.0 74 8 RPA3 replication protein A3, 14kDa 321 41 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23346.[MT7]-EDSHPFDLGLYNEAVK[MT7].4b9_2.heavy 531.273 / 571.765 74081.0 35.119598388671875 40 10 10 10 10 0.6598786715898796 97.85435086718792 0.0 3 0.8451349129358711 3.0946715959198756 74081.0 14.316183278615691 1.0 - - - - - - - 384.0 167 2 RPA3 replication protein A3, 14kDa 323 42 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23208.[MT7]-IINDGAAILRQEK[MT7].4y8_2.heavy 433.011 / 536.833 16155.0 32.06290054321289 37 7 10 10 10 0.5852283045064663 86.73229117138627 0.0 3 0.7358224423674259 2.346137772553025 16155.0 87.17301980198019 0.0 - - - - - - - 168.33333333333334 32 9 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 325 42 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23208.[MT7]-IINDGAAILRQEK[MT7].4b4_1.heavy 433.011 / 600.347 6462.0 32.06290054321289 37 7 10 10 10 0.5852283045064663 86.73229117138627 0.0 3 0.7358224423674259 2.346137772553025 6462.0 37.32178217821782 0.0 - - - - - - - 190.77777777777777 12 18 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 327 42 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23208.[MT7]-IINDGAAILRQEK[MT7].4y7_2.heavy 433.011 / 501.315 55634.0 32.06290054321289 37 7 10 10 10 0.5852283045064663 86.73229117138627 0.0 3 0.7358224423674259 2.346137772553025 55634.0 113.66368065377966 0.0 - - - - - - - 767.6 111 10 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 329 42 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23208.[MT7]-IINDGAAILRQEK[MT7].4b3_1.heavy 433.011 / 485.32 11409.0 32.06290054321289 37 7 10 10 10 0.5852283045064663 86.73229117138627 0.0 3 0.7358224423674259 2.346137772553025 11409.0 14.274086408640866 0.0 - - - - - - - 620.4285714285714 22 7 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 331 43 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23347.[MT7]-DVK[MT7]PSNVLINALGQVK[MT7].3b6_1.heavy 709.767 / 929.529 1032.0 37.5515251159668 37 11 10 6 10 0.9690301581196568 63.28601563780672 0.03070068359375 3 0.8643039667920884 3.3116225725704367 1032.0 7.199999999999999 0.0 - - - - - - - 141.0952380952381 2 21 MAP2K6 mitogen-activated protein kinase kinase 6 333 43 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23347.[MT7]-DVK[MT7]PSNVLINALGQVK[MT7].3y4_1.heavy 709.767 / 575.363 5482.0 37.5515251159668 37 11 10 6 10 0.9690301581196568 63.28601563780672 0.03070068359375 3 0.8643039667920884 3.3116225725704367 5482.0 6.374418604651162 0.0 - - - - - - - 717.5 10 8 MAP2K6 mitogen-activated protein kinase kinase 6 335 43 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23347.[MT7]-DVK[MT7]PSNVLINALGQVK[MT7].3b8_2.heavy 709.767 / 571.345 8513.0 37.5515251159668 37 11 10 6 10 0.9690301581196568 63.28601563780672 0.03070068359375 3 0.8643039667920884 3.3116225725704367 8513.0 25.851109678750063 0.0 - - - - - - - 681.7142857142857 17 7 MAP2K6 mitogen-activated protein kinase kinase 6 337 43 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23347.[MT7]-DVK[MT7]PSNVLINALGQVK[MT7].3b7_2.heavy 709.767 / 514.803 9029.0 37.5515251159668 37 11 10 6 10 0.9690301581196568 63.28601563780672 0.03070068359375 3 0.8643039667920884 3.3116225725704367 9029.0 49.733622225432136 0.0 - - - - - - - 225.38888888888889 18 18 MAP2K6 mitogen-activated protein kinase kinase 6 339 44 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23076.[MT7]-SGIVEYLSLVK[MT7].2y4_1.heavy 748.452 / 590.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 341 44 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23076.[MT7]-SGIVEYLSLVK[MT7].2b4_1.heavy 748.452 / 501.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 343 44 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23076.[MT7]-SGIVEYLSLVK[MT7].2b6_1.heavy 748.452 / 793.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 345 44 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23076.[MT7]-SGIVEYLSLVK[MT7].2b5_1.heavy 748.452 / 630.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 347 45 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23204.[MT7]-ATILC[CAM]TSYVQFK[MT7].3y3_1.heavy 573.651 / 566.342 48188.0 36.382301330566406 44 14 10 10 10 2.5495761739598195 39.22220525174078 0.0 3 0.9480805437627521 5.392623851794424 48188.0 69.21648251971581 0.0 - - - - - - - 744.125 96 8 RPA3 replication protein A3, 14kDa 349 45 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23204.[MT7]-ATILC[CAM]TSYVQFK[MT7].3b4_1.heavy 573.651 / 543.362 48755.0 36.382301330566406 44 14 10 10 10 2.5495761739598195 39.22220525174078 0.0 3 0.9480805437627521 5.392623851794424 48755.0 69.6465499742846 0.0 - - - - - - - 786.0 97 11 RPA3 replication protein A3, 14kDa 351 45 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23204.[MT7]-ATILC[CAM]TSYVQFK[MT7].3y4_1.heavy 573.651 / 665.41 36212.0 36.382301330566406 44 14 10 10 10 2.5495761739598195 39.22220525174078 0.0 3 0.9480805437627521 5.392623851794424 36212.0 93.97754583921015 0.0 - - - - - - - 691.1666666666666 72 12 RPA3 replication protein A3, 14kDa 353 45 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23204.[MT7]-ATILC[CAM]TSYVQFK[MT7].3y5_1.heavy 573.651 / 828.474 12827.0 36.382301330566406 44 14 10 10 10 2.5495761739598195 39.22220525174078 0.0 3 0.9480805437627521 5.392623851794424 12827.0 71.59315366033819 0.0 - - - - - - - 226.8 25 20 RPA3 replication protein A3, 14kDa 355 46 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544060.[MT7]-WLNYGGVIK[MT7].3b6_1.heavy 446.599 / 835.422 32180.0 36.277801513671875 47 17 10 10 10 1.7243494555674215 44.38562591995804 0.0 3 0.9760380996512579 7.95665808325426 32180.0 263.60652060263294 0.0 - - - - - - - 194.72727272727272 64 11 PRIM1 primase, DNA, polypeptide 1 (49kDa) 357 46 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544060.[MT7]-WLNYGGVIK[MT7].3y4_1.heavy 446.599 / 560.389 52204.0 36.277801513671875 47 17 10 10 10 1.7243494555674215 44.38562591995804 0.0 3 0.9760380996512579 7.95665808325426 52204.0 142.06049816750374 0.0 - - - - - - - 715.125 104 8 PRIM1 primase, DNA, polypeptide 1 (49kDa) 359 46 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544060.[MT7]-WLNYGGVIK[MT7].3b3_1.heavy 446.599 / 558.316 119981.0 36.277801513671875 47 17 10 10 10 1.7243494555674215 44.38562591995804 0.0 3 0.9760380996512579 7.95665808325426 119981.0 221.40312341118 0.0 - - - - - - - 256.61538461538464 239 13 PRIM1 primase, DNA, polypeptide 1 (49kDa) 361 46 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544060.[MT7]-WLNYGGVIK[MT7].3y5_1.heavy 446.599 / 617.41 31862.0 36.277801513671875 47 17 10 10 10 1.7243494555674215 44.38562591995804 0.0 3 0.9760380996512579 7.95665808325426 31862.0 63.59422181227055 0.0 - - - - - - - 259.53333333333336 63 15 PRIM1 primase, DNA, polypeptide 1 (49kDa) 363 47 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544559.[MT7]-AVVC[CAM]LAFNDSVLG.2b4_1.heavy 754.899 / 574.314 5950.0 43.38367462158203 40 14 10 6 10 4.292515693373571 23.296362120322982 0.0364990234375 3 0.9328899698534991 4.737065742122013 5950.0 16.802928870292888 0.0 - - - - - - - 243.76470588235293 11 17 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 365 47 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544559.[MT7]-AVVC[CAM]LAFNDSVLG.2b6_1.heavy 754.899 / 758.435 31293.0 43.38367462158203 40 14 10 6 10 4.292515693373571 23.296362120322982 0.0364990234375 3 0.9328899698534991 4.737065742122013 31293.0 147.63981679617453 0.0 - - - - - - - 239.0 62 8 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 367 47 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544559.[MT7]-AVVC[CAM]LAFNDSVLG.2b7_1.heavy 754.899 / 905.503 8448.0 43.38367462158203 40 14 10 6 10 4.292515693373571 23.296362120322982 0.0364990234375 3 0.9328899698534991 4.737065742122013 8448.0 28.633959766446825 0.0 - - - - - - - 249.0625 16 16 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 369 47 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544559.[MT7]-AVVC[CAM]LAFNDSVLG.2b5_1.heavy 754.899 / 687.398 15939.0 43.38367462158203 40 14 10 6 10 4.292515693373571 23.296362120322982 0.0364990234375 3 0.9328899698534991 4.737065742122013 15939.0 37.4274458021285 0.0 - - - - - - - 254.28571428571428 31 14 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 371 48 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542025.[MT7]-ESWDK[MT7].2b3_1.heavy 476.753 / 547.263 889.0 21.547125339508057 41 15 10 6 10 2.7039778023364627 36.98255211769551 0.03510093688964844 3 0.95189485901593 5.6041542412041485 889.0 1.918705035971223 9.0 - - - - - - - 253.05555555555554 2 18 PRIM1 primase, DNA, polypeptide 1 (49kDa) 373 48 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542025.[MT7]-ESWDK[MT7].2y4_1.heavy 476.753 / 679.353 8886.0 21.547125339508057 41 15 10 6 10 2.7039778023364627 36.98255211769551 0.03510093688964844 3 0.95189485901593 5.6041542412041485 8886.0 22.899672830725457 0.0 - - - - - - - 638.5 17 8 PRIM1 primase, DNA, polypeptide 1 (49kDa) 375 48 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542025.[MT7]-ESWDK[MT7].2b4_1.heavy 476.753 / 662.29 7553.0 21.547125339508057 41 15 10 6 10 2.7039778023364627 36.98255211769551 0.03510093688964844 3 0.95189485901593 5.6041542412041485 7553.0 40.59867246907925 0.0 - - - - - - - 191.0 15 16 PRIM1 primase, DNA, polypeptide 1 (49kDa) 377 48 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542025.[MT7]-ESWDK[MT7].2y3_1.heavy 476.753 / 592.321 2666.0 21.547125339508057 41 15 10 6 10 2.7039778023364627 36.98255211769551 0.03510093688964844 3 0.95189485901593 5.6041542412041485 2666.0 9.274745105311142 0.0 - - - - - - - 251.64705882352942 5 17 PRIM1 primase, DNA, polypeptide 1 (49kDa) 379 49 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22877.[MT7]-GTDVASFVK[MT7].2y4_1.heavy 606.347 / 624.384 4548.0 29.071399688720703 40 14 10 6 10 2.388564812760554 28.153775162196773 0.033599853515625 3 0.9425144948266322 5.122482031770017 4548.0 21.022477341389724 0.0 - - - - - - - 213.94117647058823 9 17 MAP2K6 mitogen-activated protein kinase kinase 6 381 49 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22877.[MT7]-GTDVASFVK[MT7].2y5_1.heavy 606.347 / 695.421 4135.0 29.071399688720703 40 14 10 6 10 2.388564812760554 28.153775162196773 0.033599853515625 3 0.9425144948266322 5.122482031770017 4135.0 9.718919146885167 0.0 - - - - - - - 236.93333333333334 8 15 MAP2K6 mitogen-activated protein kinase kinase 6 383 49 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22877.[MT7]-GTDVASFVK[MT7].2b4_1.heavy 606.347 / 517.274 3804.0 29.071399688720703 40 14 10 6 10 2.388564812760554 28.153775162196773 0.033599853515625 3 0.9425144948266322 5.122482031770017 3804.0 11.396791711245001 0.0 - - - - - - - 321.3888888888889 7 18 MAP2K6 mitogen-activated protein kinase kinase 6 385 49 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22877.[MT7]-GTDVASFVK[MT7].2y6_1.heavy 606.347 / 794.489 5458.0 29.071399688720703 40 14 10 6 10 2.388564812760554 28.153775162196773 0.033599853515625 3 0.9425144948266322 5.122482031770017 5458.0 67.10073260785077 0.0 - - - - - - - 182.0 10 15 MAP2K6 mitogen-activated protein kinase kinase 6 387 50 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544542.[MT7]-ILEAELAVEPK[MT7].3b6_1.heavy 500.636 / 813.484 75093.0 35.49100112915039 50 20 10 10 10 4.901291887095202 20.402784062563953 0.0 3 0.9911780324500374 13.129852475729217 75093.0 348.04848039613216 0.0 - - - - - - - 201.07692307692307 150 13 RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 389 50 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544542.[MT7]-ILEAELAVEPK[MT7].3b4_1.heavy 500.636 / 571.357 61830.0 35.49100112915039 50 20 10 10 10 4.901291887095202 20.402784062563953 0.0 3 0.9911780324500374 13.129852475729217 61830.0 94.86173962189145 0.0 - - - - - - - 303.75 123 8 RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 391 50 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544542.[MT7]-ILEAELAVEPK[MT7].3b5_1.heavy 500.636 / 700.4 242744.0 35.49100112915039 50 20 10 10 10 4.901291887095202 20.402784062563953 0.0 3 0.9911780324500374 13.129852475729217 242744.0 411.11388248061496 0.0 - - - - - - - 712.25 485 8 RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 393 50 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544542.[MT7]-ILEAELAVEPK[MT7].3b3_1.heavy 500.636 / 500.32 N/A 35.49100112915039 50 20 10 10 10 4.901291887095202 20.402784062563953 0.0 3 0.9911780324500374 13.129852475729217 103393.0 4.40480102949976 2.0 - - - - - - - 22509.0 206 1 RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 395 51 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23473.[MT7]-SALTIQFIQSYFVSDYDPTIEDSYTK[MT7].4y4_1.heavy 830.668 / 642.358 4508.0 47.902099609375 50 20 10 10 10 7.9772071896050045 12.535715523386267 0.0 3 0.9945109272318001 16.64999162001446 4508.0 21.64422387648194 0.0 - - - - - - - 194.65217391304347 9 23 RRAS related RAS viral (r-ras) oncogene homolog 397 51 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23473.[MT7]-SALTIQFIQSYFVSDYDPTIEDSYTK[MT7].4b7_1.heavy 830.668 / 905.521 4608.0 47.902099609375 50 20 10 10 10 7.9772071896050045 12.535715523386267 0.0 3 0.9945109272318001 16.64999162001446 4608.0 24.37871164784668 0.0 - - - - - - - 217.9047619047619 9 21 RRAS related RAS viral (r-ras) oncogene homolog 399 51 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23473.[MT7]-SALTIQFIQSYFVSDYDPTIEDSYTK[MT7].4b4_1.heavy 830.668 / 517.31 4642.0 47.902099609375 50 20 10 10 10 7.9772071896050045 12.535715523386267 0.0 3 0.9945109272318001 16.64999162001446 4642.0 11.370301442915856 0.0 - - - - - - - 227.72727272727272 9 22 RRAS related RAS viral (r-ras) oncogene homolog 401 51 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23473.[MT7]-SALTIQFIQSYFVSDYDPTIEDSYTK[MT7].4b6_1.heavy 830.668 / 758.453 8683.0 47.902099609375 50 20 10 10 10 7.9772071896050045 12.535715523386267 0.0 3 0.9945109272318001 16.64999162001446 8683.0 23.772647724903823 0.0 - - - - - - - 227.88235294117646 17 17 RRAS related RAS viral (r-ras) oncogene homolog 403 52 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544817.[MT7]-RIGDELDSNMELQR.3y7_1.heavy 607.308 / 877.42 2151.0 29.088199615478516 35 13 8 6 8 1.1862932947781533 56.70858508101573 0.033599853515625 4 0.9044663566424727 3.9606322508030285 2151.0 27.54285213581599 0.0 - - - - - - - 124.0625 4 16 BAX BCL2-associated X protein 405 52 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544817.[MT7]-RIGDELDSNMELQR.3b4_1.heavy 607.308 / 586.343 2896.0 29.088199615478516 35 13 8 6 8 1.1862932947781533 56.70858508101573 0.033599853515625 4 0.9044663566424727 3.9606322508030285 2896.0 3.579628252788104 3.0 - - - - - - - 792.9166666666666 12 12 BAX BCL2-associated X protein 407 52 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544817.[MT7]-RIGDELDSNMELQR.3b5_1.heavy 607.308 / 715.385 2565.0 29.088199615478516 35 13 8 6 8 1.1862932947781533 56.70858508101573 0.033599853515625 4 0.9044663566424727 3.9606322508030285 2565.0 24.722891566265062 0.0 - - - - - - - 313.5263157894737 5 19 BAX BCL2-associated X protein 409 52 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544817.[MT7]-RIGDELDSNMELQR.3y4_1.heavy 607.308 / 545.304 4799.0 29.088199615478516 35 13 8 6 8 1.1862932947781533 56.70858508101573 0.033599853515625 4 0.9044663566424727 3.9606322508030285 4799.0 17.06335135541038 0.0 - - - - - - - 269.89473684210526 9 19 BAX BCL2-associated X protein 411 53 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22879.[MT7]-ENLAILEK[MT7].2b3_1.heavy 609.371 / 501.279 5061.0 31.943174362182617 46 20 10 6 10 7.1585515483240725 13.969306405764662 0.0364990234375 3 0.9932832584103944 15.050109605736175 5061.0 22.53184931506849 0.0 - - - - - - - 291.90909090909093 10 11 UBE2Q1;UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 1;ubiquitin-conjugating enzyme E2Q family member 2 413 53 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22879.[MT7]-ENLAILEK[MT7].2y5_1.heavy 609.371 / 717.463 7786.0 31.943174362182617 46 20 10 6 10 7.1585515483240725 13.969306405764662 0.0364990234375 3 0.9932832584103944 15.050109605736175 7786.0 27.346415994647323 0.0 - - - - - - - 314.38461538461536 15 13 UBE2Q1;UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 1;ubiquitin-conjugating enzyme E2Q family member 2 415 53 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22879.[MT7]-ENLAILEK[MT7].2b4_1.heavy 609.371 / 572.316 8954.0 31.943174362182617 46 20 10 6 10 7.1585515483240725 13.969306405764662 0.0364990234375 3 0.9932832584103944 15.050109605736175 8954.0 19.931210929814362 0.0 - - - - - - - 357.1111111111111 17 9 UBE2Q1;UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 1;ubiquitin-conjugating enzyme E2Q family member 2 417 53 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22879.[MT7]-ENLAILEK[MT7].2y3_1.heavy 609.371 / 533.341 7397.0 31.943174362182617 46 20 10 6 10 7.1585515483240725 13.969306405764662 0.0364990234375 3 0.9932832584103944 15.050109605736175 7397.0 23.44579145899104 0.0 - - - - - - - 359.38461538461536 14 13 UBE2Q1;UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 1;ubiquitin-conjugating enzyme E2Q family member 2 419 54 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544819.[MT7]-QVVEEPSPQLPADK[MT7].3b4_1.heavy 609.003 / 600.347 7596.0 26.956624507904053 44 18 10 6 10 10.866829774952594 9.202315861291408 0.03869819641113281 3 0.9832952799278384 9.53534354142644 7596.0 6.848120050951778 0.0 - - - - - - - 250.0 15 1 MAP2K6 mitogen-activated protein kinase kinase 6 421 54 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544819.[MT7]-QVVEEPSPQLPADK[MT7].3y4_1.heavy 609.003 / 574.332 46078.0 26.956624507904053 44 18 10 6 10 10.866829774952594 9.202315861291408 0.03869819641113281 3 0.9832952799278384 9.53534354142644 46078.0 103.27147989734814 0.0 - - - - - - - 658.5555555555555 92 9 MAP2K6 mitogen-activated protein kinase kinase 6 423 54 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544819.[MT7]-QVVEEPSPQLPADK[MT7].3y5_1.heavy 609.003 / 687.416 7847.0 26.956624507904053 44 18 10 6 10 10.866829774952594 9.202315861291408 0.03869819641113281 3 0.9832952799278384 9.53534354142644 7847.0 14.427596318493151 0.0 - - - - - - - 615.625 15 8 MAP2K6 mitogen-activated protein kinase kinase 6 425 54 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544819.[MT7]-QVVEEPSPQLPADK[MT7].3b7_1.heavy 609.003 / 913.475 9099.0 26.956624507904053 44 18 10 6 10 10.866829774952594 9.202315861291408 0.03869819641113281 3 0.9832952799278384 9.53534354142644 9099.0 102.43185628742515 0.0 - - - - - - - 183.5 18 10 MAP2K6 mitogen-activated protein kinase kinase 6 427 55 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 866771.0 17.9906005859375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 866771.0 3038.8282483322873 0.0 - - - - - - - 274.8 1733 5 429 55 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 415414.0 17.9906005859375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 415414.0 3666.7152141144225 0.0 - - - - - - - 254.9090909090909 830 11 431 55 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 464286.0 17.9906005859375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 464286.0 7756.303789644774 0.0 - - - - - - - 699.5555555555555 928 9 433 56 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23330.[MT7]-TVDC[CAM]PFTVTFYGALFR.3y7_1.heavy 680.012 / 873.462 2654.0 48.04050064086914 47 17 10 10 10 2.9133724918784725 34.32448143131962 0.0 3 0.9716020458867326 7.306101374742508 2654.0 32.353523809523814 0.0 - - - - - - - 93.33333333333333 5 15 MAP2K6 mitogen-activated protein kinase kinase 6 435 56 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23330.[MT7]-TVDC[CAM]PFTVTFYGALFR.3y6_1.heavy 680.012 / 726.393 5588.0 48.04050064086914 47 17 10 10 10 2.9133724918784725 34.32448143131962 0.0 3 0.9716020458867326 7.306101374742508 5588.0 51.612175729646694 0.0 - - - - - - - 137.76470588235293 11 17 MAP2K6 mitogen-activated protein kinase kinase 6 437 56 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23330.[MT7]-TVDC[CAM]PFTVTFYGALFR.3b4_1.heavy 680.012 / 620.283 8801.0 48.04050064086914 47 17 10 10 10 2.9133724918784725 34.32448143131962 0.0 3 0.9716020458867326 7.306101374742508 8801.0 68.04142157738094 0.0 - - - - - - - 127.13636363636364 17 22 MAP2K6 mitogen-activated protein kinase kinase 6 439 56 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23330.[MT7]-TVDC[CAM]PFTVTFYGALFR.3y8_1.heavy 680.012 / 974.509 2759.0 48.04050064086914 47 17 10 10 10 2.9133724918784725 34.32448143131962 0.0 3 0.9716020458867326 7.306101374742508 2759.0 109.96585714285715 0.0 - - - - - - - 80.6923076923077 5 13 MAP2K6 mitogen-activated protein kinase kinase 6 441 57 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544177.[MT7]-LFPYSQYYR.3y3_1.heavy 460.907 / 501.246 49609.0 36.42447376251221 44 18 10 6 10 4.346390072396627 23.00759902685388 0.033100128173828125 3 0.9864143865933601 10.57620437942689 49609.0 94.91879744010183 0.0 - - - - - - - 290.09090909090907 99 11 PRIM1 primase, DNA, polypeptide 1 (49kDa) 443 57 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544177.[MT7]-LFPYSQYYR.3b4_1.heavy 460.907 / 665.378 9496.0 36.42447376251221 44 18 10 6 10 4.346390072396627 23.00759902685388 0.033100128173828125 3 0.9864143865933601 10.57620437942689 9496.0 164.4429268292683 0.0 - - - - - - - 169.33333333333334 18 15 PRIM1 primase, DNA, polypeptide 1 (49kDa) 445 57 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544177.[MT7]-LFPYSQYYR.3y4_1.heavy 460.907 / 629.304 26278.0 36.42447376251221 44 18 10 6 10 4.346390072396627 23.00759902685388 0.033100128173828125 3 0.9864143865933601 10.57620437942689 26278.0 75.45919050374214 0.0 - - - - - - - 263.07142857142856 52 14 PRIM1 primase, DNA, polypeptide 1 (49kDa) 447 57 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544177.[MT7]-LFPYSQYYR.3y5_1.heavy 460.907 / 716.336 32991.0 36.42447376251221 44 18 10 6 10 4.346390072396627 23.00759902685388 0.033100128173828125 3 0.9864143865933601 10.57620437942689 32991.0 239.7685838334823 0.0 - - - - - - - 204.75 65 12 PRIM1 primase, DNA, polypeptide 1 (49kDa) 449 58 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38493.[MT7]-EDSHPFDLGLYNEAVK[MT7].3b9_1.heavy 708.028 / 1142.52 1466.0 35.119598388671875 50 20 10 10 10 9.18816791370329 10.883562527286793 0.0 3 0.9980643549072973 28.046548690072783 1466.0 8.90237041943109 0.0 - - - - - - - 219.9 2 10 RPA3 replication protein A3, 14kDa 451 58 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38493.[MT7]-EDSHPFDLGLYNEAVK[MT7].3b4_1.heavy 708.028 / 613.27 6494.0 35.119598388671875 50 20 10 10 10 9.18816791370329 10.883562527286793 0.0 3 0.9980643549072973 28.046548690072783 6494.0 12.145267175572519 0.0 - - - - - - - 209.25 12 12 RPA3 replication protein A3, 14kDa 453 58 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38493.[MT7]-EDSHPFDLGLYNEAVK[MT7].3b5_1.heavy 708.028 / 710.323 1257.0 35.119598388671875 50 20 10 10 10 9.18816791370329 10.883562527286793 0.0 3 0.9980643549072973 28.046548690072783 1257.0 2.882069286679572 0.0 - - - - - - - 209.47058823529412 2 17 RPA3 replication protein A3, 14kDa 455 58 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38493.[MT7]-EDSHPFDLGLYNEAVK[MT7].3b7_1.heavy 708.028 / 972.418 1152.0 35.119598388671875 50 20 10 10 10 9.18816791370329 10.883562527286793 0.0 3 0.9980643549072973 28.046548690072783 1152.0 4.2721700135293315 0.0 - - - - - - - 244.16666666666666 2 12 RPA3 replication protein A3, 14kDa 457 59 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23338.[MT7]-GGVLFPGTDHIDQWNK[MT7].3b9_1.heavy 691.365 / 988.522 N/A 34.5088996887207 46 16 10 10 10 6.742349046520191 14.831626086105883 0.0 2 0.9666822380910308 6.742348796690085 202.0 1.6400000000000001 12.0 - - - - - - - 0.0 1 0 MAPK8 mitogen-activated protein kinase 8 459 59 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23338.[MT7]-GGVLFPGTDHIDQWNK[MT7].3y3_1.heavy 691.365 / 591.337 2623.0 34.5088996887207 46 16 10 10 10 6.742349046520191 14.831626086105883 0.0 2 0.9666822380910308 6.742348796690085 2623.0 5.982443422913719 0.0 - - - - - - - 288.57142857142856 5 14 MAPK8 mitogen-activated protein kinase 8 461 59 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23338.[MT7]-GGVLFPGTDHIDQWNK[MT7].3b7_1.heavy 691.365 / 772.447 N/A 34.5088996887207 46 16 10 10 10 6.742349046520191 14.831626086105883 0.0 2 0.9666822380910308 6.742348796690085 404.0 2.1066666666666665 16.0 - - - - - - - 0.0 1 0 MAPK8 mitogen-activated protein kinase 8 463 59 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23338.[MT7]-GGVLFPGTDHIDQWNK[MT7].3b5_1.heavy 691.365 / 618.373 3127.0 34.5088996887207 46 16 10 10 10 6.742349046520191 14.831626086105883 0.0 2 0.9666822380910308 6.742348796690085 3127.0 7.23603305785124 1.0 - - - - - - - 672.3333333333334 6 9 MAPK8 mitogen-activated protein kinase 8 465 60 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38491.[MT7]-RITQVFELEILDLYGR.3y6_1.heavy 703.732 / 736.399 1925.0 46.20677661895752 36 9 10 7 10 0.5517141665081364 93.37274442657235 0.026500701904296875 3 0.8177095136112477 2.845448893431472 1925.0 38.5 0.0 - - - - - - - 98.4090909090909 3 22 TSC1 tuberous sclerosis 1 467 60 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38491.[MT7]-RITQVFELEILDLYGR.3b5_1.heavy 703.732 / 742.469 1243.0 46.20677661895752 36 9 10 7 10 0.5517141665081364 93.37274442657235 0.026500701904296875 3 0.8177095136112477 2.845448893431472 1243.0 9.825373443983402 0.0 - - - - - - - 131.4 2 25 TSC1 tuberous sclerosis 1 469 60 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38491.[MT7]-RITQVFELEILDLYGR.3y4_1.heavy 703.732 / 508.288 1444.0 46.20677661895752 36 9 10 7 10 0.5517141665081364 93.37274442657235 0.026500701904296875 3 0.8177095136112477 2.845448893431472 1444.0 2.513532090172579 0.0 - - - - - - - 130.62962962962962 2 27 TSC1 tuberous sclerosis 1 471 60 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38491.[MT7]-RITQVFELEILDLYGR.3y5_1.heavy 703.732 / 623.315 2727.0 46.20677661895752 36 9 10 7 10 0.5517141665081364 93.37274442657235 0.026500701904296875 3 0.8177095136112477 2.845448893431472 2727.0 25.825794392523367 0.0 - - - - - - - 134.68 5 25 TSC1 tuberous sclerosis 1 473 61 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37787.[MT7]-IHPTGK[MT7].2y4_1.heavy 470.795 / 546.337 28602.0 15.82640027999878 37 15 10 6 6 0.796104223555573 64.49309373723379 0.035599708557128906 6 0.9561737219180015 5.873487494719796 28602.0 93.70285046057896 0.0 - - - - - - - 237.16666666666666 57 18 RPA3 replication protein A3, 14kDa 475 61 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37787.[MT7]-IHPTGK[MT7].2y5_2.heavy 470.795 / 342.202 7067.0 15.82640027999878 37 15 10 6 6 0.796104223555573 64.49309373723379 0.035599708557128906 6 0.9561737219180015 5.873487494719796 7067.0 19.497584697312973 0.0 - - - - - - - 184.68421052631578 14 19 RPA3 replication protein A3, 14kDa 477 61 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37787.[MT7]-IHPTGK[MT7].2y5_1.heavy 470.795 / 683.396 3510.0 15.82640027999878 37 15 10 6 6 0.796104223555573 64.49309373723379 0.035599708557128906 6 0.9561737219180015 5.873487494719796 3510.0 28.10806129247169 0.0 - - - - - - - 159.28571428571428 7 14 RPA3 replication protein A3, 14kDa 479 61 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37787.[MT7]-IHPTGK[MT7].2y3_1.heavy 470.795 / 449.284 6024.0 15.82640027999878 37 15 10 6 6 0.796104223555573 64.49309373723379 0.035599708557128906 6 0.9561737219180015 5.873487494719796 6024.0 5.554668492467668 3.0 - - - - - - - 298.14285714285717 15 7 RPA3 replication protein A3, 14kDa 481 62 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38509.[MT7]-EEFLAWQHDLEVNDK[MT7].3y3_1.heavy 721.032 / 520.285 2643.0 37.144649505615234 37 11 10 6 10 0.9159580674733617 65.75769951923814 0.03530120849609375 3 0.8756222225855405 3.4624481646265943 2643.0 6.546701636224791 0.0 - - - - - - - 230.73684210526315 5 19 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 483 62 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38509.[MT7]-EEFLAWQHDLEVNDK[MT7].3b4_1.heavy 721.032 / 663.347 2039.0 37.144649505615234 37 11 10 6 10 0.9159580674733617 65.75769951923814 0.03530120849609375 3 0.8756222225855405 3.4624481646265943 2039.0 6.886688741721855 0.0 - - - - - - - 755.1428571428571 4 7 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 485 62 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38509.[MT7]-EEFLAWQHDLEVNDK[MT7].3b5_1.heavy 721.032 / 734.384 5891.0 37.144649505615234 37 11 10 6 10 0.9159580674733617 65.75769951923814 0.03530120849609375 3 0.8756222225855405 3.4624481646265943 5891.0 21.45728476821192 0.0 - - - - - - - 316.04545454545456 11 22 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 487 62 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38509.[MT7]-EEFLAWQHDLEVNDK[MT7].3b3_1.heavy 721.032 / 550.263 1964.0 37.144649505615234 37 11 10 6 10 0.9159580674733617 65.75769951923814 0.03530120849609375 3 0.8756222225855405 3.4624481646265943 1964.0 2.934216335540839 0.0 - - - - - - - 690.5714285714286 3 7 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 489 63 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22587.[MT7]-TLFLLR.2y4_1.heavy 453.798 / 548.356 32307.0 39.64860153198242 43 13 10 10 10 1.0073818697083383 65.96324667886083 0.0 3 0.9220279790718798 4.390660370536425 32307.0 97.61700398156088 0.0 - - - - - - - 277.6923076923077 64 13 PPP3CA;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 491 63 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22587.[MT7]-TLFLLR.2b3_1.heavy 453.798 / 506.31 34271.0 39.64860153198242 43 13 10 10 10 1.0073818697083383 65.96324667886083 0.0 3 0.9220279790718798 4.390660370536425 34271.0 112.6582272781276 0.0 - - - - - - - 308.2 68 15 PPP3CA;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 493 63 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22587.[MT7]-TLFLLR.2y5_1.heavy 453.798 / 661.44 54542.0 39.64860153198242 43 13 10 10 10 1.0073818697083383 65.96324667886083 0.0 3 0.9220279790718798 4.390660370536425 54542.0 152.80451162669988 0.0 - - - - - - - 316.6363636363636 109 11 PPP3CA;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 495 63 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22587.[MT7]-TLFLLR.2b4_1.heavy 453.798 / 619.394 43773.0 39.64860153198242 43 13 10 10 10 1.0073818697083383 65.96324667886083 0.0 3 0.9220279790718798 4.390660370536425 43773.0 142.81549018997197 0.0 - - - - - - - 230.94117647058823 87 17 PPP3CA;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 497 64 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38603.[MT7]-RYQNLK[MT7]PIGSGAQGIVC[CAM]AAYDAILER.4y5_1.heavy 788.679 / 601.367 7369.0 42.24209976196289 39 9 10 10 10 1.6931444017344153 51.84401461105244 0.0 3 0.8195352112168827 2.8602722928409037 7369.0 28.21645516900642 0.0 - - - - - - - 695.8571428571429 14 7 MAPK8 mitogen-activated protein kinase 8 499 64 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38603.[MT7]-RYQNLK[MT7]PIGSGAQGIVC[CAM]AAYDAILER.4y9_1.heavy 788.679 / 1021.53 4358.0 42.24209976196289 39 9 10 10 10 1.6931444017344153 51.84401461105244 0.0 3 0.8195352112168827 2.8602722928409037 4358.0 14.273432387052747 0.0 - - - - - - - 187.8 8 15 MAPK8 mitogen-activated protein kinase 8 501 64 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38603.[MT7]-RYQNLK[MT7]PIGSGAQGIVC[CAM]AAYDAILER.4b14_2.heavy 788.679 / 879.996 21403.0 42.24209976196289 39 9 10 10 10 1.6931444017344153 51.84401461105244 0.0 3 0.8195352112168827 2.8602722928409037 21403.0 47.37615385655828 0.0 - - - - - - - 186.66666666666666 42 12 MAPK8 mitogen-activated protein kinase 8 503 64 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38603.[MT7]-RYQNLK[MT7]PIGSGAQGIVC[CAM]AAYDAILER.4b6_2.heavy 788.679 / 546.332 2563.0 42.24209976196289 39 9 10 10 10 1.6931444017344153 51.84401461105244 0.0 3 0.8195352112168827 2.8602722928409037 2563.0 6.295711257690074 0.0 - - - - - - - 288.1875 5 16 MAPK8 mitogen-activated protein kinase 8 505 65 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542586.[MT7]-SGNPGESSR.2y8_1.heavy 517.753 / 803.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 507 65 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542586.[MT7]-SGNPGESSR.2y5_1.heavy 517.753 / 535.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 509 65 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542586.[MT7]-SGNPGESSR.2b4_1.heavy 517.753 / 500.259 N/A N/A - - - - - - - - - 0.0 - - - - - - - MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 511 65 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542586.[MT7]-SGNPGESSR.2y6_1.heavy 517.753 / 632.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 513 66 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 2133090.0 36.86180114746094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2133090.0 3265.363425651362 0.0 - - - - - - - 210.16666666666666 4266 6 515 66 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 933673.0 36.86180114746094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 933673.0 2581.5990149246145 0.0 - - - - - - - 330.85714285714283 1867 7 517 66 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1447900.0 36.86180114746094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1447900.0 393.83014614407585 0.0 - - - - - - - 280.7142857142857 2895 7 519 67 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38384.[MT7]-GGGPGPGDPPPSETHK[MT7].3y7_1.heavy 592.304 / 939.502 1664.0 16.14259910583496 41 14 9 10 8 2.2949920560568713 43.57313557407884 0.0 4 0.9405212507681348 5.035063858844392 1664.0 20.684450643178234 0.0 - - - - - - - 154.42857142857142 3 14 RRAS related RAS viral (r-ras) oncogene homolog 521 67 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38384.[MT7]-GGGPGPGDPPPSETHK[MT7].3y3_1.heavy 592.304 / 529.321 832.0 16.14259910583496 41 14 9 10 8 2.2949920560568713 43.57313557407884 0.0 4 0.9405212507681348 5.035063858844392 832.0 0.0 2.0 - - - - - - - 0.0 1 0 RRAS related RAS viral (r-ras) oncogene homolog 523 67 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38384.[MT7]-GGGPGPGDPPPSETHK[MT7].3y6_1.heavy 592.304 / 842.449 1831.0 16.14259910583496 41 14 9 10 8 2.2949920560568713 43.57313557407884 0.0 4 0.9405212507681348 5.035063858844392 1831.0 21.177831325301202 1.0 - - - - - - - 207.88888888888889 5 9 RRAS related RAS viral (r-ras) oncogene homolog 525 67 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38384.[MT7]-GGGPGPGDPPPSETHK[MT7].3b8_1.heavy 592.304 / 739.349 8113.0 16.14259910583496 41 14 9 10 8 2.2949920560568713 43.57313557407884 0.0 4 0.9405212507681348 5.035063858844392 8113.0 95.79204819277108 1.0 - - - - - - - 124.66666666666667 18 3 RRAS related RAS viral (r-ras) oncogene homolog 527 68 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23463.[MT7]-HENFHGGLDAISVGDGLFTILTTLSK[MT7].4y4_1.heavy 758.409 / 592.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - BIRC6 baculoviral IAP repeat-containing 6 529 68 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23463.[MT7]-HENFHGGLDAISVGDGLFTILTTLSK[MT7].4b4_1.heavy 758.409 / 672.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - BIRC6 baculoviral IAP repeat-containing 6 531 68 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23463.[MT7]-HENFHGGLDAISVGDGLFTILTTLSK[MT7].4y6_1.heavy 758.409 / 806.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - BIRC6 baculoviral IAP repeat-containing 6 533 68 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23463.[MT7]-HENFHGGLDAISVGDGLFTILTTLSK[MT7].4b9_2.heavy 758.409 / 576.271 N/A N/A - - - - - - - - - 0.0 - - - - - - - BIRC6 baculoviral IAP repeat-containing 6 535 69 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23464.[MT7]-SQATGFPSLITIFSAPNYLDVYNNK[MT7].4y4_1.heavy 762.903 / 682.364 3005.0 50.070899963378906 43 13 10 10 10 3.622724329107023 27.6035356034527 0.0 3 0.9221210412333758 4.393317993637919 3005.0 31.314098964013084 0.0 - - - - - - - 93.44444444444444 6 18 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 537 69 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23464.[MT7]-SQATGFPSLITIFSAPNYLDVYNNK[MT7].4b5_1.heavy 762.903 / 589.306 1699.0 50.070899963378906 43 13 10 10 10 3.622724329107023 27.6035356034527 0.0 3 0.9221210412333758 4.393317993637919 1699.0 28.075469762101047 1.0 - - - - - - - 113.11111111111111 4 18 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 539 69 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23464.[MT7]-SQATGFPSLITIFSAPNYLDVYNNK[MT7].4y6_1.heavy 762.903 / 896.459 1941.0 50.070899963378906 43 13 10 10 10 3.622724329107023 27.6035356034527 0.0 3 0.9221210412333758 4.393317993637919 1941.0 59.47501285714286 0.0 - - - - - - - 80.53846153846153 3 13 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 541 69 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23464.[MT7]-SQATGFPSLITIFSAPNYLDVYNNK[MT7].4b6_1.heavy 762.903 / 736.375 5917.0 50.070899963378906 43 13 10 10 10 3.622724329107023 27.6035356034527 0.0 3 0.9221210412333758 4.393317993637919 5917.0 317.1485282912375 0.0 - - - - - - - 136.83333333333334 11 12 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 543 70 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22783.