Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22887.[MT7]-EAAGPAPSPMR.2y8_1.heavy 614.317 / 812.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 3 1 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22887.[MT7]-EAAGPAPSPMR.2y10_1.heavy 614.317 / 954.483 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 5 1 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22887.[MT7]-EAAGPAPSPMR.2b5_1.heavy 614.317 / 570.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 7 1 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22887.[MT7]-EAAGPAPSPMR.2y7_1.heavy 614.317 / 755.387 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 9 2 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22741.[MT7]-RANPNSIR.2y5_1.heavy 536.311 / 586.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 11 2 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22741.[MT7]-RANPNSIR.2b6_1.heavy 536.311 / 784.418 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 13 2 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22741.[MT7]-RANPNSIR.2y6_1.heavy 536.311 / 700.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 15 2 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22741.[MT7]-RANPNSIR.2y7_1.heavy 536.311 / 771.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 17 3 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22744.[MT7]-GHLWLFR.2y4_1.heavy 536.812 / 621.351 20025.0 36.40890121459961 48 18 10 10 10 4.20978180174266 23.754200267245324 0.0 3 0.9872981614119969 10.938765340104627 20025.0 20.782985843975997 0.0 - - - - - - - 697.4444444444445 40 9 VHL von Hippel-Lindau tumor suppressor 19 3 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22744.[MT7]-GHLWLFR.2y5_1.heavy 536.812 / 734.435 18262.0 36.40890121459961 48 18 10 10 10 4.20978180174266 23.754200267245324 0.0 3 0.9872981614119969 10.938765340104627 18262.0 34.930539436922416 0.0 - - - - - - - 1238.857142857143 36 7 VHL von Hippel-Lindau tumor suppressor 21 3 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22744.[MT7]-GHLWLFR.2b4_1.heavy 536.812 / 638.353 5993.0 36.40890121459961 48 18 10 10 10 4.20978180174266 23.754200267245324 0.0 3 0.9872981614119969 10.938765340104627 5993.0 11.745563727954503 0.0 - - - - - - - 733.4 11 10 VHL von Hippel-Lindau tumor suppressor 23 3 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22744.[MT7]-GHLWLFR.2y6_1.heavy 536.812 / 871.494 9871.0 36.40890121459961 48 18 10 10 10 4.20978180174266 23.754200267245324 0.0 3 0.9872981614119969 10.938765340104627 9871.0 37.920980656770126 0.0 - - - - - - - 215.3 19 20 VHL von Hippel-Lindau tumor suppressor 25 4 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22746.[MT7]-SAEGAPQK[MT7].2y5_1.heavy 538.303 / 644.385 4640.0 14.840200424194336 44 14 10 10 10 2.9711176939985284 33.65736746208127 0.0 3 0.9430421316050543 5.146384875882705 4640.0 38.17721518987342 0.0 - - - - - - - 127.57894736842105 9 19 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 27 4 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22746.[MT7]-SAEGAPQK[MT7].2y3_1.heavy 538.303 / 516.326 8067.0 14.840200424194336 44 14 10 10 10 2.9711176939985284 33.65736746208127 0.0 3 0.9430421316050543 5.146384875882705 8067.0 11.31882789520241 0.0 - - - - - - - 762.1818181818181 16 11 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 29 4 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22746.[MT7]-SAEGAPQK[MT7].2b5_1.heavy 538.303 / 560.28 5378.0 14.840200424194336 44 14 10 10 10 2.9711176939985284 33.65736746208127 0.0 3 0.9430421316050543 5.146384875882705 5378.0 22.75204010025063 0.0 - - - - - - - 135.89473684210526 10 19 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 31 4 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22746.[MT7]-SAEGAPQK[MT7].2y7_1.heavy 538.303 / 844.464 1582.0 14.840200424194336 44 14 10 10 10 2.9711176939985284 33.65736746208127 0.0 3 0.9430421316050543 5.146384875882705 1582.0 53.13132075471698 0.0 - - - - - - - 118.625 3 8 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 33 5 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544694.[MT7]-SPNVLVTHTDAVK[MT7].3b4_1.heavy 556.989 / 542.305 13329.0 25.498600482940674 43 17 10 6 10 3.9461117566560344 25.34140089452022 0.03759956359863281 3 0.9775875226198365 8.228164191406877 13329.0 7.423493509727758 0.0 - - - - - - - 1696.7142857142858 26 7 MAP3K13 mitogen-activated protein kinase kinase kinase 13 35 5 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544694.[MT7]-SPNVLVTHTDAVK[MT7].3b5_1.heavy 556.989 / 655.39 6891.0 25.498600482940674 43 17 10 6 10 3.9461117566560344 25.34140089452022 0.03759956359863281 3 0.9775875226198365 8.228164191406877 6891.0 28.611281549853985 0.0 - - - - - - - 680.125 13 8 MAP3K13 mitogen-activated protein kinase kinase kinase 13 37 5 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544694.[MT7]-SPNVLVTHTDAVK[MT7].3y4_1.heavy 556.989 / 576.347 8523.0 25.498600482940674 43 17 10 6 10 3.9461117566560344 25.34140089452022 0.03759956359863281 3 0.9775875226198365 8.228164191406877 8523.0 14.85247030605361 0.0 - - - - - - - 296.8181818181818 17 11 MAP3K13 mitogen-activated protein kinase kinase kinase 13 39 5 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544694.[MT7]-SPNVLVTHTDAVK[MT7].3y5_1.heavy 556.989 / 677.395 11606.0 25.498600482940674 43 17 10 6 10 3.9461117566560344 25.34140089452022 0.03759956359863281 3 0.9775875226198365 8.228164191406877 11606.0 35.32613583180039 0.0 - - - - - - - 280.27272727272725 23 11 MAP3K13 mitogen-activated protein kinase kinase kinase 13 41 6 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23227.[MT7]-SAAQMEVASFLLSK[MT7].2b8_1.heavy 885.489 / 932.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 43 6 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23227.[MT7]-SAAQMEVASFLLSK[MT7].2b4_1.heavy 885.489 / 502.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 45 6 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23227.[MT7]-SAAQMEVASFLLSK[MT7].2b6_1.heavy 885.489 / 762.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 47 6 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23227.[MT7]-SAAQMEVASFLLSK[MT7].2b7_1.heavy 885.489 / 861.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 49 7 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23099.[MT7]-LTQYIDGQGRPR.3y7_1.heavy 516.619 / 785.401 5941.0 27.907000064849854 39 13 10 6 10 1.7243605672973132 45.332250285218336 0.03999900817871094 3 0.9058673924382417 3.9904804337181434 5941.0 21.5120751873433 0.0 - - - - - - - 246.0 11 13 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 51 7 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23099.[MT7]-LTQYIDGQGRPR.3y6_1.heavy 516.619 / 670.374 13618.0 27.907000064849854 39 13 10 6 10 1.7243605672973132 45.332250285218336 0.03999900817871094 3 0.9058673924382417 3.9904804337181434 13618.0 32.87919898672402 0.0 - - - - - - - 667.1 27 10 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 53 7 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23099.[MT7]-LTQYIDGQGRPR.3y11_2.heavy 516.619 / 645.831 42864.0 27.907000064849854 39 13 10 6 10 1.7243605672973132 45.332250285218336 0.03999900817871094 3 0.9058673924382417 3.9904804337181434 42864.0 112.73133834848024 0.0 - - - - - - - 274.14285714285717 85 7 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 55 7 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23099.[MT7]-LTQYIDGQGRPR.3b4_1.heavy 516.619 / 650.363 27327.0 27.907000064849854 39 13 10 6 10 1.7243605672973132 45.332250285218336 0.03999900817871094 3 0.9058673924382417 3.9904804337181434 27327.0 34.218743397205245 0.0 - - - - - - - 284.3333333333333 54 9 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 57 8 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542851.[MT7]-TAQSEETR.2b4_1.heavy 533.268 / 532.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A calcium/calmodulin-dependent protein kinase II alpha 59 8 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542851.[MT7]-TAQSEETR.2b6_1.heavy 533.268 / 790.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A calcium/calmodulin-dependent protein kinase II alpha 61 8 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542851.[MT7]-TAQSEETR.2b5_1.heavy 533.268 / 661.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A calcium/calmodulin-dependent protein kinase II alpha 63 8 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542851.[MT7]-TAQSEETR.2y7_1.heavy 533.268 / 820.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A calcium/calmodulin-dependent protein kinase II alpha 65 9 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23199.[MT7]-QIGTFASVEQFWR.3y7_1.heavy 571.634 / 951.468 11102.0 43.138999938964844 48 18 10 10 10 5.292550189389461 18.89448307934437 0.0 3 0.9815294770202964 9.06675807691038 11102.0 91.38440584287406 0.0 - - - - - - - 135.06666666666666 22 15 EIF4E2 eukaryotic translation initiation factor 4E family member 2 67 9 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23199.[MT7]-QIGTFASVEQFWR.3b4_1.heavy 571.634 / 544.321 22144.0 43.138999938964844 48 18 10 10 10 5.292550189389461 18.89448307934437 0.0 3 0.9815294770202964 9.06675807691038 22144.0 53.59285596455872 0.0 - - - - - - - 733.2857142857143 44 7 EIF4E2 eukaryotic translation initiation factor 4E family member 2 69 9 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23199.[MT7]-QIGTFASVEQFWR.3y4_1.heavy 571.634 / 636.325 26860.0 43.138999938964844 48 18 10 10 10 5.292550189389461 18.89448307934437 0.0 3 0.9815294770202964 9.06675807691038 26860.0 61.32420091324201 0.0 - - - - - - - 223.75 53 20 EIF4E2 eukaryotic translation initiation factor 4E family member 2 71 9 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23199.[MT7]-QIGTFASVEQFWR.3y5_1.heavy 571.634 / 765.368 43214.0 43.138999938964844 48 18 10 10 10 5.292550189389461 18.89448307934437 0.0 3 0.9815294770202964 9.06675807691038 43214.0 197.748974261399 0.0 - - - - - - - 235.0625 86 16 EIF4E2 eukaryotic translation initiation factor 4E family member 2 73 10 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37751.[MT7]-NNNLLR.2y4_1.heavy 444.263 / 515.33 2383.0 22.638500213623047 34 8 10 6 10 0.9045206353014106 73.11094351008923 0.039600372314453125 3 0.7965367019331728 2.688218500953379 2383.0 2.014897319921329 2.0 - - - - - - - 1235.3636363636363 4 11 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 75 10 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37751.[MT7]-NNNLLR.2b3_1.heavy 444.263 / 487.238 6698.0 22.638500213623047 34 8 10 6 10 0.9045206353014106 73.11094351008923 0.039600372314453125 3 0.7965367019331728 2.688218500953379 6698.0 15.341209951924762 1.0 - - - - - - - 734.1 13 10 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 77 10 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37751.[MT7]-NNNLLR.2y5_1.heavy 444.263 / 629.373 6312.0 22.638500213623047 34 8 10 6 10 0.9045206353014106 73.11094351008923 0.039600372314453125 3 0.7965367019331728 2.688218500953379 6312.0 12.900724737036857 0.0 - - - - - - - 282.38461538461536 12 13 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 79 10 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37751.[MT7]-NNNLLR.2b4_1.heavy 444.263 / 600.322 9596.0 22.638500213623047 34 8 10 6 10 0.9045206353014106 73.11094351008923 0.039600372314453125 3 0.7965367019331728 2.688218500953379 9596.0 36.25817805383023 0.0 - - - - - - - 695.4 19 10 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 81 11 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544584.[MT7]-FRLDSIIC[CAM]VK[MT7].3b6_1.heavy 513.637 / 876.506 9304.0 37.08179950714111 38 11 10 7 10 1.7336323202408164 50.23333371028223 0.027599334716796875 3 0.8704391791136586 3.3909472350755547 9304.0 116.27166179337232 0.0 - - - - - - - 125.04761904761905 18 21 SOCS2 suppressor of cytokine signaling 2 83 11 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544584.[MT7]-FRLDSIIC[CAM]VK[MT7].3y3_1.heavy 513.637 / 550.314 40552.0 37.08179950714111 38 11 10 7 10 1.7336323202408164 50.23333371028223 0.027599334716796875 3 0.8704391791136586 3.3909472350755547 40552.0 68.28923076923077 0.0 - - - - - - - 770.0 81 11 SOCS2 suppressor of cytokine signaling 2 85 11 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544584.[MT7]-FRLDSIIC[CAM]VK[MT7].3b4_1.heavy 513.637 / 676.39 3080.0 37.08179950714111 38 11 10 7 10 1.7336323202408164 50.23333371028223 0.027599334716796875 3 0.8704391791136586 3.3909472350755547 3080.0 16.03565554236392 0.0 - - - - - - - 262.1304347826087 6 23 SOCS2 suppressor of cytokine signaling 2 87 11 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544584.[MT7]-FRLDSIIC[CAM]VK[MT7].3b5_1.heavy 513.637 / 763.422 6031.0 37.08179950714111 38 11 10 7 10 1.7336323202408164 50.23333371028223 0.027599334716796875 3 0.8704391791136586 3.3909472350755547 6031.0 29.592532015590198 0.0 - - - - - - - 211.8695652173913 12 23 SOCS2 suppressor of cytokine signaling 2 89 12 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22752.[MT7]-LYQQIK[MT7].2b3_1.heavy 540.836 / 549.315 5162.0 26.238100051879883 48 20 8 10 10 6.4845687145744195 15.421226052435003 0.0 3 0.9966948738836543 21.460936166103615 5162.0 12.132065758454182 1.0 - - - - - - - 261.1666666666667 10 12 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 91 12 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22752.[MT7]-LYQQIK[MT7].2y5_1.heavy 540.836 / 823.479 14380.0 26.238100051879883 48 20 8 10 10 6.4845687145744195 15.421226052435003 0.0 3 0.9966948738836543 21.460936166103615 14380.0 86.34077661354232 0.0 - - - - - - - 205.53846153846155 28 13 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 93 12 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22752.[MT7]-LYQQIK[MT7].2b4_1.heavy 540.836 / 677.374 6084.0 26.238100051879883 48 20 8 10 10 6.4845687145744195 15.421226052435003 0.0 3 0.9966948738836543 21.460936166103615 6084.0 20.555610755183373 0.0 - - - - - - - 294.9 12 10 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 95 12 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22752.[MT7]-LYQQIK[MT7].2y3_1.heavy 540.836 / 532.357 N/A 26.238100051879883 48 20 8 10 10 6.4845687145744195 15.421226052435003 0.0 3 0.9966948738836543 21.460936166103615 13550.0 8.762185783076303 1.0 - - - - - - - 2238.4285714285716 38 7 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 97 13 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22753.[MT7]-EYLLSASR.2b3_1.heavy 541.802 / 550.299 8603.0 29.388999938964844 48 18 10 10 10 4.517897258364597 22.13419081517545 0.0 3 0.9811947450447895 8.98544961646708 8603.0 33.14644981412639 0.0 - - - - - - - 683.375 17 8 PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 99 13 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22753.[MT7]-EYLLSASR.2y5_1.heavy 541.802 / 533.304 N/A 29.388999938964844 48 18 10 10 10 4.517897258364597 22.13419081517545 0.0 3 0.9811947450447895 8.98544961646708 11919.0 6.621303709658755 1.0 - - - - - - - 1817.7142857142858 23 7 PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 101 13 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22753.[MT7]-EYLLSASR.2y6_1.heavy 541.802 / 646.388 6721.0 29.388999938964844 48 18 10 10 10 4.517897258364597 22.13419081517545 0.0 3 0.9811947450447895 8.98544961646708 6721.0 17.924738798669537 0.0 - - - - - - - 679.75 13 12 PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 103 13 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22753.[MT7]-EYLLSASR.2y7_1.heavy 541.802 / 809.452 14428.0 29.388999938964844 48 18 10 10 10 4.517897258364597 22.13419081517545 0.0 3 0.9811947450447895 8.98544961646708 14428.0 138.3399007936508 0.0 - - - - - - - 320.9166666666667 28 12 PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 105 14 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544523.[MT7]-VLQAEELHEK[MT7].3b6_1.heavy 495.283 / 814.443 14227.0 25.23189926147461 48 18 10 10 10 6.061480857496615 16.497618709184525 0.0 3 0.9886262766836965 11.56108383268102 14227.0 66.45711283738619 0.0 - - - - - - - 228.33333333333334 28 15 PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 107 14 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544523.