[MT7]-GAYGVVEK[MT7].2y5_1.heavy 555.823 / 675.416 6341.0 23.30322551727295 44 17 10 7 10 6.7424093277628945 14.831493482342403 0.024898529052734375 3 0.9766592494249018 8.062256161553208 6341.0 19.61373137740522 0.0 - - - - - - - 244.08333333333334 12 24 LOC100133591;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 545 70 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22783.[MT7]-GAYGVVEK[MT7].2y3_1.heavy 555.823 / 519.326 7368.0 23.30322551727295 44 17 10 7 10 6.7424093277628945 14.831493482342403 0.024898529052734375 3 0.9766592494249018 8.062256161553208 7368.0 15.947023566524404 0.0 - - - - - - - 649.25 14 8 LOC100133591;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 547 70 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22783.[MT7]-GAYGVVEK[MT7].2y6_1.heavy 555.823 / 838.479 4529.0 23.30322551727295 44 17 10 7 10 6.7424093277628945 14.831493482342403 0.024898529052734375 3 0.9766592494249018 8.062256161553208 4529.0 13.531306161257607 0.0 - - - - - - - 219.42105263157896 9 19 LOC100133591;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 549 70 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22783.[MT7]-GAYGVVEK[MT7].2b5_1.heavy 555.823 / 592.321 5798.0 23.30322551727295 44 17 10 7 10 6.7424093277628945 14.831493482342403 0.024898529052734375 3 0.9766592494249018 8.062256161553208 5798.0 11.595091714375233 0.0 - - - - - - - 228.95833333333334 11 24 LOC100133591;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 551 71 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541970.[MT7]-DDIYIR.2b3_1.heavy 469.757 / 488.247 21935.0 26.639099597930908 40 14 10 6 10 1.5680634030450642 42.87973313968871 0.03759956359863281 3 0.9342676329914321 4.787012937126323 21935.0 28.71683376423161 0.0 - - - - - - - 655.75 43 12 PRIM1 primase, DNA, polypeptide 1 (49kDa) 553 71 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541970.[MT7]-DDIYIR.2y4_1.heavy 469.757 / 564.35 30223.0 26.639099597930908 40 14 10 6 10 1.5680634030450642 42.87973313968871 0.03759956359863281 3 0.9342676329914321 4.787012937126323 30223.0 47.06836553691445 0.0 - - - - - - - 727.5384615384615 60 13 PRIM1 primase, DNA, polypeptide 1 (49kDa) 555 71 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541970.[MT7]-DDIYIR.2y5_1.heavy 469.757 / 679.377 25367.0 26.639099597930908 40 14 10 6 10 1.5680634030450642 42.87973313968871 0.03759956359863281 3 0.9342676329914321 4.787012937126323 25367.0 118.93241850508412 0.0 - - - - - - - 627.625 50 8 PRIM1 primase, DNA, polypeptide 1 (49kDa) 557 71 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541970.[MT7]-DDIYIR.2b4_1.heavy 469.757 / 651.311 30725.0 26.639099597930908 40 14 10 6 10 1.5680634030450642 42.87973313968871 0.03759956359863281 3 0.9342676329914321 4.787012937126323 30725.0 29.695608054203202 0.0 - - - - - - - 729.5714285714286 61 7 PRIM1 primase, DNA, polypeptide 1 (49kDa) 559 72 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38605.[MT7]-SALTIQFIQSYFVSDYDPTIEDSYTK[MT7].3b6_1.heavy 1107.22 / 758.453 1612.0 47.902099609375 50 20 10 10 10 10.163372398873387 9.839253751154985 0.0 3 0.996816787880501 21.86826400910596 1612.0 14.277714285714286 0.0 - - - - - - - 105.0 3 17 RRAS related RAS viral (r-ras) oncogene homolog 561 72 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38605.[MT7]-SALTIQFIQSYFVSDYDPTIEDSYTK[MT7].3b7_1.heavy 1107.22 / 905.521 1612.0 47.902099609375 50 20 10 10 10 10.163372398873387 9.839253751154985 0.0 3 0.996816787880501 21.86826400910596 1612.0 67.01314285714285 0.0 - - - - - - - 112.0 3 15 RRAS related RAS viral (r-ras) oncogene homolog 563 72 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38605.[MT7]-SALTIQFIQSYFVSDYDPTIEDSYTK[MT7].3b4_1.heavy 1107.22 / 517.31 946.0 47.902099609375 50 20 10 10 10 10.163372398873387 9.839253751154985 0.0 3 0.996816787880501 21.86826400910596 946.0 29.731428571428573 1.0 - - - - - - - 96.3125 3 16 RRAS related RAS viral (r-ras) oncogene homolog 565 72 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38605.[MT7]-SALTIQFIQSYFVSDYDPTIEDSYTK[MT7].3y9_1.heavy 1107.22 / 1197.61 1297.0 47.902099609375 50 20 10 10 10 10.163372398873387 9.839253751154985 0.0 3 0.996816787880501 21.86826400910596 1297.0 30.94271428571429 0.0 - - - - - - - 107.57142857142857 2 14 RRAS related RAS viral (r-ras) oncogene homolog 567 73 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37810.[MT7]-RNPGLK[MT7].2y4_1.heavy 486.813 / 558.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K6 mitogen-activated protein kinase kinase 6 569 73 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37810.[MT7]-RNPGLK[MT7].2y5_1.heavy 486.813 / 672.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K6 mitogen-activated protein kinase kinase 6 571 73 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37810.[MT7]-RNPGLK[MT7].2b4_2.heavy 486.813 / 285.167 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K6 mitogen-activated protein kinase kinase 6 573 73 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37810.[MT7]-RNPGLK[MT7].2y3_1.heavy 486.813 / 461.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K6 mitogen-activated protein kinase kinase 6 575 74 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23159.[MT7]-QHLLDFFDIFGR.3y7_1.heavy 551.295 / 901.457 467.0 48.61232376098633 42 16 10 6 10 8.266777466605765 12.096612060014571 0.0345001220703125 3 0.9654506925112529 6.620401356874092 467.0 14.989193548387096 0.0 - - - - - - - 0.0 0 0 TSC1 tuberous sclerosis 1 577 74 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23159.[MT7]-QHLLDFFDIFGR.3y6_1.heavy 551.295 / 754.388 1183.0 48.61232376098633 42 16 10 6 10 8.266777466605765 12.096612060014571 0.0345001220703125 3 0.9654506925112529 6.620401356874092 1183.0 25.440860215053767 0.0 - - - - - - - 130.7 2 10 TSC1 tuberous sclerosis 1 579 74 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23159.[MT7]-QHLLDFFDIFGR.3y5_1.heavy 551.295 / 607.32 1277.0 48.61232376098633 42 16 10 6 10 8.266777466605765 12.096612060014571 0.0345001220703125 3 0.9654506925112529 6.620401356874092 1277.0 24.066538461538464 0.0 - - - - - - - 77.75 2 12 TSC1 tuberous sclerosis 1 581 74 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23159.[MT7]-QHLLDFFDIFGR.3b5_1.heavy 551.295 / 751.422 1464.0 48.61232376098633 42 16 10 6 10 8.266777466605765 12.096612060014571 0.0345001220703125 3 0.9654506925112529 6.620401356874092 1464.0 24.4 0.0 - - - - - - - 110.18181818181819 2 11 TSC1 tuberous sclerosis 1 583 75 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23157.[MT7]-INVNEIFYDLVR.2y8_1.heavy 819.952 / 1054.56 2748.0 48.995399475097656 48 20 10 10 8 3.7036346710872565 21.037535166257406 0.0 4 0.9920739639219491 13.853103430808062 2748.0 56.84013401516488 0.0 - - - - - - - 92.33333333333333 5 15 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 585 75 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23157.[MT7]-INVNEIFYDLVR.2b4_1.heavy 819.952 / 585.348 3896.0 48.995399475097656 48 20 10 10 8 3.7036346710872565 21.037535166257406 0.0 4 0.9920739639219491 13.853103430808062 3896.0 34.87908646616541 1.0 - - - - - - - 130.95652173913044 10 23 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 587 75 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23157.[MT7]-INVNEIFYDLVR.2y9_1.heavy 819.952 / 1168.6 8112.0 48.995399475097656 48 20 10 10 8 3.7036346710872565 21.037535166257406 0.0 4 0.9920739639219491 13.853103430808062 8112.0 127.83910055512612 0.0 - - - - - - - 81.6875 16 16 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 589 75 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23157.[MT7]-INVNEIFYDLVR.2y7_1.heavy 819.952 / 925.514 3229.0 48.995399475097656 48 20 10 10 8 3.7036346710872565 21.037535166257406 0.0 4 0.9920739639219491 13.853103430808062 3229.0 126.98395433027011 0.0 - - - - - - - 86.75 6 16 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 591 76 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22980.[MT7]-VFTDPSNLQR.2y8_1.heavy 660.855 / 930.464 3184.0 28.422300338745117 41 11 10 10 10 1.8177204847115158 55.01395887931068 0.0 3 0.8799625772435907 3.5258257265017483 3184.0 24.207427814067977 0.0 - - - - - - - 157.25 6 8 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 593 76 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22980.[MT7]-VFTDPSNLQR.2y9_1.heavy 660.855 / 1077.53 5447.0 28.422300338745117 41 11 10 10 10 1.8177204847115158 55.01395887931068 0.0 3 0.8799625772435907 3.5258257265017483 5447.0 38.76777398720682 0.0 - - - - - - - 148.46153846153845 10 13 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 595 76 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22980.[MT7]-VFTDPSNLQR.2b4_1.heavy 660.855 / 607.321 22793.0 28.422300338745117 41 11 10 10 10 1.8177204847115158 55.01395887931068 0.0 3 0.8799625772435907 3.5258257265017483 22793.0 32.34026315028352 0.0 - - - - - - - 270.0 45 9 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 597 76 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22980.[MT7]-VFTDPSNLQR.2y6_1.heavy 660.855 / 714.389 23631.0 28.422300338745117 41 11 10 10 10 1.8177204847115158 55.01395887931068 0.0 3 0.8799625772435907 3.5258257265017483 23631.0 63.47832900203305 0.0 - - - - - - - 205.8181818181818 47 11 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 599 77 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23263.[MT7]-ELSEITTAEAEPVVPR.2y5_1.heavy 943.005 / 567.361 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSC1 tuberous sclerosis 1 601 77 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23263.[MT7]-ELSEITTAEAEPVVPR.2b4_1.heavy 943.005 / 603.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSC1 tuberous sclerosis 1 603 77 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23263.[MT7]-ELSEITTAEAEPVVPR.2y10_1.heavy 943.005 / 1068.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSC1 tuberous sclerosis 1 605 77 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23263.[MT7]-ELSEITTAEAEPVVPR.2y11_1.heavy 943.005 / 1169.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSC1 tuberous sclerosis 1 607 78 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541976.[MT7]-LQDFK[MT7].2y4_1.heavy 469.781 / 681.369 15034.0 26.87987518310547 40 16 10 6 8 1.9601388005094904 41.252200909798596 0.0364990234375 4 0.9600500461866579 6.153861026037819 15034.0 41.810532544378695 1.0 - - - - - - - 732.0 45 9 DDB2;RAP1GAP;SHMT2;GGCT;CCDC45 damage-specific DNA binding protein 2, 48kDa;RAP1 GTPase activating protein;serine hydroxymethyltransferase 2 (mitochondrial);gamma-glutamylcyclotransferase;coiled-coil domain containing 45 609 78 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541976.[MT7]-LQDFK[MT7].2b3_1.heavy 469.781 / 501.279 22044.0 26.87987518310547 40 16 10 6 8 1.9601388005094904 41.252200909798596 0.0364990234375 4 0.9600500461866579 6.153861026037819 22044.0 29.47579502688668 0.0 - - - - - - - 1134.2857142857142 44 7 DDB2;RAP1GAP;SHMT2;GGCT;CCDC45 damage-specific DNA binding protein 2, 48kDa;RAP1 GTPase activating protein;serine hydroxymethyltransferase 2 (mitochondrial);gamma-glutamylcyclotransferase;coiled-coil domain containing 45 611 78 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541976.[MT7]-LQDFK[MT7].2b4_1.heavy 469.781 / 648.347 2280.0 26.87987518310547 40 16 10 6 8 1.9601388005094904 41.252200909798596 0.0364990234375 4 0.9600500461866579 6.153861026037819 2280.0 1.4289693593314763 3.0 - - - - - - - 675.8181818181819 5 11 DDB2;RAP1GAP;SHMT2;GGCT;CCDC45 damage-specific DNA binding protein 2, 48kDa;RAP1 GTPase activating protein;serine hydroxymethyltransferase 2 (mitochondrial);gamma-glutamylcyclotransferase;coiled-coil domain containing 45 613 78 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541976.[MT7]-LQDFK[MT7].2y3_1.heavy 469.781 / 553.31 7348.0 26.87987518310547 40 16 10 6 8 1.9601388005094904 41.252200909798596 0.0364990234375 4 0.9600500461866579 6.153861026037819 7348.0 25.290085803822627 0.0 - - - - - - - 644.125 14 8 DDB2;RAP1GAP;SHMT2;GGCT;CCDC45 damage-specific DNA binding protein 2, 48kDa;RAP1 GTPase activating protein;serine hydroxymethyltransferase 2 (mitochondrial);gamma-glutamylcyclotransferase;coiled-coil domain containing 45 615 79 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543937.[MT7]-ISVPIDLQK[MT7].3b6_1.heavy 434.274 / 769.458 14521.0 34.70294952392578 45 20 10 5 10 8.68332684968936 11.516323378242687 0.0435028076171875 3 0.9970132396586207 22.576365528434398 14521.0 164.9614296742319 0.0 - - - - - - - 183.0 29 5 PRIM1 primase, DNA, polypeptide 1 (49kDa) 617 79 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543937.[MT7]-ISVPIDLQK[MT7].3y3_1.heavy 434.274 / 532.357 27316.0 34.70294952392578 45 20 10 5 10 8.68332684968936 11.516323378242687 0.0435028076171875 3 0.9970132396586207 22.576365528434398 27316.0 313.3239920795905 0.0 - - - - - - - 233.7 54 10 PRIM1 primase, DNA, polypeptide 1 (49kDa) 619 79 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543937.[MT7]-ISVPIDLQK[MT7].3y4_1.heavy 434.274 / 647.385 32190.0 34.70294952392578 45 20 10 5 10 8.68332684968936 11.516323378242687 0.0435028076171875 3 0.9970132396586207 22.576365528434398 32190.0 168.80889610389613 0.0 - - - - - - - 174.28571428571428 64 7 PRIM1 primase, DNA, polypeptide 1 (49kDa) 621 79 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543937.[MT7]-ISVPIDLQK[MT7].3b3_1.heavy 434.274 / 444.294 111193.0 34.70294952392578 45 20 10 5 10 8.68332684968936 11.516323378242687 0.0435028076171875 3 0.9970132396586207 22.576365528434398 111193.0 306.52360056258794 0.0 - - - - - - - 190.625 222 8 PRIM1 primase, DNA, polypeptide 1 (49kDa) 623 80 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23369.[MT7]-VDQFDPFTVPTISFIC[CAM]R.3y7_1.heavy 729.374 / 896.466 6760.0 47.22380065917969 50 20 10 10 10 13.451225476705629 7.434266875771027 0.0 3 0.9990889390410532 40.88421595314828 6760.0 69.93103448275862 0.0 - - - - - - - 153.55 13 20 PRIM1 primase, DNA, polypeptide 1 (49kDa) 625 80 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23369.[MT7]-VDQFDPFTVPTISFIC[CAM]R.3y6_1.heavy 729.374 / 795.418 7880.0 47.22380065917969 50 20 10 10 10 13.451225476705629 7.434266875771027 0.0 3 0.9990889390410532 40.88421595314828 7880.0 51.93243565895777 0.0 - - - - - - - 135.85714285714286 15 21 PRIM1 primase, DNA, polypeptide 1 (49kDa) 627 80 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23369.[MT7]-VDQFDPFTVPTISFIC[CAM]R.3b5_1.heavy 729.374 / 749.359 52595.0 47.22380065917969 50 20 10 10 10 13.451225476705629 7.434266875771027 0.0 3 0.9990889390410532 40.88421595314828 52595.0 109.07679233829045 0.0 - - - - - - - 243.4 105 15 PRIM1 primase, DNA, polypeptide 1 (49kDa) 629 80 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23369.[MT7]-VDQFDPFTVPTISFIC[CAM]R.3y5_1.heavy 729.374 / 682.334 11965.0 47.22380065917969 50 20 10 10 10 13.451225476705629 7.434266875771027 0.0 3 0.9990889390410532 40.88421595314828 11965.0 72.01554879902707 0.0 - - - - - - - 214.95 23 20 PRIM1 primase, DNA, polypeptide 1 (49kDa) 631 81 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22989.[MT7]-WLNYGGVIK[MT7].2b3_1.heavy 669.395 / 558.316 3393.0 36.28650093078613 40 20 4 6 10 7.632520998422731 13.101830970483425 0.03479766845703125 3 0.9941979907722203 16.194328950895198 3393.0 8.094706271239517 1.0 - - - - - - - 216.77777777777777 18 18 PRIM1 primase, DNA, polypeptide 1 (49kDa) 633 81 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22989.[MT7]-WLNYGGVIK[MT7].2y8_1.heavy 669.395 / 1007.6 3563.0 36.28650093078613 40 20 4 6 10 7.632520998422731 13.101830970483425 0.03479766845703125 3 0.9941979907722203 16.194328950895198 3563.0 53.42849698934691 0.0 - - - - - - - 176.75 7 12 PRIM1 primase, DNA, polypeptide 1 (49kDa) 635 81 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22989.[MT7]-WLNYGGVIK[MT7].2y5_1.heavy 669.395 / 617.41 4666.0 36.28650093078613 40 20 4 6 10 7.632520998422731 13.101830970483425 0.03479766845703125 3 0.9941979907722203 16.194328950895198 4666.0 8.316854521625164 0.0 - - - - - - - 636.3 9 10 PRIM1 primase, DNA, polypeptide 1 (49kDa) 637 81 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22989.[MT7]-WLNYGGVIK[MT7].2y7_1.heavy 669.395 / 894.516 4326.0 36.28650093078613 40 20 4 6 10 7.632520998422731 13.101830970483425 0.03479766845703125 3 0.9941979907722203 16.194328950895198 4326.0 29.024051054384017 0.0 - - - - - - - 212.125 8 16 PRIM1 primase, DNA, polypeptide 1 (49kDa) 639 82 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23363.[MT7]-EEFLAWQHDLEVNDK[MT7].4b4_1.heavy 541.026 / 663.347 9673.0 37.12699890136719 41 11 10 10 10 0.8442125010202617 71.95285764773558 0.0 3 0.8501387712973846 3.147303179187014 9673.0 14.466954807871376 0.0 - - - - - - - 759.1538461538462 19 13 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 641 82 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23363.[MT7]-EEFLAWQHDLEVNDK[MT7].4b5_1.heavy 541.026 / 734.384 15595.0 37.12699890136719 41 11 10 10 10 0.8442125010202617 71.95285764773558 0.0 3 0.8501387712973846 3.147303179187014 15595.0 56.636103762384934 0.0 - - - - - - - 274.25 31 12 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 643 82 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23363.[MT7]-EEFLAWQHDLEVNDK[MT7].4y3_1.heavy 541.026 / 520.285 25597.0 37.12699890136719 41 11 10 10 10 0.8442125010202617 71.95285764773558 0.0 3 0.8501387712973846 3.147303179187014 25597.0 43.316591414743016 0.0 - - - - - - - 1220.3636363636363 51 11 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 645 82 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23363.[MT7]-EEFLAWQHDLEVNDK[MT7].4b3_1.heavy 541.026 / 550.263 19214.0 37.12699890136719 41 11 10 10 10 0.8442125010202617 71.95285764773558 0.0 3 0.8501387712973846 3.147303179187014 19214.0 34.31560302493475 0.0 - - - - - - - 734.5833333333334 38 12 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 647 83 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37911.[MT7]-YQNNIK[MT7].2y4_1.heavy 534.308 / 632.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 649 83 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37911.[MT7]-YQNNIK[MT7].2y5_1.heavy 534.308 / 760.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 651 83 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37911.[MT7]-YQNNIK[MT7].2b4_1.heavy 534.308 / 664.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 653 83 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37911.[MT7]-YQNNIK[MT7].2y3_1.heavy 534.308 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 655 84 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542595.[MT7]-LFTQILR.2b3_1.heavy 517.828 / 506.31 10557.0 39.40629959106445 50 20 10 10 10 3.868578505607713 25.8492880149762 0.0 3 0.9944578511363962 16.56999949403732 10557.0 25.269678966673983 2.0 - - - - - - - 647.5454545454545 21 11 RRAS related RAS viral (r-ras) oncogene homolog 657 84 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542595.[MT7]-LFTQILR.2y4_1.heavy 517.828 / 529.346 19525.0 39.40629959106445 50 20 10 10 10 3.868578505607713 25.8492880149762 0.0 3 0.9944578511363962 16.56999949403732 19525.0 46.08871938980329 0.0 - - - - - - - 296.8666666666667 39 15 RRAS related RAS viral (r-ras) oncogene homolog 659 84 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542595.[MT7]-LFTQILR.2y6_1.heavy 517.828 / 777.462 209495.0 39.40629959106445 50 20 10 10 10 3.868578505607713 25.8492880149762 0.0 3 0.9944578511363962 16.56999949403732 209495.0 313.8808429916421 0.0 - - - - - - - 675.75 418 8 RRAS related RAS viral (r-ras) oncogene homolog 661 84 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542595.[MT7]-LFTQILR.2b5_1.heavy 517.828 / 747.452 45791.0 39.40629959106445 50 20 10 10 10 3.868578505607713 25.8492880149762 0.0 3 0.9944578511363962 16.56999949403732 45791.0 401.79009483095143 0.0 - - - - - - - 202.1764705882353 91 17 RRAS related RAS viral (r-ras) oncogene homolog 663 85 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22598.[MT7]-MFILSDGEGK[MT7].3y3_1.heavy 462.251 / 477.279 3285.0 35.61859893798828 42 14 10 10 8 3.020682920895139 33.105096635023955 0.0 4 0.936673172241927 4.878087049328963 3285.0 11.384008528784648 2.0 - - - - - - - 347.7647058823529 9 17 RPA3 replication protein A3, 14kDa 665 85 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22598.[MT7]-MFILSDGEGK[MT7].3y4_1.heavy 462.251 / 534.3 5726.0 35.61859893798828 42 14 10 10 8 3.020682920895139 33.105096635023955 0.0 4 0.936673172241927 4.878087049328963 5726.0 13.62849023090586 0.0 - - - - - - - 727.5 11 8 RPA3 replication protein A3, 14kDa 667 85 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22598.[MT7]-MFILSDGEGK[MT7].3b3_1.heavy 462.251 / 536.302 7603.0 35.61859893798828 42 14 10 10 8 3.020682920895139 33.105096635023955 0.0 4 0.936673172241927 4.878087049328963 7603.0 18.67428805539751 0.0 - - - - - - - 657.0 15 9 RPA3 replication protein A3, 14kDa 669 85 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22598.[MT7]-MFILSDGEGK[MT7].3b7_1.heavy 462.251 / 908.467 N/A 35.61859893798828 42 14 10 10 8 3.020682920895139 33.105096635023955 0.0 4 0.936673172241927 4.878087049328963 188.0 3.56 4.0 - - - - - - - 0.0 0 0 RPA3 replication protein A3, 14kDa 671 86 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22798.[MT7]-VFGTTAGGK[MT7].2y8_1.heavy 563.329 / 882.48 5460.0 24.06577444076538 41 17 10 6 8 4.6440717332280395 21.532828462684225 0.03289985656738281 4 0.9756813237383983 7.897840002788834 5460.0 46.2 0.0 - - - - - - - 182.8125 10 16 TSC1 tuberous sclerosis 1 673 86 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22798.[MT7]-VFGTTAGGK[MT7].2y5_1.heavy 563.329 / 577.343 1625.0 24.06577444076538 41 17 10 6 8 4.6440717332280395 21.532828462684225 0.03289985656738281 4 0.9756813237383983 7.897840002788834 1625.0 1.1538461538461537 1.0 - - - - - - - 742.8571428571429 4 7 TSC1 tuberous sclerosis 1 675 86 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22798.[MT7]-VFGTTAGGK[MT7].2y6_1.heavy 563.329 / 678.39 1560.0 24.06577444076538 41 17 10 6 8 4.6440717332280395 21.532828462684225 0.03289985656738281 4 0.9756813237383983 7.897840002788834 1560.0 5.199999999999999 0.0 - - - - - - - 211.95652173913044 3 23 TSC1 tuberous sclerosis 1 677 86 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22798.[MT7]-VFGTTAGGK[MT7].2y7_1.heavy 563.329 / 735.412 2210.0 24.06577444076538 41 17 10 6 8 4.6440717332280395 21.532828462684225 0.03289985656738281 4 0.9756813237383983 7.897840002788834 2210.0 0.0 2.0 - - - - - - - 179.7058823529412 4 17 TSC1 tuberous sclerosis 1 679 87 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38112.[MT7]-YIHSAGVVHR.3y7_1.heavy 428.243 / 725.405 3982.0 20.159249782562256 44 18 10 6 10 7.76320705136518 12.88127436745549 0.031000137329101562 3 0.983137549634022 9.490516743464747 3982.0 27.080597506469065 0.0 - - - - - - - 154.11764705882354 7 17 MAPK13 mitogen-activated protein kinase 13 681 87 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38112.[MT7]-YIHSAGVVHR.3y3_1.heavy 428.243 / 411.246 11236.0 20.159249782562256 44 18 10 6 10 7.76320705136518 12.88127436745549 0.031000137329101562 3 0.983137549634022 9.490516743464747 11236.0 26.007564154786152 0.0 - - - - - - - 763.6363636363636 22 11 MAPK13 mitogen-activated protein kinase 13 683 87 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38112.[MT7]-YIHSAGVVHR.3y6_1.heavy 428.243 / 638.373 7582.0 20.159249782562256 44 18 10 6 10 7.76320705136518 12.88127436745549 0.031000137329101562 3 0.983137549634022 9.490516743464747 7582.0 54.58051014026624 0.0 - - - - - - - 182.95 15 20 MAPK13 mitogen-activated protein kinase 13 685 87 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38112.[MT7]-YIHSAGVVHR.3y5_1.heavy 428.243 / 567.336 14836.0 20.159249782562256 44 18 10 6 10 7.76320705136518 12.88127436745549 0.031000137329101562 3 0.983137549634022 9.490516743464747 14836.0 84.24534128440366 0.0 - - - - - - - 200.95454545454547 29 22 MAPK13 mitogen-activated protein kinase 13 687 88 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23075.[MT7]-DNFPFDPPFVR.2b3_1.heavy 747.879 / 521.248 17327.0 41.48200035095215 42 16 10 6 10 1.1964617181373376 51.26490965049392 0.03800201416015625 3 0.9634372470512756 6.434439402365128 17327.0 17.871284467114965 1.0 - - - - - - - 301.7142857142857 34 7 UBE2Q1;UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 1;ubiquitin-conjugating enzyme E2Q family member 2 689 88 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23075.[MT7]-DNFPFDPPFVR.2y8_1.heavy 747.879 / 974.509 5243.0 41.48200035095215 42 16 10 6 10 1.1964617181373376 51.26490965049392 0.03800201416015625 3 0.9634372470512756 6.434439402365128 5243.0 13.380572916666667 1.0 - - - - - - - 219.42857142857142 10 14 UBE2Q1;UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 1;ubiquitin-conjugating enzyme E2Q family member 2 691 88 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23075.[MT7]-DNFPFDPPFVR.2y5_1.heavy 747.879 / 615.361 64195.0 41.48200035095215 42 16 10 6 10 1.1964617181373376 51.26490965049392 0.03800201416015625 3 0.9634372470512756 6.434439402365128 64195.0 118.78479321252601 0.0 - - - - - - - 192.0 128 1 UBE2Q1;UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 1;ubiquitin-conjugating enzyme E2Q family member 2 693 88 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23075.[MT7]-DNFPFDPPFVR.2b6_1.heavy 747.879 / 880.396 24297.0 41.48200035095215 42 16 10 6 10 1.1964617181373376 51.26490965049392 0.03800201416015625 3 0.9634372470512756 6.434439402365128 24297.0 74.921655625543 0.0 - - - - - - - 213.33333333333334 48 6 UBE2Q1;UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 1;ubiquitin-conjugating enzyme E2Q family member 2 695 89 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543656.[MT7]-SHVLQQTQR.3y6_1.heavy 414.234 / 773.426 1154.0 15.999350309371948 42 16 10 6 10 2.1837930628796576 30.698608115594947 0.038199424743652344 3 0.9690761807193715 6.999874223511147 1154.0 19.156399999999998 0.0 - - - - - - - 92.85714285714286 2 7 TSC1 tuberous sclerosis 1 697 89 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543656.[MT7]-SHVLQQTQR.3y4_1.heavy 414.234 / 532.284 4815.0 15.999350309371948 42 16 10 6 10 2.1837930628796576 30.698608115594947 0.038199424743652344 3 0.9690761807193715 6.999874223511147 4815.0 39.23865671641791 0.0 - - - - - - - 197.8421052631579 9 19 TSC1 tuberous sclerosis 1 699 89 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543656.[MT7]-SHVLQQTQR.3b3_1.heavy 414.234 / 468.269 5266.0 15.999350309371948 42 16 10 6 10 2.1837930628796576 30.698608115594947 0.038199424743652344 3 0.9690761807193715 6.999874223511147 5266.0 7.426690782880748 0.0 - - - - - - - 168.05882352941177 10 17 TSC1 tuberous sclerosis 1 701 89 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543656.[MT7]-SHVLQQTQR.3y5_1.heavy 414.234 / 660.342 3912.0 15.999350309371948 42 16 10 6 10 2.1837930628796576 30.698608115594947 0.038199424743652344 3 0.9690761807193715 6.999874223511147 3912.0 45.63999999999999 0.0 - - - - - - - 140.2 7 15 TSC1 tuberous sclerosis 1 703 90 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38210.[MT7]-VYATLEAYTK[MT7].2y4_1.heavy 723.908 / 626.363 3152.0 33.65359878540039 50 20 10 10 10 5.089052396130891 19.650023661777993 0.0 3 0.9916558333093152 13.501077665858682 3152.0 20.645227105232536 0.0 - - - - - - - 176.26666666666668 6 15 RXRG retinoid X receptor, gamma 705 90 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38210.[MT7]-VYATLEAYTK[MT7].2y9_1.heavy 723.908 / 1203.64 2542.0 33.65359878540039 50 20 10 10 10 5.089052396130891 19.650023661777993 0.0 3 0.9916558333093152 13.501077665858682 2542.0 30.928075216972033 0.0 - - - - - - - 166.45454545454547 5 11 RXRG retinoid X receptor, gamma 707 90 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38210.[MT7]-VYATLEAYTK[MT7].2y3_1.heavy 723.908 / 555.326 2745.0 33.65359878540039 50 20 10 10 10 5.089052396130891 19.650023661777993 0.0 3 0.9916558333093152 13.501077665858682 2745.0 8.095577395577395 0.0 - - - - - - - 169.77777777777777 5 9 RXRG retinoid X receptor, gamma 709 90 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38210.[MT7]-VYATLEAYTK[MT7].2y7_1.heavy 723.908 / 969.537 2948.0 33.65359878540039 50 20 10 10 10 5.089052396130891 19.650023661777993 0.0 3 0.9916558333093152 13.501077665858682 2948.0 40.23067516661837 0.0 - - - - - - - 165.125 5 8 RXRG retinoid X receptor, gamma 711 91 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38274.[MT7]-VTGVPGTEFVQK[MT7].2y4_1.heavy 775.445 / 665.41 1462.0 30.752700805664062 38 12 10 6 10 1.5122923932110492 54.13287087467748 0.0391998291015625 3 0.8907350407595601 3.699012474797378 1462.0 7.904999999999999 0.0 - - - - - - - 186.33333333333334 2 12 MAPK13 mitogen-activated protein kinase 13 713 91 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38274.[MT7]-VTGVPGTEFVQK[MT7].2y8_1.heavy 775.445 / 1049.57 29748.0 30.752700805664062 38 12 10 6 10 1.5122923932110492 54.13287087467748 0.0391998291015625 3 0.8907350407595601 3.699012474797378 29748.0 216.1918604651163 0.0 - - - - - - - 193.5 59 12 MAPK13 mitogen-activated protein kinase 13 715 91 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38274.[MT7]-VTGVPGTEFVQK[MT7].2b4_1.heavy 775.445 / 501.315 47202.0 30.752700805664062 38 12 10 6 10 1.5122923932110492 54.13287087467748 0.0391998291015625 3 0.8907350407595601 3.699012474797378 47202.0 110.48489882210814 0.0 - - - - - - - 688.0 94 7 MAPK13 mitogen-activated protein kinase 13 717 91 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38274.[MT7]-VTGVPGTEFVQK[MT7].2y3_1.heavy 775.445 / 518.342 1290.0 30.752700805664062 38 12 10 6 10 1.5122923932110492 54.13287087467748 0.0391998291015625 3 0.8907350407595601 3.699012474797378 1290.0 3.5 2.0 - - - - - - - 229.33333333333334 3 15 MAPK13 mitogen-activated protein kinase 13 719 92 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23253.[MT7]-GLSNPSEVETLREK[MT7].3y10_2.heavy 616.342 / 666.368 8485.0 26.467000484466553 36 10 10 6 10 1.165962565570851 52.56219208798903 0.03840065002441406 3 0.8425111131291501 3.068072369717764 8485.0 40.404761904761905 0.0 - - - - - - - 177.88235294117646 16 17 RXRG retinoid X receptor, gamma 721 92 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23253.[MT7]-GLSNPSEVETLREK[MT7].3y6_1.heavy 616.342 / 919.533 1932.0 26.467000484466553 36 10 10 6 10 1.165962565570851 52.56219208798903 0.03840065002441406 3 0.8425111131291501 3.068072369717764 1932.0 18.4 0.0 - - - - - - - 182.0 3 6 RXRG retinoid X receptor, gamma 723 92 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23253.[MT7]-GLSNPSEVETLREK[MT7].3b4_1.heavy 616.342 / 516.29 5545.0 26.467000484466553 36 10 10 6 10 1.165962565570851 52.56219208798903 0.03840065002441406 3 0.8425111131291501 3.068072369717764 5545.0 25.08452380952381 0.0 - - - - - - - 636.0 11 7 RXRG retinoid X receptor, gamma 725 92 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23253.[MT7]-GLSNPSEVETLREK[MT7].3y5_1.heavy 616.342 / 790.49 1428.0 26.467000484466553 36 10 10 6 10 1.165962565570851 52.56219208798903 0.03840065002441406 3 0.8425111131291501 3.068072369717764 1428.0 8.783333333333333 0.0 - - - - - - - 193.2 2 10 RXRG retinoid X receptor, gamma 727 93 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38205.[MT7]-EENEAESDVK[MT7].2b3_1.heavy 719.351 / 517.237 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 729 93 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38205.[MT7]-EENEAESDVK[MT7].2y5_1.heavy 719.351 / 721.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 731 93 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38205.[MT7]-EENEAESDVK[MT7].2b4_1.heavy 719.351 / 646.28 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 733 93 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38205.[MT7]-EENEAESDVK[MT7].2b5_1.heavy 719.351 / 717.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 735 94 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23252.[MT7]-LRLNVDEAFEQLVR.4y4_1.heavy 462.263 / 515.33 44201.0 41.80780029296875 31 5 10 6 10 0.8163937134557491 76.65363898370946 0.03839874267578125 3 0.6347357992678238 1.9762998933500793 44201.0 238.73887079127184 0.0 - - - - - - - 184.86666666666667 88 15 RRAS related RAS viral (r-ras) oncogene homolog 737 94 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23252.[MT7]-LRLNVDEAFEQLVR.4b7_1.heavy 462.263 / 984.56 60.0 41.80780029296875 31 5 10 6 10 0.8163937134557491 76.65363898370946 0.03839874267578125 3 0.6347357992678238 1.9762998933500793 60.0 -1.5 1.0 - - - - - - - 0.0 0 0 RRAS related RAS viral (r-ras) oncogene homolog 739 94 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23252.[MT7]-LRLNVDEAFEQLVR.4b4_1.heavy 462.263 / 641.422 3015.0 41.80780029296875 31 5 10 6 10 0.8163937134557491 76.65363898370946 0.03839874267578125 3 0.6347357992678238 1.9762998933500793 3015.0 63.22893646408839 0.0 - - - - - - - 146.5 6 14 RRAS related RAS viral (r-ras) oncogene homolog 741 94 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23252.[MT7]-LRLNVDEAFEQLVR.4b6_1.heavy 462.263 / 855.517 6693.0 41.80780029296875 31 5 10 6 10 0.8163937134557491 76.65363898370946 0.03839874267578125 3 0.6347357992678238 1.9762998933500793 6693.0 120.0666267955801 0.0 - - - - - - - 190.83333333333334 13 6 RRAS related RAS viral (r-ras) oncogene homolog 743 95 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37823.[MT7]-LLSNEK[MT7].2y4_1.heavy 496.305 / 621.332 2547.0 23.808800379435223 29 15 4 6 4 2.6029766636643057 30.06200781458302 0.030599594116210938 7 0.9593113281057978 6.097361311383919 2547.0 4.950927835051546 0.0 - - - - - - - 341.8181818181818 5 22 UBE3A ubiquitin protein ligase E3A 745 95 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37823.[MT7]-LLSNEK[MT7].2y5_1.heavy 496.305 / 734.417 2729.0 23.808800379435223 29 15 4 6 4 2.6029766636643057 30.06200781458302 0.030599594116210938 7 0.9593113281057978 6.097361311383919 2729.0 0.7852433281004709 3.0 - - - - - - - 277.0869565217391 10 23 UBE3A ubiquitin protein ligase E3A 747 95 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37823.[MT7]-LLSNEK[MT7].2y3_1.heavy 496.305 / 534.3 1456.0 23.808800379435223 29 15 4 6 4 2.6029766636643057 30.06200781458302 0.030599594116210938 7 0.9593113281057978 6.097361311383919 1456.0 0.48052805280528044 9.0 - - - - - - - 758.0 4 10 UBE3A ubiquitin protein ligase E3A 749 96 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23257.[MT7]-GLTPTGTLPLGVLSGGK[MT7].2y5_1.heavy 928.558 / 605.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 751 96 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23257.[MT7]-GLTPTGTLPLGVLSGGK[MT7].2y9_1.heavy 928.558 / 971.601 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 753 96 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23257.[MT7]-GLTPTGTLPLGVLSGGK[MT7].2y10_1.heavy 928.558 / 1084.68 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 755 96 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23257.[MT7]-GLTPTGTLPLGVLSGGK[MT7].2y7_1.heavy 928.558 / 761.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 757 97 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23164.[MT7]-QTIETATVEAVEAR.3y6_1.heavy 554.632 / 674.347 116882.0 32.871498107910156 43 13 10 10 10 0.9733443544729748 60.875403803544174 0.0 3 0.9121000128076621 4.131751688948208 116882.0 289.58547574045724 0.0 - - - - - - - 654.1428571428571 233 7 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 759 97 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23164.[MT7]-QTIETATVEAVEAR.3b4_1.heavy 554.632 / 616.342 41840.0 32.871498107910156 43 13 10 10 10 0.9733443544729748 60.875403803544174 0.0 3 0.9121000128076621 4.131751688948208 41840.0 40.11772290842833 0.0 - - - - - - - 1263.857142857143 83 7 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 761 97 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23164.[MT7]-QTIETATVEAVEAR.3b5_1.heavy 554.632 / 717.39 21961.0 32.871498107910156 43 13 10 10 10 0.9733443544729748 60.875403803544174 0.0 3 0.9121000128076621 4.131751688948208 21961.0 54.07285681297569 0.0 - - - - - - - 208.0 43 8 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 763 97 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23164.[MT7]-QTIETATVEAVEAR.3y5_1.heavy 554.632 / 545.304 89717.0 32.871498107910156 43 13 10 10 10 0.9733443544729748 60.875403803544174 0.0 3 0.9121000128076621 4.131751688948208 89717.0 80.04488921181758 0.0 - - - - - - - 763.3333333333334 179 3 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 765 98 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23259.[MT7]-TLSAVGTPLNALGSPYR.2b3_1.heavy 931.019 / 446.273 2663.0 37.45634937286377 38 12 10 6 10 1.0345277221165141 65.75475190728874 0.031398773193359375 3 0.881730770024244 3.552631997464226 2663.0 11.74451282051282 0.0 - - - - - - - 169.72222222222223 5 18 RXRG retinoid X receptor, gamma 767 98 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23259.[MT7]-TLSAVGTPLNALGSPYR.2y12_1.heavy 931.019 / 1245.66 6820.0 37.45634937286377 38 12 10 6 10 1.0345277221165141 65.75475190728874 0.031398773193359375 3 0.881730770024244 3.552631997464226 6820.0 41.269743589743584 0.0 - - - - - - - 183.52941176470588 13 17 RXRG retinoid X receptor, gamma 769 98 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23259.