[MT7]-VLQAEELHEK[MT7].3y3_1.heavy 495.283 / 557.316 16071.0 25.23189926147461 48 18 10 10 10 6.061480857496615 16.497618709184525 0.0 3 0.9886262766836965 11.56108383268102 16071.0 24.311063732582046 0.0 - - - - - - - 726.5454545454545 32 11 PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 109 14 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544523.[MT7]-VLQAEELHEK[MT7].3b4_1.heavy 495.283 / 556.357 10187.0 25.23189926147461 48 18 10 10 10 6.061480857496615 16.497618709184525 0.0 3 0.9886262766836965 11.56108383268102 10187.0 23.526485693649644 0.0 - - - - - - - 647.75 20 8 PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 111 14 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544523.[MT7]-VLQAEELHEK[MT7].3b5_1.heavy 495.283 / 685.4 7640.0 25.23189926147461 48 18 10 10 10 6.061480857496615 16.497618709184525 0.0 3 0.9886262766836965 11.56108383268102 7640.0 19.40298899832544 0.0 - - - - - - - 790.2857142857143 15 7 PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 113 15 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543809.[MT7]-LLEDQQEK[MT7].3y3_1.heavy 430.91 / 548.316 10353.0 24.493900299072266 48 18 10 10 10 3.6815964791784164 27.16212940922737 0.0 3 0.9833903290026916 9.562663898288442 10353.0 62.93508525252524 0.0 - - - - - - - 728.0 20 8 MAP3K13 mitogen-activated protein kinase kinase kinase 13 115 15 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543809.[MT7]-LLEDQQEK[MT7].3b4_1.heavy 430.91 / 615.347 27985.0 24.493900299072266 48 18 10 10 10 3.6815964791784164 27.16212940922737 0.0 3 0.9833903290026916 9.562663898288442 27985.0 38.50302211497376 0.0 - - - - - - - 755.0 55 9 MAP3K13 mitogen-activated protein kinase kinase kinase 13 117 15 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543809.[MT7]-LLEDQQEK[MT7].3b5_1.heavy 430.91 / 743.406 4610.0 24.493900299072266 48 18 10 10 10 3.6815964791784164 27.16212940922737 0.0 3 0.9833903290026916 9.562663898288442 4610.0 5.93759108295846 1.0 - - - - - - - 224.15384615384616 9 13 MAP3K13 mitogen-activated protein kinase kinase kinase 13 119 15 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543809.[MT7]-LLEDQQEK[MT7].3b3_1.heavy 430.91 / 500.32 21838.0 24.493900299072266 48 18 10 10 10 3.6815964791784164 27.16212940922737 0.0 3 0.9833903290026916 9.562663898288442 21838.0 23.369922019441624 0.0 - - - - - - - 800.9 43 10 MAP3K13 mitogen-activated protein kinase kinase kinase 13 121 16 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543709.[MT7]-VYIGEEEK[MT7].3y3_1.heavy 418.899 / 549.3 18406.0 26.114299774169922 50 20 10 10 10 12.886964591279957 7.759779216563194 0.0 3 0.9974730705671125 24.54563759389896 18406.0 38.148132081541924 0.0 - - - - - - - 691.25 36 8 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 123 16 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543709.[MT7]-VYIGEEEK[MT7].3b4_1.heavy 418.899 / 577.347 26748.0 26.114299774169922 50 20 10 10 10 12.886964591279957 7.759779216563194 0.0 3 0.9974730705671125 24.54563759389896 26748.0 90.47117647058823 0.0 - - - - - - - 317.25 53 12 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 125 16 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543709.[MT7]-VYIGEEEK[MT7].3b5_1.heavy 418.899 / 706.389 11787.0 26.114299774169922 50 20 10 10 10 12.886964591279957 7.759779216563194 0.0 3 0.9974730705671125 24.54563759389896 11787.0 74.86583726031849 0.0 - - - - - - - 206.0909090909091 23 11 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 127 16 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543709.[MT7]-VYIGEEEK[MT7].3b3_1.heavy 418.899 / 520.325 17590.0 26.114299774169922 50 20 10 10 10 12.886964591279957 7.759779216563194 0.0 3 0.9974730705671125 24.54563759389896 17590.0 33.07007809685554 0.0 - - - - - - - 281.0 35 10 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 129 17 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544580.[MT7]-RDVEFLVQLK[MT7].3b6_1.heavy 512.311 / 904.501 27394.0 35.44110107421875 44 14 10 10 10 4.070832325425579 19.41221290669174 0.0 3 0.9496597949381951 5.477292772741302 27394.0 321.85723258015395 0.0 - - - - - - - 170.3125 54 16 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 131 17 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544580.[MT7]-RDVEFLVQLK[MT7].3b4_1.heavy 512.311 / 644.348 20157.0 35.44110107421875 44 14 10 10 10 4.070832325425579 19.41221290669174 0.0 3 0.9496597949381951 5.477292772741302 20157.0 43.196936200046736 0.0 - - - - - - - 636.9090909090909 40 11 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 133 17 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544580.[MT7]-RDVEFLVQLK[MT7].3b5_1.heavy 512.311 / 791.417 39691.0 35.44110107421875 44 14 10 10 10 4.070832325425579 19.41221290669174 0.0 3 0.9496597949381951 5.477292772741302 39691.0 116.43826552462528 0.0 - - - - - - - 224.2941176470588 79 17 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 135 17 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544580.[MT7]-RDVEFLVQLK[MT7].3b3_1.heavy 512.311 / 515.306 55645.0 35.44110107421875 44 14 10 10 10 4.070832325425579 19.41221290669174 0.0 3 0.9496597949381951 5.477292772741302 55645.0 92.61097485453836 0.0 - - - - - - - 772.2307692307693 111 13 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 137 18 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544058.[MT7]-VLAGQEYAAK[MT7].3b6_1.heavy 446.594 / 742.422 33675.0 25.192899703979492 50 20 10 10 10 14.333082161535307 6.976866445959755 0.0 3 0.9931704880359469 14.92519645622013 33675.0 114.25354691075513 0.0 - - - - - - - 238.8 67 15 CAMK2A calcium/calmodulin-dependent protein kinase II alpha 139 18 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544058.[MT7]-VLAGQEYAAK[MT7].3b4_1.heavy 446.594 / 485.32 28164.0 25.192899703979492 50 20 10 10 10 14.333082161535307 6.976866445959755 0.0 3 0.9931704880359469 14.92519645622013 28164.0 44.566465751320635 0.0 - - - - - - - 708.5 56 10 CAMK2A calcium/calmodulin-dependent protein kinase II alpha 141 18 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544058.[MT7]-VLAGQEYAAK[MT7].3b5_1.heavy 446.594 / 613.379 30876.0 25.192899703979492 50 20 10 10 10 14.333082161535307 6.976866445959755 0.0 3 0.9931704880359469 14.92519645622013 30876.0 80.3930557269922 0.0 - - - - - - - 699.7 61 10 CAMK2A calcium/calmodulin-dependent protein kinase II alpha 143 18 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544058.[MT7]-VLAGQEYAAK[MT7].3y4_1.heavy 446.594 / 596.352 26502.0 25.192899703979492 50 20 10 10 10 14.333082161535307 6.976866445959755 0.0 3 0.9931704880359469 14.92519645622013 26502.0 35.44143354438169 0.0 - - - - - - - 262.1666666666667 53 12 CAMK2A calcium/calmodulin-dependent protein kinase II alpha 145 19 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23219.[MT7]-NLINQMLTINPAK[MT7].2y4_1.heavy 879.513 / 573.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 147 19 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23219.[MT7]-NLINQMLTINPAK[MT7].2b6_1.heavy 879.513 / 858.462 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 149 19 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23219.[MT7]-NLINQMLTINPAK[MT7].2b7_1.heavy 879.513 / 971.546 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 151 19 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23219.[MT7]-NLINQMLTINPAK[MT7].2b5_1.heavy 879.513 / 727.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 153 20 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544290.[MT7]-SLVK[MT7]PENYR.3b4_2.heavy 465.273 / 358.749 43141.0 22.778799057006836 40 10 10 10 10 1.6863302282981854 59.30036615717802 0.0 3 0.8413939162779612 3.05694549330435 43141.0 73.51157908928147 0.0 - - - - - - - 297.8333333333333 86 6 VHL von Hippel-Lindau tumor suppressor 155 20 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544290.[MT7]-SLVK[MT7]PENYR.3y6_1.heavy 465.273 / 950.518 N/A 22.778799057006836 40 10 10 10 10 1.6863302282981854 59.30036615717802 0.0 3 0.8413939162779612 3.05694549330435 69.0 1.5036496350364965 5.0 - - - - - - - 0.0 0 0 VHL von Hippel-Lindau tumor suppressor 157 20 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544290.[MT7]-SLVK[MT7]PENYR.3y8_2.heavy 465.273 / 581.839 20884.0 22.778799057006836 40 10 10 10 10 1.6863302282981854 59.30036615717802 0.0 3 0.8413939162779612 3.05694549330435 20884.0 45.65013213885778 0.0 - - - - - - - 674.5454545454545 41 11 VHL von Hippel-Lindau tumor suppressor 159 20 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544290.[MT7]-SLVK[MT7]PENYR.3y5_1.heavy 465.273 / 678.321 44584.0 22.778799057006836 40 10 10 10 10 1.6863302282981854 59.30036615717802 0.0 3 0.8413939162779612 3.05694549330435 44584.0 434.8474647485688 0.0 - - - - - - - 200.69230769230768 89 13 VHL von Hippel-Lindau tumor suppressor 161 21 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544830.[MT7]-GLSGQPARPPC[CAM]GVSAPR.3y15_2.heavy 617.664 / 768.889 3233.0 23.026766459147137 34 8 10 6 10 0.6616635806726144 79.86330274971866 0.035800933837890625 3 0.7894726154545566 2.641048766312523 3233.0 9.417087198515771 0.0 - - - - - - - 192.5 6 10 ACSS1 acyl-CoA synthetase short-chain family member 1 163 21 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544830.[MT7]-GLSGQPARPPC[CAM]GVSAPR.3b5_1.heavy 617.664 / 587.327 N/A 23.026766459147137 34 8 10 6 10 0.6616635806726144 79.86330274971866 0.035800933837890625 3 0.7894726154545566 2.641048766312523 3079.0 1.0101982228298019 2.0 - - - - - - - 286.0 7 7 ACSS1 acyl-CoA synthetase short-chain family member 1 165 21 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544830.[MT7]-GLSGQPARPPC[CAM]GVSAPR.3y12_2.heavy 617.664 / 632.833 4542.0 23.026766459147137 34 8 10 6 10 0.6616635806726144 79.86330274971866 0.035800933837890625 3 0.7894726154545566 2.641048766312523 4542.0 6.772582972582971 0.0 - - - - - - - 247.5 9 14 ACSS1 acyl-CoA synthetase short-chain family member 1 167 21 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544830.[MT7]-GLSGQPARPPC[CAM]GVSAPR.3y9_1.heavy 617.664 / 940.467 2541.0 23.026766459147137 34 8 10 6 10 0.6616635806726144 79.86330274971866 0.035800933837890625 3 0.7894726154545566 2.641048766312523 2541.0 16.676 0.0 - - - - - - - 174.53333333333333 5 15 ACSS1 acyl-CoA synthetase short-chain family member 1 169 22 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1127530.0 29.818899154663086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1127530.0 2558.9551455275227 0.0 - - - - - - - 268.2 2255 5 171 22 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 339922.0 29.818899154663086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 339922.0 889.5248047692249 0.0 - - - - - - - 715.7777777777778 679 9 173 22 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 272725.0 29.818899154663086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 272725.0 308.5691941346954 0.0 - - - - - - - 1173.3333333333333 545 9 175 23 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23315.[MT7]-DASVHTLLDALETLGER.3b4_1.heavy 662.02 / 517.274 5112.0 46.975399017333984 43 17 10 6 10 2.6694312105518407 30.678719374144155 0.03659820556640625 3 0.9754295481238757 7.8571045236965595 5112.0 41.78952418801257 0.0 - - - - - - - 148.75 10 20 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 177 23 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23315.[MT7]-DASVHTLLDALETLGER.3y8_1.heavy 662.02 / 888.479 4756.0 46.975399017333984 43 17 10 6 10 2.6694312105518407 30.678719374144155 0.03659820556640625 3 0.9754295481238757 7.8571045236965595 4756.0 61.453932584269666 0.0 - - - - - - - 109.23076923076923 9 13 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 179 23 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23315.[MT7]-DASVHTLLDALETLGER.3y5_1.heavy 662.02 / 575.315 5734.0 46.975399017333984 43 17 10 6 10 2.6694312105518407 30.678719374144155 0.03659820556640625 3 0.9754295481238757 7.8571045236965595 5734.0 40.72483763506272 0.0 - - - - - - - 157.45454545454547 11 22 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 181 23 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23315.[MT7]-DASVHTLLDALETLGER.3y9_1.heavy 662.02 / 1003.51 6356.0 46.975399017333984 43 17 10 6 10 2.6694312105518407 30.678719374144155 0.03659820556640625 3 0.9754295481238757 7.8571045236965595 6356.0 157.79215311004785 0.0 - - - - - - - 76.45454545454545 12 11 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 183 24 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544297.[MT7]-DC[CAM]LVLQSFK[MT7].2b3_1.heavy 699.389 / 533.251 N/A 35.4939333597819 41 15 10 6 10 2.1565491895366375 37.12798856065828 0.0305023193359375 3 0.9520183257099778 5.611418700848741 4806.0 1.9826334096324698 1.0 - - - - - - - 697.7142857142857 9 7 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 185 24 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544297.[MT7]-DC[CAM]LVLQSFK[MT7].2y5_1.heavy 699.389 / 766.458 2521.0 35.4939333597819 41 15 10 6 10 2.1565491895366375 37.12798856065828 0.0305023193359375 3 0.9520183257099778 5.611418700848741 2521.0 18.677883762770673 0.0 - - - - - - - 203.26315789473685 5 19 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 187 24 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544297.[MT7]-DC[CAM]LVLQSFK[MT7].2b4_1.heavy 699.389 / 632.319 4727.0 35.4939333597819 41 15 10 6 10 2.1565491895366375 37.12798856065828 0.0305023193359375 3 0.9520183257099778 5.611418700848741 4727.0 9.49397463002114 0.0 - - - - - - - 277.76190476190476 9 21 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 189 24 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544297.[MT7]-DC[CAM]LVLQSFK[MT7].2y3_1.heavy 699.389 / 525.315 2442.0 35.4939333597819 41 15 10 6 10 2.1565491895366375 37.12798856065828 0.0305023193359375 3 0.9520183257099778 5.611418700848741 2442.0 5.0390476190476186 0.0 - - - - - - - 244.35 4 20 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 191 25 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22865.[MT7]-HDLEVAVK[MT7].3b4_1.heavy 400.239 / 639.322 13816.0 23.79400062561035 50 20 10 10 10 8.635888673088424 11.579584196311476 0.0 3 0.9982584827124116 29.56891760076652 13816.0 226.96692938460313 0.0 - - - - - - - 201.53846153846155 27 13 ULK1 unc-51-like kinase 1 (C. elegans) 193 25 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22865.[MT7]-HDLEVAVK[MT7].3b5_1.heavy 400.239 / 738.39 2064.0 23.79400062561035 50 20 10 10 10 8.635888673088424 11.579584196311476 0.0 3 0.9982584827124116 29.56891760076652 2064.0 18.662286348501663 0.0 - - - - - - - 148.75 4 8 ULK1 unc-51-like kinase 1 (C. elegans) 195 25 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22865.[MT7]-HDLEVAVK[MT7].3y4_1.heavy 400.239 / 560.389 3891.0 23.79400062561035 50 20 10 10 10 8.635888673088424 11.579584196311476 0.0 3 0.9982584827124116 29.56891760076652 3891.0 19.29061798662937 0.0 - - - - - - - 165.33333333333334 7 12 ULK1 unc-51-like kinase 1 (C. elegans) 197 25 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22865.[MT7]-HDLEVAVK[MT7].3b3_1.heavy 400.239 / 510.279 5955.0 23.79400062561035 50 20 10 10 10 8.635888673088424 11.579584196311476 0.0 3 0.9982584827124116 29.56891760076652 5955.0 30.52405660377358 0.0 - - - - - - - 166.7 11 20 ULK1 unc-51-like kinase 1 (C. elegans) 199 26 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 442165.0 15.48503335316976 23 -3 10 6 10 null 0.0 0.03229999542236328 3 0.0 0.0 442165.0 1865.45734321776 0.0 - - - - - - - 360.0 884 7 201 26 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 930723.0 15.48503335316976 23 -3 10 6 10 null 0.0 0.03229999542236328 3 0.0 0.0 930723.0 15800.39791034905 0.0 - - - - - - - 774.4285714285714 1861 7 203 26 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 312539.0 15.48503335316976 23 -3 10 6 10 null 0.0 0.03229999542236328 3 0.0 0.0 312539.0 953.9947873391135 0.0 - - - - - - - 334.77777777777777 625 9 205 27 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22760.[MT7]-THTDSIK[MT7].2y4_1.heavy 545.311 / 606.