[MT7]-TLSAVGTPLNALGSPYR.2b4_1.heavy 931.019 / 517.31 10068.0 37.45634937286377 38 12 10 6 10 1.0345277221165141 65.75475190728874 0.031398773193359375 3 0.881730770024244 3.552631997464226 10068.0 18.892809690611358 0.0 - - - - - - - 687.4166666666666 20 12 RXRG retinoid X receptor, gamma 771 98 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23259.[MT7]-TLSAVGTPLNALGSPYR.2y10_1.heavy 931.019 / 1087.59 6300.0 37.45634937286377 38 12 10 6 10 1.0345277221165141 65.75475190728874 0.031398773193359375 3 0.881730770024244 3.552631997464226 6300.0 74.3076923076923 0.0 - - - - - - - 159.54545454545453 12 22 RXRG retinoid X receptor, gamma 773 99 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542796.[MT7]-ILDFGLAR.2y5_1.heavy 524.817 / 563.33 150318.0 39.47679901123047 50 20 10 10 10 9.300724792989847 10.751850229497395 0.0 3 0.9922338456323141 13.99516080332115 150318.0 326.57920093774715 0.0 - - - - - - - 191.0 300 7 LOC100509672;LOC100509694;MAPK14;MAPK8;MAPK11;MAPK9;MAPK10;MAPK13;MAPK12 mitogen-activated protein kinase 12-like;mitogen-activated protein kinase 12-like;mitogen-activated protein kinase 14;mitogen-activated protein kinase 8;mitogen-activated protein kinase 11;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10;mitogen-activated protein kinase 13;mitogen-activated protein kinase 12 775 99 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542796.[MT7]-ILDFGLAR.2y6_1.heavy 524.817 / 678.357 52312.0 39.47679901123047 50 20 10 10 10 9.300724792989847 10.751850229497395 0.0 3 0.9922338456323141 13.99516080332115 52312.0 239.6760661123088 0.0 - - - - - - - 222.9 104 10 LOC100509672;LOC100509694;MAPK14;MAPK8;MAPK11;MAPK9;MAPK10;MAPK13;MAPK12 mitogen-activated protein kinase 12-like;mitogen-activated protein kinase 12-like;mitogen-activated protein kinase 14;mitogen-activated protein kinase 8;mitogen-activated protein kinase 11;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10;mitogen-activated protein kinase 13;mitogen-activated protein kinase 12 777 99 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542796.[MT7]-ILDFGLAR.2b5_1.heavy 524.817 / 690.394 24311.0 39.47679901123047 50 20 10 10 10 9.300724792989847 10.751850229497395 0.0 3 0.9922338456323141 13.99516080332115 24311.0 85.42779916613668 0.0 - - - - - - - 254.52941176470588 48 17 LOC100509672;LOC100509694;MAPK14;MAPK8;MAPK11;MAPK9;MAPK10;MAPK13;MAPK12 mitogen-activated protein kinase 12-like;mitogen-activated protein kinase 12-like;mitogen-activated protein kinase 14;mitogen-activated protein kinase 8;mitogen-activated protein kinase 11;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10;mitogen-activated protein kinase 13;mitogen-activated protein kinase 12 779 99 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542796.[MT7]-ILDFGLAR.2y7_1.heavy 524.817 / 791.441 130399.0 39.47679901123047 50 20 10 10 10 9.300724792989847 10.751850229497395 0.0 3 0.9922338456323141 13.99516080332115 130399.0 872.3524588662086 0.0 - - - - - - - 645.4285714285714 260 7 LOC100509672;LOC100509694;MAPK14;MAPK8;MAPK11;MAPK9;MAPK10;MAPK13;MAPK12 mitogen-activated protein kinase 12-like;mitogen-activated protein kinase 12-like;mitogen-activated protein kinase 14;mitogen-activated protein kinase 8;mitogen-activated protein kinase 11;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10;mitogen-activated protein kinase 13;mitogen-activated protein kinase 12 781 100 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38102.[MT7]-RFHLSTTDR.3y6_1.heavy 426.234 / 692.357 5655.0 21.006575107574463 43 18 10 7 8 3.4419508428748906 29.053291161030927 0.029699325561523438 4 0.9852516719210721 10.149759830996235 5655.0 53.49324324324324 0.0 - - - - - - - 144.61111111111111 11 18 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 783 100 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38102.[MT7]-RFHLSTTDR.3b3_1.heavy 426.234 / 585.338 19682.0 21.006575107574463 43 18 10 7 8 3.4419508428748906 29.053291161030927 0.029699325561523438 4 0.9852516719210721 10.149759830996235 19682.0 88.29520951813537 0.0 - - - - - - - 240.28571428571428 39 21 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 785 100 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38102.[MT7]-RFHLSTTDR.3y5_1.heavy 426.234 / 579.273 34430.0 21.006575107574463 43 18 10 7 8 3.4419508428748906 29.053291161030927 0.029699325561523438 4 0.9852516719210721 10.149759830996235 34430.0 43.775402585383944 0.0 - - - - - - - 251.6153846153846 68 13 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 787 100 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38102.[MT7]-RFHLSTTDR.3b8_2.heavy 426.234 / 551.792 6653.0 21.006575107574463 43 18 10 7 8 3.4419508428748906 29.053291161030927 0.029699325561523438 4 0.9852516719210721 10.149759830996235 6653.0 56.25406490828177 2.0 - - - - - - - 208.44 21 25 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 789 101 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 554221.0 33.964500427246094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 554221.0 164.6761742970227 0.0 - - - - - - - 419.0 1108 1 791 101 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 169914.0 33.964500427246094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 169914.0 93.74131726275415 0.0 - - - - - - - 718.2857142857143 339 7 793 101 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 239890.0 33.964500427246094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 239890.0 115.72899268427545 0.0 - - - - - - - 419.0 479 1 795 102 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38106.[MT7]-ARVQFGANK[MT7].3y7_2.heavy 426.922 / 454.259 8720.0 21.20127534866333 37 11 10 6 10 1.1453271877785534 57.53114862465667 0.031099319458007812 3 0.8778450182630828 3.4944864614235525 8720.0 17.61455697569757 0.0 - - - - - - - 606.1666666666666 17 12 UBE2Q1;UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 1;ubiquitin-conjugating enzyme E2Q family member 2 797 102 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38106.[MT7]-ARVQFGANK[MT7].3b3_1.heavy 426.922 / 471.316 6776.0 21.20127534866333 37 11 10 6 10 1.1453271877785534 57.53114862465667 0.031099319458007812 3 0.8778450182630828 3.4944864614235525 6776.0 18.778538094881583 0.0 - - - - - - - 269.05263157894734 13 19 UBE2Q1;UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 1;ubiquitin-conjugating enzyme E2Q family member 2 799 102 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38106.[MT7]-ARVQFGANK[MT7].3y4_1.heavy 426.922 / 533.316 23828.0 21.20127534866333 37 11 10 6 10 1.1453271877785534 57.53114862465667 0.031099319458007812 3 0.8778450182630828 3.4944864614235525 23828.0 60.13308018252933 0.0 - - - - - - - 691.2222222222222 47 9 UBE2Q1;UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 1;ubiquitin-conjugating enzyme E2Q family member 2 801 102 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38106.[MT7]-ARVQFGANK[MT7].3y5_1.heavy 426.922 / 680.385 8443.0 21.20127534866333 37 11 10 6 10 1.1453271877785534 57.53114862465667 0.031099319458007812 3 0.8778450182630828 3.4944864614235525 8443.0 29.18369614395887 0.0 - - - - - - - 180.65 16 20 UBE2Q1;UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 1;ubiquitin-conjugating enzyme E2Q family member 2 803 103 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23354.[MT7]-VFSILRQESESVLTLK[MT7].3y15_2.heavy 713.087 / 947.542 4329.0 43.07324981689453 43 17 10 6 10 2.581193750909652 31.281227787205328 0.0384979248046875 3 0.9721894721077337 7.383224693075851 4329.0 41.55811014395715 0.0 - - - - - - - 148.375 8 16 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 805 103 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23354.[MT7]-VFSILRQESESVLTLK[MT7].3b11_2.heavy 713.087 / 710.881 3865.0 43.07324981689453 43 17 10 6 10 2.581193750909652 31.281227787205328 0.0384979248046875 3 0.9721894721077337 7.383224693075851 3865.0 54.2286251174444 0.0 - - - - - - - 145.0625 7 16 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 807 103 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23354.[MT7]-VFSILRQESESVLTLK[MT7].3y3_1.heavy 713.087 / 505.347 5926.0 43.07324981689453 43 17 10 6 10 2.581193750909652 31.281227787205328 0.0384979248046875 3 0.9721894721077337 7.383224693075851 5926.0 31.020404530744337 0.0 - - - - - - - 217.10526315789474 11 19 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 809 103 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23354.[MT7]-VFSILRQESESVLTLK[MT7].3y4_1.heavy 713.087 / 618.431 3968.0 43.07324981689453 43 17 10 6 10 2.581193750909652 31.281227787205328 0.0384979248046875 3 0.9721894721077337 7.383224693075851 3968.0 18.8537301638429 0.0 - - - - - - - 196.0 7 20 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 811 104 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542882.[MT7]-LDINVSK[MT7].2y4_1.heavy 538.831 / 591.358 5065.0 28.876100540161133 41 14 9 10 8 3.440903163408344 23.254010064311334 0.0 4 0.9327309202776259 4.731398019291127 5065.0 2.212182061579652 1.0 - - - - - - - 351.52941176470586 10 17 PRIM1 primase, DNA, polypeptide 1 (49kDa) 813 104 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542882.[MT7]-LDINVSK[MT7].2y5_1.heavy 538.831 / 704.442 5979.0 28.876100540161133 41 14 9 10 8 3.440903163408344 23.254010064311334 0.0 4 0.9327309202776259 4.731398019291127 5979.0 2.8814457831325306 0.0 - - - - - - - 755.3 11 10 PRIM1 primase, DNA, polypeptide 1 (49kDa) 815 104 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542882.[MT7]-LDINVSK[MT7].2b4_1.heavy 538.831 / 600.347 1661.0 28.876100540161133 41 14 9 10 8 3.440903163408344 23.254010064311334 0.0 4 0.9327309202776259 4.731398019291127 1661.0 2.946829074539918 3.0 - - - - - - - 713.8 3 10 PRIM1 primase, DNA, polypeptide 1 (49kDa) 817 104 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542882.[MT7]-LDINVSK[MT7].2y6_1.heavy 538.831 / 819.469 6311.0 28.876100540161133 41 14 9 10 8 3.440903163408344 23.254010064311334 0.0 4 0.9327309202776259 4.731398019291127 6311.0 11.731290877796903 1.0 - - - - - - - 218.42105263157896 15 19 PRIM1 primase, DNA, polypeptide 1 (49kDa) 819 105 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23041.[MT7]-NIASVGFHEDGR.3y7_1.heavy 482.58 / 817.359 9722.0 26.20560073852539 48 18 10 10 10 11.954526513145334 8.365032265396614 0.0 3 0.9895458982831397 12.059795272534663 9722.0 50.55020251906382 0.0 - - - - - - - 235.78571428571428 19 14 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 821 105 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23041.[MT7]-NIASVGFHEDGR.3b6_1.heavy 482.58 / 686.395 18007.0 26.20560073852539 48 18 10 10 10 11.954526513145334 8.365032265396614 0.0 3 0.9895458982831397 12.059795272534663 18007.0 52.681202023028945 0.0 - - - - - - - 241.64285714285714 36 14 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 823 105 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23041.[MT7]-NIASVGFHEDGR.3b4_1.heavy 482.58 / 530.305 17246.0 26.20560073852539 48 18 10 10 10 11.954526513145334 8.365032265396614 0.0 3 0.9895458982831397 12.059795272534663 17246.0 43.59506139848571 0.0 - - - - - - - 702.1538461538462 34 13 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 825 105 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23041.[MT7]-NIASVGFHEDGR.3y5_1.heavy 482.58 / 613.269 20627.0 26.20560073852539 48 18 10 10 10 11.954526513145334 8.365032265396614 0.0 3 0.9895458982831397 12.059795272534663 20627.0 32.61315454603296 0.0 - - - - - - - 743.9 41 10 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 827 106 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23042.[MT7]-GLSNPSEVETLR.2y8_1.heavy 723.389 / 930.489 4113.0 28.30340003967285 43 13 10 10 10 0.8132674959286014 64.26531771085345 0.0 3 0.9022787669865068 3.9153097626302023 4113.0 31.043357142857143 0.0 - - - - - - - 186.0 8 14 RXRG retinoid X receptor, gamma 829 106 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23042.[MT7]-GLSNPSEVETLR.2y9_1.heavy 723.389 / 1044.53 1007.0 28.30340003967285 43 13 10 10 10 0.8132674959286014 64.26531771085345 0.0 3 0.9022787669865068 3.9153097626302023 1007.0 5.673090941702539 1.0 - - - - - - - 168.0 2 8 RXRG retinoid X receptor, gamma 831 106 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23042.[MT7]-GLSNPSEVETLR.2b4_1.heavy 723.389 / 516.29 4197.0 28.30340003967285 43 13 10 10 10 0.8132674959286014 64.26531771085345 0.0 3 0.9022787669865068 3.9153097626302023 4197.0 29.621683673469388 0.0 - - - - - - - 243.6 8 10 RXRG retinoid X receptor, gamma 833 106 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23042.[MT7]-GLSNPSEVETLR.2y10_1.heavy 723.389 / 1131.56 1595.0 28.30340003967285 43 13 10 10 10 0.8132674959286014 64.26531771085345 0.0 3 0.9022787669865068 3.9153097626302023 1595.0 22.02619047619047 0.0 - - - - - - - 224.0 3 3 RXRG retinoid X receptor, gamma 835 107 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23448.[MT7]-GSVTLSDLPGFLGDLASEEDSIEK[MT7].3y4_1.heavy 923.142 / 620.374 1631.0 48.05780029296875 39 13 10 6 10 1.3978328922117866 46.93129694379484 0.03459930419921875 3 0.9011749964296248 3.8930118858608833 1631.0 15.228635238402756 0.0 - - - - - - - 125.76190476190476 3 21 TSC1 tuberous sclerosis 1 837 107 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23448.[MT7]-GSVTLSDLPGFLGDLASEEDSIEK[MT7].3y8_1.heavy 923.142 / 1080.52 2413.0 48.05780029296875 39 13 10 6 10 1.3978328922117866 46.93129694379484 0.03459930419921875 3 0.9011749964296248 3.8930118858608833 2413.0 26.616414173031174 0.0 - - - - - - - 97.94736842105263 4 19 TSC1 tuberous sclerosis 1 839 107 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23448.[MT7]-GSVTLSDLPGFLGDLASEEDSIEK[MT7].3b8_1.heavy 923.142 / 917.506 4631.0 48.05780029296875 39 13 10 6 10 1.3978328922117866 46.93129694379484 0.03459930419921875 3 0.9011749964296248 3.8930118858608833 4631.0 33.82790311378631 0.0 - - - - - - - 229.72727272727272 9 22 TSC1 tuberous sclerosis 1 841 107 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23448.[MT7]-GSVTLSDLPGFLGDLASEEDSIEK[MT7].3b7_1.heavy 923.142 / 804.422 4044.0 48.05780029296875 39 13 10 6 10 1.3978328922117866 46.93129694379484 0.03459930419921875 3 0.9011749964296248 3.8930118858608833 4044.0 42.92098159509203 0.0 - - - - - - - 140.77272727272728 8 22 TSC1 tuberous sclerosis 1 843 108 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38262.[MT7]-LWC[CAM]VETGEIK[MT7].2y4_1.heavy 761.913 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 845 108 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38262.[MT7]-LWC[CAM]VETGEIK[MT7].2y5_1.heavy 761.913 / 691.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 847 108 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38262.[MT7]-LWC[CAM]VETGEIK[MT7].2y6_1.heavy 761.913 / 820.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 849 108 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38262.[MT7]-LWC[CAM]VETGEIK[MT7].2y7_1.heavy 761.913 / 919.522 N/A N/A - - - - - - - - - 0.0 - - - - - - - MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 851 109 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542465.[MT7]-ELLLLK[MT7].2y4_1.heavy 508.852 / 630.467 22067.0 37.368099212646484 47 17 10 10 10 2.616682711251823 31.105270224180444 0.0 3 0.9713265957791056 7.270755114132414 22067.0 68.59319777732641 0.0 - - - - - - - 251.94117647058823 44 17 MAPK13 mitogen-activated protein kinase 13 853 109 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542465.[MT7]-ELLLLK[MT7].2b3_1.heavy 508.852 / 500.32 40850.0 37.368099212646484 47 17 10 10 10 2.616682711251823 31.105270224180444 0.0 3 0.9713265957791056 7.270755114132414 40850.0 54.61030105017503 0.0 - - - - - - - 1237.7777777777778 81 9 MAPK13 mitogen-activated protein kinase 13 855 109 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542465.[MT7]-ELLLLK[MT7].2y5_1.heavy 508.852 / 743.551 30494.0 37.368099212646484 47 17 10 10 10 2.616682711251823 31.105270224180444 0.0 3 0.9713265957791056 7.270755114132414 30494.0 82.57951702983772 0.0 - - - - - - - 673.4285714285714 60 7 MAPK13 mitogen-activated protein kinase 13 857 109 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542465.[MT7]-ELLLLK[MT7].2y3_1.heavy 508.852 / 517.383 30923.0 37.368099212646484 47 17 10 10 10 2.616682711251823 31.105270224180444 0.0 3 0.9713265957791056 7.270755114132414 30923.0 88.29259472817132 0.0 - - - - - - - 735.5 61 10 MAPK13 mitogen-activated protein kinase 13 859 110 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23443.[MT7]-AQHIVPC[CAM]TISQLLSATLVDEVFR.3b4_1.heavy 914.497 / 594.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPA2 replication protein A2, 32kDa 861 110 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23443.[MT7]-AQHIVPC[CAM]TISQLLSATLVDEVFR.3b5_1.heavy 914.497 / 693.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPA2 replication protein A2, 32kDa 863 110 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23443.[MT7]-AQHIVPC[CAM]TISQLLSATLVDEVFR.3y4_1.heavy 914.497 / 550.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPA2 replication protein A2, 32kDa 865 110 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23443.[MT7]-AQHIVPC[CAM]TISQLLSATLVDEVFR.3y10_1.heavy 914.497 / 1136.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPA2 replication protein A2, 32kDa 867 111 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23444.[MT7]-ALTTAPAPPSLPPATPLGPWAFWSR.3b5_1.heavy 916.166 / 602.363 7978.0 48.07509994506836 42 12 10 10 10 0.8521050009954768 69.22368006435161 0.0 3 0.8842588659633625 3.592012681481053 7978.0 13.771745849063809 0.0 - - - - - - - 208.07692307692307 15 13 BAX BCL2-associated X protein 869 111 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23444.[MT7]-ALTTAPAPPSLPPATPLGPWAFWSR.3y8_1.heavy 916.166 / 1006.49 2179.0 48.07509994506836 42 12 10 10 10 0.8521050009954768 69.22368006435161 0.0 3 0.8842588659633625 3.592012681481053 2179.0 21.98955347829032 0.0 - - - - - - - 180.95 4 20 BAX BCL2-associated X protein 871 111 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23444.[MT7]-ALTTAPAPPSLPPATPLGPWAFWSR.3b7_1.heavy 916.166 / 770.453 9278.0 48.07509994506836 42 12 10 10 10 0.8521050009954768 69.22368006435161 0.0 3 0.8842588659633625 3.592012681481053 9278.0 23.20831865625587 0.0 - - - - - - - 749.7777777777778 18 9 BAX BCL2-associated X protein 873 111 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23444.[MT7]-ALTTAPAPPSLPPATPLGPWAFWSR.3y10_1.heavy 916.166 / 1216.63 3550.0 48.07509994506836 42 12 10 10 10 0.8521050009954768 69.22368006435161 0.0 3 0.8842588659633625 3.592012681481053 3550.0 12.66008483101206 0.0 - - - - - - - 198.47058823529412 7 17 BAX BCL2-associated X protein 875 112 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542267.[MT7]-LSLENK[MT7].2y4_1.heavy 496.305 / 647.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - WWP1;SYCP1;CCDC68 WW domain containing E3 ubiquitin protein ligase 1;synaptonemal complex protein 1;coiled-coil domain containing 68 877 112 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542267.[MT7]-LSLENK[MT7].2y5_1.heavy 496.305 / 734.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - WWP1;SYCP1;CCDC68 WW domain containing E3 ubiquitin protein ligase 1;synaptonemal complex protein 1;coiled-coil domain containing 68 879 112 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542267.[MT7]-LSLENK[MT7].2b4_1.heavy 496.305 / 587.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - WWP1;SYCP1;CCDC68 WW domain containing E3 ubiquitin protein ligase 1;synaptonemal complex protein 1;coiled-coil domain containing 68 881 112 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542267.[MT7]-LSLENK[MT7].2y3_1.heavy 496.305 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - WWP1;SYCP1;CCDC68 WW domain containing E3 ubiquitin protein ligase 1;synaptonemal complex protein 1;coiled-coil domain containing 68 883 113 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23440.[MT7]-APEK[MT7]EEFLAWQHDLEVNDK[MT7].4y5_1.heavy 683.358 / 748.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 885 113 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23440.[MT7]-APEK[MT7]EEFLAWQHDLEVNDK[MT7].4y4_1.heavy 683.358 / 619.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 887 113 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23440.[MT7]-APEK[MT7]EEFLAWQHDLEVNDK[MT7].4b7_2.heavy 683.358 / 560.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 889 113 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23440.[MT7]-APEK[MT7]EEFLAWQHDLEVNDK[MT7].4y3_1.heavy 683.358 / 520.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 891 114 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38256.[MT7]-TLEHYTHNTVR.3y6_1.heavy 505.599 / 727.385 8360.0 19.96886698404948 42 16 10 6 10 3.439128154507285 29.077136851949255 0.03220176696777344 3 0.9665959391973779 6.733584759520793 8360.0 26.719716223875956 0.0 - - - - - - - 212.78947368421052 16 19 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 893 114 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38256.[MT7]-TLEHYTHNTVR.3b4_1.heavy 505.599 / 625.343 5955.0 19.96886698404948 42 16 10 6 10 3.439128154507285 29.077136851949255 0.03220176696777344 3 0.9665959391973779 6.733584759520793 5955.0 13.42191107428887 0.0 - - - - - - - 737.6 11 10 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 895 114 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38256.[MT7]-TLEHYTHNTVR.3b3_1.heavy 505.599 / 488.284 N/A 19.96886698404948 42 16 10 6 10 3.439128154507285 29.077136851949255 0.03220176696777344 3 0.9665959391973779 6.733584759520793 10764.0 2.1714637982686544 1.0 - - - - - - - 1717.142857142857 21 7 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 897 114 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38256.[MT7]-TLEHYTHNTVR.3y5_1.heavy 505.599 / 626.337 8523.0 19.96886698404948 42 16 10 6 10 3.439128154507285 29.077136851949255 0.03220176696777344 3 0.9665959391973779 6.733584759520793 8523.0 27.15443610443147 0.0 - - - - - - - 294.0 17 21 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 899 115 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38234.[MT7]-YPEQPGRFAK[MT7].3y7_1.heavy 494.277 / 947.554 714.0 23.687766393025715 41 16 10 7 8 3.1542853591355464 31.702902120246243 0.029499053955078125 4 0.961184380245144 6.243731491890663 714.0 19.04 3.0 - - - - - - - 0.0 1 0 RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 901 115 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38234.[MT7]-YPEQPGRFAK[MT7].3y6_1.heavy 494.277 / 819.496 2143.0 23.687766393025715 41 16 10 7 8 3.1542853591355464 31.702902120246243 0.029499053955078125 4 0.961184380245144 6.243731491890663 2143.0 8.272987987141164 0.0 - - - - - - - 207.32 4 25 RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 903 115 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38234.[MT7]-YPEQPGRFAK[MT7].3y8_1.heavy 494.277 / 1076.6 N/A 23.687766393025715 41 16 10 7 8 3.1542853591355464 31.702902120246243 0.029499053955078125 4 0.961184380245144 6.243731491890663 0.0 0.0 1.0 - - - - - - - 0.0 0 0 RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 905 115 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38234.[MT7]-YPEQPGRFAK[MT7].3y9_2.heavy 494.277 / 587.328 20176.0 23.687766393025715 41 16 10 7 8 3.1542853591355464 31.702902120246243 0.029499053955078125 4 0.961184380245144 6.243731491890663 20176.0 54.24339823275335 0.0 - - - - - - - 702.4 40 10 RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 907 116 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23176.[MT7]-VFEHFLENLDK[MT7].3b4_1.heavy 560.306 / 657.348 43912.0 40.28179931640625 43 13 10 10 10 1.4535016778361416 59.75114307259328 0.0 3 0.9095885995135138 4.073080978931278 43912.0 117.6081434986286 0.0 - - - - - - - 310.0 87 12 PRIM1 primase, DNA, polypeptide 1 (49kDa) 909 116 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23176.[MT7]-VFEHFLENLDK[MT7].3y4_1.heavy 560.306 / 633.369 30161.0 40.28179931640625 43 13 10 10 10 1.4535016778361416 59.75114307259328 0.0 3 0.9095885995135138 4.073080978931278 30161.0 91.09108467741936 0.0 - - - - - - - 701.2222222222222 60 9 PRIM1 primase, DNA, polypeptide 1 (49kDa) 911 116 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23176.[MT7]-VFEHFLENLDK[MT7].3b3_1.heavy 560.306 / 520.289 33150.0 40.28179931640625 43 13 10 10 10 1.4535016778361416 59.75114307259328 0.0 3 0.9095885995135138 4.073080978931278 33150.0 60.99538033492571 0.0 - - - - - - - 711.8571428571429 66 7 PRIM1 primase, DNA, polypeptide 1 (49kDa) 913 116 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23176.[MT7]-VFEHFLENLDK[MT7].3y5_1.heavy 560.306 / 762.411 27437.0 40.28179931640625 43 13 10 10 10 1.4535016778361416 59.75114307259328 0.0 3 0.9095885995135138 4.073080978931278 27437.0 118.15966737919419 0.0 - - - - - - - 259.05 54 20 PRIM1 primase, DNA, polypeptide 1 (49kDa) 915 117 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545348.[MT7]-FFVDGQWTHDPSEPIVTSQLGTVNNIIQVK[MT7].4y4_1.heavy 915.234 / 631.426 15646.0 41.63840103149414 41 11 10 10 10 3.0808156308819794 26.32311226054874 0.0 3 0.8782240619786298 3.50003652273559 15646.0 39.465768850784904 0.0 - - - - - - - 285.6363636363636 31 11 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 917 117 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545348.[MT7]-FFVDGQWTHDPSEPIVTSQLGTVNNIIQVK[MT7].4b4_1.heavy 915.234 / 653.341 6342.0 41.63840103149414 41 11 10 10 10 3.0808156308819794 26.32311226054874 0.0 3 0.8782240619786298 3.50003652273559 6342.0 21.089060240963853 0.0 - - - - - - - 256.8 12 15 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 919 117 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545348.[MT7]-FFVDGQWTHDPSEPIVTSQLGTVNNIIQVK[MT7].4b13_2.heavy 915.234 / 845.885 19914.0 41.63840103149414 41 11 10 10 10 3.0808156308819794 26.32311226054874 0.0 3 0.8782240619786298 3.50003652273559 19914.0 72.11520452361594 0.0 - - - - - - - 694.1428571428571 39 7 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 921 117 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545348.[MT7]-FFVDGQWTHDPSEPIVTSQLGTVNNIIQVK[MT7].4y7_1.heavy 915.234 / 972.596 8357.0 41.63840103149414 41 11 10 10 10 3.0808156308819794 26.32311226054874 0.0 3 0.8782240619786298 3.50003652273559 8357.0 82.58326773747473 0.0 - - - - - - - 200.0 16 16 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 923 118 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23038.[MT7]-SYIQSLPQTPR.2y8_1.heavy 717.397 / 926.505 2739.0 29.258649826049805 40 14 10 6 10 1.925650802183719 36.731734402112465 0.0345001220703125 3 0.941013470564151 5.056240058029487 2739.0 34.209999999999994 0.0 - - - - - - - 138.33333333333334 5 9 MAPK13 mitogen-activated protein kinase 13 925 118 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23038.[MT7]-SYIQSLPQTPR.2y5_1.heavy 717.397 / 598.331 4731.0 29.258649826049805 40 14 10 6 10 1.925650802183719 36.731734402112465 0.0345001220703125 3 0.941013470564151 5.056240058029487 4731.0 32.49 0.0 - - - - - - - 193.66666666666666 9 15 MAPK13 mitogen-activated protein kinase 13 927 118 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23038.[MT7]-SYIQSLPQTPR.2y10_1.heavy 717.397 / 1202.65 747.0 29.258649826049805 40 14 10 6 10 1.925650802183719 36.731734402112465 0.0345001220703125 3 0.941013470564151 5.056240058029487 747.0 11.969999999999999 0.0 - - - - - - - 0.0 1 0 MAPK13 mitogen-activated protein kinase 13 929 118 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23038.[MT7]-SYIQSLPQTPR.2y7_1.heavy 717.397 / 798.447 3154.0 29.258649826049805 40 14 10 6 10 1.925650802183719 36.731734402112465 0.0345001220703125 3 0.941013470564151 5.056240058029487 3154.0 45.6 0.0 - - - - - - - 193.66666666666666 6 6 MAPK13 mitogen-activated protein kinase 13 931 119 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 264402.0 22.300100326538086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 264402.0 613.3217396212115 0.0 - - - - - - - 755.1111111111111 528 9 933 119 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 430003.0 22.300100326538086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 430003.0 941.9063672942941 0.0 - - - - - - - 222.0 860 20 935 119 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 1476100.0 22.300100326538086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1476100.0 1824.892730402405 0.0 - - - - - - - 706.4444444444445 2952 9 937 120 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544703.[MT7]-AGHGFLLVFAINDR.3b6_1.heavy 558.646 / 727.401 43625.0 41.97719955444336 45 15 10 10 10 1.6896036910308856 47.20697114520901 0.0 3 0.9576044989554942 5.972498815112062 43625.0 176.59688606944147 0.0 - - - - - - - 260.8 87 10 RRAS related RAS viral (r-ras) oncogene homolog 939 120 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544703.[MT7]-AGHGFLLVFAINDR.3y6_1.heavy 558.646 / 735.378 111508.0 41.97719955444336 45 15 10 10 10 1.6896036910308856 47.20697114520901 0.0 3 0.9576044989554942 5.972498815112062 111508.0 408.1653042529663 0.0 - - - - - - - 311.44444444444446 223 9 RRAS related RAS viral (r-ras) oncogene homolog 941 120 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544703.[MT7]-AGHGFLLVFAINDR.3b5_1.heavy 558.646 / 614.317 66448.0 41.97719955444336 45 15 10 10 10 1.6896036910308856 47.20697114520901 0.0 3 0.9576044989554942 5.972498815112062 66448.0 203.20420476163025 0.0 - - - - - - - 710.1111111111111 132 9 RRAS related RAS viral (r-ras) oncogene homolog 943 120 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544703.[MT7]-AGHGFLLVFAINDR.3y5_1.heavy 558.646 / 588.31 83468.0 41.97719955444336 45 15 10 10 10 1.6896036910308856 47.20697114520901 0.0 3 0.9576044989554942 5.972498815112062 83468.0 150.7750173917427 0.0 - - - - - - - 692.875 166 8 RRAS related RAS viral (r-ras) oncogene homolog 945 121 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23034.[MT7]-QESESVLTLK[MT7].2y8_1.heavy 711.408 / 1020.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 947 121 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23034.[MT7]-QESESVLTLK[MT7].2y9_1.heavy 711.408 / 1149.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 949 121 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23034.[MT7]-QESESVLTLK[MT7].2y3_1.heavy 711.408 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 951 121 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23034.[MT7]-QESESVLTLK[MT7].2b5_1.heavy 711.408 / 705.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 953 122 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23388.[MT7]-TLRDQLLLLHNQLLYER.3y7_1.heavy 761.442 / 935.495 4618.0 39.361449241638184 39 13 10 6 10 2.948560558182584 33.91485371480293 0.035800933837890625 3 0.9184068182999828 4.290790264329273 4618.0 36.47035897435897 0.0 - - - - - - - 164.04761904761904 9 21 TSC1 tuberous sclerosis 1 955 122 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23388.[MT7]-TLRDQLLLLHNQLLYER.3y4_1.heavy 761.442 / 580.309 1366.0 39.361449241638184 39 13 10 6 10 2.948560558182584 33.91485371480293 0.035800933837890625 3 0.9184068182999828 4.290790264329273 1366.0 6.071111111111112 0.0 - - - - - - - 175.2173913043478 2 23 TSC1 tuberous sclerosis 1 957 122 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23388.[MT7]-TLRDQLLLLHNQLLYER.3b8_1.heavy 761.442 / 1097.68 1626.0 39.361449241638184 39 13 10 6 10 2.948560558182584 33.91485371480293 0.035800933837890625 3 0.9184068182999828 4.290790264329273 1626.0 23.389384615384614 0.0 - - - - - - - 189.58333333333334 3 12 TSC1 tuberous sclerosis 1 959 122 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23388.[MT7]-TLRDQLLLLHNQLLYER.3b7_1.heavy 761.442 / 984.596 1366.0 39.361449241638184 39 13 10 6 10 2.948560558182584 33.91485371480293 0.035800933837890625 3 0.9184068182999828 4.290790264329273 1366.0 17.1625641025641 0.0 - - - - - - - 178.75 2 20 TSC1 tuberous sclerosis 1 961 123 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23052.[MT7]-GQTIPEDILGK[MT7].2y4_1.heavy 729.924 / 574.404 1469.0 33.998549461364746 35 10 10 5 10 0.8354022294365993 67.51955392052056 0.045398712158203125 3 0.8258563200520985 2.913362877971629 1469.0 3.3980952380952383 1.0 - - - - - - - 234.23076923076923 2 13 MAP2K6 mitogen-activated protein kinase kinase 6 963 123 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23052.[MT7]-GQTIPEDILGK[MT7].2y8_1.heavy 729.924 / 1028.61 629.0 33.998549461364746 35 10 10 5 10 0.8354022294365993 67.51955392052056 0.045398712158203125 3 0.8258563200520985 2.913362877971629 629.0 0.958818829724454 2.0 - - - - - - - 225.0 2 7 MAP2K6 mitogen-activated protein kinase kinase 6 965 123 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23052.[MT7]-GQTIPEDILGK[MT7].2b4_1.heavy 729.924 / 544.321 6924.0 33.998549461364746 35 10 10 5 10 0.8354022294365993 67.51955392052056 0.045398712158203125 3 0.8258563200520985 2.913362877971629 6924.0 18.786914285714285 0.0 - - - - - - - 262.5 13 8 MAP2K6 mitogen-activated protein kinase kinase 6 967 123 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23052.[MT7]-GQTIPEDILGK[MT7].2y7_1.heavy 729.924 / 915.527 6714.0 33.998549461364746 35 10 10 5 10 0.8354022294365993 67.51955392052056 0.045398712158203125 3 0.8258563200520985 2.913362877971629 6714.0 25.18069714285714 0.0 - - - - - - - 175.0 13 9 MAP2K6 mitogen-activated protein kinase kinase 6 969 124 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23383.[MT7]-ITVLYSLVQGQQLNPYLR.3y6_1.heavy 750.431 / 775.446 1665.0 46.287925720214844 41 14 10 7 10 1.4134022148984386 40.697698727418654 0.0287017822265625 3 0.946982844838768 5.336008067538115 1665.0 6.126501003241241 0.0 - - - - - - - 131.6 3 20 UBE3A ubiquitin protein ligase E3A 971 124 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23383.[MT7]-ITVLYSLVQGQQLNPYLR.3b4_1.heavy 750.431 / 571.394 3058.0 46.287925720214844 41 14 10 7 10 1.4134022148984386 40.697698727418654 0.0287017822265625 3 0.946982844838768 5.336008067538115 3058.0 15.932467563385313 0.0 - - - - - - - 167.28 6 25 UBE3A ubiquitin protein ligase E3A 973 124 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23383.[MT7]-ITVLYSLVQGQQLNPYLR.3y4_1.heavy 750.431 / 548.319 3484.0 46.287925720214844 41 14 10 7 10 1.4134022148984386 40.697698727418654 0.0287017822265625 3 0.946982844838768 5.336008067538115 3484.0 28.36030255839822 0.0 - - - - - - - 145.16666666666666 6 24 UBE3A ubiquitin protein ligase E3A 975 124 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23383.[MT7]-ITVLYSLVQGQQLNPYLR.3y9_1.heavy 750.431 / 1088.58 1703.0 46.287925720214844 41 14 10 7 10 1.4134022148984386 40.697698727418654 0.0287017822265625 3 0.946982844838768 5.336008067538115 1703.0 50.21525806451613 0.0 - - - - - - - 88.57142857142857 3 14 UBE3A ubiquitin protein ligase E3A 977 125 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543332.[MT7]-EFSFTLK[MT7].2y4_1.heavy 580.334 / 652.415 5624.0 36.277801513671875 34 18 0 10 6 4.579048932523681 21.838596065162893 0.0 5 0.9868607163502469 10.75473836167222 5624.0 14.097095303223302 0.0 - - - - - - - 681.7142857142857 11 7 PRIM1 primase, DNA, polypeptide 1 (49kDa) 979 125 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543332.[MT7]-EFSFTLK[MT7].2y5_1.heavy 580.334 / 739.447 7839.0 36.277801513671875 34 18 0 10 6 4.579048932523681 21.838596065162893 0.0 5 0.9868607163502469 10.75473836167222 7839.0 11.789187014973184 0.0 - - - - - - - 674.4166666666666 15 12 PRIM1 primase, DNA, polypeptide 1 (49kDa) 981 125 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543332.[MT7]-EFSFTLK[MT7].2y3_1.heavy 580.334 / 505.347 6391.0 36.277801513671875 34 18 0 10 6 4.579048932523681 21.838596065162893 0.0 5 0.9868607163502469 10.75473836167222 6391.0 16.919158916751073 2.0 - - - - - - - 773.0 257 14 PRIM1 primase, DNA, polypeptide 1 (49kDa) 983 125 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543332.[MT7]-EFSFTLK[MT7].2y6_1.heavy 580.334 / 886.516 10055.0 36.277801513671875 34 18 0 10 6 4.579048932523681 21.838596065162893 0.0 5 0.9868607163502469 10.75473836167222 10055.0 26.9784462398394 0.0 - - - - - - - 183.46153846153845 20 13 PRIM1 primase, DNA, polypeptide 1 (49kDa) 985 126 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38251.[MT7]-FWQAHSGIC[CAM]TR.2y9_1.heavy 753.873 / 1029.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 987 126 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38251.[MT7]-FWQAHSGIC[CAM]TR.2y6_1.heavy 753.873 / 693.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 989 126 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38251.[MT7]-FWQAHSGIC[CAM]TR.2y10_1.heavy 753.873 / 1215.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 991 126 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38251.[MT7]-FWQAHSGIC[CAM]TR.2y7_1.heavy 753.873 / 830.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 993 127 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542470.[MT7]-IAVSIVK[MT7].2y4_1.heavy 509.349 / 590.399 27131.0 30.802499771118164 50 20 10 10 10 6.432943257835969 15.544983997517775 0.0 3 0.9907077905010441 12.792811561419283 27131.0 54.7823773829426 0.0 - - - - - - - 720.0909090909091 54 11 MAP2K6 mitogen-activated protein kinase kinase 6 995 127 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542470.