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4E2 eukaryotic translation initiation factor 4E family member 2 207 27 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22760.[MT7]-THTDSIK[MT7].2y5_1.heavy 545.311 / 707.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4E2 eukaryotic translation initiation factor 4E family member 2 209 27 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22760.[MT7]-THTDSIK[MT7].2b4_1.heavy 545.311 / 599.291 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4E2 eukaryotic translation initiation factor 4E family member 2 211 27 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22760.[MT7]-THTDSIK[MT7].2y6_1.heavy 545.311 / 844.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4E2 eukaryotic translation initiation factor 4E family member 2 213 28 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22769.[MT7]-IIYDRK[MT7].2y4_1.heavy 548.342 / 725.406 2215.0 22.415199279785156 45 15 10 10 10 2.1819336310762436 38.98344403421416 0.0 3 0.9524266251658265 5.63564248804362 2215.0 7.880879948400244 0.0 - - - - - - - 222.1875 4 16 EIF4EBP1;EIF4EBP2;EIF4EBP3 eukaryotic translation initiation factor 4E binding protein 1;eukaryotic translation initiation factor 4E binding protein 2;eukaryotic translation initiation factor 4E binding protein 3 215 28 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22769.[MT7]-IIYDRK[MT7].2y5_1.heavy 548.342 / 838.49 3960.0 22.415199279785156 45 15 10 10 10 2.1819336310762436 38.98344403421416 0.0 3 0.9524266251658265 5.63564248804362 3960.0 34.87164179104477 0.0 - - - - - - - 169.58823529411765 7 17 EIF4EBP1;EIF4EBP2;EIF4EBP3 eukaryotic translation initiation factor 4E binding protein 1;eukaryotic translation initiation factor 4E binding protein 2;eukaryotic translation initiation factor 4E binding protein 3 217 28 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22769.[MT7]-IIYDRK[MT7].2b4_1.heavy 548.342 / 649.368 3490.0 22.415199279785156 45 15 10 10 10 2.1819336310762436 38.98344403421416 0.0 3 0.9524266251658265 5.63564248804362 3490.0 25.598294243070363 0.0 - - - - - - - 226.4375 6 16 EIF4EBP1;EIF4EBP2;EIF4EBP3 eukaryotic translation initiation factor 4E binding protein 1;eukaryotic translation initiation factor 4E binding protein 2;eukaryotic translation initiation factor 4E binding protein 3 219 29 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23085.[MT7]-GC[CAM]FQVYEQGK[MT7].3b4_1.heavy 501.922 / 637.288 14107.0 26.897075653076172 41 17 10 6 8 4.413991135912439 22.655233533750284 0.0381011962890625 4 0.9760383360636922 7.956697492603394 14107.0 86.70144291800713 0.0 - - - - - - - 214.23076923076923 28 13 ACVR1 activin A receptor, type I 221 29 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23085.[MT7]-GC[CAM]FQVYEQGK[MT7].3b5_1.heavy 501.922 / 736.357 10024.0 26.897075653076172 41 17 10 6 8 4.413991135912439 22.655233533750284 0.0381011962890625 4 0.9760383360636922 7.956697492603394 10024.0 38.35631099544567 0.0 - - - - - - - 216.58333333333334 20 12 ACVR1 activin A receptor, type I 223 29 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23085.[MT7]-GC[CAM]FQVYEQGK[MT7].3y4_1.heavy 501.922 / 605.338 5476.0 26.897075653076172 41 17 10 6 8 4.413991135912439 22.655233533750284 0.0381011962890625 4 0.9760383360636922 7.956697492603394 5476.0 13.933910271764162 1.0 - - - - - - - 675.0 12 11 ACVR1 activin A receptor, type I 225 29 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23085.[MT7]-GC[CAM]FQVYEQGK[MT7].3b3_1.heavy 501.922 / 509.23 4269.0 26.897075653076172 41 17 10 6 8 4.413991135912439 22.655233533750284 0.0381011962890625 4 0.9760383360636922 7.956697492603394 4269.0 21.5318298408834 1.0 - - - - - - - 272.1333333333333 8 15 ACVR1 activin A receptor, type I 227 30 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB545208.[MT7]-LQGLTVPSNSHLVLVLDK[MT7].4y5_1.heavy 556.084 / 731.478 9094.0 38.20109939575195 48 18 10 10 10 4.075833493963437 20.00804279532418 0.0 3 0.9881948530056158 11.347455805030283 9094.0 20.988817568921704 0.0 - - - - - - - 718.5714285714286 18 7 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 229 30 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB545208.[MT7]-LQGLTVPSNSHLVLVLDK[MT7].4y4_1.heavy 556.084 / 618.394 12705.0 38.20109939575195 48 18 10 10 10 4.075833493963437 20.00804279532418 0.0 3 0.9881948530056158 11.347455805030283 12705.0 36.843968614104746 0.0 - - - - - - - 677.0 25 10 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 231 30 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB545208.[MT7]-LQGLTVPSNSHLVLVLDK[MT7].4b5_1.heavy 556.084 / 657.405 16317.0 38.20109939575195 48 18 10 10 10 4.075833493963437 20.00804279532418 0.0 3 0.9881948530056158 11.347455805030283 16317.0 49.21270008019246 0.0 - - - - - - - 668.875 32 8 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 233 30 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB545208.[MT7]-LQGLTVPSNSHLVLVLDK[MT7].4y3_1.heavy 556.084 / 519.326 19671.0 38.20109939575195 48 18 10 10 10 4.075833493963437 20.00804279532418 0.0 3 0.9881948530056158 11.347455805030283 19671.0 63.761172413793105 0.0 - - - - - - - 649.7692307692307 39 13 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 235 31 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22860.[MT7]-SEDEGIEK[MT7].2y4_1.heavy 597.808 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 237 31 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22860.[MT7]-SEDEGIEK[MT7].2y5_1.heavy 597.808 / 719.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 239 31 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22860.[MT7]-SEDEGIEK[MT7].2y6_1.heavy 597.808 / 834.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 241 31 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22860.[MT7]-SEDEGIEK[MT7].2b5_1.heavy 597.808 / 662.275 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 243 32 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544413.[MT7]-QETVEC[CAM]LRK[MT7].3b3_1.heavy 484.269 / 503.258 1604.0 21.40192461013794 34 8 10 6 10 1.684868186900692 59.351823945319765 0.03289985656738281 3 0.7763862827639993 2.5595667067727454 1604.0 6.33358334347985 1.0 - - - - - - - 249.0 3 26 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 245 32 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544413.[MT7]-QETVEC[CAM]LRK[MT7].3y4_1.heavy 484.269 / 720.431 1146.0 21.40192461013794 34 8 10 6 10 1.684868186900692 59.351823945319765 0.03289985656738281 3 0.7763862827639993 2.5595667067727454 1146.0 9.99418604651163 0.0 - - - - - - - 132.1304347826087 2 23 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 247 32 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544413.[MT7]-QETVEC[CAM]LRK[MT7].3y8_2.heavy 484.269 / 589.82 8881.0 21.40192461013794 34 8 10 6 10 1.684868186900692 59.351823945319765 0.03289985656738281 3 0.7763862827639993 2.5595667067727454 8881.0 23.254488778054863 0.0 - - - - - - - 291.95238095238096 17 21 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 249 32 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544413.[MT7]-QETVEC[CAM]LRK[MT7].3y5_1.heavy 484.269 / 849.473 1318.0 21.40192461013794 34 8 10 6 10 1.684868186900692 59.351823945319765 0.03289985656738281 3 0.7763862827639993 2.5595667067727454 1318.0 -0.5 1.0 - - - - - - - 127.61538461538461 2 13 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 251 33 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542563.[MT7]-TIVPWK[MT7].2b3_1.heavy 516.328 / 458.31 19956.0 33.774898529052734 44 14 10 10 10 2.709640279166737 36.90526774674009 0.0 3 0.9485181814329617 5.4156975401553025 19956.0 14.501113172541746 0.0 - - - - - - - 1319.857142857143 39 7 CBL;CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence;Cas-Br-M (murine) ecotropic retroviral transforming sequence b 253 33 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542563.[MT7]-TIVPWK[MT7].2y4_1.heavy 516.328 / 673.415 4804.0 33.774898529052734 44 14 10 10 10 2.709640279166737 36.90526774674009 0.0 3 0.9485181814329617 5.4156975401553025 4804.0 10.688224625104137 0.0 - - - - - - - 692.9 9 10 CBL;CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence;Cas-Br-M (murine) ecotropic retroviral transforming sequence b 255 33 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542563.