[MT7]-IAVSIVK[MT7].2y5_1.heavy 509.349 / 689.468 8451.0 30.802499771118164 50 20 10 10 10 6.432943257835969 15.544983997517775 0.0 3 0.9907077905010441 12.792811561419283 8451.0 8.812077461996035 0.0 - - - - - - - 667.5 16 14 MAP2K6 mitogen-activated protein kinase kinase 6 997 127 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542470.[MT7]-IAVSIVK[MT7].2y3_1.heavy 509.349 / 503.367 8095.0 30.802499771118164 50 20 10 10 10 6.432943257835969 15.544983997517775 0.0 3 0.9907077905010441 12.792811561419283 8095.0 3.164292245280021 4.0 - - - - - - - 1156.0 16 1 MAP2K6 mitogen-activated protein kinase kinase 6 999 127 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542470.[MT7]-IAVSIVK[MT7].2y6_1.heavy 509.349 / 760.505 31757.0 30.802499771118164 50 20 10 10 10 6.432943257835969 15.544983997517775 0.0 3 0.9907077905010441 12.792811561419283 31757.0 69.75509339163673 0.0 - - - - - - - 311.5 63 8 MAP2K6 mitogen-activated protein kinase kinase 6 1001 128 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543634.[MT7]-IGNVEISQVTIVGIIR.3y7_1.heavy 619.043 / 771.509 8790.0 42.82862567901611 46 20 10 6 10 5.534763784976168 18.06761839980323 0.037502288818359375 3 0.9909241152766745 12.944606980594852 8790.0 13.585863274728702 0.0 - - - - - - - 266.2857142857143 17 14 RPA2 replication protein A2, 32kDa 1003 128 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543634.[MT7]-IGNVEISQVTIVGIIR.3b4_1.heavy 619.043 / 528.326 5174.0 42.82862567901611 46 20 10 6 10 5.534763784976168 18.06761839980323 0.037502288818359375 3 0.9909241152766745 12.944606980594852 5174.0 19.204976681042844 0.0 - - - - - - - 244.8 10 15 RPA2 replication protein A2, 32kDa 1005 128 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543634.[MT7]-IGNVEISQVTIVGIIR.3b5_1.heavy 619.043 / 657.369 11460.0 42.82862567901611 46 20 10 6 10 5.534763784976168 18.06761839980323 0.037502288818359375 3 0.9909241152766745 12.944606980594852 11460.0 25.10428128085767 0.0 - - - - - - - 194.71428571428572 22 14 RPA2 replication protein A2, 32kDa 1007 128 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543634.[MT7]-IGNVEISQVTIVGIIR.3y5_1.heavy 619.043 / 557.377 8122.0 42.82862567901611 46 20 10 6 10 5.534763784976168 18.06761839980323 0.037502288818359375 3 0.9909241152766745 12.944606980594852 8122.0 21.926314283404736 0.0 - - - - - - - 639.75 16 8 RPA2 replication protein A2, 32kDa 1009 129 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23196.[MT7]-SYIQSLPQTPRK[MT7].3y6_1.heavy 569.333 / 870.528 19958.0 26.742700576782227 44 14 10 10 10 2.645591595090858 37.79872909543534 0.0 3 0.9349418952019549 4.812032333094431 19958.0 97.82586273826848 0.0 - - - - - - - 195.08333333333334 39 12 MAPK13 mitogen-activated protein kinase 13 1011 129 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23196.[MT7]-SYIQSLPQTPRK[MT7].3b4_1.heavy 569.333 / 636.347 8267.0 26.742700576782227 44 14 10 10 10 2.645591595090858 37.79872909543534 0.0 3 0.9349418952019549 4.812032333094431 8267.0 12.090154306771073 0.0 - - - - - - - 704.0 16 7 MAPK13 mitogen-activated protein kinase 13 1013 129 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23196.[MT7]-SYIQSLPQTPRK[MT7].3b3_1.heavy 569.333 / 508.289 10271.0 26.742700576782227 44 14 10 10 10 2.645591595090858 37.79872909543534 0.0 3 0.9349418952019549 4.812032333094431 10271.0 17.717357768395157 0.0 - - - - - - - 713.7272727272727 20 11 MAPK13 mitogen-activated protein kinase 13 1015 129 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23196.[MT7]-SYIQSLPQTPRK[MT7].3y8_1.heavy 569.333 / 1070.64 3173.0 26.742700576782227 44 14 10 10 10 2.645591595090858 37.79872909543534 0.0 3 0.9349418952019549 4.812032333094431 3173.0 73.65892857142858 0.0 - - - - - - - 100.6 6 5 MAPK13 mitogen-activated protein kinase 13 1017 130 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23431.[MT7]-NFYDFYLVMPFMQTDLQK[MT7].3b6_1.heavy 863.432 / 994.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK13 mitogen-activated protein kinase 13 1019 130 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23431.[MT7]-NFYDFYLVMPFMQTDLQK[MT7].3b4_1.heavy 863.432 / 684.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK13 mitogen-activated protein kinase 13 1021 130 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23431.[MT7]-NFYDFYLVMPFMQTDLQK[MT7].3b5_1.heavy 863.432 / 831.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK13 mitogen-activated protein kinase 13 1023 130 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23431.[MT7]-NFYDFYLVMPFMQTDLQK[MT7].3b3_1.heavy 863.432 / 569.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK13 mitogen-activated protein kinase 13 1025 131 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37743.[MT7]-VMLVK[MT7].2b3_1.heavy 439.293 / 488.302 831.0 28.26140022277832 33 12 10 10 1 1.7556276347345159 56.959686679300816 0.0 18 0.883348093029717 3.5776789777969227 831.0 1.9461922556536306 18.0 - - - - - - - 703.3076923076923 6 13 GCK;PRKACA;PRKACB glucokinase (hexokinase 4);protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 1027 131 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37743.[MT7]-VMLVK[MT7].2y4_1.heavy 439.293 / 634.408 9724.0 28.26140022277832 33 12 10 10 1 1.7556276347345159 56.959686679300816 0.0 18 0.883348093029717 3.5776789777969227 9724.0 20.13001266843257 0.0 - - - - - - - 356.14285714285717 19 14 GCK;PRKACA;PRKACB glucokinase (hexokinase 4);protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 1029 131 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37743.[MT7]-VMLVK[MT7].2y3_1.heavy 439.293 / 503.367 914.0 28.26140022277832 33 12 10 10 1 1.7556276347345159 56.959686679300816 0.0 18 0.883348093029717 3.5776789777969227 914.0 0.7925563909774436 26.0 - - - - - - - 854.7142857142857 4 7 GCK;PRKACA;PRKACB glucokinase (hexokinase 4);protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 1031 132 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37948.[MT7]-GQLQAAESR.2y6_1.heavy 552.3 / 661.326 1809.0 17.873250007629395 44 18 10 6 10 5.652048377953916 14.083577537158014 0.03130149841308594 3 0.9851929920721431 10.129578424006164 1809.0 28.286181818181817 0.0 - - - - - - - 133.6875 3 16 TSC1 tuberous sclerosis 1 1033 132 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37948.[MT7]-GQLQAAESR.2b5_1.heavy 552.3 / 642.369 767.0 17.873250007629395 44 18 10 6 10 5.652048377953916 14.083577537158014 0.03130149841308594 3 0.9851929920721431 10.129578424006164 767.0 5.61219512195122 0.0 - - - - - - - 0.0 1 0 TSC1 tuberous sclerosis 1 1035 132 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37948.[MT7]-GQLQAAESR.2b4_1.heavy 552.3 / 571.332 1425.0 17.873250007629395 44 18 10 6 10 5.652048377953916 14.083577537158014 0.03130149841308594 3 0.9851929920721431 10.129578424006164 1425.0 23.318181818181817 0.0 - - - - - - - 131.0 2 18 TSC1 tuberous sclerosis 1 1037 132 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37948.[MT7]-GQLQAAESR.2y7_1.heavy 552.3 / 774.41 1151.0 17.873250007629395 44 18 10 6 10 5.652048377953916 14.083577537158014 0.03130149841308594 3 0.9851929920721431 10.129578424006164 1151.0 23.268830376940134 0.0 - - - - - - - 128.0 2 12 TSC1 tuberous sclerosis 1 1039 133 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37747.[MT7]-SFEEAR.2y5_1.heavy 441.726 / 651.31 13170.0 19.31209945678711 44 20 10 6 8 6.505112111561952 15.37252522093564 0.03929901123046875 4 0.9906604501807617 12.76029775064649 13170.0 27.82129451947331 0.0 - - - - - - - 225.75 26 16 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1041 133 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37747.[MT7]-SFEEAR.2b4_1.heavy 441.726 / 637.295 25339.0 19.31209945678711 44 20 10 6 8 6.505112111561952 15.37252522093564 0.03929901123046875 4 0.9906604501807617 12.76029775064649 25339.0 84.85728162638428 0.0 - - - - - - - 192.73333333333332 50 15 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1043 133 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37747.[MT7]-SFEEAR.2b5_1.heavy 441.726 / 708.332 3668.0 19.31209945678711 44 20 10 6 8 6.505112111561952 15.37252522093564 0.03929901123046875 4 0.9906604501807617 12.76029775064649 3668.0 22.580780780780778 1.0 - - - - - - - 214.1 8 20 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1045 134 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 607141.0 31.38559913635254 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 607141.0 1038.9341779501972 0.0 - - - - - - - 192.33333333333334 1214 12 1047 134 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 603523.0 31.38559913635254 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 603523.0 1231.2764570969262 0.0 - - - - - - - 250.11764705882354 1207 17 1049 134 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1093350.0 31.38559913635254 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1093350.0 830.3908322940412 0.0 - - - - - - - 314.1 2186 10 1051 135 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23044.[MT7]-SQWC[CAM]PLPIFR.2y4_1.heavy 724.385 / 532.324 1714.0 42.8380012512207 50 20 10 10 10 8.19911437485385 12.196439204055192 0.0 3 0.9958241684399382 19.091481870593345 1714.0 5.8322004288096565 0.0 - - - - - - - 212.61111111111111 3 18 BAX BCL2-associated X protein 1053 135 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23044.[MT7]-SQWC[CAM]PLPIFR.2y8_1.heavy 724.385 / 1088.57 1885.0 42.8380012512207 50 20 10 10 10 8.19911437485385 12.196439204055192 0.0 3 0.9958241684399382 19.091481870593345 1885.0 40.896783625731 0.0 - - - - - - - 133.13333333333333 3 15 BAX BCL2-associated X protein 1055 135 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23044.[MT7]-SQWC[CAM]PLPIFR.2y6_1.heavy 724.385 / 742.461 4056.0 42.8380012512207 50 20 10 10 10 8.19911437485385 12.196439204055192 0.0 3 0.9958241684399382 19.091481870593345 4056.0 82.54315789473685 0.0 - - - - - - - 128.25 8 12 BAX BCL2-associated X protein 1057 135 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23044.[MT7]-SQWC[CAM]PLPIFR.2y7_1.heavy 724.385 / 902.492 3599.0 42.8380012512207 50 20 10 10 10 8.19911437485385 12.196439204055192 0.0 3 0.9958241684399382 19.091481870593345 3599.0 21.454616242291852 0.0 - - - - - - - 152.06666666666666 7 15 BAX BCL2-associated X protein 1059 136 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23043.[MT7]-VYATLEAYTK[MT7].3b6_1.heavy 482.941 / 821.453 27551.0 33.65359878540039 50 20 10 10 10 15.39443979075656 6.495851837365594 0.0 3 0.9977388751629531 25.94885700114656 27551.0 92.01192748091603 0.0 - - - - - - - 282.0769230769231 55 13 RXRG retinoid X receptor, gamma 1061 136 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23043.[MT7]-VYATLEAYTK[MT7].3y3_1.heavy 482.941 / 555.326 87995.0 33.65359878540039 50 20 10 10 10 15.39443979075656 6.495851837365594 0.0 3 0.9977388751629531 25.94885700114656 87995.0 127.25644735514678 0.0 - - - - - - - 681.0 175 8 RXRG retinoid X receptor, gamma 1063 136 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23043.[MT7]-VYATLEAYTK[MT7].3b4_1.heavy 482.941 / 579.326 74900.0 33.65359878540039 50 20 10 10 10 15.39443979075656 6.495851837365594 0.0 3 0.9977388751629531 25.94885700114656 74900.0 177.49119385930047 0.0 - - - - - - - 589.375 149 8 RXRG retinoid X receptor, gamma 1065 136 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23043.[MT7]-VYATLEAYTK[MT7].3y4_1.heavy 482.941 / 626.363 56254.0 33.65359878540039 50 20 10 10 10 15.39443979075656 6.495851837365594 0.0 3 0.9977388751629531 25.94885700114656 56254.0 183.02336290263392 0.0 - - - - - - - 694.125 112 8 RXRG retinoid X receptor, gamma 1067 137 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22944.[MT7]-HLHSAGIIHR.3y7_1.heavy 428.918 / 753.437 1548.0 17.403449535369873 44 18 10 6 10 6.284607542688432 15.91189255983707 0.03500175476074219 3 0.9885328373902038 11.513795154732442 1548.0 13.482444529248216 1.0 - - - - - - - 175.58823529411765 3 17 MAPK8;MAPK9;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10 1069 137 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22944.[MT7]-HLHSAGIIHR.3y3_1.heavy 428.918 / 425.262 3316.0 17.403449535369873 44 18 10 6 10 6.284607542688432 15.91189255983707 0.03500175476074219 3 0.9885328373902038 11.513795154732442 3316.0 8.517577671769779 0.0 - - - - - - - 635.7 6 10 MAPK8;MAPK9;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10 1071 137 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22944.[MT7]-HLHSAGIIHR.3y6_1.heavy 428.918 / 666.405 2045.0 17.403449535369873 44 18 10 6 10 6.284607542688432 15.91189255983707 0.03500175476074219 3 0.9885328373902038 11.513795154732442 2045.0 52.640745290745286 0.0 - - - - - - - 122.77777777777777 4 18 MAPK8;MAPK9;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10 1073 137 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22944.[MT7]-HLHSAGIIHR.3y5_1.heavy 428.918 / 595.367 3979.0 17.403449535369873 44 18 10 6 10 6.284607542688432 15.91189255983707 0.03500175476074219 3 0.9885328373902038 11.513795154732442 3979.0 33.55783132530121 0.0 - - - - - - - 171.3 7 20 MAPK8;MAPK9;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10 1075 138 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23011.[MT7]-LFPYSQYYR.2y8_1.heavy 690.857 / 1123.52 11356.0 36.42447376251221 46 20 10 6 10 7.607672144703535 13.144625333206564 0.033100128173828125 3 0.9916343234242472 13.483685218854117 11356.0 48.60205746233887 0.0 - - - - - - - 182.66666666666666 22 12 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1077 138 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23011.[MT7]-LFPYSQYYR.2y5_1.heavy 690.857 / 716.336 2115.0 36.42447376251221 46 20 10 6 10 7.607672144703535 13.144625333206564 0.033100128173828125 3 0.9916343234242472 13.483685218854117 2115.0 27.046300832925038 0.0 - - - - - - - 191.38888888888889 4 18 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1079 138 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23011.[MT7]-LFPYSQYYR.2y6_1.heavy 690.857 / 879.399 2663.0 36.42447376251221 46 20 10 6 10 7.607672144703535 13.144625333206564 0.033100128173828125 3 0.9916343234242472 13.483685218854117 2663.0 4.519324817518248 0.0 - - - - - - - 203.8 5 10 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1081 138 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23011.[MT7]-LFPYSQYYR.2y7_1.heavy 690.857 / 976.452 23730.0 36.42447376251221 46 20 10 6 10 7.607672144703535 13.144625333206564 0.033100128173828125 3 0.9916343234242472 13.483685218854117 23730.0 80.84750186934947 0.0 - - - - - - - 191.44444444444446 47 9 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1083 139 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23013.[MT7]-DVTYLTEEK[MT7].2y4_1.heavy 693.374 / 650.348 2767.0 28.14150047302246 43 13 10 10 10 1.232783102926244 53.69682900915319 0.0 3 0.9065700689497371 4.005701256537898 2767.0 3.481655629139073 0.0 - - - - - - - 754.625 5 8 UBE3A ubiquitin protein ligase E3A 1085 139 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23013.[MT7]-DVTYLTEEK[MT7].2y5_1.heavy 693.374 / 763.432 922.0 28.14150047302246 43 13 10 10 10 1.232783102926244 53.69682900915319 0.0 3 0.9065700689497371 4.005701256537898 922.0 7.128367712240027 1.0 - - - - - - - 0.0 1 0 UBE3A ubiquitin protein ligase E3A 1087 139 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23013.[MT7]-DVTYLTEEK[MT7].2y3_1.heavy 693.374 / 549.3 1090.0 28.14150047302246 43 13 10 10 10 1.232783102926244 53.69682900915319 0.0 3 0.9065700689497371 4.005701256537898 1090.0 3.058507462686567 0.0 - - - - - - - 251.53333333333333 2 15 UBE3A ubiquitin protein ligase E3A 1089 139 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23013.[MT7]-DVTYLTEEK[MT7].2y7_1.heavy 693.374 / 1027.54 N/A 28.14150047302246 43 13 10 10 10 1.232783102926244 53.69682900915319 0.0 3 0.9065700689497371 4.005701256537898 419.0 8.978571428571428 1.0 - - - - - - - 0.0 0 0 UBE3A ubiquitin protein ligase E3A 1091 140 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23113.[MT7]-EIVNFSPIARK[MT7].2y5_1.heavy 781.469 / 728.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK13 mitogen-activated protein kinase 13 1093 140 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23113.[MT7]-EIVNFSPIARK[MT7].2y9_1.heavy 781.469 / 1175.7 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK13 mitogen-activated protein kinase 13 1095 140 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23113.[MT7]-EIVNFSPIARK[MT7].2y6_1.heavy 781.469 / 815.522 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK13 mitogen-activated protein kinase 13 1097 140 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23113.[MT7]-EIVNFSPIARK[MT7].2y7_1.heavy 781.469 / 962.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK13 mitogen-activated protein kinase 13 1099 141 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 323396.0 26.055099487304688 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 323396.0 628.9744792120357 0.0 - - - - - - - 1328.0 646 6 1101 141 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 408019.0 26.055099487304688 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 408019.0 1162.916604987066 0.0 - - - - - - - 1279.0 816 4 1103 141 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 526764.0 26.055099487304688 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 526764.0 864.8549253558366 0.0 - - - - - - - 1761.0 1053 2 1105 142 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38126.[MT7]-TYVENRPK[MT7].2y4_1.heavy 647.872 / 658.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK8 mitogen-activated protein kinase 8 1107 142 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38126.[MT7]-TYVENRPK[MT7].2y5_1.heavy 647.872 / 787.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK8 mitogen-activated protein kinase 8 1109 142 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38126.[MT7]-TYVENRPK[MT7].2y6_1.heavy 647.872 / 886.523 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK8 mitogen-activated protein kinase 8 1111 142 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38126.[MT7]-TYVENRPK[MT7].2y7_1.heavy 647.872 / 1049.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK8 mitogen-activated protein kinase 8 1113 143 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38551.[MT7]-ILMDSPEDADLFHSEEIK[MT7].3y6_1.heavy 793.066 / 886.475 1971.0 37.408498764038086 44 18 10 6 10 5.641746985409536 17.725006147673064 0.03240203857421875 3 0.9805611954521145 8.837339893471356 1971.0 9.927463235294116 0.0 - - - - - - - 188.54545454545453 3 22 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 1115 143 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38551.[MT7]-ILMDSPEDADLFHSEEIK[MT7].3b4_1.heavy 793.066 / 617.345 2922.0 37.408498764038086 44 18 10 6 10 5.641746985409536 17.725006147673064 0.03240203857421875 3 0.9805611954521145 8.837339893471356 2922.0 6.892512221079784 0.0 - - - - - - - 708.5714285714286 5 7 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 1117 143 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38551.[MT7]-ILMDSPEDADLFHSEEIK[MT7].3b7_1.heavy 793.066 / 930.472 544.0 37.408498764038086 44 18 10 6 10 5.641746985409536 17.725006147673064 0.03240203857421875 3 0.9805611954521145 8.837339893471356 544.0 0.2666666666666666 11.0 - - - - - - - 0.0 1 0 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 1119 143 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38551.[MT7]-ILMDSPEDADLFHSEEIK[MT7].3y5_1.heavy 793.066 / 749.416 2650.0 37.408498764038086 44 18 10 6 10 5.641746985409536 17.725006147673064 0.03240203857421875 3 0.9805611954521145 8.837339893471356 2650.0 4.611780455153949 0.0 - - - - - - - 239.78947368421052 5 19 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 1121 144 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23112.[MT7]-EGRLEEEVALK[MT7].3y3_1.heavy 520.966 / 475.336 14414.0 27.524150848388672 38 13 10 5 10 1.016326250283567 63.106093232722 0.041500091552734375 3 0.920326294957186 4.3428847777145245 14414.0 16.93899110277569 0.0 - - - - - - - 1149.6 28 10 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1123 144 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23112.[MT7]-EGRLEEEVALK[MT7].3b6_1.heavy 520.966 / 858.444 916.0 27.524150848388672 38 13 10 5 10 1.016326250283567 63.106093232722 0.041500091552734375 3 0.920326294957186 4.3428847777145245 916.0 3.3185057057057055 0.0 - - - - - - - 0.0 1 0 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1125 144 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23112.[MT7]-EGRLEEEVALK[MT7].3y4_1.heavy 520.966 / 574.404 5915.0 27.524150848388672 38 13 10 5 10 1.016326250283567 63.106093232722 0.041500091552734375 3 0.920326294957186 4.3428847777145245 5915.0 7.793126145262601 0.0 - - - - - - - 657.3333333333334 11 9 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1127 144 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23112.[MT7]-EGRLEEEVALK[MT7].3b7_1.heavy 520.966 / 987.486 3833.0 27.524150848388672 38 13 10 5 10 1.016326250283567 63.106093232722 0.041500091552734375 3 0.920326294957186 4.3428847777145245 3833.0 72.04192771084337 0.0 - - - - - - - 83.0 7 6 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1129 145 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22802.[MT7]-TAWELPK[MT7].2b3_1.heavy 566.834 / 503.273 6252.0 32.26882457733154 38 15 10 5 8 3.2874803612167125 30.41843266342419 0.041301727294921875 4 0.9531251978190695 5.677817381546553 6252.0 11.203069833392416 1.0 - - - - - - - 855.75 23 8 MAPK13 mitogen-activated protein kinase 13 1131 145 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22802.[MT7]-TAWELPK[MT7].2b4_1.heavy 566.834 / 632.316 11412.0 32.26882457733154 38 15 10 5 8 3.2874803612167125 30.41843266342419 0.041301727294921875 4 0.9531251978190695 5.677817381546553 11412.0 18.935905456738745 0.0 - - - - - - - 773.8 22 10 MAPK13 mitogen-activated protein kinase 13 1133 145 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22802.[MT7]-TAWELPK[MT7].2y3_1.heavy 566.834 / 501.352 8931.0 32.26882457733154 38 15 10 5 8 3.2874803612167125 30.41843266342419 0.041301727294921875 4 0.9531251978190695 5.677817381546553 8931.0 16.524856158027312 1.0 - - - - - - - 756.75 17 8 MAPK13 mitogen-activated protein kinase 13 1135 145 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22802.[MT7]-TAWELPK[MT7].2y6_1.heavy 566.834 / 887.511 5061.0 32.26882457733154 38 15 10 5 8 3.2874803612167125 30.41843266342419 0.041301727294921875 4 0.9531251978190695 5.677817381546553 5061.0 7.471604041696379 1.0 - - - - - - - 229.25 10 16 MAPK13 mitogen-activated protein kinase 13 1137 146 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22800.[MT7]-K[MT7]LQPTVR.2y4_1.heavy 565.368 / 472.288 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK8;MAPK9;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10 1139 146 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22800.[MT7]-K[MT7]LQPTVR.2b3_1.heavy 565.368 / 658.449 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK8;MAPK9;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10 1141 146 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22800.[MT7]-K[MT7]LQPTVR.2y5_1.heavy 565.368 / 600.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK8;MAPK9;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10 1143 146 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22800.[MT7]-K[MT7]LQPTVR.2y6_1.heavy 565.368 / 713.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK8;MAPK9;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;mitogen-activated protein kinase 10 1145 147 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544381.[MT7]-ASPQAADLLEK[MT7].2y4_1.heavy 715.908 / 646.426 1829.0 29.581850051879883 30 17 2 3 8 4.5824406282192145 21.82243221749303 0.07080078125 4 0.9785615981986601 8.413703770924837 1829.0 2.196996996996997 2.0 - - - - - - - 254.8 16 15 MAPK13 mitogen-activated protein kinase 13 1147 147 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544381.[MT7]-ASPQAADLLEK[MT7].2y9_1.heavy 715.908 / 1128.64 2993.0 29.581850051879883 30 17 2 3 8 4.5824406282192145 21.82243221749303 0.07080078125 4 0.9785615981986601 8.413703770924837 2993.0 35.77175903614458 1.0 - - - - - - - 201.85714285714286 5 7 MAPK13 mitogen-activated protein kinase 13 1149 147 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544381.[MT7]-ASPQAADLLEK[MT7].2y3_1.heavy 715.908 / 533.341 1330.0 29.581850051879883 30 17 2 3 8 4.5824406282192145 21.82243221749303 0.07080078125 4 0.9785615981986601 8.413703770924837 1330.0 6.264425964425964 0.0 - - - - - - - 215.1764705882353 2 17 MAPK13 mitogen-activated protein kinase 13 1151 147 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544381.[MT7]-ASPQAADLLEK[MT7].2b7_1.heavy 715.908 / 785.391 1413.0 29.581850051879883 30 17 2 3 8 4.5824406282192145 21.82243221749303 0.07080078125 4 0.9785615981986601 8.413703770924837 1413.0 13.477409638554217 0.0 - - - - - - - 185.30769230769232 2 13 MAPK13 mitogen-activated protein kinase 13 1153 148 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543371.[MT7]-EVMDLEER.2y4_1.heavy 582.788 / 546.288 2584.0 28.17067575454712 46 20 10 6 10 8.43006538272179 11.862304200505893 0.03890037536621094 3 0.9911970281248913 13.144031977636448 2584.0 3.497458302583026 0.0 - - - - - - - 593.875 5 8 MAPK8 mitogen-activated protein kinase 8 1155 148 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543371.[MT7]-EVMDLEER.2b4_1.heavy 582.788 / 619.288 3251.0 28.17067575454712 46 20 10 6 10 8.43006538272179 11.862304200505893 0.03890037536621094 3 0.9911970281248913 13.144031977636448 3251.0 20.685341741741745 0.0 - - - - - - - 289.29411764705884 6 17 MAPK8 mitogen-activated protein kinase 8 1157 148 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543371.[MT7]-EVMDLEER.2y6_1.heavy 582.788 / 792.356 750.0 28.17067575454712 46 20 10 6 10 8.43006538272179 11.862304200505893 0.03890037536621094 3 0.9911970281248913 13.144031977636448 750.0 0.7871064467766117 8.0 - - - - - - - 201.0 2 17 MAPK8 mitogen-activated protein kinase 8 1159 148 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543371.[MT7]-EVMDLEER.2y7_1.heavy 582.788 / 891.424 2084.0 28.17067575454712 46 20 10 6 10 8.43006538272179 11.862304200505893 0.03890037536621094 3 0.9911970281248913 13.144031977636448 2084.0 4.718490566037736 0.0 - - - - - - - 145.83333333333334 4 12 MAPK8 mitogen-activated protein kinase 8 1161 149 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544384.[MT7]-SYIQSLPQTPR.3b4_1.heavy 478.6 / 636.347 15120.0 29.27589988708496 50 20 10 10 10 9.796225562386784 10.208013215207723 0.0 3 0.9923479363037083 14.099241672931264 15120.0 25.552709511766636 0.0 - - - - - - - 713.4166666666666 30 12 MAPK13 mitogen-activated protein kinase 13 1163 149 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544384.[MT7]-SYIQSLPQTPR.3y4_1.heavy 478.6 / 501.278 13043.0 29.27589988708496 50 20 10 10 10 9.796225562386784 10.208013215207723 0.0 3 0.9923479363037083 14.099241672931264 13043.0 12.967691874383892 1.0 - - - - - - - 1210.4285714285713 27 7 MAPK13 mitogen-activated protein kinase 13 1165 149 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544384.[MT7]-SYIQSLPQTPR.3b3_1.heavy 478.6 / 508.289 35225.0 29.27589988708496 50 20 10 10 10 9.796225562386784 10.208013215207723 0.0 3 0.9923479363037083 14.099241672931264 35225.0 38.204340443595456 0.0 - - - - - - - 320.14285714285717 70 7 MAPK13 mitogen-activated protein kinase 13 1167 149 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544384.[MT7]-SYIQSLPQTPR.3y5_1.heavy 478.6 / 598.331 110245.0 29.27589988708496 50 20 10 10 10 9.796225562386784 10.208013215207723 0.0 3 0.9923479363037083 14.099241672931264 110245.0 130.7388801803641 0.0 - - - - - - - 831.0 220 8 MAPK13 mitogen-activated protein kinase 13 1169 150 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544388.[MT7]-EENEAESDVK[MT7].3b4_1.heavy 479.903 / 646.28 21289.0 17.76059913635254 47 17 10 10 10 9.2783695548443 10.777755661584887 0.0 3 0.9742445564944413 7.673461172876403 21289.0 31.466488785166455 0.0 - - - - - - - 767.6666666666666 42 9 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1171 150 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544388.[MT7]-EENEAESDVK[MT7].3b5_1.heavy 479.903 / 717.317 9682.0 17.76059913635254 47 17 10 10 10 9.2783695548443 10.777755661584887 0.0 3 0.9742445564944413 7.673461172876403 9682.0 37.40286975717439 0.0 - - - - - - - 283.0625 19 16 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1173 150 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544388.[MT7]-EENEAESDVK[MT7].3y4_1.heavy 479.903 / 592.342 10135.0 17.76059913635254 47 17 10 10 10 9.2783695548443 10.777755661584887 0.0 3 0.9742445564944413 7.673461172876403 10135.0 22.684906092414018 0.0 - - - - - - - 727.3076923076923 20 13 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1175 150 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544388.[MT7]-EENEAESDVK[MT7].3b3_1.heavy 479.903 / 517.237 8040.0 17.76059913635254 47 17 10 10 10 9.2783695548443 10.777755661584887 0.0 3 0.9742445564944413 7.673461172876403 8040.0 11.307750516510692 1.0 - - - - - - - 1174.875 16 8 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1177 151 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23024.[MT7]-YLFLGDYVDR.2b3_1.heavy 702.868 / 568.325 4959.0 41.317376136779785 42 16 10 6 10 1.7660041840715184 40.69987804819837 0.035099029541015625 3 0.9635431790382382 6.443838500984293 4959.0 48.82116279069768 0.0 - - - - - - - 152.9375 9 16 PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 1179 151 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23024.[MT7]-YLFLGDYVDR.2y4_1.heavy 702.868 / 552.278 5410.0 41.317376136779785 42 16 10 6 10 1.7660041840715184 40.69987804819837 0.035099029541015625 3 0.9635431790382382 6.443838500984293 5410.0 30.819698052528143 1.0 - - - - - - - 198.15384615384616 10 13 PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 1181 151 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23024.[MT7]-YLFLGDYVDR.2y8_1.heavy 702.868 / 984.479 3864.0 41.317376136779785 42 16 10 6 10 1.7660041840715184 40.69987804819837 0.035099029541015625 3 0.9635431790382382 6.443838500984293 3864.0 45.57586215206652 0.0 - - - - - - - 156.28571428571428 7 7 PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 1183 151 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23024.[MT7]-YLFLGDYVDR.2y9_1.heavy 702.868 / 1097.56 3284.0 41.317376136779785 42 16 10 6 10 1.7660041840715184 40.69987804819837 0.035099029541015625 3 0.9635431790382382 6.443838500984293 3284.0 39.586861067598505 0.0 - - - - - - - 124.0 6 14 PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 1185 152 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545254.[MT7]-TLRDQLLLLHNQLLYER.4y5_1.heavy 571.333 / 693.393 10100.0 39.370399475097656 42 12 10 10 10 2.0004568221393337 34.61189538344124 0.0 3 0.8806415570340168 3.5360492809577675 10100.0 46.29166666666667 0.0 - - - - - - - 228.52380952380952 20 21 TSC1 tuberous sclerosis 1 1187 152 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545254.[MT7]-TLRDQLLLLHNQLLYER.4y4_1.heavy 571.333 / 580.309 14383.0 39.370399475097656 42 12 10 10 10 2.0004568221393337 34.61189538344124 0.0 3 0.8806415570340168 3.5360492809577675 14383.0 38.33506334253529 0.0 - - - - - - - 252.33333333333334 28 18 TSC1 tuberous sclerosis 1 1189 152 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545254.[MT7]-TLRDQLLLLHNQLLYER.4b8_2.heavy 571.333 / 549.344 18475.0 39.370399475097656 42 12 10 10 10 2.0004568221393337 34.61189538344124 0.0 3 0.8806415570340168 3.5360492809577675 18475.0 32.94468901878018 0.0 - - - - - - - 672.8823529411765 36 17 TSC1 tuberous sclerosis 1 1191 152 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545254.[MT7]-TLRDQLLLLHNQLLYER.4b7_1.heavy 571.333 / 984.596 2237.0 39.370399475097656 42 12 10 10 10 2.0004568221393337 34.61189538344124 0.0 3 0.8806415570340168 3.5360492809577675 2237.0 36.70078125 0.0 - - - - - - - 128.0 4 12 TSC1 tuberous sclerosis 1 1193 153 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23399.[MT7]-RIPHFSDLTLEDQVILLR.4y4_1.heavy 578.083 / 514.371 11456.0 39.69860076904297 35 13 10 6 6 6.523057664268777 15.330233940406199 0.0334014892578125 5 0.9154275676945939 4.213457191692357 11456.0 16.740859598853866 0.0 - - - - - - - 727.5555555555555 22 9 RXRG retinoid X receptor, gamma 1195 153 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23399.[MT7]-RIPHFSDLTLEDQVILLR.4b7_1.heavy 578.083 / 997.534 458.0 39.69860076904297 35 13 10 6 6 6.523057664268777 15.330233940406199 0.0334014892578125 5 0.9154275676945939 4.213457191692357 458.0 2.429632403420084 3.0 - - - - - - - 0.0 0 0 RXRG retinoid X receptor, gamma 1197 153 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23399.[MT7]-RIPHFSDLTLEDQVILLR.4b4_1.heavy 578.083 / 648.406 982.0 39.69860076904297 35 13 10 6 6 6.523057664268777 15.330233940406199 0.0334014892578125 5 0.9154275676945939 4.213457191692357 982.0 1.2547777777777778 9.0 - - - - - - - 869.5714285714286 3 7 RXRG retinoid X receptor, gamma 1199 153 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23399.[MT7]-RIPHFSDLTLEDQVILLR.4y6_1.heavy 578.083 / 741.498 1178.0 39.69860076904297 35 13 10 6 6 6.523057664268777 15.330233940406199 0.0334014892578125 5 0.9154275676945939 4.213457191692357 1178.0 3.596946564885496 2.0 - - - - - - - 224.38095238095238 2 21 RXRG retinoid X receptor, gamma 1201 154 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544739.[MT7]-LSRPFQSEIFAK[MT7].3y3_1.heavy 570.998 / 509.32 47858.0 33.17319869995117 43 13 10 10 10 4.796269341497976 20.84953802214283 0.0 3 0.916092437555078 4.23035950859816 47858.0 73.15747504844833 0.0 - - - - - - - 700.0 95 7 MAPK13 mitogen-activated protein kinase 13 1203 154 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544739.[MT7]-LSRPFQSEIFAK[MT7].3y4_1.heavy 570.998 / 622.404 16891.0 33.17319869995117 43 13 10 10 10 4.796269341497976 20.84953802214283 0.0 3 0.916092437555078 4.23035950859816 16891.0 28.48115309670311 0.0 - - - - - - - 776.1111111111111 33 9 MAPK13 mitogen-activated protein kinase 13 1205 154 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544739.[MT7]-LSRPFQSEIFAK[MT7].3b8_1.heavy 570.998 / 1089.58 4171.0 33.17319869995117 43 13 10 10 10 4.796269341497976 20.84953802214283 0.0 3 0.916092437555078 4.23035950859816 4171.0 77.00307692307693 0.0 - - - - - - - 104.0 8 3 MAPK13 mitogen-activated protein kinase 13 1207 154 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544739.[MT7]-LSRPFQSEIFAK[MT7].3b8_2.heavy 570.998 / 545.294 36076.0 33.17319869995117 43 13 10 10 10 4.796269341497976 20.84953802214283 0.0 3 0.916092437555078 4.23035950859816 36076.0 47.655924993275576 0.0 - - - - - - - 365.0 72 4 MAPK13 mitogen-activated protein kinase 13 1209 155 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22956.[MT7]-ATVNSQEQK[MT7].2y8_1.heavy 646.856 / 1077.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K3;MAP2K6 mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1211 155 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22956.[MT7]-ATVNSQEQK[MT7].2y5_1.heavy 646.856 / 763.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K3;MAP2K6 mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1213 155 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22956.[MT7]-ATVNSQEQK[MT7].2b4_1.heavy 646.856 / 530.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K3;MAP2K6 mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1215 155 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22956.[MT7]-ATVNSQEQK[MT7].2y6_1.heavy 646.856 / 877.45 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K3;MAP2K6 mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1217 156 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23128.[MT7]-IQYLVYQMLK[MT7].3y3_1.heavy 529.645 / 535.339 33405.0 46.635398864746094 45 15 10 10 10 1.9073974064568067 36.99427529066825 0.0 3 0.9579608378760567 5.997938827636608 33405.0 169.11841546492082 0.0 - - - - - - - 192.5 66 20 MAPK13 mitogen-activated protein kinase 13 1219 156 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23128.[MT7]-IQYLVYQMLK[MT7].3b4_1.heavy 529.645 / 662.399 31766.0 46.635398864746094 45 15 10 10 10 1.9073974064568067 36.99427529066825 0.0 3 0.9579608378760567 5.997938827636608 31766.0 261.30131954338685 0.0 - - - - - - - 170.52631578947367 63 19 MAPK13 mitogen-activated protein kinase 13 1221 156 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23128.[MT7]-IQYLVYQMLK[MT7].3b5_1.heavy 529.645 / 761.468 23414.0 46.635398864746094 45 15 10 10 10 1.9073974064568067 36.99427529066825 0.0 3 0.9579608378760567 5.997938827636608 23414.0 618.8342846376083 0.0 - - - - - - - 152.4375 46 16 MAPK13 mitogen-activated protein kinase 13 1223 156 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23128.[MT7]-IQYLVYQMLK[MT7].3b3_1.heavy 529.645 / 549.315 28029.0 46.635398864746094 45 15 10 10 10 1.9073974064568067 36.99427529066825 0.0 3 0.9579608378760567 5.997938827636608 28029.0 255.58715182451544 0.0 - - - - - - - 160.05 56 20 MAPK13 mitogen-activated protein kinase 13 1225 157 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23026.