[MT7]-TIVPWK[MT7].2y5_1.heavy 516.328 / 786.499 4435.0 33.774898529052734 44 14 10 10 10 2.709640279166737 36.90526774674009 0.0 3 0.9485181814329617 5.4156975401553025 4435.0 5.205282363853266 1.0 - - - - - - - 716.125 9 8 CBL;CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence;Cas-Br-M (murine) ecotropic retroviral transforming sequence b 257 33 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542563.[MT7]-TIVPWK[MT7].2y3_1.heavy 516.328 / 574.347 34831.0 33.774898529052734 44 14 10 10 10 2.709640279166737 36.90526774674009 0.0 3 0.9485181814329617 5.4156975401553025 34831.0 37.14724122394397 0.0 - - - - - - - 724.0 69 6 CBL;CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence;Cas-Br-M (murine) ecotropic retroviral transforming sequence b 259 34 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38098.[MT7]-NITAQLPTK[MT7].2y4_1.heavy 637.39 / 602.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR1 activin A receptor, type I 261 34 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38098.[MT7]-NITAQLPTK[MT7].2b4_1.heavy 637.39 / 544.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR1 activin A receptor, type I 263 34 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38098.[MT7]-NITAQLPTK[MT7].2y6_1.heavy 637.39 / 801.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR1 activin A receptor, type I 265 34 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38098.[MT7]-NITAQLPTK[MT7].2b5_1.heavy 637.39 / 672.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR1 activin A receptor, type I 267 35 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22767.[MT7]-IDNSLDK[MT7].2y4_1.heavy 546.811 / 606.358 793.0 24.662224292755127 27 5 10 6 6 1.2165202632892804 70.44084051151354 0.03930091857910156 6 0.6988811378729164 2.1899715488554756 793.0 1.650386278034583 11.0 - - - - - - - 288.0 7 20 ACVR1 activin A receptor, type I 269 35 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22767.[MT7]-IDNSLDK[MT7].2y5_1.heavy 546.811 / 720.401 649.0 24.662224292755127 27 5 10 6 6 1.2165202632892804 70.44084051151354 0.03930091857910156 6 0.6988811378729164 2.1899715488554756 649.0 1.915451388888889 6.0 - - - - - - - 212.4 4 20 ACVR1 activin A receptor, type I 271 35 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22767.[MT7]-IDNSLDK[MT7].2y3_1.heavy 546.811 / 519.326 1585.0 24.662224292755127 27 5 10 6 6 1.2165202632892804 70.44084051151354 0.03930091857910156 6 0.6988811378729164 2.1899715488554756 1585.0 0.5498699045967043 19.0 - - - - - - - 725.25 5 16 ACVR1 activin A receptor, type I 273 35 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22767.[MT7]-IDNSLDK[MT7].2y6_1.heavy 546.811 / 835.428 21185.0 24.662224292755127 27 5 10 6 6 1.2165202632892804 70.44084051151354 0.03930091857910156 6 0.6988811378729164 2.1899715488554756 21185.0 37.38145322854061 0.0 - - - - - - - 190.28571428571428 42 14 ACVR1 activin A receptor, type I 275 36 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544168.[MT7]-DVEFLVQLK[MT7].3y3_1.heavy 460.278 / 532.357 30750.0 39.580501556396484 44 14 10 10 10 1.6207539712384762 51.47652055238494 0.0 3 0.9330807414001395 4.743890405885105 30750.0 119.99321798890765 0.0 - - - - - - - 277.4117647058824 61 17 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 277 36 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544168.[MT7]-DVEFLVQLK[MT7].3b4_1.heavy 460.278 / 635.316 46471.0 39.580501556396484 44 14 10 10 10 1.6207539712384762 51.47652055238494 0.0 3 0.9330807414001395 4.743890405885105 46471.0 270.2412786771435 0.0 - - - - - - - 169.1875 92 16 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 279 36 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544168.[MT7]-DVEFLVQLK[MT7].3b5_1.heavy 460.278 / 748.4 25782.0 39.580501556396484 44 14 10 10 10 1.6207539712384762 51.47652055238494 0.0 3 0.9330807414001395 4.743890405885105 25782.0 409.3103987884907 0.0 - - - - - - - 176.1 51 10 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 281 36 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544168.[MT7]-DVEFLVQLK[MT7].3y4_1.heavy 460.278 / 631.426 10627.0 39.580501556396484 44 14 10 10 10 1.6207539712384762 51.47652055238494 0.0 3 0.9330807414001395 4.743890405885105 10627.0 56.67470002872155 0.0 - - - - - - - 159.46666666666667 21 15 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 283 37 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23343.[MT7]-WLIC[CAM]ELC[CAM]SLYNLPK[MT7].3b6_1.heavy 699.709 / 959.514 2229.0 48.8468017578125 50 20 10 10 10 13.441901928200894 7.439423418958414 0.0 3 0.9959906290936928 19.48404131028248 2229.0 7.867058823529411 1.0 - - - - - - - 121.13333333333334 4 15 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 285 37 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23343.[MT7]-WLIC[CAM]ELC[CAM]SLYNLPK[MT7].3b5_1.heavy 699.709 / 846.43 7803.0 48.8468017578125 50 20 10 10 10 13.441901928200894 7.439423418958414 0.0 3 0.9959906290936928 19.48404131028248 7803.0 0.0 0.0 - - - - - - - 151.8235294117647 15 17 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 287 37 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23343.[MT7]-WLIC[CAM]ELC[CAM]SLYNLPK[MT7].3b3_1.heavy 699.709 / 557.357 4809.0 48.8468017578125 50 20 10 10 10 13.441901928200894 7.439423418958414 0.0 3 0.9959906290936928 19.48404131028248 4809.0 31.030385363540468 0.0 - - - - - - - 127.41176470588235 9 17 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 289 37 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23343.[MT7]-WLIC[CAM]ELC[CAM]SLYNLPK[MT7].3y9_2.heavy 699.709 / 626.348 1720.0 48.8468017578125 50 20 10 10 10 13.441901928200894 7.439423418958414 0.0 3 0.9959906290936928 19.48404131028248 1720.0 13.601923843289223 0.0 - - - - - - - 99.16666666666667 3 18 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 291 38 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23341.[MT7]-TILVDWLVEVGEEYK[MT7].3b6_1.heavy 694.385 / 872.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNA1 cyclin A1 293 38 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23341.[MT7]-TILVDWLVEVGEEYK[MT7].3b5_1.heavy 694.385 / 686.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNA1 cyclin A1 295 38 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23341.[MT7]-TILVDWLVEVGEEYK[MT7].3b7_1.heavy 694.385 / 985.584 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNA1 cyclin A1 297 38 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23341.[MT7]-TILVDWLVEVGEEYK[MT7].3y5_1.heavy 694.385 / 769.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNA1 cyclin A1 299 39 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544068.[MT7]-FRAEEVAIK[MT7].3y3_1.heavy 450.938 / 475.336 33607.0 26.944599151611328 33 13 2 10 8 0.9547281311209669 68.04081387812133 0.0 4 0.9199631894557387 4.332887248360417 33607.0 54.500232218174844 1.0 - - - - - - - 690.75 139 12 MAP3K13 mitogen-activated protein kinase kinase kinase 13 301 39 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544068.[MT7]-FRAEEVAIK[MT7].3b5_1.heavy 450.938 / 777.401 11730.0 26.944599151611328 33 13 2 10 8 0.9547281311209669 68.04081387812133 0.0 4 0.9199631894557387 4.332887248360417 11730.0 106.5790322580645 0.0 - - - - - - - 134.33333333333334 23 9 MAP3K13 mitogen-activated protein kinase kinase kinase 13 303 39 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544068.[MT7]-FRAEEVAIK[MT7].3b7_1.heavy 450.938 / 947.507 N/A 26.944599151611328 33 13 2 10 8 0.9547281311209669 68.04081387812133 0.0 4 0.9199631894557387 4.332887248360417 0.0 0.0 2.0 - - - - - - - 0.0 0 0 MAP3K13 mitogen-activated protein kinase kinase kinase 13 305 39 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544068.[MT7]-FRAEEVAIK[MT7].3b7_2.heavy 450.938 / 474.257 17967.0 26.944599151611328 33 13 2 10 8 0.9547281311209669 68.04081387812133 0.0 4 0.9199631894557387 4.332887248360417 17967.0 37.91917348753023 0.0 - - - - - - - 771.5714285714286 35 7 MAP3K13 mitogen-activated protein kinase kinase kinase 13 307 40 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543307.[MT7]-C[CAM]FELDPAR.2b3_1.heavy 576.285 / 581.251 2498.0 30.185400009155273 37 14 10 3 10 1.2594081417262653 52.127655117045336 0.0670013427734375 3 0.9330349539115822 4.742249754647067 2498.0 8.356328737270022 0.0 - - - - - - - 257.0 4 17 CDC20 cell division cycle 20 homolog (S. cerevisiae) 309 40 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543307.[MT7]-C[CAM]FELDPAR.2b4_1.heavy 576.285 / 694.335 2141.0 30.185400009155273 37 14 10 3 10 1.2594081417262653 52.127655117045336 0.0670013427734375 3 0.9330349539115822 4.742249754647067 2141.0 11.907808988764044 1.0 - - - - - - - 188.76470588235293 4 17 CDC20 cell division cycle 20 homolog (S. cerevisiae) 311 40 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543307.[MT7]-C[CAM]FELDPAR.2b5_1.heavy 576.285 / 809.362 15700.0 30.185400009155273 37 14 10 3 10 1.2594081417262653 52.127655117045336 0.0670013427734375 3 0.9330349539115822 4.742249754647067 15700.0 67.9771237271586 0.0 - - - - - - - 200.58333333333334 31 12 CDC20 cell division cycle 20 homolog (S. cerevisiae) 313 40 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543307.[MT7]-C[CAM]FELDPAR.2y7_1.heavy 576.285 / 847.431 3390.0 30.185400009155273 37 14 10 3 10 1.2594081417262653 52.127655117045336 0.0670013427734375 3 0.9330349539115822 4.742249754647067 3390.0 22.515671641791048 0.0 - - - - - - - 202.26666666666668 6 15 CDC20 cell division cycle 20 homolog (S. cerevisiae) 315 41 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23203.[MT7]-EYGASPVLSQGVDPR.2b4_1.heavy 859.945 / 565.274 6100.0 29.06599998474121 46 16 10 10 10 3.2353983673047146 30.908094969246754 0.0 3 0.9665611343993682 6.730059763432365 6100.0 31.86059479553903 0.0 - - - - - - - 195.72727272727272 12 11 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 317 41 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23203.[MT7]-EYGASPVLSQGVDPR.2y10_1.heavy 859.945 / 1067.58 4844.0 29.06599998474121 46 16 10 10 10 3.2353983673047146 30.908094969246754 0.0 3 0.9665611343993682 6.730059763432365 4844.0 31.846957563685592 0.0 - - - - - - - 169.55555555555554 9 9 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 319 41 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23203.[MT7]-EYGASPVLSQGVDPR.2b7_1.heavy 859.945 / 848.427 1794.0 29.06599998474121 46 16 10 10 10 3.2353983673047146 30.908094969246754 0.0 3 0.9665611343993682 6.730059763432365 1794.0 28.05811545623836 0.0 - - - - - - - 212.0 3 11 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 321 41 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23203.[MT7]-EYGASPVLSQGVDPR.2b5_1.heavy 859.945 / 652.306 7446.0 29.06599998474121 46 16 10 10 10 3.2353983673047146 30.908094969246754 0.0 3 0.9665611343993682 6.730059763432365 7446.0 93.95000495662948 0.0 - - - - - - - 244.9090909090909 14 11 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 323 42 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544160.[MT7]-FLLSYSIIK[MT7].3y3_1.heavy 457.954 / 517.383 46591.0 42.14820098876953 45 15 10 10 10 2.2069795554057916 45.31079581369899 0.0 3 0.9514944849991077 5.580787853809513 46591.0 54.4772271714922 0.0 - - - - - - - 1221.0 93 8 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 325 42 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544160.[MT7]-FLLSYSIIK[MT7].3b4_1.heavy 457.954 / 605.378 51250.0 42.14820098876953 45 15 10 10 10 2.2069795554057916 45.31079581369899 0.0 3 0.9514944849991077 5.580787853809513 51250.0 117.63176716359384 0.0 - - - - - - - 209.53333333333333 102 15 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 327 42 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544160.[MT7]-FLLSYSIIK[MT7].3y4_1.heavy 457.954 / 604.415 37273.0 42.14820098876953 45 15 10 10 10 2.2069795554057916 45.31079581369899 0.0 3 0.9514944849991077 5.580787853809513 37273.0 127.68770297029701 0.0 - - - - - - - 204.8 74 20 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 329 42 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544160.[MT7]-FLLSYSIIK[MT7].3b3_1.heavy 457.954 / 518.346 52092.0 42.14820098876953 45 15 10 10 10 2.2069795554057916 45.31079581369899 0.0 3 0.9514944849991077 5.580787853809513 52092.0 244.47136633663368 0.0 - - - - - - - 681.5714285714286 104 7 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 331 43 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542970.[MT7]-TSQSEETR.2y5_1.heavy 541.266 / 621.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 333 43 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542970.[MT7]-TSQSEETR.2b6_1.heavy 541.266 / 806.365 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 335 43 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542970.[MT7]-TSQSEETR.2b5_1.heavy 541.266 / 677.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 337 43 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542970.[MT7]-TSQSEETR.2y7_1.heavy 541.266 / 836.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 339 44 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544063.[MT7]-AQELLNEAVGR.2y8_1.heavy 672.374 / 871.5 7063.0 32.88999938964844 48 18 10 10 10 5.178270402503658 19.31146738718988 0.0 3 0.9873287837812375 10.952003231074181 7063.0 19.499030893491717 0.0 - - - - - - - 269.14285714285717 14 7 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 341 44 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544063.[MT7]-AQELLNEAVGR.2b4_1.heavy 672.374 / 586.332 5838.0 32.88999938964844 48 18 10 10 10 5.178270402503658 19.31146738718988 0.0 3 0.9873287837812375 10.952003231074181 5838.0 5.254879244085605 1.0 - - - - - - - 272.22222222222223 13 9 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 343 44 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544063.[MT7]-AQELLNEAVGR.2y10_1.heavy 672.374 / 1128.6 5838.0 32.88999938964844 48 18 10 10 10 5.178270402503658 19.31146738718988 0.0 3 0.9873287837812375 10.952003231074181 5838.0 74.43260550821152 0.0 - - - - - - - 188.16666666666666 11 6 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 345 44 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544063.[MT7]-AQELLNEAVGR.2y7_1.heavy 672.374 / 758.416 8475.0 32.88999938964844 48 18 10 10 10 5.178270402503658 19.31146738718988 0.0 3 0.9873287837812375 10.952003231074181 8475.0 50.308332708475874 0.0 - - - - - - - 251.25 16 12 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 347 45 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22774.[MT7]-FMDVYQR.2y4_1.heavy 551.777 / 565.309 4424.0 31.41374969482422 46 20 10 6 10 27.580300318448543 3.6257763275010353 0.03730010986328125 3 0.9974479935293595 24.424691146730435 4424.0 9.315477894895064 0.0 - - - - - - - 699.2857142857143 8 7 VEGFA vascular endothelial growth factor A 349 45 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22774.[MT7]-FMDVYQR.2b3_1.heavy 551.777 / 538.245 4519.0 31.41374969482422 46 20 10 6 10 27.580300318448543 3.6257763275010353 0.03730010986328125 3 0.9974479935293595 24.424691146730435 4519.0 6.18359896465961 0.0 - - - - - - - 1802.0 9 7 VEGFA vascular endothelial growth factor A 351 45 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22774.[MT7]-FMDVYQR.2b4_1.heavy 551.777 / 637.314 1600.0 31.41374969482422 46 20 10 6 10 27.580300318448543 3.6257763275010353 0.03730010986328125 3 0.9974479935293595 24.424691146730435 1600.0 2.5312868949232588 2.0 - - - - - - - 715.4 3 10 VEGFA vascular endothelial growth factor A 353 45 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22774.[MT7]-FMDVYQR.2y6_1.heavy 551.777 / 811.377 2824.0 31.41374969482422 46 20 10 6 10 27.580300318448543 3.6257763275010353 0.03730010986328125 3 0.9974479935293595 24.424691146730435 2824.0 12.437451553498114 0.0 - - - - - - - 176.375 5 16 VEGFA vascular endothelial growth factor A 355 46 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22878.