[MT7]-LFEVGGSPSNTR.2b3_1.heavy 704.371 / 534.304 8167.0 31.48889923095703 47 17 10 10 10 6.7243320994327105 14.871365441399952 0.0 3 0.9715717634752459 7.302190402673571 8167.0 29.081942122996708 0.0 - - - - - - - 206.33333333333334 16 9 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1227 157 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23026.[MT7]-LFEVGGSPSNTR.2y8_1.heavy 704.371 / 775.369 9095.0 31.48889923095703 47 17 10 10 10 6.7243320994327105 14.871365441399952 0.0 3 0.9715717634752459 7.302190402673571 9095.0 35.44332119025641 0.0 - - - - - - - 194.0909090909091 18 11 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1229 157 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23026.[MT7]-LFEVGGSPSNTR.2y9_1.heavy 704.371 / 874.438 4455.0 31.48889923095703 47 17 10 10 10 6.7243320994327105 14.871365441399952 0.0 3 0.9715717634752459 7.302190402673571 4455.0 70.41774193548387 0.0 - - - - - - - 213.5 8 10 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1231 157 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23026.[MT7]-LFEVGGSPSNTR.2y11_1.heavy 704.371 / 1150.55 6867.0 31.48889923095703 47 17 10 10 10 6.7243320994327105 14.871365441399952 0.0 3 0.9715717634752459 7.302190402673571 6867.0 7.894285050588479 0.0 - - - - - - - 222.7 13 10 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1233 158 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38454.[MT7]-SALTVQFVQGIFVEK[MT7].2b3_1.heavy 977.566 / 416.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1235 158 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38454.[MT7]-SALTVQFVQGIFVEK[MT7].2b4_1.heavy 977.566 / 517.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1237 158 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38454.[MT7]-SALTVQFVQGIFVEK[MT7].2y6_1.heavy 977.566 / 836.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1239 158 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38454.[MT7]-SALTVQFVQGIFVEK[MT7].2y7_1.heavy 977.566 / 964.558 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1241 159 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23298.[MT7]-SALTVQFVQGIFVEK[MT7].4y4_1.heavy 489.287 / 666.394 33111.0 43.67470169067383 40 10 10 10 10 0.9244461382125452 72.11525248574179 0.0 3 0.8429937326649465 3.072915413332386 33111.0 191.0016842051229 0.0 - - - - - - - 223.89473684210526 66 19 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1243 159 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23298.[MT7]-SALTVQFVQGIFVEK[MT7].4b4_1.heavy 489.287 / 517.31 25425.0 43.67470169067383 40 10 10 10 10 0.9244461382125452 72.11525248574179 0.0 3 0.8429937326649465 3.072915413332386 25425.0 103.78017776825874 0.0 - - - - - - - 304.9230769230769 50 13 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1245 159 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23298.[MT7]-SALTVQFVQGIFVEK[MT7].4y3_1.heavy 489.287 / 519.326 45678.0 43.67470169067383 40 10 10 10 10 0.9244461382125452 72.11525248574179 0.0 3 0.8429937326649465 3.072915413332386 45678.0 180.27433990147784 0.0 - - - - - - - 322.2 91 15 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1247 159 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23298.[MT7]-SALTVQFVQGIFVEK[MT7].4b6_1.heavy 489.287 / 744.437 20253.0 43.67470169067383 40 10 10 10 10 0.9244461382125452 72.11525248574179 0.0 3 0.8429937326649465 3.072915413332386 20253.0 338.00118663348735 0.0 - - - - - - - 155.72222222222223 40 18 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1249 160 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 133417.0 35.86069869995117 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 133417.0 132.21724412050563 0.0 - - - - - - - 294.85714285714283 266 14 1251 160 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 348925.0 35.86069869995117 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 348925.0 248.88277218813323 0.0 - - - - - - - 189.75 697 16 1253 160 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 307964.0 35.86069869995117 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 307964.0 149.84807450298678 0.0 - - - - - - - 231.91666666666666 615 12 1255 161 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23299.[MT7]-SALTVQFVQGIFVEK[MT7].3y6_1.heavy 652.047 / 836.5 22718.0 43.67470169067383 45 15 10 10 10 2.308858842296655 34.14619962945018 0.0 3 0.9511888768844056 5.563145409516512 22718.0 117.07182969506982 0.0 - - - - - - - 229.5 45 16 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1257 161 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23299.[MT7]-SALTVQFVQGIFVEK[MT7].3b6_1.heavy 652.047 / 744.437 48820.0 43.67470169067383 45 15 10 10 10 2.308858842296655 34.14619962945018 0.0 3 0.9511888768844056 5.563145409516512 48820.0 176.1924812030075 0.0 - - - - - - - 235.5625 97 16 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1259 161 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23299.[MT7]-SALTVQFVQGIFVEK[MT7].3b4_1.heavy 652.047 / 517.31 20881.0 43.67470169067383 45 15 10 10 10 2.308858842296655 34.14619962945018 0.0 3 0.9511888768844056 5.563145409516512 20881.0 124.51909936747603 0.0 - - - - - - - 233.55555555555554 41 18 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1261 161 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23299.[MT7]-SALTVQFVQGIFVEK[MT7].3y4_1.heavy 652.047 / 666.394 51672.0 43.67470169067383 45 15 10 10 10 2.308858842296655 34.14619962945018 0.0 3 0.9511888768844056 5.563145409516512 51672.0 175.66751231685276 0.0 - - - - - - - 306.05555555555554 103 18 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1263 162 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545252.[MT7]-YFEEYALVNQDILENK[MT7].3b6_1.heavy 759.394 / 947.427 24646.0 41.238399505615234 43 13 10 10 10 0.9826955964480214 62.11605125209189 0.0 3 0.9185399886201617 4.294345241424464 24646.0 68.07355815606925 0.0 - - - - - - - 256.14285714285717 49 14 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1265 162 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545252.[MT7]-YFEEYALVNQDILENK[MT7].3b4_1.heavy 759.394 / 713.326 15323.0 41.238399505615234 43 13 10 10 10 0.9826955964480214 62.11605125209189 0.0 3 0.9185399886201617 4.294345241424464 15323.0 79.20188829492125 0.0 - - - - - - - 269.46666666666664 30 15 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1267 162 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545252.[MT7]-YFEEYALVNQDILENK[MT7].3b5_1.heavy 759.394 / 876.39 12128.0 41.238399505615234 43 13 10 10 10 0.9826955964480214 62.11605125209189 0.0 3 0.9185399886201617 4.294345241424464 12128.0 51.67473773948939 0.0 - - - - - - - 189.1 24 20 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1269 162 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545252.[MT7]-YFEEYALVNQDILENK[MT7].3y4_1.heavy 759.394 / 647.385 21582.0 41.238399505615234 43 13 10 10 10 0.9826955964480214 62.11605125209189 0.0 3 0.9185399886201617 4.294345241424464 21582.0 43.39061464658605 0.0 - - - - - - - 652.2857142857143 43 7 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1271 163 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23122.[MT7]-LNVDEAFEQLVR.2y8_1.heavy 788.926 / 991.521 3693.0 43.310675621032715 40 14 10 6 10 1.5069045776838008 44.31901028680099 0.036502838134765625 3 0.9426462218019243 5.128418683936511 3693.0 30.061920731707318 0.0 - - - - - - - 197.10526315789474 7 19 RRAS related RAS viral (r-ras) oncogene homolog 1273 163 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23122.[MT7]-LNVDEAFEQLVR.2b4_1.heavy 788.926 / 586.332 5488.0 43.310675621032715 40 14 10 6 10 1.5069045776838008 44.31901028680099 0.036502838134765625 3 0.9426462218019243 5.128418683936511 5488.0 35.174802636048646 0.0 - - - - - - - 169.25 10 20 RRAS related RAS viral (r-ras) oncogene homolog 1275 163 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23122.[MT7]-LNVDEAFEQLVR.2y9_1.heavy 788.926 / 1106.55 4514.0 43.310675621032715 40 14 10 6 10 1.5069045776838008 44.31901028680099 0.036502838134765625 3 0.9426462218019243 5.128418683936511 4514.0 60.14105991001658 0.0 - - - - - - - 150.94117647058823 9 17 RRAS related RAS viral (r-ras) oncogene homolog 1277 163 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23122.[MT7]-LNVDEAFEQLVR.2b6_1.heavy 788.926 / 786.411 2359.0 43.310675621032715 40 14 10 6 10 1.5069045776838008 44.31901028680099 0.036502838134765625 3 0.9426462218019243 5.128418683936511 2359.0 45.65697274031564 0.0 - - - - - - - 170.88888888888889 4 18 RRAS related RAS viral (r-ras) oncogene homolog 1279 164 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22950.[MT7]-EIVNFSPIAR.2y8_1.heavy 645.37 / 903.505 8322.0 34.923301696777344 50 20 10 10 10 7.014258559317427 14.25667433761256 0.0 3 0.9925534192803747 14.292692479481328 8322.0 26.3389898989899 0.0 - - - - - - - 227.7 16 10 MAPK13 mitogen-activated protein kinase 13 1281 164 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22950.[MT7]-EIVNFSPIAR.2b4_1.heavy 645.37 / 600.347 5845.0 34.923301696777344 50 20 10 10 10 7.014258559317427 14.25667433761256 0.0 3 0.9925534192803747 14.292692479481328 5845.0 16.877048292725526 0.0 - - - - - - - 376.2 11 10 MAPK13 mitogen-activated protein kinase 13 1283 164 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22950.[MT7]-EIVNFSPIAR.2y9_1.heavy 645.37 / 1016.59 8719.0 34.923301696777344 50 20 10 10 10 7.014258559317427 14.25667433761256 0.0 3 0.9925534192803747 14.292692479481328 8719.0 70.8969191919192 0.0 - - - - - - - 234.0 17 11 MAPK13 mitogen-activated protein kinase 13 1285 164 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22950.[MT7]-EIVNFSPIAR.2y7_1.heavy 645.37 / 804.436 8719.0 34.923301696777344 50 20 10 10 10 7.014258559317427 14.25667433761256 0.0 3 0.9925534192803747 14.292692479481328 8719.0 44.620911130143966 0.0 - - - - - - - 270.6 17 15 MAPK13 mitogen-activated protein kinase 13 1287 165 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23121.[MT7]-TGALLLQGFIQDR.2y8_1.heavy 788.452 / 976.521 9568.0 42.76300048828125 44 14 10 10 10 2.3565175023940808 33.758390722622245 0.0 3 0.9489457748279442 5.438526750141862 9568.0 87.4693180545384 0.0 - - - - - - - 163.5 19 16 BAX BCL2-associated X protein 1289 165 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23121.[MT7]-TGALLLQGFIQDR.2y9_1.heavy 788.452 / 1089.61 6397.0 42.76300048828125 44 14 10 10 10 2.3565175023940808 33.758390722622245 0.0 3 0.9489457748279442 5.438526750141862 6397.0 70.25415439391487 0.0 - - - - - - - 122.6 12 15 BAX BCL2-associated X protein 1291 165 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23121.[MT7]-TGALLLQGFIQDR.2b5_1.heavy 788.452 / 600.384 12294.0 42.76300048828125 44 14 10 10 10 2.3565175023940808 33.758390722622245 0.0 3 0.9489457748279442 5.438526750141862 12294.0 145.45788450320822 0.0 - - - - - - - 222.64705882352942 24 17 BAX BCL2-associated X protein 1293 165 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23121.[MT7]-TGALLLQGFIQDR.2y7_1.heavy 788.452 / 863.437 7899.0 42.76300048828125 44 14 10 10 10 2.3565175023940808 33.758390722622245 0.0 3 0.9489457748279442 5.438526750141862 7899.0 62.45902942316805 0.0 - - - - - - - 196.6 15 15 BAX BCL2-associated X protein 1295 166 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544635.[MT7]-SSDVVYNAFSLRV.3y6_1.heavy 534.287 / 692.409 26527.0 40.46849822998047 47 17 10 10 10 3.6802385268018014 27.17215182432807 0.0 3 0.9704448182243135 7.160940599305085 26527.0 58.99168716846893 0.0 - - - - - - - 275.1818181818182 53 11 BAX BCL2-associated X protein 1297 166 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544635.[MT7]-SSDVVYNAFSLRV.3b4_1.heavy 534.287 / 533.269 87612.0 40.46849822998047 47 17 10 10 10 3.6802385268018014 27.17215182432807 0.0 3 0.9704448182243135 7.160940599305085 87612.0 65.98721584915612 0.0 - - - - - - - 404.42857142857144 175 7 BAX BCL2-associated X protein 1299 166 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544635.[MT7]-SSDVVYNAFSLRV.3b5_1.heavy 534.287 / 632.337 77606.0 40.46849822998047 47 17 10 10 10 3.6802385268018014 27.17215182432807 0.0 3 0.9704448182243135 7.160940599305085 77606.0 76.4586980968807 0.0 - - - - - - - 724.0 155 7 BAX BCL2-associated X protein 1301 166 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544635.[MT7]-SSDVVYNAFSLRV.3y5_1.heavy 534.287 / 621.372 46208.0 40.46849822998047 47 17 10 10 10 3.6802385268018014 27.17215182432807 0.0 3 0.9704448182243135 7.160940599305085 46208.0 113.7936033620752 0.0 - - - - - - - 239.36363636363637 92 11 BAX BCL2-associated X protein 1303 167 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23421.[MT7]-ILALVPETIHDELQQSFQK[MT7].3b4_1.heavy 833.135 / 555.399 8058.0 45.973201751708984 45 15 10 10 10 3.2801231474352837 30.486660257920388 0.0 3 0.9598008181587854 6.134625610133802 8058.0 14.433136532954373 0.0 - - - - - - - 252.93333333333334 16 15 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1305 167 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23421.[MT7]-ILALVPETIHDELQQSFQK[MT7].3b5_1.heavy 833.135 / 654.467 7823.0 45.973201751708984 45 15 10 10 10 3.2801231474352837 30.486660257920388 0.0 3 0.9598008181587854 6.134625610133802 7823.0 27.756894580884286 0.0 - - - - - - - 243.7058823529412 15 17 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1307 167 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23421.[MT7]-ILALVPETIHDELQQSFQK[MT7].3y4_1.heavy 833.135 / 653.374 2503.0 45.973201751708984 45 15 10 10 10 3.2801231474352837 30.486660257920388 0.0 3 0.9598008181587854 6.134625610133802 2503.0 5.544483327201727 1.0 - - - - - - - 205.3 5 20 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1309 167 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23421.[MT7]-ILALVPETIHDELQQSFQK[MT7].3y8_1.heavy 833.135 / 1151.62 1174.0 45.973201751708984 45 15 10 10 10 3.2801231474352837 30.486660257920388 0.0 3 0.9598008181587854 6.134625610133802 1174.0 0.0 0.0 - - - - - - - 141.38095238095238 2 21 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1311 168 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23424.[MT7]-QLLVLGEVNELYLEQLQNK[MT7].3b4_1.heavy 844.482 / 598.404 9932.0 46.1869010925293 45 15 10 10 10 2.280715086810566 43.84589753376148 0.0 3 0.9589188788181958 6.067965798755944 9932.0 47.80600227195971 0.0 - - - - - - - 263.5925925925926 19 27 TSC1 tuberous sclerosis 1 1313 168 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23424.[MT7]-QLLVLGEVNELYLEQLQNK[MT7].3y4_1.heavy 844.482 / 646.4 6467.0 46.1869010925293 45 15 10 10 10 2.280715086810566 43.84589753376148 0.0 3 0.9589188788181958 6.067965798755944 6467.0 34.90710227272727 0.0 - - - - - - - 189.2 12 25 TSC1 tuberous sclerosis 1 1315 168 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23424.[MT7]-QLLVLGEVNELYLEQLQNK[MT7].3b8_1.heavy 844.482 / 996.621 3157.0 46.1869010925293 45 15 10 10 10 2.280715086810566 43.84589753376148 0.0 3 0.9589188788181958 6.067965798755944 3157.0 21.73 0.0 - - - - - - - 162.0 6 28 TSC1 tuberous sclerosis 1 1317 168 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23424.[MT7]-QLLVLGEVNELYLEQLQNK[MT7].3b7_1.heavy 844.482 / 897.553 6852.0 46.1869010925293 45 15 10 10 10 2.280715086810566 43.84589753376148 0.0 3 0.9589188788181958 6.067965798755944 6852.0 28.23854545454546 0.0 - - - - - - - 187.6 13 25 TSC1 tuberous sclerosis 1 1319 169 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22680.[MT7]-TEELLK[MT7].2b3_1.heavy 510.813 / 504.242 4184.0 25.987399578094482 29 17 0 6 6 15.260064296176948 6.553052337076499 0.03800010681152344 6 0.9785896876391822 8.419241040628387 4184.0 2.3683018867924526 5.0 - - - - - - - 1143.3333333333333 30 3 IFT81;TSC1 intraflagellar transport 81 homolog (Chlamydomonas);tuberous sclerosis 1 1321 169 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22680.[MT7]-TEELLK[MT7].2y5_1.heavy 510.813 / 775.468 3263.0 25.987399578094482 29 17 0 6 6 15.260064296176948 6.553052337076499 0.03800010681152344 6 0.9785896876391822 8.419241040628387 3263.0 12.875598086124402 2.0 - - - - - - - 251.0 6 9 IFT81;TSC1 intraflagellar transport 81 homolog (Chlamydomonas);tuberous sclerosis 1 1323 169 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22680.[MT7]-TEELLK[MT7].2b4_1.heavy 510.813 / 617.326 2092.0 25.987399578094482 29 17 0 6 6 15.260064296176948 6.553052337076499 0.03800010681152344 6 0.9785896876391822 8.419241040628387 2092.0 1.6669322709163348 2.0 - - - - - - - 351.2 4 10 IFT81;TSC1 intraflagellar transport 81 homolog (Chlamydomonas);tuberous sclerosis 1 1325 169 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22680.[MT7]-TEELLK[MT7].2y3_1.heavy 510.813 / 517.383 2678.0 25.987399578094482 29 17 0 6 6 15.260064296176948 6.553052337076499 0.03800010681152344 6 0.9785896876391822 8.419241040628387 2678.0 4.535095043775041 2.0 - - - - - - - 778.0 5 10 IFT81;TSC1 intraflagellar transport 81 homolog (Chlamydomonas);tuberous sclerosis 1 1327 170 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22681.[MT7]-ELVLMK[MT7].2y4_1.heavy 510.822 / 634.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK8;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 10 1329 170 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22681.[MT7]-ELVLMK[MT7].2y5_1.heavy 510.822 / 747.492 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK8;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 10 1331 170 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22681.[MT7]-ELVLMK[MT7].2b4_1.heavy 510.822 / 599.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK8;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 10 1333 170 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22681.[MT7]-ELVLMK[MT7].2y3_1.heavy 510.822 / 535.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK8;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 10 1335 171 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38557.[MT7]-RDNNFYSVEIGDSTFTVLK[MT7].3y3_1.heavy 831.767 / 503.367 4553.0 38.61119842529297 41 11 10 10 10 5.485093235768639 18.231230664939964 0.0 3 0.8727634181725629 3.422474182355596 4553.0 5.786771241496382 0.0 - - - - - - - 686.9285714285714 9 14 MAPK8 mitogen-activated protein kinase 8 1337 171 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38557.[MT7]-RDNNFYSVEIGDSTFTVLK[MT7].3b4_1.heavy 831.767 / 644.323 1090.0 38.61119842529297 41 11 10 10 10 5.485093235768639 18.231230664939964 0.0 3 0.8727634181725629 3.422474182355596 1090.0 3.5072122529171312 1.0 - - - - - - - 292.7391304347826 2 23 MAPK8 mitogen-activated protein kinase 8 1339 171 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38557.[MT7]-RDNNFYSVEIGDSTFTVLK[MT7].3b7_2.heavy 831.767 / 521.247 6477.0 38.61119842529297 41 11 10 10 10 5.485093235768639 18.231230664939964 0.0 3 0.8727634181725629 3.422474182355596 6477.0 28.89585885300668 0.0 - - - - - - - 317.36842105263156 12 19 MAPK8 mitogen-activated protein kinase 8 1341 171 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38557.[MT7]-RDNNFYSVEIGDSTFTVLK[MT7].3y9_1.heavy 831.767 / 1111.61 4168.0 38.61119842529297 41 11 10 10 10 5.485093235768639 18.231230664939964 0.0 3 0.8727634181725629 3.422474182355596 4168.0 27.64142386091127 0.0 - - - - - - - 634.7 8 10 MAPK8 mitogen-activated protein kinase 8 1343 172 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38362.[MT7]-ATILC[CAM]TSYVQFK[MT7].2y4_1.heavy 859.973 / 665.41 2350.0 36.407724380493164 40 14 10 6 10 1.6676187957337265 41.56719183390642 0.03389739990234375 3 0.9444775830225348 5.213123239260105 2350.0 8.942477876106196 0.0 - - - - - - - 199.6315789473684 4 19 RPA3 replication protein A3, 14kDa 1345 172 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38362.[MT7]-ATILC[CAM]TSYVQFK[MT7].2y8_1.heavy 859.973 / 1176.58 3344.0 36.407724380493164 40 14 10 6 10 1.6676187957337265 41.56719183390642 0.03389739990234375 3 0.9444775830225348 5.213123239260105 3344.0 4.7589577687136195 0.0 - - - - - - - 171.5 6 10 RPA3 replication protein A3, 14kDa 1347 172 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38362.[MT7]-ATILC[CAM]TSYVQFK[MT7].2y3_1.heavy 859.973 / 566.342 2530.0 36.407724380493164 40 14 10 6 10 1.6676187957337265 41.56719183390642 0.03389739990234375 3 0.9444775830225348 5.213123239260105 2530.0 17.162386087949276 0.0 - - - - - - - 220.1875 5 16 RPA3 replication protein A3, 14kDa 1349 172 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38362.[MT7]-ATILC[CAM]TSYVQFK[MT7].2y6_1.heavy 859.973 / 915.506 2169.0 36.407724380493164 40 14 10 6 10 1.6676187957337265 41.56719183390642 0.03389739990234375 3 0.9444775830225348 5.213123239260105 2169.0 15.98969236101201 0.0 - - - - - - - 180.6 4 15 RPA3 replication protein A3, 14kDa 1351 173 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541793.[MT7]-SDELQR.2y4_1.heavy 446.236 / 545.304 3729.0 16.409799575805664 40 10 10 10 10 1.1430496533451568 60.7240720565631 0.0 3 0.8387864928003326 3.03142348497505 3729.0 17.170856145551916 0.0 - - - - - - - 198.47058823529412 7 17 SP9;SP8;SP5;SP1;SP2;SP3;SP4;SP6 Sp9 transcription factor homolog (mouse);Sp8 transcription factor;Sp5 transcription factor;Sp1 transcription factor;Sp2 transcription factor;Sp3 transcription factor;Sp4 transcription factor;Sp6 transcription factor 1353 173 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541793.[MT7]-SDELQR.2b3_1.heavy 446.236 / 476.211 3729.0 16.409799575805664 40 10 10 10 10 1.1430496533451568 60.7240720565631 0.0 3 0.8387864928003326 3.03142348497505 3729.0 13.141850220264317 0.0 - - - - - - - 661.25 7 8 SP9;SP8;SP5;SP1;SP2;SP3;SP4;SP6 Sp9 transcription factor homolog (mouse);Sp8 transcription factor;Sp5 transcription factor;Sp1 transcription factor;Sp2 transcription factor;Sp3 transcription factor;Sp4 transcription factor;Sp6 transcription factor 1355 173 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541793.[MT7]-SDELQR.2y5_1.heavy 446.236 / 660.331 6904.0 16.409799575805664 40 10 10 10 10 1.1430496533451568 60.7240720565631 0.0 3 0.8387864928003326 3.03142348497505 6904.0 50.658315429276634 0.0 - - - - - - - 179.4375 13 16 SP9;SP8;SP5;SP1;SP2;SP3;SP4;SP6 Sp9 transcription factor homolog (mouse);Sp8 transcription factor;Sp5 transcription factor;Sp1 transcription factor;Sp2 transcription factor;Sp3 transcription factor;Sp4 transcription factor;Sp6 transcription factor 1357 173 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541793.[MT7]-SDELQR.2b4_1.heavy 446.236 / 589.295 4535.0 16.409799575805664 40 10 10 10 10 1.1430496533451568 60.7240720565631 0.0 3 0.8387864928003326 3.03142348497505 4535.0 10.940248328376867 0.0 - - - - - - - 252.05882352941177 9 17 SP9;SP8;SP5;SP1;SP2;SP3;SP4;SP6 Sp9 transcription factor homolog (mouse);Sp8 transcription factor;Sp5 transcription factor;Sp1 transcription factor;Sp2 transcription factor;Sp3 transcription factor;Sp4 transcription factor;Sp6 transcription factor 1359 174 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545199.[MT7]-VFSILRQESESVLTLK[MT7].4y4_1.heavy 535.067 / 618.431 19208.0 43.05400085449219 44 14 10 10 10 2.4998554556674617 40.00231284304396 0.0 3 0.9404884126677283 5.033660426932336 19208.0 78.26967743445692 0.0 - - - - - - - 250.30769230769232 38 13 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1361 174 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545199.[MT7]-VFSILRQESESVLTLK[MT7].4b11_2.heavy 535.067 / 710.881 49994.0 43.05400085449219 44 14 10 10 10 2.4998554556674617 40.00231284304396 0.0 3 0.9404884126677283 5.033660426932336 49994.0 227.76759646507665 0.0 - - - - - - - 217.3846153846154 99 13 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1363 174 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545199.[MT7]-VFSILRQESESVLTLK[MT7].4y3_1.heavy 535.067 / 505.347 51754.0 43.05400085449219 44 14 10 10 10 2.4998554556674617 40.00231284304396 0.0 3 0.9404884126677283 5.033660426932336 51754.0 207.36126896067418 0.0 - - - - - - - 288.06666666666666 103 15 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1365 174 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB545199.[MT7]-VFSILRQESESVLTLK[MT7].4b10_2.heavy 535.067 / 667.365 24383.0 43.05400085449219 44 14 10 10 10 2.4998554556674617 40.00231284304396 0.0 3 0.9404884126677283 5.033660426932336 24383.0 130.59059925093632 0.0 - - - - - - - 201.07692307692307 48 13 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1367 175 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22540.[MT7]-LGAFQAQEK[MT7].3b4_1.heavy 427.246 / 533.32 22229.0 27.297399520874023 47 17 10 10 10 6.056143070853117 16.5121594437354 0.0 3 0.9747826790761932 7.755253579965936 22229.0 57.793807257280314 0.0 - - - - - - - 250.84615384615384 44 13 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1369 175 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22540.[MT7]-LGAFQAQEK[MT7].3b5_1.heavy 427.246 / 661.379 9527.0 27.297399520874023 47 17 10 10 10 6.056143070853117 16.5121594437354 0.0 3 0.9747826790761932 7.755253579965936 9527.0 47.94805734327647 0.0 - - - - - - - 221.0 19 14 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1371 175 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22540.[MT7]-LGAFQAQEK[MT7].3b3_1.heavy 427.246 / 386.252 34012.0 27.297399520874023 47 17 10 10 10 6.056143070853117 16.5121594437354 0.0 3 0.9747826790761932 7.755253579965936 34012.0 58.53298046479858 0.0 - - - - - - - 703.25 68 12 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1373 175 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22540.[MT7]-LGAFQAQEK[MT7].3y4_1.heavy 427.246 / 619.353 8942.0 27.297399520874023 47 17 10 10 10 6.056143070853117 16.5121594437354 0.0 3 0.9747826790761932 7.755253579965936 8942.0 51.40151183049011 0.0 - - - - - - - 200.6 17 10 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1375 176 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22688.[MT7]-ALELYK[MT7].2y4_1.heavy 512.818 / 696.405 3251.0 29.918400287628174 36 16 8 6 6 2.6634789153388003 29.809759051703566 0.03399848937988281 6 0.9644396069859085 6.5250470359012605 3251.0 3.1209599999999997 5.0 - - - - - - - 750.3333333333334 11 9 UBE3A ubiquitin protein ligase E3A 1377 176 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22688.[MT7]-ALELYK[MT7].2y5_1.heavy 512.818 / 809.489 4751.0 29.918400287628174 36 16 8 6 6 2.6634789153388003 29.809759051703566 0.03399848937988281 6 0.9644396069859085 6.5250470359012605 4751.0 34.73353401305497 2.0 - - - - - - - 219.3684210526316 12 19 UBE3A ubiquitin protein ligase E3A 1379 176 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22688.[MT7]-ALELYK[MT7].2b4_1.heavy 512.818 / 571.357 2084.0 29.918400287628174 36 16 8 6 6 2.6634789153388003 29.809759051703566 0.03399848937988281 6 0.9644396069859085 6.5250470359012605 2084.0 2.7188857571214395 1.0 - - - - - - - 722.5833333333334 7 12 UBE3A ubiquitin protein ligase E3A 1381 176 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22688.[MT7]-ALELYK[MT7].2y3_1.heavy 512.818 / 567.362 3918.0 29.918400287628174 36 16 8 6 6 2.6634789153388003 29.809759051703566 0.03399848937988281 6 0.9644396069859085 6.5250470359012605 3918.0 7.703637781109446 0.0 - - - - - - - 639.4444444444445 7 9 UBE3A ubiquitin protein ligase E3A 1383 177 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38040.[MT7]-VISNEFNSR.2y4_1.heavy 605.321 / 523.262 844.0 26.543550491333008 42 20 10 6 6 15.090115898381423 6.6268543378600615 0.03820037841796875 5 0.9967257641411518 21.56198898091451 844.0 1.9976331360946746 15.0 - - - - - - - 0.0 1 0 UBE3A ubiquitin protein ligase E3A 1385 177 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38040.[MT7]-VISNEFNSR.2y8_1.heavy 605.321 / 966.464 3039.0 26.543550491333008 42 20 10 6 6 15.090115898381423 6.6268543378600615 0.03820037841796875 5 0.9967257641411518 21.56198898091451 3039.0 43.971979107848675 0.0 - - - - - - - 138.35714285714286 6 14 UBE3A ubiquitin protein ligase E3A 1387 177 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38040.[MT7]-VISNEFNSR.2y6_1.heavy 605.321 / 766.348 760.0 26.543550491333008 42 20 10 6 6 15.090115898381423 6.6268543378600615 0.03820037841796875 5 0.9967257641411518 21.56198898091451 760.0 2.0911242603550293 3.0 - - - - - - - 186.85714285714286 2 14 UBE3A ubiquitin protein ligase E3A 1389 177 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38040.[MT7]-VISNEFNSR.2y7_1.heavy 605.321 / 853.38 2195.0 26.543550491333008 42 20 10 6 6 15.090115898381423 6.6268543378600615 0.03820037841796875 5 0.9967257641411518 21.56198898091451 2195.0 18.152116612484505 0.0 - - - - - - - 168.72727272727272 4 11 UBE3A ubiquitin protein ligase E3A 1391 178 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23425.[MT7]-QLLVLGEVNELYLEQLQNK[MT7].4y4_1.heavy 633.614 / 646.4 1426.0 46.200151443481445 47 20 10 7 10 8.464316340655259 11.814303243805579 0.026500701904296875 3 0.9950722284877052 17.573512925530082 1426.0 2.2586206896551717 1.0 - - - - - - - 139.6551724137931 2 29 TSC1 tuberous sclerosis 1 1393 178 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23425.[MT7]-QLLVLGEVNELYLEQLQNK[MT7].4b7_1.heavy 633.614 / 897.553 1580.0 46.200151443481445 47 20 10 7 10 8.464316340655259 11.814303243805579 0.026500701904296875 3 0.9950722284877052 17.573512925530082 1580.0 20.656277056277055 0.0 - - - - - - - 96.54545454545455 3 22 TSC1 tuberous sclerosis 1 1395 178 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23425.[MT7]-QLLVLGEVNELYLEQLQNK[MT7].4b4_1.heavy 633.614 / 598.404 5896.0 46.200151443481445 47 20 10 7 10 8.464316340655259 11.814303243805579 0.026500701904296875 3 0.9950722284877052 17.573512925530082 5896.0 24.502857142857145 0.0 - - - - - - - 246.0 11 26 TSC1 tuberous sclerosis 1 1397 178 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23425.[MT7]-QLLVLGEVNELYLEQLQNK[MT7].4y6_1.heavy 633.614 / 903.502 848.0 46.200151443481445 47 20 10 7 10 8.464316340655259 11.814303243805579 0.026500701904296875 3 0.9950722284877052 17.573512925530082 848.0 12.21246180417165 0.0 - - - - - - - 0.0 1 0 TSC1 tuberous sclerosis 1 1399 179 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22969.[MT7]-DK[MT7]EEAAISR.3y6_1.heavy 436.245 / 646.352 2863.0 17.333274364471436 30 14 2 6 8 1.7320457711701598 45.83830507611399 0.03510093688964844 4 0.9482425932894966 5.40113360895103 2863.0 26.178484906018603 0.0 - - - - - - - 141.73684210526315 5 19 TSC1 tuberous sclerosis 1 1401 179 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22969.[MT7]-DK[MT7]EEAAISR.3y4_1.heavy 436.245 / 446.272 2978.0 17.333274364471436 30 14 2 6 8 1.7320457711701598 45.83830507611399 0.03510093688964844 4 0.9482425932894966 5.40113360895103 2978.0 18.43936046511628 0.0 - - - - - - - 223.45 5 20 TSC1 tuberous sclerosis 1 1403 179 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22969.[MT7]-DK[MT7]EEAAISR.3y8_2.heavy 436.245 / 524.299 5211.0 17.333274364471436 30 14 2 6 8 1.7320457711701598 45.83830507611399 0.03510093688964844 4 0.9482425932894966 5.40113360895103 5211.0 23.893231441048034 0.0 - - - - - - - 223.4 10 20 TSC1 tuberous sclerosis 1 1405 179 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22969.[MT7]-DK[MT7]EEAAISR.3y5_1.heavy 436.245 / 517.309 5669.0 17.333274364471436 30 14 2 6 8 1.7320457711701598 45.83830507611399 0.03510093688964844 4 0.9482425932894966 5.40113360895103 5669.0 21.95333816114735 1.0 - - - - - - - 298.5263157894737 25 19 TSC1 tuberous sclerosis 1 1407 180 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37709.[MT7]-NVAIK[MT7].2b3_1.heavy 416.778 / 429.258 3989.0 20.13599967956543 48 20 10 10 8 4.4768206952594385 22.337280585280364 0.0 4 0.9918598508276806 13.669453295716416 3989.0 12.732097433278 1.0 - - - - - - - 301.7142857142857 15 21 MAPK8;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 10 1409 180 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37709.[MT7]-NVAIK[MT7].2y4_1.heavy 416.778 / 574.404 6611.0 20.13599967956543 48 20 10 10 8 4.4768206952594385 22.337280585280364 0.0 4 0.9918598508276806 13.669453295716416 6611.0 19.87598411722844 0.0 - - - - - - - 663.2857142857143 13 7 MAPK8;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 10 1411 180 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37709.[MT7]-NVAIK[MT7].2y3_1.heavy 416.778 / 475.336 10490.0 20.13599967956543 48 20 10 10 8 4.4768206952594385 22.337280585280364 0.0 4 0.9918598508276806 13.669453295716416 10490.0 46.826863463888344 1.0 - - - - - - - 632.1428571428571 20 7 MAPK8;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 10 1413 181 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22963.[MT7]-ISVPIDLQK[MT7].2y4_1.heavy 650.908 / 647.385 1614.0 34.68119812011719 46 20 10 10 6 3.4639179133099764 28.86904438923154 0.0 5 0.9915631111528693 13.426579615955129 1614.0 2.943242145119598 5.0 - - - - - - - 645.4 3 10 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1415 181 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22963.[MT7]-ISVPIDLQK[MT7].2y8_1.heavy 650.908 / 1043.62 2118.0 34.68119812011719 46 20 10 10 6 3.4639179133099764 28.86904438923154 0.0 5 0.9915631111528693 13.426579615955129 2118.0 14.25980198019802 1.0 - - - - - - - 266.27272727272725 4 11 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1417 181 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22963.[MT7]-ISVPIDLQK[MT7].2y3_1.heavy 650.908 / 532.357 3329.0 34.68119812011719 46 20 10 10 6 3.4639179133099764 28.86904438923154 0.0 5 0.9915631111528693 13.426579615955129 3329.0 8.85742349483343 1.0 - - - - - - - 627.4444444444445 10 9 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1419 181 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22963.[MT7]-ISVPIDLQK[MT7].2y6_1.heavy 650.908 / 857.521 10188.0 34.68119812011719 46 20 10 10 6 3.4639179133099764 28.86904438923154 0.0 5 0.9915631111528693 13.426579615955129 10188.0 44.229621995656814 0.0 - - - - - - - 164.125 20 8 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1421 182 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23135.[MT7]-SSDVVYNAFSLRV.2y8_1.heavy 800.926 / 969.515 3655.0 40.46849822998047 47 17 10 10 10 3.7921324424047858 26.370386983790276 0.0 3 0.9710721417531701 7.238551994522536 3655.0 18.1331748970416 0.0 - - - - - - - 177.0 7 15 BAX BCL2-associated X protein 1423 182 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23135.[MT7]-SSDVVYNAFSLRV.2y9_1.heavy 800.926 / 1068.58 2791.0 40.46849822998047 47 17 10 10 10 3.7921324424047858 26.370386983790276 0.0 3 0.9710721417531701 7.238551994522536 2791.0 48.907680565048985 0.0 - - - - - - - 199.1875 5 16 BAX BCL2-associated X protein 1425 182 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23135.[MT7]-SSDVVYNAFSLRV.2b4_1.heavy 800.926 / 533.269 6778.0 40.46849822998047 47 17 10 10 10 3.7921324424047858 26.370386983790276 0.0 3 0.9710721417531701 7.238551994522536 6778.0 14.424674587887576 0.0 - - - - - - - 588.7142857142857 13 7 BAX BCL2-associated X protein 1427 182 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23135.[MT7]-SSDVVYNAFSLRV.2y10_2.heavy 800.926 / 584.33 N/A 40.46849822998047 47 17 10 10 10 3.7921324424047858 26.370386983790276 0.0 3 0.9710721417531701 7.238551994522536 332.0 0.9609364548494983 22.0 - - - - - - - 225.05555555555554 2 18 BAX BCL2-associated X protein 1429 183 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544606.[MT7]-EIVNFSPIARK[MT7].3y6_1.heavy 521.315 / 815.522 6840.0 31.555700302124023 47 17 10 10 10 3.1575399086513904 31.670225204757827 0.0 3 0.9790688072510979 8.515397629987264 6840.0 34.56 0.0 - - - - - - - 237.5 13 16 MAPK13 mitogen-activated protein kinase 13 1431 183 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544606.[MT7]-EIVNFSPIARK[MT7].3b4_1.heavy 521.315 / 600.347 20804.0 31.555700302124023 47 17 10 10 10 3.1575399086513904 31.670225204757827 0.0 3 0.9790688072510979 8.515397629987264 20804.0 63.555611695906435 0.0 - - - - - - - 760.0 41 11 MAPK13 mitogen-activated protein kinase 13 1433 183 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544606.[MT7]-EIVNFSPIARK[MT7].3y8_1.heavy 521.315 / 1076.63 N/A 31.555700302124023 47 17 10 10 10 3.1575399086513904 31.670225204757827 0.0 3 0.9790688072510979 8.515397629987264 0.0 -0.0 0.0 - - - - - - - 0.0 0 0 MAPK13 mitogen-activated protein kinase 13 1435 183 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544606.[MT7]-EIVNFSPIARK[MT7].3y5_1.heavy 521.315 / 728.49 18049.0 31.555700302124023 47 17 10 10 10 3.1575399086513904 31.670225204757827 0.0 3 0.9790688072510979 8.515397629987264 18049.0 115.07933834586467 0.0 - - - - - - - 290.9375 36 16 MAPK13 mitogen-activated protein kinase 13 1437 184 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 295464.0 38.7952995300293 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 295464.0 159.1550137319361 0.0 - - - - - - - 197.0 590 10 1439 184 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 543330.0 38.7952995300293 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 543330.0 187.6240284094763 0.0 - - - - - - - 678.0 1086 9 1441 184 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 756453.0 38.7952995300293 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 756453.0 240.49328552572732 0.0 - - - - - - - 227.0 1512 7 1443 185 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23288.[MT7]-AC[CAM]PRPEGLNFQDLK[MT7].3b9_2.heavy 645.012 / 570.291 4937.0 31.943174362182617 36 10 10 6 10 1.1045893780879927 51.950148654645844 0.0364990234375 3 0.8255959751280845 2.9111200676695104 4937.0 12.625150829193881 0.0 - - - - - - - 345.6111111111111 9 18 RPA2 replication protein A2, 32kDa 1445 185 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23288.[MT7]-AC[CAM]PRPEGLNFQDLK[MT7].3b9_1.heavy 645.012 / 1139.57 1284.0 31.943174362182617 36 10 10 6 10 1.1045893780879927 51.950148654645844 0.0364990234375 3 0.8255959751280845 2.9111200676695104 1284.0 17.307534807534807 0.0 - - - - - - - 345.5 2 2 RPA2 replication protein A2, 32kDa 1447 185 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23288.[MT7]-AC[CAM]PRPEGLNFQDLK[MT7].3y3_1.heavy 645.012 / 519.326 3555.0 31.943174362182617 36 10 10 6 10 1.1045893780879927 51.950148654645844 0.0364990234375 3 0.8255959751280845 2.9111200676695104 3555.0 5.892738924291002 0.0 - - - - - - - 728.0 7 8 RPA2 replication protein A2, 32kDa 1449 185 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23288.[MT7]-AC[CAM]PRPEGLNFQDLK[MT7].3b12_2.heavy 645.012 / 765.368 7998.0 31.943174362182617 36 10 10 6 10 1.1045893780879927 51.950148654645844 0.0364990234375 3 0.8255959751280845 2.9111200676695104 7998.0 37.74492336640438 0.0 - - - - - - - 244.21052631578948 15 19 RPA2 replication protein A2, 32kDa 1451 186 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544888.[MT7]-AC[CAM]PRPEGLNFQDLK[MT7].4b8_2.heavy 484.011 / 513.27 50066.0 31.924924850463867 43 17 10 6 10 6.912271303493502 14.46702474618718 0.0364990234375 3 0.9715013991110623 7.293126891918763 50066.0 159.16670796906908 0.0 - - - - - - - 328.5 100 10 RPA2 replication protein A2, 32kDa 1453 186 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544888.[MT7]-AC[CAM]PRPEGLNFQDLK[MT7].4b7_1.heavy 484.011 / 912.448 3882.0 31.924924850463867 43 17 10 6 10 6.912271303493502 14.46702474618718 0.0364990234375 3 0.9715013991110623 7.293126891918763 3882.0 36.0889447236181 0.0 - - - - - - - 179.4 7 10 RPA2 replication protein A2, 32kDa 1455 186 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544888.[MT7]-AC[CAM]PRPEGLNFQDLK[MT7].4y3_1.heavy 484.011 / 519.326 80723.0 31.924924850463867 43 17 10 6 10 6.912271303493502 14.46702474618718 0.0364990234375 3 0.9715013991110623 7.293126891918763 80723.0 149.48854649490258 0.0 - - - - - - - 763.0 161 9 RPA2 replication protein A2, 32kDa 1457 186 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544888.[MT7]-AC[CAM]PRPEGLNFQDLK[MT7].4b9_2.heavy 484.011 / 570.291 130490.0 31.924924850463867 43 17 10 6 10 6.912271303493502 14.46702474618718 0.0364990234375 3 0.9715013991110623 7.293126891918763 130490.0 193.28724581813174 0.0 - - - - - - - 365.1111111111111 260 9 RPA2 replication protein A2, 32kDa 1459 187 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23291.[MT7]-VIEQLGTPC[CAM]PEFMK[MT7].3y3_1.heavy 646.342 / 569.324 1537.0 36.158949851989746 44 18 10 6 10 4.93605931163417 20.25907585111517 0.039402008056640625 3 0.9889358039835972 11.721985985119304 1537.0 4.065435513677288 1.0 - - - - - - - 669.7142857142857 3 7 MAPK8;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 10 1461 187 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23291.[MT7]-VIEQLGTPC[CAM]PEFMK[MT7].3b4_1.heavy 646.342 / 614.363 2152.0 36.158949851989746 44 18 10 6 10 4.93605931163417 20.25907585111517 0.039402008056640625 3 0.9889358039835972 11.721985985119304 2152.0 5.509345625451916 1.0 - - - - - - - 325.52941176470586 4 17 MAPK8;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 10 1463 187 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23291.[MT7]-VIEQLGTPC[CAM]PEFMK[MT7].3b5_1.heavy 646.342 / 727.447 999.0 36.158949851989746 44 18 10 6 10 4.93605931163417 20.25907585111517 0.039402008056640625 3 0.9889358039835972 11.721985985119304 999.0 1.5703248938650711 3.0 - - - - - - - 768.4285714285714 3 7 MAPK8;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 10 1465 187 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23291.[MT7]-VIEQLGTPC[CAM]PEFMK[MT7].3y5_1.heavy 646.342 / 795.419 2075.0 36.158949851989746 44 18 10 6 10 4.93605931163417 20.25907585111517 0.039402008056640625 3 0.9889358039835972 11.721985985119304 2075.0 7.2017353579175705 0.0 - - - - - - - 253.2941176470588 4 17 MAPK8;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 10 1467 188 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 677360.0 34.054298400878906 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 677360.0 398.9908700469015 0.0 - - - - - - - 270.0 1354 7 1469 188 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 119071.0 34.054298400878906 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 119071.0 238.78755821154323 0.0 - - - - - - - 792.4444444444445 238 9 1471 188 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 92005.0 34.054298400878906 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 92005.0 123.4548904540081 0.0 - - - - - - - 692.4 184 10 1473 189 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22575.[MT7]-WTGGGK[MT7].2y4_1.heavy 447.258 / 462.279 13543.0 20.78820037841797 48 18 10 10 10 3.5558673191119583 28.122534117772982 0.0 3 0.9850718515798292 10.088292023329636 13543.0 50.69482560756076 0.0 - - - - - - - 251.8421052631579 27 19 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 1475 189 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22575.[MT7]-WTGGGK[MT7].2b3_2.heavy 447.258 / 245.133 1101.0 20.78820037841797 48 18 10 10 10 3.5558673191119583 28.122534117772982 0.0 3 0.9850718515798292 10.088292023329636 1101.0 0.9775715092002357 15.0 - - - - - - - 705.6875 3 16 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 1477 189 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22575.[MT7]-WTGGGK[MT7].2y5_1.heavy 447.258 / 563.327 29673.0 20.78820037841797 48 18 10 10 10 3.5558673191119583 28.122534117772982 0.0 3 0.9850718515798292 10.088292023329636 29673.0 101.06559948628566 0.0 - - - - - - - 262.05882352941177 59 17 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 1479 189 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22575.[MT7]-WTGGGK[MT7].2y3_1.heavy 447.258 / 405.258 3193.0 20.78820037841797 48 18 10 10 10 3.5558673191119583 28.122534117772982 0.0 3 0.9850718515798292 10.088292023329636 3193.0 3.5753724686218664 1.0 - - - - - - - 1272.111111111111 6 9 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 1481 190 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22572.[MT7]-QDVNK[MT7].2b3_1.heavy 446.261 / 487.263 1144.0 13.756449699401855 42 18 10 6 8 7.653552283930131 13.065828296484776 0.032199859619140625 4 0.9894657871791124 12.013770778751086 1144.0 6.755952257394914 1.0 - - - - - - - 126.72 2 25 MAPK13 mitogen-activated protein kinase 13 1483 190 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22572.[MT7]-QDVNK[MT7].2y4_1.heavy 446.261 / 619.353 4108.0 13.756449699401855 42 18 10 6 8 7.653552283930131 13.065828296484776 0.032199859619140625 4 0.9894657871791124 12.013770778751086 4108.0 20.496608411753407 1.0 - - - - - - - 233.15 8 20 MAPK13 mitogen-activated protein kinase 13 1485 190 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22572.[MT7]-QDVNK[MT7].2b3_2.heavy 446.261 / 244.135 147.0 13.756449699401855 42 18 10 6 8 7.653552283930131 13.065828296484776 0.032199859619140625 4 0.9894657871791124 12.013770778751086 147.0 -0.09863481228668936 29.0 - - - - - - - 147.84 2 25 MAPK13 mitogen-activated protein kinase 13 1487 190 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22572.[MT7]-QDVNK[MT7].2y3_1.heavy 446.261 / 504.326 3022.0 13.756449699401855 42 18 10 6 8 7.653552283930131 13.065828296484776 0.032199859619140625 4 0.9894657871791124 12.013770778751086 3022.0 20.92935619745276 0.0 - - - - - - - 145.28571428571428 6 21 MAPK13 mitogen-activated protein kinase 13 1489 191 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22570.[MT7]-QVIDK[MT7].2y4_1.heavy 445.781 / 618.394 10880.0 19.285900115966797 47 17 10 10 10 2.839149424443562 28.281389786431674 0.0 3 0.9772030458531366 8.158220468445737 10880.0 39.97317478172371 0.0 - - - - - - - 296.22222222222223 21 18 MAP2K6 mitogen-activated protein kinase kinase 6 1491 191 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22570.[MT7]-QVIDK[MT7].2b4_1.heavy 445.781 / 600.347 8595.0 19.285900115966797 47 17 10 10 10 2.839149424443562 28.281389786431674 0.0 3 0.9772030458531366 8.158220468445737 8595.0 24.258791835699796 0.0 - - - - - - - 315.5 17 20 MAP2K6 mitogen-activated protein kinase kinase 6 1493 191 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22570.[MT7]-QVIDK[MT7].2y3_1.heavy 445.781 / 519.326 5984.0 19.285900115966797 47 17 10 10 10 2.839149424443562 28.281389786431674 0.0 3 0.9772030458531366 8.158220468445737 5984.0 24.76137931034483 0.0 - - - - - - - 252.85 11 20 MAP2K6 mitogen-activated protein kinase kinase 6 1495 192 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542256.[MT7]-SHNSLQR.2y6_1.heavy 493.268 / 754.396 1806.0 13.580599784851074 46 16 10 10 10 1.6938811463717494 46.21352955298797 0.0 3 0.9654857450436816 6.623781926519624 1806.0 66.15282801077336 0.0 - - - - - - - 85.27777777777777 3 18 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1497 192 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542256.[MT7]-SHNSLQR.2y4_1.heavy 493.268 / 503.294 723.0 13.580599784851074 46 16 10 10 10 1.6938811463717494 46.21352955298797 0.0 3 0.9654857450436816 6.623781926519624 723.0 10.679607843137255 0.0 - - - - - - - 0.0 1 0 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1499 192 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542256.[MT7]-SHNSLQR.2y5_1.heavy 493.268 / 617.336 1152.0 13.580599784851074 46 16 10 10 10 1.6938811463717494 46.21352955298797 0.0 3 0.9654857450436816 6.623781926519624 1152.0 10.432566371681414 0.0 - - - - - - - 115.57692307692308 2 26 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1501 192 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542256.[MT7]-SHNSLQR.2b4_1.heavy 493.268 / 570.275 N/A 13.580599784851074 46 16 10 10 10 1.6938811463717494 46.21352955298797 0.0 3 0.9654857450436816 6.623781926519624 226.0 0.3074829931972789 7.0 - - - - - - - 0.0 0 0 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1503 193 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541387.[MT7]-TELGK[MT7].2b3_1.heavy 418.26 / 488.284 280.0 18.706000328063965 18 5 2 7 4 0.3811236557243518 107.94480408202136 0.029001235961914062 9 0.6337989684702123 1.9735918808409387 280.0 0.22875816993464052 32.0 - - - - - - - 688.8 27 10 ZNF804B;DHX33;TGFBR2;TPP2;TSC1;VNN2 zinc finger protein 804B;DEAH (Asp-Glu-Ala-His) box polypeptide 33;transforming growth factor, beta receptor II (70/80kDa);tripeptidyl peptidase II;tuberous sclerosis 1;vanin 2 1505 193 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541387.[MT7]-TELGK[MT7].2y4_1.heavy 418.26 / 590.363 10477.0 18.706000328063965 18 5 2 7 4 0.3811236557243518 107.94480408202136 0.029001235961914062 9 0.6337989684702123 1.9735918808409387 10477.0 32.740625 1.0 - - - - - - - 616.0 47 7 ZNF804B;DHX33;TGFBR2;TPP2;TSC1;VNN2 zinc finger protein 804B;DEAH (Asp-Glu-Ala-His) box polypeptide 33;transforming growth factor, beta receptor II (70/80kDa);tripeptidyl peptidase II;tuberous sclerosis 1;vanin 2 1507 193 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541387.[MT7]-TELGK[MT7].2b4_1.heavy 418.26 / 545.305 1681.0 18.706000328063965 18 5 2 7 4 0.3811236557243518 107.94480408202136 0.029001235961914062 9 0.6337989684702123 1.9735918808409387 1681.0 4.574149659863945 0.0 - - - - - - - 610.4 3 10 ZNF804B;DHX33;TGFBR2;TPP2;TSC1;VNN2 zinc finger protein 804B;DEAH (Asp-Glu-Ala-His) box polypeptide 33;transforming growth factor, beta receptor II (70/80kDa);tripeptidyl peptidase II;tuberous sclerosis 1;vanin 2 1509 193 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541387.[MT7]-TELGK[MT7].2y3_1.heavy 418.26 / 461.32 896.0 18.706000328063965 18 5 2 7 4 0.3811236557243518 107.94480408202136 0.029001235961914062 9 0.6337989684702123 1.9735918808409387 896.0 3.6727272727272724 13.0 - - - - - - - 672.0 6 10 ZNF804B;DHX33;TGFBR2;TPP2;TSC1;VNN2 zinc finger protein 804B;DEAH (Asp-Glu-Ala-His) box polypeptide 33;transforming growth factor, beta receptor II (70/80kDa);tripeptidyl peptidase II;tuberous sclerosis 1;vanin 2 1511 194 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23003.[MT7]-IHPELVTGSK[MT7].3b4_1.heavy 456.941 / 621.348 12387.0 25.167800903320312 45 15 10 10 10 2.989173455831628 33.45406396705027 0.0 3 0.9583570532998986 6.026607320128453 12387.0 18.973781666741942 1.0 - - - - - - - 282.8888888888889 27 18 TSC1 tuberous sclerosis 1 1513 194 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23003.[MT7]-IHPELVTGSK[MT7].3b5_1.heavy 456.941 / 734.432 8131.0 25.167800903320312 45 15 10 10 10 2.989173455831628 33.45406396705027 0.0 3 0.9583570532998986 6.026607320128453 8131.0 55.63315789473684 0.0 - - - - - - - 238.13333333333333 16 15 TSC1 tuberous sclerosis 1 1515 194 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23003.[MT7]-IHPELVTGSK[MT7].3y4_1.heavy 456.941 / 536.316 41872.0 25.167800903320312 45 15 10 10 10 2.989173455831628 33.45406396705027 0.0 3 0.9583570532998986 6.026607320128453 41872.0 54.10964708205786 0.0 - - - - - - - 304.0 83 8 TSC1 tuberous sclerosis 1 1517 194 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23003.[MT7]-IHPELVTGSK[MT7].3y5_1.heavy 456.941 / 635.385 6991.0 25.167800903320312 45 15 10 10 10 2.989173455831628 33.45406396705027 0.0 3 0.9583570532998986 6.026607320128453 6991.0 25.756315789473685 0.0 - - - - - - - 234.33333333333334 13 12 TSC1 tuberous sclerosis 1 1519 195 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22971.[MT7]-K[MT7]LSEC[CAM]LK[MT7].3y6_1.heavy 437.267 / 893.488 111.0 22.392799377441406 44 14 10 10 10 1.9420665799714387 41.17051832864051 0.0 3 0.9455645347603905 5.265399812169493 111.0 2.188285714285714 2.0 - - - - - - - 0.0 0 0 BAX BCL2-associated X protein 1521 195 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22971.[MT7]-K[MT7]LSEC[CAM]LK[MT7].3y3_1.heavy 437.267 / 564.33 5670.0 22.392799377441406 44 14 10 10 10 1.9420665799714387 41.17051832864051 0.0 3 0.9455645347603905 5.265399812169493 5670.0 12.810461660489324 0.0 - - - - - - - 225.5 11 18 BAX BCL2-associated X protein 1523 195 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22971.[MT7]-K[MT7]LSEC[CAM]LK[MT7].3y4_1.heavy 437.267 / 693.372 1556.0 22.392799377441406 44 14 10 10 10 1.9420665799714387 41.17051832864051 0.0 3 0.9455645347603905 5.265399812169493 1556.0 15.974489597511182 0.0 - - - - - - - 166.75 3 16 BAX BCL2-associated X protein 1525 195 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22971.[MT7]-K[MT7]LSEC[CAM]LK[MT7].3y5_1.heavy 437.267 / 780.404 1056.0 22.392799377441406 44 14 10 10 10 1.9420665799714387 41.17051832864051 0.0 3 0.9455645347603905 5.265399812169493 1056.0 19.36679536679537 0.0 - - - - - - - 111.36363636363636 2 11 BAX BCL2-associated X protein 1527 196 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38338.[MT7]-LWC[CAM]VETGEIK[MT7]R.3y6_1.heavy 560.311 / 847.512 2004.0 31.84160041809082 48 18 10 10 10 5.651563471839409 17.69421868802848 0.0 3 0.9891632556835092 11.844588576407782 2004.0 6.472189237765528 0.0 - - - - - - - 218.6 4 10 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 1529 196 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38338.[MT7]-LWC[CAM]VETGEIK[MT7]R.3y8_1.heavy 560.311 / 1075.62 1367.0 31.84160041809082 48 18 10 10 10 5.651563471839409 17.69421868802848 0.0 3 0.9891632556835092 11.844588576407782 1367.0 17.105420956236745 0.0 - - - - - - - 208.28571428571428 2 7 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 1531 196 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38338.[MT7]-LWC[CAM]VETGEIK[MT7]R.3y5_1.heavy 560.311 / 746.464 1458.0 31.84160041809082 48 18 10 10 10 5.651563471839409 17.69421868802848 0.0 3 0.9891632556835092 11.844588576407782 1458.0 5.30936717761215 1.0 - - - - - - - 252.94444444444446 2 18 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 1533 196 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38338.[MT7]-LWC[CAM]VETGEIK[MT7]R.3y9_1.heavy 560.311 / 1235.65 N/A 31.84160041809082 48 18 10 10 10 5.651563471839409 17.69421868802848 0.0 3 0.9891632556835092 11.844588576407782 0.0 0.0 1.0 - - - - - - - 0.0 0 0 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 1535 197 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37831.[MT7]-WEHLK[MT7].2y4_1.heavy 500.795 / 670.4 3535.0 24.938100814819336 29 13 2 6 8 1.6666836930215394 52.83230826598394 0.03989982604980469 4 0.9228987301052505 4.4157137616642945 3535.0 1.5898446779108886 0.0 - - - - - - - 266.625 7 8 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1537 197 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37831.[MT7]-WEHLK[MT7].2b3_1.heavy 500.795 / 597.29 3202.0 24.938100814819336 29 13 2 6 8 1.6666836930215394 52.83230826598394 0.03989982604980469 4 0.9228987301052505 4.4157137616642945 3202.0 7.4159670829864 1.0 - - - - - - - 256.38461538461536 16 13 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1539 197 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37831.[MT7]-WEHLK[MT7].2y3_1.heavy 500.795 / 541.358 3802.0 24.938100814819336 29 13 2 6 8 1.6666836930215394 52.83230826598394 0.03989982604980469 4 0.9228987301052505 4.4157137616642945 3802.0 4.190558142521026 0.0 - - - - - - - 667.0 7 14 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1541 198 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23277.[MT7]-GVHC[CAM]WVC[CAM]DESVRK[MT7].4y8_2.heavy 480.742 / 568.796 36115.0 24.76919937133789 50 20 10 10 10 7.406557094344323 13.501549873470957 0.0 3 0.9966863660248906 21.43335243243645 36115.0 60.250736015701676 0.0 - - - - - - - 684.6 72 10 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1543 198 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23277.[MT7]-GVHC[CAM]WVC[CAM]DESVRK[MT7].4b4_1.heavy 480.742 / 598.289 6772.0 24.76919937133789 50 20 10 10 10 7.406557094344323 13.501549873470957 0.0 3 0.9966863660248906 21.43335243243645 6772.0 7.803711582018908 0.0 - - - - - - - 673.5833333333334 13 12 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1545 198 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23277.[MT7]-GVHC[CAM]WVC[CAM]DESVRK[MT7].4y7_1.heavy 480.742 / 1037.52 N/A 24.76919937133789 50 20 10 10 10 7.406557094344323 13.501549873470957 0.0 3 0.9966863660248906 21.43335243243645 0.0 -0.0 0.0 - - - - - - - 0.0 0 0 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1547 198 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23277.[MT7]-GVHC[CAM]WVC[CAM]DESVRK[MT7].4y7_2.heavy 480.742 / 519.262 42013.0 24.76919937133789 50 20 10 10 10 7.406557094344323 13.501549873470957 0.0 3 0.9966863660248906 21.43335243243645 42013.0 24.265363204870248 0.0 - - - - - - - 736.1111111111111 84 9 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1549 199 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38334.[MT7]-YDPTIEDSYRK[MT7].3y6_1.heavy 558.957 / 941.481 7356.0 25.044700622558594 38 8 10 10 10 1.565605385225843 63.8730557161278 0.0 3 0.7818917029198459 2.5929646367255708 7356.0 67.02513182590044 0.0 - - - - - - - 147.2 14 10 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1551 199 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38334.[MT7]-YDPTIEDSYRK[MT7].3y4_1.heavy 558.957 / 697.411 6019.0 25.044700622558594 38 8 10 10 10 1.565605385225843 63.8730557161278 0.0 3 0.7818917029198459 2.5929646367255708 6019.0 11.790382059652107 0.0 - - - - - - - 340.8 12 10 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1553 199 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38334.[MT7]-YDPTIEDSYRK[MT7].3y8_1.heavy 558.957 / 1155.61 134.0 25.044700622558594 38 8 10 10 10 1.565605385225843 63.8730557161278 0.0 3 0.7818917029198459 2.5929646367255708 134.0 1.4666666666666668 3.0 - - - - - - - 0.0 0 0 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1555 199 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38334.[MT7]-YDPTIEDSYRK[MT7].3y9_2.heavy 558.957 / 626.836 98437.0 25.044700622558594 38 8 10 10 10 1.565605385225843 63.8730557161278 0.0 3 0.7818917029198459 2.5929646367255708 98437.0 435.12691412494405 0.0 - - - - - - - 303.38461538461536 196 13 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1557 200 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23008.[MT7]-AIVLFNPDAK[MT7].3b6_1.heavy 459.278 / 802.494 5752.0 36.05220031738281 50 20 10 10 10 8.758240820836432 11.41781803511196 0.0 3 0.9954941713153052 18.378574612539555 5752.0 36.57892066531052 0.0 - - - - - - - 182.6 11 10 RXRG retinoid X receptor, gamma 1559 200 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23008.[MT7]-AIVLFNPDAK[MT7].3y3_1.heavy 459.278 / 477.279 73404.0 36.05220031738281 50 20 10 10 10 8.758240820836432 11.41781803511196 0.0 3 0.9954941713153052 18.378574612539555 73404.0 180.8682027480232 0.0 - - - - - - - 704.2857142857143 146 7 RXRG retinoid X receptor, gamma 1561 200 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23008.[MT7]-AIVLFNPDAK[MT7].3b4_1.heavy 459.278 / 541.383 117227.0 36.05220031738281 50 20 10 10 10 8.758240820836432 11.41781803511196 0.0 3 0.9954941713153052 18.378574612539555 117227.0 256.71378941500666 0.0 - - - - - - - 296.625 234 8 RXRG retinoid X receptor, gamma 1563 200 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23008.[MT7]-AIVLFNPDAK[MT7].3y4_1.heavy 459.278 / 574.332 97141.0 36.05220031738281 50 20 10 10 10 8.758240820836432 11.41781803511196 0.0 3 0.9954941713153052 18.378574612539555 97141.0 409.01240076305356 0.0 - - - - - - - 285.25 194 8 RXRG retinoid X receptor, gamma 1565 201 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38537.[MT7]-FSPDSTLLATC[CAM]SADQTC[CAM]K[MT7].3y3_1.heavy 764.036 / 552.293 3762.0 32.56925010681152 41 15 10 6 10 3.697311897951555 27.04667681820504 0.03980255126953125 3 0.9549178852771913 5.790485768509748 3762.0 11.833333333333332 1.0 - - - - - - - 213.23076923076923 7 13 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 1567 201 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38537.[MT7]-FSPDSTLLATC[CAM]SADQTC[CAM]K[MT7].3b6_1.heavy 764.036 / 779.369 5644.0 32.56925010681152 41 15 10 6 10 3.697311897951555 27.04667681820504 0.03980255126953125 3 0.9549178852771913 5.790485768509748 5644.0 66.84434343434343 0.0 - - - - - - - 243.0 11 11 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 1569 201 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38537.[MT7]-FSPDSTLLATC[CAM]SADQTC[CAM]K[MT7].3b5_1.heavy 764.036 / 678.321 1089.0 32.56925010681152 41 15 10 6 10 3.697311897951555 27.04667681820504 0.03980255126953125 3 0.9549178852771913 5.790485768509748 1089.0 3.3733333333333335 0.0 - - - - - - - 210.375 2 16 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 1571 201 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38537.[MT7]-FSPDSTLLATC[CAM]SADQTC[CAM]K[MT7].3b7_1.heavy 764.036 / 892.453 5644.0 32.56925010681152 41 15 10 6 10 3.697311897951555 27.04667681820504 0.03980255126953125 3 0.9549178852771913 5.790485768509748 5644.0 21.891878787878788 0.0 - - - - - - - 255.75 11 12 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 1573 202 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22661.[MT7]-LIDILLR.2y4_1.heavy 500.338 / 514.371 3489.0 45.164649963378906 39 16 10 3 10 2.4971048813755736 31.659051270888973 0.06420135498046875 3 0.9638870451025596 6.474632834796742 3489.0 76.94569015846538 0.0 - - - - - - - 96.52631578947368 6 19 BIRC6 baculoviral IAP repeat-containing 6 1575 202 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22661.[MT7]-LIDILLR.2y5_1.heavy 500.338 / 629.398 2224.0 45.164649963378906 39 16 10 3 10 2.4971048813755736 31.659051270888973 0.06420135498046875 3 0.9638870451025596 6.474632834796742 2224.0 15.337931034482757 0.0 - - - - - - - 130.83333333333334 4 18 BIRC6 baculoviral IAP repeat-containing 6 1577 202 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22661.[MT7]-LIDILLR.2b4_1.heavy 500.338 / 599.388 1352.0 45.164649963378906 39 16 10 3 10 2.4971048813755736 31.659051270888973 0.06420135498046875 3 0.9638870451025596 6.474632834796742 1352.0 5.074588378975057 0.0 - - - - - - - 201.52380952380952 2 21 BIRC6 baculoviral IAP repeat-containing 6 1579 202 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22661.[MT7]-LIDILLR.2y6_1.heavy 500.338 / 742.482 4667.0 45.164649963378906 39 16 10 3 10 2.4971048813755736 31.659051270888973 0.06420135498046875 3 0.9638870451025596 6.474632834796742 4667.0 57.27588751425814 0.0 - - - - - - - 155.5 9 16 BIRC6 baculoviral IAP repeat-containing 6 1581 203 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543767.[MT7]-LVVLGSGGVGK[MT7].3b4_1.heavy 425.274 / 569.414 50473.0 32.4995002746582 50 20 10 10 10 7.404588204490978 13.505139953542415 0.0 3 0.9921638366128388 13.932421986018367 50473.0 152.63134946914747 0.0 - - - - - - - 316.57142857142856 100 7 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1583 203 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543767.[MT7]-LVVLGSGGVGK[MT7].3b5_1.heavy 425.274 / 626.436 34555.0 32.4995002746582 50 20 10 10 10 7.404588204490978 13.505139953542415 0.0 3 0.9921638366128388 13.932421986018367 34555.0 160.69412272196934 0.0 - - - - - - - 210.54545454545453 69 11 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1585 203 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543767.[MT7]-LVVLGSGGVGK[MT7].3y4_1.heavy 425.274 / 504.326 42917.0 32.4995002746582 50 20 10 10 10 7.404588204490978 13.505139953542415 0.0 3 0.9921638366128388 13.932421986018367 42917.0 181.0014205955335 0.0 - - - - - - - 264.375 85 8 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1587 203 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543767.[MT7]-LVVLGSGGVGK[MT7].3b3_1.heavy 425.274 / 456.33 136911.0 32.4995002746582 50 20 10 10 10 7.404588204490978 13.505139953542415 0.0 3 0.9921638366128388 13.932421986018367 136911.0 345.9558154486149 0.0 - - - - - - - 223.66666666666666 273 9 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1589 204 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22662.[MT7]-VHLSEK[MT7].2y4_1.heavy 500.805 / 620.374 4804.0 19.3382994333903 26 12 0 6 8 1.099266558247786 53.864631316707346 0.03930091857910156 4 0.8985826817665362 3.8420735599943496 4804.0 21.123651365606563 0.0 - - - - - - - 660.0 9 11 ZNF773;PRIM1;ZNF419 zinc finger protein 773;primase, DNA, polypeptide 1 (49kDa);zinc finger protein 419 1591 204 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22662.[MT7]-VHLSEK[MT7].2y5_1.heavy 500.805 / 757.432 3767.0 19.3382994333903 26 12 0 6 8 1.099266558247786 53.864631316707346 0.03930091857910156 4 0.8985826817665362 3.8420735599943496 3767.0 7.025074190311492 1.0 - - - - - - - 193.95 71 20 ZNF773;PRIM1;ZNF419 zinc finger protein 773;primase, DNA, polypeptide 1 (49kDa);zinc finger protein 419 1593 204 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22662.[MT7]-VHLSEK[MT7].2y3_1.heavy 500.805 / 507.289 3275.0 19.3382994333903 26 12 0 6 8 1.099266558247786 53.864631316707346 0.03930091857910156 4 0.8985826817665362 3.8420735599943496 3275.0 11.402486910994766 0.0 - - - - - - - 230.5185185185185 6 27 ZNF773;PRIM1;ZNF419 zinc finger protein 773;primase, DNA, polypeptide 1 (49kDa);zinc finger protein 419 1595 205 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22666.[MT7]-EAVQEER.2y5_1.heavy 502.76 / 660.331 2827.0 14.943599700927734 38 10 8 10 10 0.8700151116645539 67.64043205809227 0.0 3 0.8412237701738775 3.0552611097162017 2827.0 20.402213306887845 0.0 - - - - - - - 127.3529411764706 5 17 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 1597 205 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22666.[MT7]-EAVQEER.2b4_1.heavy 502.76 / 572.316 4712.0 14.943599700927734 38 10 8 10 10 0.8700151116645539 67.64043205809227 0.0 3 0.8412237701738775 3.0552611097162017 4712.0 46.049477100613046 0.0 - - - - - - - 169.04545454545453 9 22 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 1599 205 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22666.[MT7]-EAVQEER.2y6_1.heavy 502.76 / 731.368 N/A 14.943599700927734 38 10 8 10 10 0.8700151116645539 67.64043205809227 0.0 3 0.8412237701738775 3.0552611097162017 10130.0 21.6529538305387 1.0 - - - - - - - 177.88888888888889 25 18 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 1601 205 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22666.[MT7]-EAVQEER.2b5_1.heavy 502.76 / 701.359 9565.0 14.943599700927734 38 10 8 10 10 0.8700151116645539 67.64043205809227 0.0 3 0.8412237701738775 3.0552611097162017 9565.0 58.74929747089523 0.0 - - - - - - - 141.11111111111111 19 18 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 1603 206 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543201.[MT7]-LFEGSGEAR.2b3_1.heavy 555.289 / 534.304 12520.0 26.852500915527344 48 18 10 10 10 7.863749538135065 12.71657998707263 0.0 3 0.9886230362550497 11.559434145683191 12520.0 9.96245183507911 0.0 - - - - - - - 1728.857142857143 25 7 LTB4R2 leukotriene B4 receptor 2 1605 206 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543201.[MT7]-LFEGSGEAR.2y8_1.heavy 555.289 / 852.385 32052.0 26.852500915527344 48 18 10 10 10 7.863749538135065 12.71657998707263 0.0 3 0.9886230362550497 11.559434145683191 32052.0 85.45372112917023 0.0 - - - - - - - 630.7777777777778 64 9 LTB4R2 leukotriene B4 receptor 2 1607 206 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543201.[MT7]-LFEGSGEAR.2y6_1.heavy 555.289 / 576.274 14357.0 26.852500915527344 48 18 10 10 10 7.863749538135065 12.71657998707263 0.0 3 0.9886230362550497 11.559434145683191 14357.0 26.468040032644648 0.0 - - - - - - - 264.0833333333333 28 12 LTB4R2 leukotriene B4 receptor 2 1609 206 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543201.[MT7]-LFEGSGEAR.2y7_1.heavy 555.289 / 705.316 12771.0 26.852500915527344 48 18 10 10 10 7.863749538135065 12.71657998707263 0.0 3 0.9886230362550497 11.559434145683191 12771.0 105.15044910179641 0.0 - - - - - - - 222.4 25 15 LTB4R2 leukotriene B4 receptor 2 1611 207 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544750.[MT7]-IINDGAAILRQEK[MT7].3y11_2.heavy 577.012 / 679.879 18581.0 32.06290054321289 46 16 10 10 10 96.86487896521635 1.0323659211499088 0.0 3 0.9670475370384083 6.77982632851362 18581.0 33.85761043412034 0.0 - - - - - - - 737.3 37 10 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1613 207 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544750.[MT7]-IINDGAAILRQEK[MT7].3y12_2.heavy 577.012 / 736.421 29184.0 32.06290054321289 46 16 10 10 10 96.86487896521635 1.0323659211499088 0.0 3 0.9670475370384083 6.77982632851362 29184.0 84.27722772277228 0.0 - - - - - - - 235.66666666666666 58 9 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1615 207 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544750.[MT7]-IINDGAAILRQEK[MT7].3y9_2.heavy 577.012 / 565.344 29891.0 32.06290054321289 46 16 10 10 10 96.86487896521635 1.0323659211499088 0.0 3 0.9670475370384083 6.77982632851362 29891.0 59.19009900990099 0.0 - - - - - - - 684.5555555555555 59 9 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1617 207 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544750.[MT7]-IINDGAAILRQEK[MT7].3y9_1.heavy 577.012 / 1129.68 909.0 32.06290054321289 46 16 10 10 10 96.86487896521635 1.0323659211499088 0.0 3 0.9670475370384083 6.77982632851362 909.0 17.928 0.0 - - - - - - - 0.0 1 0 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1619 208 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544373.[MT7]-DASTLGLSQIK[MT7].3b6_1.heavy 474.28 / 689.359 16418.0 30.704200744628906 43 17 10 6 10 5.780140784435663 13.664668180582934 0.03820037841796875 3 0.97313328914748 7.512387048880667 16418.0 32.74346500193241 0.0 - - - - - - - 676.5 32 12 BIRC6 baculoviral IAP repeat-containing 6 1621 208 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544373.[MT7]-DASTLGLSQIK[MT7].3b4_1.heavy 474.28 / 519.253 9994.0 30.704200744628906 43 17 10 6 10 5.780140784435663 13.664668180582934 0.03820037841796875 3 0.97313328914748 7.512387048880667 9994.0 13.656058730348894 0.0 - - - - - - - 706.5833333333334 19 12 BIRC6 baculoviral IAP repeat-containing 6 1623 208 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544373.[MT7]-DASTLGLSQIK[MT7].3y4_1.heavy 474.28 / 619.39 10172.0 30.704200744628906 43 17 10 6 10 5.780140784435663 13.664668180582934 0.03820037841796875 3 0.97313328914748 7.512387048880667 10172.0 15.136771699962674 0.0 - - - - - - - 230.41666666666666 20 12 BIRC6 baculoviral IAP repeat-containing 6 1625 208 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544373.[MT7]-DASTLGLSQIK[MT7].3b7_1.heavy 474.28 / 802.443 1428.0 30.704200744628906 43 17 10 6 10 5.780140784435663 13.664668180582934 0.03820037841796875 3 0.97313328914748 7.512387048880667 1428.0 1.1014953271028036 4.0 - - - - - - - 222.92857142857142 5 14 BIRC6 baculoviral IAP repeat-containing 6 1627 209 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22561.[MT7]-VFSILR.2y4_1.heavy 439.783 / 488.319 10817.0 37.1974983215332 48 18 10 10 10 2.896428169685463 34.52528222402266 0.0 3 0.9813732887244945 9.0285465435667 10817.0 35.512339468590085 0.0 - - - - - - - 689.0 21 7 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1629 209 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22561.[MT7]-VFSILR.2b3_1.heavy 439.783 / 478.278 7510.0 37.1974983215332 48 18 10 10 10 2.896428169685463 34.52528222402266 0.0 3 0.9813732887244945 9.0285465435667 7510.0 31.458353510895883 0.0 - - - - - - - 206.85 15 20 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1631 209 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22561.[MT7]-VFSILR.2y5_1.heavy 439.783 / 635.388 42167.0 37.1974983215332 48 18 10 10 10 2.896428169685463 34.52528222402266 0.0 3 0.9813732887244945 9.0285465435667 42167.0 258.5800504133898 0.0 - - - - - - - 241.21428571428572 84 14 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1633 209 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22561.[MT7]-VFSILR.2b4_1.heavy 439.783 / 591.362 8681.0 37.1974983215332 48 18 10 10 10 2.896428169685463 34.52528222402266 0.0 3 0.9813732887244945 9.0285465435667 8681.0 132.5621630347054 0.0 - - - - - - - 182.21428571428572 17 14 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1635 210 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22562.[MT7]-ELSDK[MT7].2b3_1.heavy 440.255 / 474.268 1146.0 17.342049598693848 39 13 10 6 10 1.038215801235856 60.05250460901733 0.03510093688964844 3 0.919598019160143 4.322900927247649 1146.0 3.4721440131920476 0.0 - - - - - - - 262.1578947368421 2 19 IWS1;MAP3K12;MAP3K13 IWS1 homolog (S. cerevisiae);mitogen-activated protein kinase kinase kinase 12;mitogen-activated protein kinase kinase kinase 13 1637 210 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22562.[MT7]-ELSDK[MT7].2y4_1.heavy 440.255 / 606.358 5785.0 17.342049598693848 39 13 10 6 10 1.038215801235856 60.05250460901733 0.03510093688964844 3 0.919598019160143 4.322900927247649 5785.0 13.72855676151364 0.0 - - - - - - - 671.1428571428571 11 7 IWS1;MAP3K12;MAP3K13 IWS1 homolog (S. cerevisiae);mitogen-activated protein kinase kinase kinase 12;mitogen-activated protein kinase kinase kinase 13 1639 210 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22562.[MT7]-ELSDK[MT7].2b4_1.heavy 440.255 / 589.295 5785.0 17.342049598693848 39 13 10 6 10 1.038215801235856 60.05250460901733 0.03510093688964844 3 0.919598019160143 4.322900927247649 5785.0 5.0524017467248905 1.0 - - - - - - - 272.8235294117647 11 17 IWS1;MAP3K12;MAP3K13 IWS1 homolog (S. cerevisiae);mitogen-activated protein kinase kinase kinase 12;mitogen-activated protein kinase kinase kinase 13 1641 210 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22562.[MT7]-ELSDK[MT7].2y3_1.heavy 440.255 / 493.274 4296.0 17.342049598693848 39 13 10 6 10 1.038215801235856 60.05250460901733 0.03510093688964844 3 0.919598019160143 4.322900927247649 4296.0 24.049659794861377 0.0 - - - - - - - 234.66666666666666 8 21 IWS1;MAP3K12;MAP3K13 IWS1 homolog (S. cerevisiae);mitogen-activated protein kinase kinase kinase 12;mitogen-activated protein kinase kinase kinase 13 1643 211 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541769.[MT7]-DDIEVR.2b3_1.heavy 445.739 / 488.247 7090.0 21.286800384521484 43 13 10 10 10 1.7068539493514627 50.25440949922003 0.0 3 0.908006032619022 4.037343517078916 7090.0 13.719277978339349 0.0 - - - - - - - 683.1111111111111 14 9 NFKB2;REL nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100);v-rel reticuloendotheliosis viral oncogene homolog (avian) 1645 211 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541769.[MT7]-DDIEVR.2y4_1.heavy 445.739 / 516.314 8475.0 21.286800384521484 43 13 10 10 10 1.7068539493514627 50.25440949922003 0.0 3 0.908006032619022 4.037343517078916 8475.0 14.99187725631769 0.0 - - - - - - - 726.3333333333334 16 9 NFKB2;REL nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100);v-rel reticuloendotheliosis viral oncogene homolog (avian) 1647 211 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541769.[MT7]-DDIEVR.2y5_1.heavy 445.739 / 631.341 9417.0 21.286800384521484 43 13 10 10 10 1.7068539493514627 50.25440949922003 0.0 3 0.908006032619022 4.037343517078916 9417.0 31.295227708803612 0.0 - - - - - - - 756.9166666666666 18 12 NFKB2;REL nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100);v-rel reticuloendotheliosis viral oncogene homolog (avian) 1649 211 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541769.[MT7]-DDIEVR.2b4_1.heavy 445.739 / 617.29 25923.0 21.286800384521484 43 13 10 10 10 1.7068539493514627 50.25440949922003 0.0 3 0.908006032619022 4.037343517078916 25923.0 61.800054595086436 0.0 - - - - - - - 254.93333333333334 51 15 NFKB2;REL nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100);v-rel reticuloendotheliosis viral oncogene homolog (avian) 1651 212 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22709.[MT7]-LSEC[CAM]LK[MT7].2y4_1.heavy 519.299 / 693.372 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAX BCL2-associated X protein 1653 212 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22709.[MT7]-LSEC[CAM]LK[MT7].2y5_1.heavy 519.299 / 780.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAX BCL2-associated X protein 1655 212 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22709.[MT7]-LSEC[CAM]LK[MT7].2y3_1.heavy 519.299 / 564.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAX BCL2-associated X protein 1657 212 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22709.[MT7]-LSEC[CAM]LK[MT7].2b5_1.heavy 519.299 / 747.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAX BCL2-associated X protein 1659 213 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22900.[MT7]-INPELNQK[MT7].2y4_1.heavy 622.366 / 646.4 754.0 23.91309928894043 45 15 10 10 10 2.3140861117526317 43.213603630446784 0.0 3 0.9550823477144721 5.801157628265355 754.0 7.4885031303358005 0.0 - - - - - - - 0.0 1 0 LOC100133591;LOC100509916;LOC100510195;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1661 213 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22900.[MT7]-INPELNQK[MT7].2y3_1.heavy 622.366 / 533.316 1068.0 23.91309928894043 45 15 10 10 10 2.3140861117526317 43.213603630446784 0.0 3 0.9550823477144721 5.801157628265355 1068.0 2.5529880478087645 1.0 - - - - - - - 207.7391304347826 2 23 LOC100133591;LOC100509916;LOC100510195;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1663 213 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22900.[MT7]-INPELNQK[MT7].2y6_1.heavy 622.366 / 872.496 4210.0 23.91309928894043 45 15 10 10 10 2.3140861117526317 43.213603630446784 0.0 3 0.9550823477144721 5.801157628265355 4210.0 15.922591938409383 0.0 - - - - - - - 141.5625 8 16 LOC100133591;LOC100509916;LOC100510195;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1665 213 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22900.[MT7]-INPELNQK[MT7].2y7_1.heavy 622.366 / 986.539 3079.0 23.91309928894043 45 15 10 10 10 2.3140861117526317 43.213603630446784 0.0 3 0.9550823477144721 5.801157628265355 3079.0 24.44624359704041 0.0 - - - - - - - 130.69230769230768 6 13 LOC100133591;LOC100509916;LOC100510195;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1667 214 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543473.[MT7]-TFATSSGLK[MT7].2y4_1.heavy 600.347 / 548.352 N/A 25.531299591064453 44 14 10 10 10 1.5561442286856162 43.39760446084465 0.0 3 0.9480904433980193 5.393142574771958 1382.0 2.4963500931098697 5.0 - - - - - - - 286.8666666666667 2 15 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 1669 214 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543473.[MT7]-TFATSSGLK[MT7].2y8_1.heavy 600.347 / 954.538 1228.0 25.531299591064453 44 14 10 10 10 1.5561442286856162 43.39760446084465 0.0 3 0.9480904433980193 5.393142574771958 1228.0 3.7363970528702133 0.0 - - - - - - - 179.41666666666666 2 12 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 1671 214 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543473.[MT7]-TFATSSGLK[MT7].2y6_1.heavy 600.347 / 736.432 2303.0 25.531299591064453 44 14 10 10 10 1.5561442286856162 43.39760446084465 0.0 3 0.9480904433980193 5.393142574771958 2303.0 15.59168930686172 0.0 - - - - - - - 199.9 4 10 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 1673 214 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543473.[MT7]-TFATSSGLK[MT7].2y7_1.heavy 600.347 / 807.469 2149.0 25.531299591064453 44 14 10 10 10 1.5561442286856162 43.39760446084465 0.0 3 0.9480904433980193 5.393142574771958 2149.0 11.168181818181818 0.0 - - - - - - - 204.88888888888889 4 9 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 1675 215 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22904.[MT7]-K[MT7]RNPGLK[MT7].3y6_1.heavy 415.61 / 828.517 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K6 mitogen-activated protein kinase kinase 6 1677 215 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22904.[MT7]-K[MT7]RNPGLK[MT7].3y3_1.heavy 415.61 / 461.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K6 mitogen-activated protein kinase kinase 6 1679 215 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22904.[MT7]-K[MT7]RNPGLK[MT7].3b5_2.heavy 415.61 / 421.266 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K6 mitogen-activated protein kinase kinase 6 1681 215 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22904.[MT7]-K[MT7]RNPGLK[MT7].3y4_1.heavy 415.61 / 558.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP2K6 mitogen-activated protein kinase kinase 6 1683 216 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22905.[MT7]-HIC[CAM]AIC[CAM]GDR.2y4_1.heavy 623.301 / 507.198 N/A N/A - - - - - - - - - 0.0 - - - - - - - RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 1685 216 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22905.[MT7]-HIC[CAM]AIC[CAM]GDR.2y8_1.heavy 623.301 / 964.434 N/A N/A - - - - - - - - - 0.0 - - - - - - - RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 1687 216 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22905.[MT7]-HIC[CAM]AIC[CAM]GDR.2y6_1.heavy 623.301 / 691.319 N/A N/A - - - - - - - - - 0.0 - - - - - - - RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 1689 216 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22905.[MT7]-HIC[CAM]AIC[CAM]GDR.2y7_1.heavy 623.301 / 851.35 N/A N/A - - - - - - - - - 0.0 - - - - - - - RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 1691 217 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38070.[MT7]-HIC[CAM]AIC[CAM]GDR.3b4_1.heavy 415.87 / 626.32 6434.0 20.354374408721924 46 20 10 6 10 12.849267692224135 7.782544686224882 0.03249931335449219 3 0.9982698752028016 29.666138449434033 6434.0 42.03431491012158 0.0 - - - - - - - 173.35294117647058 12 17 RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 1693 217 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38070.[MT7]-HIC[CAM]AIC[CAM]GDR.3b3_1.heavy 415.87 / 555.283 4525.0 20.354374408721924 46 20 10 6 10 12.849267692224135 7.782544686224882 0.03249931335449219 3 0.9982698752028016 29.666138449434033 4525.0 24.583065749235473 0.0 - - - - - - - 166.27272727272728 9 22 RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 1695 217 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38070.[MT7]-HIC[CAM]AIC[CAM]GDR.3y4_1.heavy 415.87 / 507.198 33641.0 20.354374408721924 46 20 10 6 10 12.849267692224135 7.782544686224882 0.03249931335449219 3 0.9982698752028016 29.666138449434033 33641.0 186.21802493497754 0.0 - - - - - - - 256.70588235294116 67 17 RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 1697 217 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38070.[MT7]-HIC[CAM]AIC[CAM]GDR.3y5_1.heavy 415.87 / 620.282 4798.0 20.354374408721924 46 20 10 6 10 12.849267692224135 7.782544686224882 0.03249931335449219 3 0.9982698752028016 29.666138449434033 4798.0 25.851508552609467 0.0 - - - - - - - 180.2 9 20 RXRA;RXRG retinoid X receptor, alpha;retinoid X receptor, gamma 1699 218 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22847.[MT7]-VLTELVSK[MT7].2b4_1.heavy 588.876 / 587.352 2170.0 34.372100830078125 35 13 2 10 10 1.4609534424797588 54.60216493098096 0.0 3 0.9109813683102973 4.10531337153758 2170.0 4.78170857511283 0.0 - - - - - - - 679.1428571428571 4 7 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 1701 218 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22847.[MT7]-VLTELVSK[MT7].2y6_1.heavy 588.876 / 820.49 620.0 34.372100830078125 35 13 2 10 10 1.4609534424797588 54.60216493098096 0.0 3 0.9109813683102973 4.10531337153758 620.0 -0.28327287384119304 12.0 - - - - - - - 198.6153846153846 13 13 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 1703 218 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22847.[MT7]-VLTELVSK[MT7].2b5_1.heavy 588.876 / 700.436 2170.0 34.372100830078125 35 13 2 10 10 1.4609534424797588 54.60216493098096 0.0 3 0.9109813683102973 4.10531337153758 2170.0 4.304438969571231 1.0 - - - - - - - 693.8571428571429 4 7 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 1705 218 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22847.[MT7]-VLTELVSK[MT7].2y7_1.heavy 588.876 / 933.574 1344.0 34.372100830078125 35 13 2 10 10 1.4609534424797588 54.60216493098096 0.0 3 0.9109813683102973 4.10531337153758 1344.0 4.660645161290323 0.0 - - - - - - - 227.33333333333334 2 15 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 1707 219 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38179.[MT7]-AIVLFNPDAK[MT7].2y4_1.heavy 688.413 / 574.332 5686.0 36.091050148010254 28 5 10 3 10 0.58784834477772 94.40321184653051 0.07719802856445312 3 0.6556636643474093 2.039567265329508 5686.0 8.993163265306123 0.0 - - - - - - - 322.0 11 14 RXRG retinoid X receptor, gamma 1709 219 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38179.[MT7]-AIVLFNPDAK[MT7].2y8_1.heavy 688.413 / 1047.6 1373.0 36.091050148010254 28 5 10 3 10 0.58784834477772 94.40321184653051 0.07719802856445312 3 0.6556636643474093 2.039567265329508 1373.0 12.609183673469387 1.0 - - - - - - - 196.0 2 11 RXRG retinoid X receptor, gamma 1711 219 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38179.[MT7]-AIVLFNPDAK[MT7].2b4_1.heavy 688.413 / 541.383 22550.0 36.091050148010254 28 5 10 3 10 0.58784834477772 94.40321184653051 0.07719802856445312 3 0.6556636643474093 2.039567265329508 22550.0 54.07397959183673 0.0 - - - - - - - 284.2 45 10 RXRG retinoid X receptor, gamma 1713 219 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38179.[MT7]-AIVLFNPDAK[MT7].2y6_1.heavy 688.413 / 835.443 5098.0 36.091050148010254 28 5 10 3 10 0.58784834477772 94.40321184653051 0.07719802856445312 3 0.6556636643474093 2.039567265329508 5098.0 38.32979832834905 0.0 - - - - - - - 224.0 10 14 RXRG retinoid X receptor, gamma 1715 220 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 204479.0 42.216965993245445 23 -3 10 6 10 null 0.0 0.037700653076171875 3 0.0 0.0 204479.0 811.2782456044528 0.0 - - - - - - - 237.46153846153845 408 13 1717 220 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 385408.0 42.216965993245445 23 -3 10 6 10 null 0.0 0.037700653076171875 3 0.0 0.0 385408.0 542.4412036313804 0.0 - - - - - - - 286.8333333333333 770 6 1719 220 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 289902.0 42.216965993245445 23 -3 10 6 10 null 0.0 0.037700653076171875 3 0.0 0.0 289902.0 678.4466842696629 0.0 - - - - - - - 270.22222222222223 579 9 1721 221 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543480.[MT7]-IINDGAAILR.2y8_1.heavy 600.365 / 829.453 15535.0 33.74319839477539 50 20 10 10 10 45.345933997434834 2.205269385468097 0.0 3 0.9972057628061818 23.34154271320088 15535.0 84.03695238095239 0.0 - - - - - - - 223.125 31 8 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1723 221 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543480.[MT7]-IINDGAAILR.2y9_1.heavy 600.365 / 942.537 28656.0 33.74319839477539 50 20 10 10 10 45.345933997434834 2.205269385468097 0.0 3 0.9972057628061818 23.34154271320088 28656.0 63.452571428571424 0.0 - - - - - - - 195.0 57 7 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1725 221 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543480.[MT7]-IINDGAAILR.2b6_1.heavy 600.365 / 728.406 4304.0 33.74319839477539 50 20 10 10 10 45.345933997434834 2.205269385468097 0.0 3 0.9972057628061818 23.34154271320088 4304.0 23.159619047619046 0.0 - - - - - - - 300.0 8 14 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1727 221 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543480.[MT7]-IINDGAAILR.2b7_1.heavy 600.365 / 799.443 6193.0 33.74319839477539 50 20 10 10 10 45.345933997434834 2.205269385468097 0.0 3 0.9972057628061818 23.34154271320088 6193.0 19.78600306122449 0.0 - - - - - - - 210.0 12 14 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1729 222 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544150.[MT7]-APAQARPTVFR.3y10_2.heavy 453.266 / 571.825 260549.0 23.36115074157715 40 13 10 7 10 3.079658973228426 32.471127767490884 0.02610015869140625 3 0.9177746461948071 4.274031858848271 260549.0 325.6328850565296 0.0 - - - - - - - 271.90909090909093 521 11 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 1731 222 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544150.[MT7]-APAQARPTVFR.3b4_1.heavy 453.266 / 512.295 18906.0 23.36115074157715 40 13 10 7 10 3.079658973228426 32.471127767490884 0.02610015869140625 3 0.9177746461948071 4.274031858848271 18906.0 103.67785739756499 0.0 - - - - - - - 695.375 37 8 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 1733 222 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544150.[MT7]-APAQARPTVFR.3y4_1.heavy 453.266 / 522.304 8795.0 23.36115074157715 40 13 10 7 10 3.079658973228426 32.471127767490884 0.02610015869140625 3 0.9177746461948071 4.274031858848271 8795.0 18.750728656650693 0.0 - - - - - - - 635.375 17 8 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 1735 222 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544150.[MT7]-APAQARPTVFR.3y5_1.heavy 453.266 / 619.356 69101.0 23.36115074157715 40 13 10 7 10 3.079658973228426 32.471127767490884 0.02610015869140625 3 0.9177746461948071 4.274031858848271 69101.0 167.48820045203024 0.0 - - - - - - - 308.57894736842104 138 19 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit 1737 223 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38316.[MT7]-DYLDQLTQILK[MT7].2b3_1.heavy 819.471 / 536.284 2956.0 44.984500885009766 43 17 10 6 10 3.0997642589331353 25.25542201872784 0.03279876708984375 3 0.9738787843752414 7.61931202760538 2956.0 18.962643810479044 0.0 - - - - - - - 182.54545454545453 5 22 MAPK13 mitogen-activated protein kinase 13 1739 223 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38316.[MT7]-DYLDQLTQILK[MT7].2b4_1.heavy 819.471 / 651.311 6531.0 44.984500885009766 43 17 10 6 10 3.0997642589331353 25.25542201872784 0.03279876708984375 3 0.9738787843752414 7.61931202760538 6531.0 33.94473979777509 0.0 - - - - - - - 215.125 13 24 MAPK13 mitogen-activated protein kinase 13 1741 223 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38316.[MT7]-DYLDQLTQILK[MT7].2b5_1.heavy 819.471 / 779.369 2868.0 44.984500885009766 43 17 10 6 10 3.0997642589331353 25.25542201872784 0.03279876708984375 3 0.9738787843752414 7.61931202760538 2868.0 26.056308678726815 0.0 - - - - - - - 193.5 5 26 MAPK13 mitogen-activated protein kinase 13 1743 223 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38316.[MT7]-DYLDQLTQILK[MT7].2y7_1.heavy 819.471 / 987.632 2603.0 44.984500885009766 43 17 10 6 10 3.0997642589331353 25.25542201872784 0.03279876708984375 3 0.9738787843752414 7.61931202760538 2603.0 30.08115328037658 1.0 - - - - - - - 165.95238095238096 5 21 MAPK13 mitogen-activated protein kinase 13 1745 224 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37998.[MT7]-REAVQEER.2y6_1.heavy 580.811 / 731.368 413.0 13.847200393676758 33 7 10 6 10 0.8829987202322084 72.2570953592194 0.03380012512207031 3 0.7194967202709865 2.273396082653578 413.0 9.517336152219873 0.0 - - - - - - - 0.0 0 0 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 1747 224 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37998.[MT7]-REAVQEER.2b4_1.heavy 580.811 / 600.359 152.0 13.847200393676758 33 7 10 6 10 0.8829987202322084 72.2570953592194 0.03380012512207031 3 0.7194967202709865 2.273396082653578 152.0 0.4 3.0 - - - - - - - 0.0 0 0 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 1749 224 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37998.[MT7]-REAVQEER.2b6_1.heavy 580.811 / 857.46 2304.0 13.847200393676758 33 7 10 6 10 0.8829987202322084 72.2570953592194 0.03380012512207031 3 0.7194967202709865 2.273396082653578 2304.0 73.4294670846395 0.0 - - - - - - - 87.0 4 8 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 1751 224 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37998.[MT7]-REAVQEER.2y7_1.heavy 580.811 / 860.411 804.0 13.847200393676758 33 7 10 6 10 0.8829987202322084 72.2570953592194 0.03380012512207031 3 0.7194967202709865 2.273396082653578 804.0 21.113989266547406 0.0 - - - - - - - 0.0 1 0 RXRA;RXRB;RXRG retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma 1753 225 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544153.[MT7]-EHTIEEWK[MT7].3y3_1.heavy 453.91 / 606.337 8276.0 25.825700759887695 48 18 10 10 10 3.918573835854457 25.51948851518698 0.0 3 0.982972941906462 9.444400561966212 8276.0 17.50980278805121 0.0 - - - - - - - 617.2 16 10 MAPK8;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 10 1755 225 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544153.[MT7]-EHTIEEWK[MT7].3b5_1.heavy 453.91 / 754.385 1718.0 25.825700759887695 48 18 10 10 10 3.918573835854457 25.51948851518698 0.0 3 0.982972941906462 9.444400561966212 1718.0 8.643203167045215 0.0 - - - - - - - 227.5 3 12 MAPK8;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 10 1757 225 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544153.[MT7]-EHTIEEWK[MT7].3b3_1.heavy 453.91 / 512.258 7496.0 25.825700759887695 48 18 10 10 10 3.918573835854457 25.51948851518698 0.0 3 0.982972941906462 9.444400561966212 7496.0 20.404496410256414 0.0 - - - - - - - 580.4285714285714 14 7 MAPK8;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 10 1759 225 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544153.[MT7]-EHTIEEWK[MT7].3y4_1.heavy 453.91 / 735.379 9369.0 25.825700759887695 48 18 10 10 10 3.918573835854457 25.51948851518698 0.0 3 0.982972941906462 9.444400561966212 9369.0 57.65538461538462 0.0 - - - - - - - 172.71428571428572 18 14 MAPK8;MAPK10 mitogen-activated protein kinase 8;mitogen-activated protein kinase 10 1761 226 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544777.[MT7]-AC[CAM]ISIGNQNFEVK[MT7].3y3_1.heavy 589.982 / 519.326 9244.0 32.997798919677734 46 16 10 10 10 2.4725725739927316 32.94208526353921 0.0 3 0.9681030090404948 6.891699156350702 9244.0 12.901582683982683 0.0 - - - - - - - 326.6666666666667 18 9 MAP2K6 mitogen-activated protein kinase kinase 6 1763 226 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544777.[MT7]-AC[CAM]ISIGNQNFEVK[MT7].3b6_1.heavy 589.982 / 746.399 5987.0 32.997798919677734 46 16 10 10 10 2.4725725739927316 32.94208526353921 0.0 3 0.9681030090404948 6.891699156350702 5987.0 19.547726522288045 0.0 - - - - - - - 193.84615384615384 11 13 MAP2K6 mitogen-activated protein kinase kinase 6 1765 226 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544777.[MT7]-AC[CAM]ISIGNQNFEVK[MT7].3b4_1.heavy 589.982 / 576.293 9559.0 32.997798919677734 46 16 10 10 10 2.4725725739927316 32.94208526353921 0.0 3 0.9681030090404948 6.891699156350702 9559.0 19.42146031746032 0.0 - - - - - - - 682.5 19 10 MAP2K6 mitogen-activated protein kinase kinase 6 1767 226 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544777.[MT7]-AC[CAM]ISIGNQNFEVK[MT7].3y4_1.heavy 589.982 / 666.394 5882.0 32.997798919677734 46 16 10 10 10 2.4725725739927316 32.94208526353921 0.0 3 0.9681030090404948 6.891699156350702 5882.0 14.7384126984127 1.0 - - - - - - - 253.75 11 12 MAP2K6 mitogen-activated protein kinase kinase 6 1769 227 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542511.[MT7]-AVDSTLK[MT7].2y4_1.heavy 511.31 / 592.379 4582.0 21.245332717895508 36 20 0 6 10 19.11080672256604 5.232641481425271 0.031099319458007812 3 0.9993532077568463 48.52399589993797 4582.0 20.112368369075956 0.0 - - - - - - - 269.8888888888889 9 18 BIRC6 baculoviral IAP repeat-containing 6 1771 227 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542511.[MT7]-AVDSTLK[MT7].2y5_1.heavy 511.31 / 707.406 1987.0 21.245332717895508 36 20 0 6 10 19.11080672256604 5.232641481425271 0.031099319458007812 3 0.9993532077568463 48.52399589993797 1987.0 13.494574236852538 0.0 - - - - - - - 200.08333333333334 3 24 BIRC6 baculoviral IAP repeat-containing 6 1773 227 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542511.[MT7]-AVDSTLK[MT7].2y3_1.heavy 511.31 / 505.347 N/A 21.245332717895508 36 20 0 6 10 19.11080672256604 5.232641481425271 0.031099319458007812 3 0.9993532077568463 48.52399589993797 3644.0 0.48257101836603666 23.0 - - - - - - - 2287.1428571428573 31 7 BIRC6 baculoviral IAP repeat-containing 6 1775 227 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542511.[MT7]-AVDSTLK[MT7].2y6_1.heavy 511.31 / 806.474 2871.0 21.245332717895508 36 20 0 6 10 19.11080672256604 5.232641481425271 0.031099319458007812 3 0.9993532077568463 48.52399589993797 2871.0 22.499386687019573 0.0 - - - - - - - 165.55555555555554 5 18 BIRC6 baculoviral IAP repeat-containing 6 1777 228 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22915.[MT7]-YAGYSFEK[MT7].2y6_1.heavy 626.826 / 874.443 1007.0 28.275400161743164 31 14 10 5 2 1.6395820015075515 51.31778318792689 0.04199981689453125 13 0.9372923427801126 4.902369763890308 1007.0 12.10797619047619 0.0 - - - - - - - 140.0 2 15 MAPK8 mitogen-activated protein kinase 8 1779 228 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22915.[MT7]-YAGYSFEK[MT7].2y4_1.heavy 626.826 / 654.358 N/A 28.275400161743164 31 14 10 5 2 1.6395820015075515 51.31778318792689 0.04199981689453125 13 0.9372923427801126 4.902369763890308 1511.0 6.35579365079365 0.0 - - - - - - - 184.8 3 15 MAPK8 mitogen-activated protein kinase 8 1781 228 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22915.[MT7]-YAGYSFEK[MT7].2y3_1.heavy 626.826 / 567.326 504.0 28.275400161743164 31 14 10 5 2 1.6395820015075515 51.31778318792689 0.04199981689453125 13 0.9372923427801126 4.902369763890308 504.0 0.5714285714285713 17.0 - - - - - - - 0.0 1 0 MAPK8 mitogen-activated protein kinase 8 1783 228 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22915.[MT7]-YAGYSFEK[MT7].2y7_1.heavy 626.826 / 945.48 1931.0 28.275400161743164 31 14 10 5 2 1.6395820015075515 51.31778318792689 0.04199981689453125 13 0.9372923427801126 4.902369763890308 1931.0 28.505238095238095 0.0 - - - - - - - 196.0 3 12 MAPK8 mitogen-activated protein kinase 8 1785 229 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38087.[MT7]-AHEAQDAGYR.2y8_1.heavy 631.306 / 909.406 1475.0 14.744799613952637 45 15 10 10 10 1.7966566548463192 37.509092054496094 0.0 3 0.9560966970991289 5.8682946676968415 1475.0 55.86206896551724 0.0 - - - - - - - 67.14285714285714 2 7 PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 1787 229 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38087.[MT7]-AHEAQDAGYR.2y5_1.heavy 631.306 / 581.268 560.0 14.744799613952637 45 15 10 10 10 1.7966566548463192 37.509092054496094 0.0 3 0.9560966970991289 5.8682946676968415 560.0 14.522033898305082 0.0 - - - - - - - 0.0 1 0 PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 1789 229 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38087.[MT7]-AHEAQDAGYR.2y9_1.heavy 631.306 / 1046.46 2212.0 14.744799613952637 45 15 10 10 10 1.7966566548463192 37.509092054496094 0.0 3 0.9560966970991289 5.8682946676968415 2212.0 137.29655172413794 0.0 - - - - - - - 147.16666666666666 4 6 PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 1791 229 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38087.[MT7]-AHEAQDAGYR.2y7_1.heavy 631.306 / 780.364 1652.0 14.744799613952637 45 15 10 10 10 1.7966566548463192 37.509092054496094 0.0 3 0.9560966970991289 5.8682946676968415 1652.0 68.06896551724138 0.0 - - - - - - - 64.6 3 10 PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 1793 230 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544772.[MT7]-TSNFSLMTELSIK[MT7].3b6_1.heavy 586.99 / 794.417 4900.0 40.36582374572754 39 13 10 6 10 1.3440977875247644 53.0695912915222 0.03730010986328125 3 0.924275776419515 4.456208918343804 4900.0 23.113207547169814 0.0 - - - - - - - 210.9375 9 16 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 1795 230 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544772.[MT7]-TSNFSLMTELSIK[MT7].3b4_1.heavy 586.99 / 594.3 3178.0 40.36582374572754 39 13 10 6 10 1.3440977875247644 53.0695912915222 0.03730010986328125 3 0.924275776419515 4.456208918343804 3178.0 6.898208348922978 0.0 - - - - - - - 212.47368421052633 6 19 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 1797 230 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544772.[MT7]-TSNFSLMTELSIK[MT7].3b5_1.heavy 586.99 / 681.332 3708.0 40.36582374572754 39 13 10 6 10 1.3440977875247644 53.0695912915222 0.03730010986328125 3 0.924275776419515 4.456208918343804 3708.0 12.90683833816582 0.0 - - - - - - - 277.1875 7 16 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 1799 230 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544772.[MT7]-TSNFSLMTELSIK[MT7].3y4_1.heavy 586.99 / 604.415 5761.0 40.36582374572754 39 13 10 6 10 1.3440977875247644 53.0695912915222 0.03730010986328125 3 0.924275776419515 4.456208918343804 5761.0 11.959690687159107 0.0 - - - - - - - 677.0 11 9 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 1801 231 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541368.[MT7]-QEGAK[MT7].2b3_1.heavy 410.742 / 459.232 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALDH2;FOXRED1;DUS1L aldehyde dehydrogenase 2 family (mitochondrial);FAD-dependent oxidoreductase domain containing 1;dihydrouridine synthase 1-like (S. cerevisiae) 1803 231 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541368.[MT7]-QEGAK[MT7].2y4_1.heavy 410.742 / 548.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALDH2;FOXRED1;DUS1L aldehyde dehydrogenase 2 family (mitochondrial);FAD-dependent oxidoreductase domain containing 1;dihydrouridine synthase 1-like (S. cerevisiae) 1805 231 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541368.[MT7]-QEGAK[MT7].2b4_1.heavy 410.742 / 530.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALDH2;FOXRED1;DUS1L aldehyde dehydrogenase 2 family (mitochondrial);FAD-dependent oxidoreductase domain containing 1;dihydrouridine synthase 1-like (S. cerevisiae) 1807 231 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541368.[MT7]-QEGAK[MT7].2y3_1.heavy 410.742 / 419.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALDH2;FOXRED1;DUS1L aldehyde dehydrogenase 2 family (mitochondrial);FAD-dependent oxidoreductase domain containing 1;dihydrouridine synthase 1-like (S. cerevisiae) 1809 232 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22645.[MT7]-QHIYK[MT7].2b3_1.heavy 488.795 / 523.311 1715.0 16.76650047302246 46 16 10 10 10 2.666267667008404 37.50561177235504 0.0 3 0.9604381700440955 6.184176753713854 1715.0 13.526315789473683 0.0 - - - - - - - 144.66666666666666 3 15 MAPK13 mitogen-activated protein kinase 13 1811 232 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22645.[MT7]-QHIYK[MT7].2y4_1.heavy 488.795 / 704.421 5774.0 16.76650047302246 46 16 10 10 10 2.666267667008404 37.50561177235504 0.0 3 0.9604381700440955 6.184176753713854 5774.0 45.631408359082776 0.0 - - - - - - - 209.72222222222223 11 18 MAPK13 mitogen-activated protein kinase 13 1813 232 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22645.[MT7]-QHIYK[MT7].2y4_2.heavy 488.795 / 352.714 1201.0 16.76650047302246 46 16 10 10 10 2.666267667008404 37.50561177235504 0.0 3 0.9604381700440955 6.184176753713854 1201.0 16.856140350877194 0.0 - - - - - - - 231.88888888888889 2 18 MAPK13 mitogen-activated protein kinase 13 1815 232 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22645.[MT7]-QHIYK[MT7].2y3_1.heavy 488.795 / 567.362 3030.0 16.76650047302246 46 16 10 10 10 2.666267667008404 37.50561177235504 0.0 3 0.9604381700440955 6.184176753713854 3030.0 15.671774475524476 0.0 - - - - - - - 219.84615384615384 6 13 MAPK13 mitogen-activated protein kinase 13 1817 233 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22644.[MT7]-SINIIK[MT7].2y4_1.heavy 488.326 / 631.426 15082.0 28.543874740600586 44 18 10 6 10 5.14530708700338 19.435185948879848 0.03549957275390625 3 0.9875728224499215 11.059241335656091 15082.0 19.23664490057501 0.0 - - - - - - - 328.0833333333333 30 12 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1819 233 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22644.[MT7]-SINIIK[MT7].2y5_1.heavy 488.326 / 744.51 6535.0 28.543874740600586 44 18 10 6 10 5.14530708700338 19.435185948879848 0.03549957275390625 3 0.9875728224499215 11.059241335656091 6535.0 27.688574523011184 0.0 - - - - - - - 240.9375 13 16 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1821 233 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22644.[MT7]-SINIIK[MT7].2b4_1.heavy 488.326 / 572.352 12736.0 28.543874740600586 44 18 10 6 10 5.14530708700338 19.435185948879848 0.03549957275390625 3 0.9875728224499215 11.059241335656091 12736.0 17.054854415274463 0.0 - - - - - - - 1077.0 25 7 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1823 233 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22644.[MT7]-SINIIK[MT7].2y3_1.heavy 488.326 / 517.383 7206.0 28.543874740600586 44 18 10 6 10 5.14530708700338 19.435185948879848 0.03549957275390625 3 0.9875728224499215 11.059241335656091 7206.0 11.122697460763046 2.0 - - - - - - - 729.2 14 10 PRIM1 primase, DNA, polypeptide 1 (49kDa) 1825 234 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544774.[MT7]-DRDDFPVVLVGNK[MT7].3b4_1.heavy 587.996 / 646.291 8936.0 33.63094902038574 34 9 10 5 10 1.890810066188448 52.887385035760374 0.045299530029296875 3 0.8014288504864342 2.7223303341211977 8936.0 26.912880827188346 0.0 - - - - - - - 227.66666666666666 17 6 RRAS related RAS viral (r-ras) oncogene homolog 1827 234 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544774.[MT7]-DRDDFPVVLVGNK[MT7].3b5_1.heavy 587.996 / 793.36 12511.0 33.63094902038574 34 9 10 5 10 1.890810066188448 52.887385035760374 0.045299530029296875 3 0.8014288504864342 2.7223303341211977 12511.0 76.0299824164214 0.0 - - - - - - - 268.6666666666667 25 9 RRAS related RAS viral (r-ras) oncogene homolog 1829 234 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544774.[MT7]-DRDDFPVVLVGNK[MT7].3y4_1.heavy 587.996 / 561.348 43314.0 33.63094902038574 34 9 10 5 10 1.890810066188448 52.887385035760374 0.045299530029296875 3 0.8014288504864342 2.7223303341211977 43314.0 41.72520121909183 0.0 - - - - - - - 368.0 86 2 RRAS related RAS viral (r-ras) oncogene homolog 1831 234 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544774.[MT7]-DRDDFPVVLVGNK[MT7].3b7_1.heavy 587.996 / 989.481 10618.0 33.63094902038574 34 9 10 5 10 1.890810066188448 52.887385035760374 0.045299530029296875 3 0.8014288504864342 2.7223303341211977 10618.0 67.6145319572696 0.0 - - - - - - - 221.88888888888889 21 9 RRAS related RAS viral (r-ras) oncogene homolog 1833 235 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22643.[MT7]-TTPQLK[MT7].2y4_1.heavy 488.307 / 629.41 18561.0 20.51474952697754 40 17 10 3 10 4.975750354373821 20.097471311457028 0.06229972839355469 3 0.9756088101888041 7.886043277344517 18561.0 45.65188533982926 0.0 - - - - - - - 779.4444444444445 37 9 LTB4R2 leukotriene B4 receptor 2 1835 235 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22643.[MT7]-TTPQLK[MT7].2y5_1.heavy 488.307 / 730.458 7623.0 20.51474952697754 40 17 10 3 10 4.975750354373821 20.097471311457028 0.06229972839355469 3 0.9756088101888041 7.886043277344517 7623.0 31.12232558139535 0.0 - - - - - - - 215.86363636363637 15 22 LTB4R2 leukotriene B4 receptor 2 1837 235 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22643.[MT7]-TTPQLK[MT7].2b4_1.heavy 488.307 / 572.316 2265.0 20.51474952697754 40 17 10 3 10 4.975750354373821 20.097471311457028 0.06229972839355469 3 0.9756088101888041 7.886043277344517 2265.0 5.814277393711988 1.0 - - - - - - - 613.6666666666666 4 9 LTB4R2 leukotriene B4 receptor 2 1839 235 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22643.[MT7]-TTPQLK[MT7].2y3_1.heavy 488.307 / 532.357 1547.0 20.51474952697754 40 17 10 3 10 4.975750354373821 20.097471311457028 0.06229972839355469 3 0.9756088101888041 7.886043277344517 1547.0 3.8166118421052633 6.0 - - - - - - - 335.8 6 25 LTB4R2 leukotriene B4 receptor 2 1841 236 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38598.[MT7]-SQATGFPSLITIFSAPNYLDVYNNK[MT7].3b9_1.heavy 1016.87 / 1033.54 427.0 50.02690124511719 44 14 10 10 10 1.9409311476676498 51.521662744279496 0.0 3 0.9412282655824795 5.065563913009989 427.0 12.182058823529411 0.0 - - - - - - - 0.0 0 0 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1843 236 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38598.[MT7]-SQATGFPSLITIFSAPNYLDVYNNK[MT7].3b8_1.heavy 1016.87 / 920.459 256.0 50.02690124511719 44 14 10 10 10 1.9409311476676498 51.521662744279496 0.0 3 0.9412282655824795 5.065563913009989 256.0 7.669960784313725 0.0 - - - - - - - 0.0 0 0 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1845 236 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38598.[MT7]-SQATGFPSLITIFSAPNYLDVYNNK[MT7].3b6_1.heavy 1016.87 / 736.375 1792.0 50.02690124511719 44 14 10 10 10 1.9409311476676498 51.521662744279496 0.0 3 0.9412282655824795 5.065563913009989 1792.0 97.4097037355088 0.0 - - - - - - - 90.625 3 16 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1847 236 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38598.[MT7]-SQATGFPSLITIFSAPNYLDVYNNK[MT7].3b5_1.heavy 1016.87 / 589.306 461.0 50.02690124511719 44 14 10 10 10 1.9409311476676498 51.521662744279496 0.0 3 0.9412282655824795 5.065563913009989 461.0 14.892107843137254 0.0 - - - - - - - 0.0 0 0 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1849 237 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22859.[MT7]-APTNIVYK[MT7].2y5_1.heavy 597.36 / 780.474 1512.0 26.025699615478516 38 12 10 6 10 2.8467260730693154 35.128072541303865 0.0391998291015625 3 0.8965948926411782 3.8043107124444933 1512.0 3.5712 0.0 - - - - - - - 252.0 3 17 RPA2 replication protein A2, 32kDa 1851 237 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22859.[MT7]-APTNIVYK[MT7].2b4_1.heavy 597.36 / 528.29 1512.0 26.025699615478516 38 12 10 6 10 2.8467260730693154 35.128072541303865 0.0391998291015625 3 0.8965948926411782 3.8043107124444933 1512.0 1.4 2.0 - - - - - - - 619.5 3 8 RPA2 replication protein A2, 32kDa 1853 237 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22859.[MT7]-APTNIVYK[MT7].2y3_1.heavy 597.36 / 553.347 4033.0 26.025699615478516 38 12 10 6 10 2.8467260730693154 35.128072541303865 0.0391998291015625 3 0.8965948926411782 3.8043107124444933 4033.0 10.442589285714286 0.0 - - - - - - - 619.5 8 8 RPA2 replication protein A2, 32kDa 1855 237 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22859.[MT7]-APTNIVYK[MT7].2y7_1.heavy 597.36 / 978.574 13107.0 26.025699615478516 38 12 10 6 10 2.8467260730693154 35.128072541303865 0.0391998291015625 3 0.8965948926411782 3.8043107124444933 13107.0 285.54535714285714 0.0 - - - - - - - 145.0909090909091 26 11 RPA2 replication protein A2, 32kDa 1857 238 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544671.[MT7]-DYLDQLTQILK[MT7].3y3_1.heavy 546.65 / 517.383 119272.0 45.00090026855469 42 12 10 10 10 0.9658014391496021 63.0387838480509 0.0 3 0.8981584307871557 3.8339217440494644 119272.0 638.7989112936687 0.0 - - - - - - - 733.75 238 8 MAPK13 mitogen-activated protein kinase 13 1859 238 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544671.[MT7]-DYLDQLTQILK[MT7].3b4_1.heavy 546.65 / 651.311 105019.0 45.00090026855469 42 12 10 10 10 0.9658014391496021 63.0387838480509 0.0 3 0.8981584307871557 3.8339217440494644 105019.0 817.0299190340909 0.0 - - - - - - - 250.875 210 16 MAPK13 mitogen-activated protein kinase 13 1861 238 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544671.[MT7]-DYLDQLTQILK[MT7].3b5_1.heavy 546.65 / 779.369 129156.0 45.00090026855469 42 12 10 10 10 0.9658014391496021 63.0387838480509 0.0 3 0.8981584307871557 3.8339217440494644 129156.0 1091.40544630596 0.0 - - - - - - - 234.07692307692307 258 13 MAPK13 mitogen-activated protein kinase 13 1863 238 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544671.[MT7]-DYLDQLTQILK[MT7].3b3_1.heavy 546.65 / 536.284 51495.0 45.00090026855469 42 12 10 10 10 0.9658014391496021 63.0387838480509 0.0 3 0.8981584307871557 3.8339217440494644 51495.0 282.64654930947285 0.0 - - - - - - - 267.3529411764706 102 17 MAPK13 mitogen-activated protein kinase 13 1865 239 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543490.[MT7]-LLLRLPALR.3y4_1.heavy 403.616 / 456.293 20512.0 39.49409866333008 41 15 10 6 10 3.290655792876266 30.389079349011134 0.03459930419921875 3 0.9514973924991692 5.580956498875018 20512.0 157.66086274509803 0.0 - - - - - - - 186.23076923076923 41 13 NR2F6;RXRA;RXRB;RXRG;NR2C1 nuclear receptor subfamily 2, group F, member 6;retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma;nuclear receptor subfamily 2, group C, member 1 1867 239 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543490.[MT7]-LLLRLPALR.3b4_2.heavy 403.616 / 320.735 11275.0 39.49409866333008 41 15 10 6 10 3.290655792876266 30.389079349011134 0.03459930419921875 3 0.9514973924991692 5.580956498875018 11275.0 54.30890052356021 1.0 - - - - - - - 226.0 22 11 NR2F6;RXRA;RXRB;RXRG;NR2C1 nuclear receptor subfamily 2, group F, member 6;retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma;nuclear receptor subfamily 2, group C, member 1 1869 239 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543490.[MT7]-LLLRLPALR.3y8_2.heavy 403.616 / 476.327 11020.0 39.49409866333008 41 15 10 6 10 3.290655792876266 30.389079349011134 0.03459930419921875 3 0.9514973924991692 5.580956498875018 11020.0 55.38848167539267 0.0 - - - - - - - 220.0909090909091 22 11 NR2F6;RXRA;RXRB;RXRG;NR2C1 nuclear receptor subfamily 2, group F, member 6;retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma;nuclear receptor subfamily 2, group C, member 1 1871 239 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB543490.[MT7]-LLLRLPALR.3y5_1.heavy 403.616 / 569.377 8217.0 39.49409866333008 41 15 10 6 10 3.290655792876266 30.389079349011134 0.03459930419921875 3 0.9514973924991692 5.580956498875018 8217.0 81.30958115183245 0.0 - - - - - - - 135.375 16 8 NR2F6;RXRA;RXRB;RXRG;NR2C1 nuclear receptor subfamily 2, group F, member 6;retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma;nuclear receptor subfamily 2, group C, member 1 1873 240 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38048.[MT7]-AEVASAVC[CAM]LR.2y9_1.heavy 610.333 / 1004.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - BIRC6 baculoviral IAP repeat-containing 6 1875 240 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38048.[MT7]-AEVASAVC[CAM]LR.2b6_1.heavy 610.333 / 673.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - BIRC6 baculoviral IAP repeat-containing 6 1877 240 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38048.[MT7]-AEVASAVC[CAM]LR.2y6_1.heavy 610.333 / 705.371 N/A N/A - - - - - - - - - 0.0 - - - - - - - BIRC6 baculoviral IAP repeat-containing 6 1879 240 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38048.[MT7]-AEVASAVC[CAM]LR.2y7_1.heavy 610.333 / 776.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - BIRC6 baculoviral IAP repeat-containing 6 1881 241 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541889.[MT7]-SFQNK[MT7].2b3_1.heavy 456.263 / 507.268 1831.0 16.98965072631836 42 17 10 5 10 3.1046619774042585 27.09769389658034 0.041500091552734375 3 0.975481683488808 7.865488182904318 1831.0 6.295005132009074 0.0 - - - - - - - 215.35294117647058 3 17 RPA2 replication protein A2, 32kDa 1883 241 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541889.[MT7]-SFQNK[MT7].2y4_1.heavy 456.263 / 680.385 4955.0 16.98965072631836 42 17 10 5 10 3.1046619774042585 27.09769389658034 0.041500091552734375 3 0.975481683488808 7.865488182904318 4955.0 26.38575851393189 0.0 - - - - - - - 168.86666666666667 9 15 RPA2 replication protein A2, 32kDa 1885 241 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541889.[MT7]-SFQNK[MT7].2b4_1.heavy 456.263 / 621.311 1077.0 16.98965072631836 42 17 10 5 10 3.1046619774042585 27.09769389658034 0.041500091552734375 3 0.975481683488808 7.865488182904318 1077.0 6.679592092092092 1.0 - - - - - - - 204.75 2 20 RPA2 replication protein A2, 32kDa 1887 241 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541889.[MT7]-SFQNK[MT7].2y3_1.heavy 456.263 / 533.316 1616.0 16.98965072631836 42 17 10 5 10 3.1046619774042585 27.09769389658034 0.041500091552734375 3 0.975481683488808 7.865488182904318 1616.0 5.261935962877031 0.0 - - - - - - - 263.22222222222223 3 18 RPA2 replication protein A2, 32kDa 1889 242 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22922.[MT7]-AHEAQDAGYR.3b4_1.heavy 421.206 / 553.285 16594.0 14.744799613952637 50 20 10 10 10 29.07697086294816 3.439147787138541 0.0 3 0.9997222106335727 74.04479022881318 16594.0 84.92839448469269 0.0 - - - - - - - 252.22727272727272 33 22 PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 1891 242 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22922.[MT7]-AHEAQDAGYR.3b3_1.heavy 421.206 / 482.248 17957.0 14.744799613952637 50 20 10 10 10 29.07697086294816 3.439147787138541 0.0 3 0.9997222106335727 74.04479022881318 17957.0 66.54832681522274 0.0 - - - - - - - 216.77272727272728 35 22 PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 1893 242 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22922.[MT7]-AHEAQDAGYR.3y4_1.heavy 421.206 / 466.241 52460.0 14.744799613952637 50 20 10 10 10 29.07697086294816 3.439147787138541 0.0 3 0.9997222106335727 74.04479022881318 52460.0 108.76074594221251 0.0 - - - - - - - 270.6875 104 16 PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 1895 242 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22922.[MT7]-AHEAQDAGYR.3y5_1.heavy 421.206 / 581.268 41170.0 14.744799613952637 50 20 10 10 10 29.07697086294816 3.439147787138541 0.0 3 0.9997222106335727 74.04479022881318 41170.0 394.07585616438354 0.0 - - - - - - - 213.55555555555554 82 18 PPP3CA;PPP3CB;PPP3CC protein phosphatase 3, catalytic subunit, alpha isozyme;protein phosphatase 3, catalytic subunit, beta isozyme;protein phosphatase 3, catalytic subunit, gamma isozyme 1897 243 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22729.[MT7]-EQGQNLAR.2b4_1.heavy 530.287 / 587.291 3350.0 15.808600425720215 47 17 10 10 10 2.7823307306930127 29.610146204654843 0.0 3 0.9773264832155664 8.18048235013852 3350.0 11.257779886148008 0.0 - - - - - - - 203.72222222222223 6 18 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1899 243 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22729.[MT7]-EQGQNLAR.2y6_1.heavy 530.287 / 658.363 8986.0 15.808600425720215 47 17 10 10 10 2.7823307306930127 29.610146204654843 0.0 3 0.9773264832155664 8.18048235013852 8986.0 27.133468692608346 0.0 - - - - - - - 223.4 17 15 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1901 243 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22729.[MT7]-EQGQNLAR.2b5_1.heavy 530.287 / 701.333 6381.0 15.808600425720215 47 17 10 10 10 2.7823307306930127 29.610146204654843 0.0 3 0.9773264832155664 8.18048235013852 6381.0 57.818450704225356 0.0 - - - - - - - 166.125 12 16 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1903 243 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22729.[MT7]-EQGQNLAR.2y7_1.heavy 530.287 / 786.422 18610.0 15.808600425720215 47 17 10 10 10 2.7823307306930127 29.610146204654843 0.0 3 0.9773264832155664 8.18048235013852 18610.0 196.4873517942254 0.0 - - - - - - - 146.125 37 16 LOC100508643;LOC100510068;RAP1A;RAP1B ras-related protein Rap-1b-like protein-like;ras-related protein Rap-1b-like protein-like;RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 1905 244 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22636.[MT7]-ADLESQR.2y4_1.heavy 481.755 / 519.252 11866.0 17.217599868774414 45 15 10 10 10 3.069456372083354 32.579058920497474 0.0 3 0.9512105767442858 5.564392665959169 11866.0 36.39607951229809 1.0 - - - - - - - 216.6 32 15 RRAS related RAS viral (r-ras) oncogene homolog 1907 244 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22636.[MT7]-ADLESQR.2y5_1.heavy 481.755 / 632.336 37252.0 17.217599868774414 45 15 10 10 10 3.069456372083354 32.579058920497474 0.0 3 0.9512105767442858 5.564392665959169 37252.0 39.83798842290548 0.0 - - - - - - - 306.9230769230769 74 13 RRAS related RAS viral (r-ras) oncogene homolog 1909 244 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22636.[MT7]-ADLESQR.2b4_1.heavy 481.755 / 573.3 26356.0 17.217599868774414 45 15 10 10 10 3.069456372083354 32.579058920497474 0.0 3 0.9512105767442858 5.564392665959169 26356.0 56.077839416058396 0.0 - - - - - - - 646.3333333333334 52 9 RRAS related RAS viral (r-ras) oncogene homolog 1911 244 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22636.[MT7]-ADLESQR.2y6_1.heavy 481.755 / 747.363 36853.0 17.217599868774414 45 15 10 10 10 3.069456372083354 32.579058920497474 0.0 3 0.9512105767442858 5.564392665959169 36853.0 96.790585839599 0.0 - - - - - - - 223.25 73 12 RRAS related RAS viral (r-ras) oncogene homolog 1913 245 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22635.[MT7]-NLQC[CAM]QR.2y4_1.heavy 481.752 / 591.267 5032.0 15.109800338745117 47 17 10 10 10 1.7793872073963004 43.894871118520896 0.0 3 0.9713675456658608 7.275977634928068 5032.0 86.86524244643256 0.0 - - - - - - - 164.4 10 15 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 1915 245 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22635.[MT7]-NLQC[CAM]QR.2b3_1.heavy 481.752 / 500.295 3108.0 15.109800338745117 47 17 10 10 10 1.7793872073963004 43.894871118520896 0.0 3 0.9713675456658608 7.275977634928068 3108.0 31.409835059455315 0.0 - - - - - - - 182.65 6 20 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 1917 245 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22635.[MT7]-NLQC[CAM]QR.2y5_1.heavy 481.752 / 704.351 8238.0 15.109800338745117 47 17 10 10 10 1.7793872073963004 43.894871118520896 0.0 3 0.9713675456658608 7.275977634928068 8238.0 48.93988565488564 0.0 - - - - - - - 172.55555555555554 16 18 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 1919 245 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22635.[MT7]-NLQC[CAM]QR.2y3_1.heavy 481.752 / 463.208 2368.0 15.109800338745117 47 17 10 10 10 1.7793872073963004 43.894871118520896 0.0 3 0.9713675456658608 7.275977634928068 2368.0 4.786666666666666 0.0 - - - - - - - 725.9285714285714 4 14 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 1921 246 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544786.[MT7]-GGGPGPGDPPPSETHK[MT7].4y5_1.heavy 444.48 / 745.396 1633.0 16.190250396728516 46 20 10 6 10 11.112779625645212 8.998648706146188 0.03820037841796875 3 0.9939022533962566 15.796350127063885 1633.0 4.993168712254042 0.0 - - - - - - - 265.6470588235294 3 17 RRAS related RAS viral (r-ras) oncogene homolog 1923 246 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544786.[MT7]-GGGPGPGDPPPSETHK[MT7].4y3_1.heavy 444.48 / 529.321 1579.0 16.190250396728516 46 20 10 6 10 11.112779625645212 8.998648706146188 0.03820037841796875 3 0.9939022533962566 15.796350127063885 1579.0 3.8542519685039367 5.0 - - - - - - - 266.1111111111111 3 18 RRAS related RAS viral (r-ras) oncogene homolog 1925 246 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544786.[MT7]-GGGPGPGDPPPSETHK[MT7].4y6_1.heavy 444.48 / 842.449 2069.0 16.190250396728516 46 20 10 6 10 11.112779625645212 8.998648706146188 0.03820037841796875 3 0.9939022533962566 15.796350127063885 2069.0 2.21791730474732 1.0 - - - - - - - 199.5 4 12 RRAS related RAS viral (r-ras) oncogene homolog 1927 246 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544786.[MT7]-GGGPGPGDPPPSETHK[MT7].4b3_1.heavy 444.48 / 316.174 8764.0 16.190250396728516 46 20 10 6 10 11.112779625645212 8.998648706146188 0.03820037841796875 3 0.9939022533962566 15.796350127063885 8764.0 14.375701537307835 0.0 - - - - - - - 832.1428571428571 17 7 RRAS related RAS viral (r-ras) oncogene homolog 1929 247 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38051.[MT7]-ALEHLHSK[MT7].3y3_1.heavy 408.243 / 515.306 12646.0 18.45224952697754 41 14 10 7 10 1.9711808858059645 50.731011405436085 0.02899932861328125 3 0.9356980418684727 4.840555168833627 12646.0 24.005787482274506 1.0 - - - - - - - 612.5555555555555 25 9 LOC100133591;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1931 247 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38051.[MT7]-ALEHLHSK[MT7].3b4_1.heavy 408.243 / 595.332 14094.0 18.45224952697754 41 14 10 7 10 1.9711808858059645 50.731011405436085 0.02899932861328125 3 0.9356980418684727 4.840555168833627 14094.0 104.2829596412556 0.0 - - - - - - - 157.47826086956522 28 23 LOC100133591;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1933 247 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38051.[MT7]-ALEHLHSK[MT7].3b5_1.heavy 408.243 / 708.416 1616.0 18.45224952697754 41 14 10 7 10 1.9711808858059645 50.731011405436085 0.02899932861328125 3 0.9356980418684727 4.840555168833627 1616.0 53.385714285714286 0.0 - - - - - - - 90.625 3 8 LOC100133591;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1935 247 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB38051.[MT7]-ALEHLHSK[MT7].3b3_1.heavy 408.243 / 458.273 14930.0 18.45224952697754 41 14 10 7 10 1.9711808858059645 50.731011405436085 0.02899932861328125 3 0.9356980418684727 4.840555168833627 14930.0 29.05538922155689 0.0 - - - - - - - 617.7272727272727 29 11 LOC100133591;MAP2K3;MAP2K6 dual specificity mitogen-activated protein kinase kinase 3-like;mitogen-activated protein kinase kinase 3;mitogen-activated protein kinase kinase 6 1937 248 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22639.[MT7]-WVSDSAR.2y5_1.heavy 482.752 / 535.247 2904.0 24.073999404907227 48 20 10 10 8 7.710137627754752 12.969937091657433 0.0 4 0.9949677963581117 17.39005582363244 2904.0 4.4 1.0 - - - - - - - 726.0 8 12 BIRC6 baculoviral IAP repeat-containing 6 1939 248 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22639.[MT7]-WVSDSAR.2y3_1.heavy 482.752 / 333.188 7063.0 24.073999404907227 48 20 10 10 8 7.710137627754752 12.969937091657433 0.0 4 0.9949677963581117 17.39005582363244 7063.0 12.310861179689 1.0 - - - - - - - 684.0 14 11 BIRC6 baculoviral IAP repeat-containing 6 1941 248 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22639.[MT7]-WVSDSAR.2y6_1.heavy 482.752 / 634.315 6403.0 24.073999404907227 48 20 10 10 8 7.710137627754752 12.969937091657433 0.0 4 0.9949677963581117 17.39005582363244 6403.0 14.205790043290044 0.0 - - - - - - - 718.6666666666666 12 9 BIRC6 baculoviral IAP repeat-containing 6 1943 248 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22639.[MT7]-WVSDSAR.2b5_1.heavy 482.752 / 719.348 2178.0 24.073999404907227 48 20 10 10 8 7.710137627754752 12.969937091657433 0.0 4 0.9949677963581117 17.39005582363244 2178.0 2.1214285714285714 1.0 - - - - - - - 775.5 6 8 BIRC6 baculoviral IAP repeat-containing 6 1945 249 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37892.[MT7]-VQFGANK[MT7].2y4_1.heavy 526.311 / 533.316 2132.0 23.74244976043701 44 18 10 6 10 4.722734389128221 21.174174061154265 0.030698776245117188 3 0.9862212309115308 10.501642357757149 2132.0 4.835541844619046 1.0 - - - - - - - 737.4545454545455 4 11 UBE2Q1;UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 1;ubiquitin-conjugating enzyme E2Q family member 2 1947 249 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37892.[MT7]-VQFGANK[MT7].2y5_1.heavy 526.311 / 680.385 2310.0 23.74244976043701 44 18 10 6 10 4.722734389128221 21.174174061154265 0.030698776245117188 3 0.9862212309115308 10.501642357757149 2310.0 0.6497890295358648 1.0 - - - - - - - 232.4814814814815 4 27 UBE2Q1;UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 1;ubiquitin-conjugating enzyme E2Q family member 2 1949 249 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37892.[MT7]-VQFGANK[MT7].2b4_1.heavy 526.311 / 576.326 1007.0 23.74244976043701 44 18 10 6 10 4.722734389128221 21.174174061154265 0.030698776245117188 3 0.9862212309115308 10.501642357757149 1007.0 0.849789029535865 1.0 - - - - - - - 256.6666666666667 2 30 UBE2Q1;UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 1;ubiquitin-conjugating enzyme E2Q family member 2 1951 249 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB37892.[MT7]-VQFGANK[MT7].2y6_1.heavy 526.311 / 808.443 2487.0 23.74244976043701 44 18 10 6 10 4.722734389128221 21.174174061154265 0.030698776245117188 3 0.9862212309115308 10.501642357757149 2487.0 8.734031175162505 0.0 - - - - - - - 180.0 4 24 UBE2Q1;UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 1;ubiquitin-conjugating enzyme E2Q family member 2 1953 250 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544846.[MT7]-TLSAVGTPLNALGSPYR.3y6_1.heavy 621.015 / 692.373 99256.0 37.472373962402344 36 10 10 6 10 0.6853400097218841 83.71573718909798 0.0326995849609375 3 0.8359788750084225 3.0046184001298912 99256.0 175.29279606879606 0.0 - - - - - - - 696.4166666666666 198 12 RXRG retinoid X receptor, gamma 1955 250 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544846.[MT7]-TLSAVGTPLNALGSPYR.3b4_1.heavy 621.015 / 517.31 39768.0 37.472373962402344 36 10 10 6 10 0.6853400097218841 83.71573718909798 0.0326995849609375 3 0.8359788750084225 3.0046184001298912 39768.0 48.71712383488682 0.0 - - - - - - - 770.6 79 10 RXRG retinoid X receptor, gamma 1957 250 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544846.[MT7]-TLSAVGTPLNALGSPYR.3y8_1.heavy 621.015 / 877.453 27557.0 37.472373962402344 36 10 10 6 10 0.6853400097218841 83.71573718909798 0.0326995849609375 3 0.8359788750084225 3.0046184001298912 27557.0 35.18180650684932 0.0 - - - - - - - 216.0 55 13 RXRG retinoid X receptor, gamma 1959 250 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544846.[MT7]-TLSAVGTPLNALGSPYR.3y5_1.heavy 621.015 / 579.289 69806.0 37.472373962402344 36 10 10 6 10 0.6853400097218841 83.71573718909798 0.0326995849609375 3 0.8359788750084225 3.0046184001298912 69806.0 42.47100431931519 0.0 - - - - - - - 272.0 139 6 RXRG retinoid X receptor, gamma 1961 251 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22820.[MT7]-IRSFEEAR.2y5_1.heavy 576.318 / 651.31 N/A 23.478500366210938 41 17 10 10 4 4.009372334389549 24.94155984024507 0.0 9 0.9718998467355425 7.344897963170412 624.0 -0.9529632031718448 15.0 - - - - - - - 217.48387096774192 2 31 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1963 251 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22820.[MT7]-IRSFEEAR.2b6_1.heavy 576.318 / 906.48 2185.0 23.478500366210938 41 17 10 10 4 4.009372334389549 24.94155984024507 0.0 9 0.9718998467355425 7.344897963170412 2185.0 11.639578616049203 1.0 - - - - - - - 167.75 4 16 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1965 251 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22820.[MT7]-IRSFEEAR.2y6_1.heavy 576.318 / 738.342 749.0 23.478500366210938 41 17 10 10 4 4.009372334389549 24.94155984024507 0.0 9 0.9718998467355425 7.344897963170412 749.0 5.60107807486631 4.0 - - - - - - - 0.0 1 0 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1967 251 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22820.[MT7]-IRSFEEAR.2b7_1.heavy 576.318 / 977.517 250.0 23.478500366210938 41 17 10 10 4 4.009372334389549 24.94155984024507 0.0 9 0.9718998467355425 7.344897963170412 250.0 -0.5333333333333334 14.0 - - - - - - - 0.0 1 0 PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1969 252 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22536.[MT7]-SLPLK[MT7].2y4_1.heavy 423.289 / 614.436 2744.0 26.015899658203125 50 20 10 10 10 17.872934837257368 5.5950520107947295 0.0 2 0.995235823434789 17.872934896255273 2744.0 24.795180722891565 0.0 - - - - - - - 205.47368421052633 5 19 MECOM;DEPDC1 MDS1 and EVI1 complex locus;DEP domain containing 1 1971 252 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22536.[MT7]-SLPLK[MT7].2y3_1.heavy 423.289 / 501.352 9481.0 26.015899658203125 50 20 10 10 10 17.872934837257368 5.5950520107947295 0.0 2 0.995235823434789 17.872934896255273 9481.0 26.251059587471353 0.0 - - - - - - - 702.1111111111111 18 9 MECOM;DEPDC1 MDS1 and EVI1 complex locus;DEP domain containing 1 1973 253 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22825.[MT7]-AVPFPPTQR.2y8_1.heavy 578.833 / 941.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1975 253 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22825.[MT7]-AVPFPPTQR.2y5_1.heavy 578.833 / 598.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1977 253 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22825.[MT7]-AVPFPPTQR.2y6_1.heavy 578.833 / 745.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1979 253 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22825.[MT7]-AVPFPPTQR.2y7_1.heavy 578.833 / 842.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP3CC protein phosphatase 3, catalytic subunit, gamma isozyme 1981 254 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542103.[MT7]-SELGC[CAM]LR.2y4_1.heavy 489.762 / 505.255 4312.0 25.416799545288086 30 16 0 10 4 1.8606666255566509 36.4834100821611 0.0 7 0.9608705413149902 6.218477072840636 4312.0 10.50880503144654 0.0 - - - - - - - 760.0 8 8 RXRG retinoid X receptor, gamma 1983 254 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542103.[MT7]-SELGC[CAM]LR.2y5_1.heavy 489.762 / 618.339 3747.0 25.416799545288086 30 16 0 10 4 1.8606666255566509 36.4834100821611 0.0 7 0.9608705413149902 6.218477072840636 3747.0 5.744221698113208 5.0 - - - - - - - 761.3076923076923 176 13 RXRG retinoid X receptor, gamma 1985 254 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542103.[MT7]-SELGC[CAM]LR.2b4_1.heavy 489.762 / 531.289 2474.0 25.416799545288086 30 16 0 10 4 1.8606666255566509 36.4834100821611 0.0 7 0.9608705413149902 6.218477072840636 2474.0 4.550916871027476 3.0 - - - - - - - 714.0 4 10 RXRG retinoid X receptor, gamma 1987 254 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB542103.[MT7]-SELGC[CAM]LR.2y6_1.heavy 489.762 / 747.382 5443.0 25.416799545288086 30 16 0 10 4 1.8606666255566509 36.4834100821611 0.0 7 0.9608705413149902 6.218477072840636 5443.0 40.5476101740116 0.0 - - - - - - - 250.15384615384616 10 13 RXRG retinoid X receptor, gamma 1989 255 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544852.[MT7]-ELSEITTAEAEPVVPR.3y7_1.heavy 629.006 / 767.441 10385.0 33.217498779296875 48 18 10 10 10 3.787336926549821 20.91348788170582 0.0 3 0.9809360305106763 8.924077442344034 10385.0 68.73880952380952 0.0 - - - - - - - 210.0 20 10 TSC1 tuberous sclerosis 1 1991 255 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544852.[MT7]-ELSEITTAEAEPVVPR.3b4_1.heavy 629.006 / 603.311 24126.0 33.217498779296875 48 18 10 10 10 3.787336926549821 20.91348788170582 0.0 3 0.9809360305106763 8.924077442344034 24126.0 112.82186404943657 0.0 - - - - - - - 689.0 48 7 TSC1 tuberous sclerosis 1 1993 255 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544852.[MT7]-ELSEITTAEAEPVVPR.3b5_1.heavy 629.006 / 716.395 8706.0 33.217498779296875 48 18 10 10 10 3.787336926549821 20.91348788170582 0.0 3 0.9809360305106763 8.924077442344034 8706.0 17.731187673141438 0.0 - - - - - - - 248.1818181818182 17 11 TSC1 tuberous sclerosis 1 1995 255 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB544852.[MT7]-ELSEITTAEAEPVVPR.3y5_1.heavy 629.006 / 567.361 34930.0 33.217498779296875 48 18 10 10 10 3.787336926549821 20.91348788170582 0.0 3 0.9809360305106763 8.924077442344034 34930.0 91.37358260019552 0.0 - - - - - - - 245.0 69 9 TSC1 tuberous sclerosis 1 1997 256 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23103.[MT7]-VTGVPGTEFVQK[MT7].3b6_1.heavy 517.299 / 655.39 26351.0 30.762500762939453 50 20 10 10 10 19.713955348565747 5.072548772272395 0.0 3 0.9992594986797307 45.34951511772439 26351.0 64.66831726301115 0.0 - - - - - - - 683.375 52 8 MAPK13 mitogen-activated protein kinase 13 1999 256 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23103.[MT7]-VTGVPGTEFVQK[MT7].3b4_1.heavy 517.299 / 501.315 406916.0 30.762500762939453 50 20 10 10 10 19.713955348565747 5.072548772272395 0.0 3 0.9992594986797307 45.34951511772439 406916.0 646.641570776793 0.0 - - - - - - - 403.25 813 4 MAPK13 mitogen-activated protein kinase 13 2001 256 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23103.[MT7]-VTGVPGTEFVQK[MT7].3y4_1.heavy 517.299 / 665.41 89540.0 30.762500762939453 50 20 10 10 10 19.713955348565747 5.072548772272395 0.0 3 0.9992594986797307 45.34951511772439 89540.0 137.32317120592307 0.0 - - - - - - - 231.75 179 12 MAPK13 mitogen-activated protein kinase 13 2003 256 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB23103.[MT7]-VTGVPGTEFVQK[MT7].3b8_1.heavy 517.299 / 885.48 48131.0 30.762500762939453 50 20 10 10 10 19.713955348565747 5.072548772272395 0.0 3 0.9992594986797307 45.34951511772439 48131.0 213.16104216590887 0.0 - - - - - - - 242.1 96 10 MAPK13 mitogen-activated protein kinase 13 2005 257 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541341.[MT7]-SIGLK[MT7].2b3_1.heavy 403.273 / 402.247 3909.0 23.584075450897217 34 15 10 3 6 2.8635520678412245 34.92166289659543 0.05449867248535156 5 0.955653278505252 5.838663397435571 3909.0 2.970226822696932 3.0 - - - - - - - 1697.7777777777778 9 9 IFT80;RXRA;RXRB;RXRG;TRAF2 intraflagellar transport 80 homolog (Chlamydomonas);retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma;TNF receptor-associated factor 2 2007 257 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541341.[MT7]-SIGLK[MT7].2y4_1.heavy 403.273 / 574.404 5449.0 23.584075450897217 34 15 10 3 6 2.8635520678412245 34.92166289659543 0.05449867248535156 5 0.955653278505252 5.838663397435571 5449.0 9.975756179304565 0.0 - - - - - - - 229.1304347826087 10 23 IFT80;RXRA;RXRB;RXRG;TRAF2 intraflagellar transport 80 homolog (Chlamydomonas);retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma;TNF receptor-associated factor 2 2009 257 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541341.[MT7]-SIGLK[MT7].2b4_1.heavy 403.273 / 515.331 1658.0 23.584075450897217 34 15 10 3 6 2.8635520678412245 34.92166289659543 0.05449867248535156 5 0.955653278505252 5.838663397435571 1658.0 1.7802364864864866 3.0 - - - - - - - 769.8571428571429 4 7 IFT80;RXRA;RXRB;RXRG;TRAF2 intraflagellar transport 80 homolog (Chlamydomonas);retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma;TNF receptor-associated factor 2 2011 257 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB541341.[MT7]-SIGLK[MT7].2y3_1.heavy 403.273 / 461.32 5567.0 23.584075450897217 34 15 10 3 6 2.8635520678412245 34.92166289659543 0.05449867248535156 5 0.955653278505252 5.838663397435571 5567.0 0.21915206090330377 2.0 - - - - - - - 222.0 12 16 IFT80;RXRA;RXRB;RXRG;TRAF2 intraflagellar transport 80 homolog (Chlamydomonas);retinoid X receptor, alpha;retinoid X receptor, beta;retinoid X receptor, gamma;TNF receptor-associated factor 2 2013 258 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22931.[MT7]-K[MT7]VHLSEK[MT7].2b3_1.heavy 636.904 / 653.434 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 2015 258 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22931.[MT7]-K[MT7]VHLSEK[MT7].2y5_1.heavy 636.904 / 757.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 2017 258 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22931.[MT7]-K[MT7]VHLSEK[MT7].2y3_1.heavy 636.904 / 507.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 2019 258 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22931.[MT7]-K[MT7]VHLSEK[MT7].2y6_1.heavy 636.904 / 856.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 2021 259 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22932.[MT7]-LVVLGSGGVGK[MT7].2y8_1.heavy 637.408 / 818.485 11586.0 32.4995002746582 48 20 10 10 8 4.678635641627049 21.373752448315006 0.0 4 0.9902122017040357 12.464216807426302 11586.0 140.8195851902808 1.0 - - - - - - - 246.11111111111111 39 9 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 2023 259 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22932.[MT7]-LVVLGSGGVGK[MT7].2y9_1.heavy 637.408 / 917.554 6145.0 32.4995002746582 48 20 10 10 8 4.678635641627049 21.373752448315006 0.0 4 0.9902122017040357 12.464216807426302 6145.0 57.47562189054726 0.0 - - - - - - - 226.5 12 8 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 2025 259 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22932.[MT7]-LVVLGSGGVGK[MT7].2y6_1.heavy 637.408 / 648.38 5037.0 32.4995002746582 48 20 10 10 8 4.678635641627049 21.373752448315006 0.0 4 0.9902122017040357 12.464216807426302 5037.0 19.087923109789163 0.0 - - - - - - - 208.71428571428572 10 14 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 2027 259 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22932.[MT7]-LVVLGSGGVGK[MT7].2y7_1.heavy 637.408 / 705.401 18235.0 32.4995002746582 48 20 10 10 8 4.678635641627049 21.373752448315006 0.0 4 0.9902122017040357 12.464216807426302 18235.0 146.9686567164179 0.0 - - - - - - - 213.1764705882353 36 17 RAP1A;RAP1B RAP1A, member of RAS oncogene family;RAP1B, member of RAS oncogene family 2029 260 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22625.[MT7]-SLVAFK[MT7].2b3_1.heavy 476.807 / 444.294 21465.0 31.144399642944336 47 17 10 10 10 2.496621352262625 32.133009549448275 0.0 3 0.9751422032247433 7.811371472921555 21465.0 21.85891207224147 0.0 - - - - - - - 821.0909090909091 42 11 RPA2 replication protein A2, 32kDa 2031 260 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22625.[MT7]-SLVAFK[MT7].2y4_1.heavy 476.807 / 608.389 16725.0 31.144399642944336 47 17 10 10 10 2.496621352262625 32.133009549448275 0.0 3 0.9751422032247433 7.811371472921555 16725.0 30.68132175773672 0.0 - - - - - - - 748.1818181818181 33 11 RPA2 replication protein A2, 32kDa 2033 260 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22625.[MT7]-SLVAFK[MT7].2b4_1.heavy 476.807 / 515.331 9570.0 31.144399642944336 47 17 10 10 10 2.496621352262625 32.133009549448275 0.0 3 0.9751422032247433 7.811371472921555 9570.0 4.960639754195395 2.0 - - - - - - - 708.1666666666666 19 12 RPA2 replication protein A2, 32kDa 2035 260 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22625.[MT7]-SLVAFK[MT7].2y3_1.heavy 476.807 / 509.32 37475.0 31.144399642944336 47 17 10 10 10 2.496621352262625 32.133009549448275 0.0 3 0.9751422032247433 7.811371472921555 37475.0 65.76612707159933 0.0 - - - - - - - 821.3636363636364 74 11 RPA2 replication protein A2, 32kDa 2037 261 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22939.[MT7]-LGAFQAQEK[MT7].2y4_1.heavy 640.366 / 619.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 2039 261 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22939.[MT7]-LGAFQAQEK[MT7].2y8_1.heavy 640.366 / 1022.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 2041 261 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22939.[MT7]-LGAFQAQEK[MT7].2b4_1.heavy 640.366 / 533.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 2043 261 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22939.[MT7]-LGAFQAQEK[MT7].2b5_1.heavy 640.366 / 661.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRIM1 primase, DNA, polypeptide 1 (49kDa) 2045 262 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22627.[MT7]-ASPQAADLLEK[MT7].3y3_1.heavy 477.608 / 533.341 112237.0 29.599550247192383 39 13 10 6 10 1.1958226674650791 55.749626161534096 0.035400390625 3 0.9249086814530513 4.475191789254292 112237.0 168.17201520424942 0.0 - - - - - - - 1258.5 224 8 MAPK13 mitogen-activated protein kinase 13 2047 262 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22627.[MT7]-ASPQAADLLEK[MT7].3b4_1.heavy 477.608 / 528.29 86196.0 29.599550247192383 39 13 10 6 10 1.1958226674650791 55.749626161534096 0.035400390625 3 0.9249086814530513 4.475191789254292 86196.0 201.81920234467367 0.0 - - - - - - - 724.0 172 10 MAPK13 mitogen-activated protein kinase 13 2049 262 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22627.[MT7]-ASPQAADLLEK[MT7].3b5_1.heavy 477.608 / 599.327 45843.0 29.599550247192383 39 13 10 6 10 1.1958226674650791 55.749626161534096 0.035400390625 3 0.9249086814530513 4.475191789254292 45843.0 98.56923903882532 0.0 - - - - - - - 804.25 91 12 MAPK13 mitogen-activated protein kinase 13 2051 262 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22627.[MT7]-ASPQAADLLEK[MT7].3b7_1.heavy 477.608 / 785.391 73632.0 29.599550247192383 39 13 10 6 10 1.1958226674650791 55.749626161534096 0.035400390625 3 0.9249086814530513 4.475191789254292 73632.0 242.99619057935695 0.0 - - - - - - - 332.7692307692308 147 13 MAPK13 mitogen-activated protein kinase 13 2053 263 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22628.[MT7]-YALQC[CAM]R.2b3_1.heavy 477.751 / 492.294 5620.0 22.27692461013794 46 20 10 6 10 2.2426870454440033 32.945885399919185 0.030900955200195312 3 0.9903773632591965 12.570902362902077 5620.0 14.78642109675215 0.0 - - - - - - - 734.5555555555555 11 9 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 2055 263 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22628.[MT7]-YALQC[CAM]R.2y4_1.heavy 477.751 / 576.292 5565.0 22.27692461013794 46 20 10 6 10 2.2426870454440033 32.945885399919185 0.030900955200195312 3 0.9903773632591965 12.570902362902077 5565.0 18.095891183934413 0.0 - - - - - - - 684.7142857142857 11 7 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 2057 263 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22628.[MT7]-YALQC[CAM]R.2y5_1.heavy 477.751 / 647.329 30579.0 22.27692461013794 46 20 10 6 10 2.2426870454440033 32.945885399919185 0.030900955200195312 3 0.9903773632591965 12.570902362902077 30579.0 52.77295570792016 0.0 - - - - - - - 771.2727272727273 61 11 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 2059 263 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22628.[MT7]-YALQC[CAM]R.2b4_1.heavy 477.751 / 620.352 6777.0 22.27692461013794 46 20 10 6 10 2.2426870454440033 32.945885399919185 0.030900955200195312 3 0.9903773632591965 12.570902362902077 6777.0 21.314758064516127 0.0 - - - - - - - 287.05263157894734 13 19 MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) 2061 264 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22834.[MT7]-FLDSGPNK[MT7].2b3_1.heavy 583.326 / 520.289 3962.0 26.495750427246094 38 15 9 6 8 1.302305779139789 50.85813359149328 0.038299560546875 4 0.9528301040277766 5.659887737380527 3962.0 24.946010225771243 1.0 - - - - - - - 684.75 7 8 BIRC6 baculoviral IAP repeat-containing 6 2063 264 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22834.[MT7]-FLDSGPNK[MT7].2y5_1.heavy 583.326 / 646.364 4300.0 26.495750427246094 38 15 9 6 8 1.302305779139789 50.85813359149328 0.038299560546875 4 0.9528301040277766 5.659887737380527 4300.0 16.498743449693215 0.0 - - - - - - - 184.4375 8 16 BIRC6 baculoviral IAP repeat-containing 6 2065 264 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22834.[MT7]-FLDSGPNK[MT7].2y3_1.heavy 583.326 / 502.311 1265.0 26.495750427246094 38 15 9 6 8 1.302305779139789 50.85813359149328 0.038299560546875 4 0.9528301040277766 5.659887737380527 1265.0 1.5008474576271187 8.0 - - - - - - - 686.5714285714286 5 7 BIRC6 baculoviral IAP repeat-containing 6 2067 264 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22834.[MT7]-FLDSGPNK[MT7].2y7_1.heavy 583.326 / 874.475 1517.0 26.495750427246094 38 15 9 6 8 1.302305779139789 50.85813359149328 0.038299560546875 4 0.9528301040277766 5.659887737380527 1517.0 2.5163507109004737 1.0 - - - - - - - 174.64285714285714 9 14 BIRC6 baculoviral IAP repeat-containing 6 2069 265 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22835.[MT7]-TSLAPYVK[MT7].2y4_1.heavy 583.855 / 650.399 16450.0 28.023799896240234 43 13 10 10 10 2.27882119934752 43.882337073497624 0.0 3 0.9214246163930015 4.373544006986528 16450.0 56.65663617034984 0.0 - - - - - - - 290.5 32 14 PRIM1 primase, DNA, polypeptide 1 (49kDa) 2071 265 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22835.[MT7]-TSLAPYVK[MT7].2y5_1.heavy 583.855 / 721.437 4653.0 28.023799896240234 43 13 10 10 10 2.27882119934752 43.882337073497624 0.0 3 0.9214246163930015 4.373544006986528 4653.0 6.414420131291028 0.0 - - - - - - - 283.5833333333333 9 12 PRIM1 primase, DNA, polypeptide 1 (49kDa) 2073 265 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22835.[MT7]-TSLAPYVK[MT7].2b4_1.heavy 583.855 / 517.31 14290.0 28.023799896240234 43 13 10 10 10 2.27882119934752 43.882337073497624 0.0 3 0.9214246163930015 4.373544006986528 14290.0 27.400805040943396 0.0 - - - - - - - 754.9166666666666 28 12 PRIM1 primase, DNA, polypeptide 1 (49kDa) 2075 265 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22835.[MT7]-TSLAPYVK[MT7].2y3_1.heavy 583.855 / 553.347 1412.0 28.023799896240234 43 13 10 10 10 2.27882119934752 43.882337073497624 0.0 3 0.9214246163930015 4.373544006986528 1412.0 2.0083150984682714 13.0 - - - - - - - 808.3636363636364 4 11 PRIM1 primase, DNA, polypeptide 1 (49kDa) 2077 266 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22838.[MT7]-DFTQLFPR.2y5_1.heavy 584.318 / 660.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK13 mitogen-activated protein kinase 13 2079 266 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22838.[MT7]-DFTQLFPR.2b4_1.heavy 584.318 / 636.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK13 mitogen-activated protein kinase 13 2081 266 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22838.[MT7]-DFTQLFPR.2y6_1.heavy 584.318 / 761.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK13 mitogen-activated protein kinase 13 2083 266 B20140227_KEGG1700_set05_04 B20140227_KEGG1700_set05_04 TB22838.[MT7]-DFTQLFPR.2y7_1.heavy 584.318 / 908.499 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK13 mitogen-activated protein kinase 13