[MT7]-QLLLALLQR.3y3_1.heavy 404.603 / 416.262 19481.0 45.54624938964844 40 14 10 6 10 2.0966857481574075 34.51010957574172 0.0337982177734375 3 0.9406444780301486 5.0403406804432755 19481.0 207.9064705882353 0.0 - - - - - - - 148.4 38 10 ULK1 unc-51-like kinase 1 (C. elegans) 357 46 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22878.[MT7]-QLLLALLQR.3y4_1.heavy 404.603 / 529.346 11819.0 45.54624938964844 40 14 10 6 10 2.0966857481574075 34.51010957574172 0.0337982177734375 3 0.9406444780301486 5.0403406804432755 11819.0 104.44286805106658 0.0 - - - - - - - 198.0 23 9 ULK1 unc-51-like kinase 1 (C. elegans) 359 46 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22878.[MT7]-QLLLALLQR.3b3_1.heavy 404.603 / 499.336 10750.0 45.54624938964844 40 14 10 6 10 2.0966857481574075 34.51010957574172 0.0337982177734375 3 0.9406444780301486 5.0403406804432755 10750.0 106.1782397169394 0.0 - - - - - - - 203.57142857142858 21 7 ULK1 unc-51-like kinase 1 (C. elegans) 361 46 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22878.[MT7]-QLLLALLQR.3y5_1.heavy 404.603 / 600.383 11701.0 45.54624938964844 40 14 10 6 10 2.0966857481574075 34.51010957574172 0.0337982177734375 3 0.9406444780301486 5.0403406804432755 11701.0 240.06132246118784 0.0 - - - - - - - 142.4 23 10 ULK1 unc-51-like kinase 1 (C. elegans) 363 47 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22875.[MT7]-K[MT7]IFLEK[MT7].3y3_1.heavy 403.936 / 533.341 21071.0 27.689549922943115 40 14 10 6 10 1.0529709099854463 60.20172604765145 0.03899955749511719 3 0.945515760876772 5.263020682662478 21071.0 28.69191919191919 0.0 - - - - - - - 729.2222222222222 42 9 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 365 47 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22875.[MT7]-K[MT7]IFLEK[MT7].3b3_2.heavy 403.936 / 339.233 13031.0 27.689549922943115 40 14 10 6 10 1.0529709099854463 60.20172604765145 0.03899955749511719 3 0.945515760876772 5.263020682662478 13031.0 51.6162987012987 0.0 - - - - - - - 308.0 26 12 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 367 47 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22875.[MT7]-K[MT7]IFLEK[MT7].3y4_1.heavy 403.936 / 680.41 4528.0 27.689549922943115 40 14 10 6 10 1.0529709099854463 60.20172604765145 0.03899955749511719 3 0.945515760876772 5.263020682662478 4528.0 73.44804418331375 0.0 - - - - - - - 115.25 9 8 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 369 47 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22875.[MT7]-K[MT7]IFLEK[MT7].3y5_1.heavy 403.936 / 793.494 185.0 27.689549922943115 40 14 10 6 10 1.0529709099854463 60.20172604765145 0.03899955749511719 3 0.945515760876772 5.263020682662478 185.0 2.010869565217391 4.0 - - - - - - - 0.0 0 0 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 371 48 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22773.[MT7]-TPGRTPGK[MT7].2y4_1.heavy 551.335 / 546.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 373 48 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22773.[MT7]-TPGRTPGK[MT7].2y6_1.heavy 551.335 / 759.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 375 48 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22773.[MT7]-TPGRTPGK[MT7].2b5_1.heavy 551.335 / 657.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 377 48 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22773.[MT7]-TPGRTPGK[MT7].2y7_1.heavy 551.335 / 856.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 379 49 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23478.[MT7]-LQQQDTWEVPFEEISELQWLGSGAQGAVFLGK[MT7].4y4_1.heavy 970.502 / 608.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K13 mitogen-activated protein kinase kinase kinase 13 381 49 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23478.[MT7]-LQQQDTWEVPFEEISELQWLGSGAQGAVFLGK[MT7].4b8_1.heavy 970.502 / 1173.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K13 mitogen-activated protein kinase kinase kinase 13 383 49 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23478.[MT7]-LQQQDTWEVPFEEISELQWLGSGAQGAVFLGK[MT7].4b5_1.heavy 970.502 / 757.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K13 mitogen-activated protein kinase kinase kinase 13 385 49 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23478.[MT7]-LQQQDTWEVPFEEISELQWLGSGAQGAVFLGK[MT7].4b6_1.heavy 970.502 / 858.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K13 mitogen-activated protein kinase kinase kinase 13 387 50 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23472.[MT7]-TLVLVVAAVLLLVSAESALITQQDLAPQQR.4b8_1.heavy 826.74 / 911.605 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 389 50 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23472.[MT7]-TLVLVVAAVLLLVSAESALITQQDLAPQQR.4y4_1.heavy 826.74 / 528.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 391 50 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23472.[MT7]-TLVLVVAAVLLLVSAESALITQQDLAPQQR.4b4_1.heavy 826.74 / 571.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 393 50 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23472.[MT7]-TLVLVVAAVLLLVSAESALITQQDLAPQQR.4b5_1.heavy 826.74 / 670.462 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 395 51 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37792.[MT7]-LANTLK[MT7].2y4_1.heavy 474.31 / 619.39 4422.0 24.805599212646484 50 20 10 10 10 5.505588371236378 18.163362979049452 0.0 3 0.9943127477310338 16.357053718894427 4422.0 7.865309598786078 0.0 - - - - - - - 667.625 8 8 ACSS1 acyl-CoA synthetase short-chain family member 1 397 51 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37792.[MT7]-LANTLK[MT7].2y5_1.heavy 474.31 / 690.427 9594.0 24.805599212646484 50 20 10 10 10 5.505588371236378 18.163362979049452 0.0 3 0.9943127477310338 16.357053718894427 9594.0 4.984296265540287 0.0 - - - - - - - 667.5714285714286 19 7 ACSS1 acyl-CoA synthetase short-chain family member 1 399 51 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37792.[MT7]-LANTLK[MT7].2b4_1.heavy 474.31 / 544.321 1669.0 24.805599212646484 50 20 10 10 10 5.505588371236378 18.163362979049452 0.0 3 0.9943127477310338 16.357053718894427 1669.0 3.121388422035481 7.0 - - - - - - - 699.4615384615385 5 13 ACSS1 acyl-CoA synthetase short-chain family member 1 401 51 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37792.[MT7]-LANTLK[MT7].2y3_1.heavy 474.31 / 505.347 2670.0 24.805599212646484 50 20 10 10 10 5.505588371236378 18.163362979049452 0.0 3 0.9943127477310338 16.357053718894427 2670.0 2.241007194244604 0.0 - - - - - - - 731.6153846153846 5 13 ACSS1 acyl-CoA synthetase short-chain family member 1 403 52 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23095.[MT7]-TPSSQNLLALLAR.2y4_1.heavy 764.452 / 472.324 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 405 52 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23095.[MT7]-TPSSQNLLALLAR.2b6_1.heavy 764.452 / 759.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 407 52 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23095.[MT7]-TPSSQNLLALLAR.2y6_1.heavy 764.452 / 656.445 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 409 52 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23095.[MT7]-TPSSQNLLALLAR.2y11_1.heavy 764.452 / 1185.69 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 411 53 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23091.[MT7]-VREQNETDIK[MT7].3y3_1.heavy 507.282 / 519.326 9313.0 18.44730059305827 38 11 10 7 10 1.17841445667846 74.53999228436864 0.028200149536132812 3 0.8700121352198944 3.3852460500324133 9313.0 20.47868245156905 0.0 - - - - - - - 252.4 18 20 MAP3K13 mitogen-activated protein kinase kinase kinase 13 413 53 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23091.[MT7]-VREQNETDIK[MT7].3b5_1.heavy 507.282 / 771.423 2377.0 18.44730059305827 38 11 10 7 10 1.17841445667846 74.53999228436864 0.028200149536132812 3 0.8700121352198944 3.3852460500324133 2377.0 8.749781685870225 0.0 - - - - - - - 126.78260869565217 4 23 MAP3K13 mitogen-activated protein kinase kinase kinase 13 415 53 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23091.[MT7]-VREQNETDIK[MT7].3b8_2.heavy 507.282 / 558.774 18868.0 18.44730059305827 38 11 10 7 10 1.17841445667846 74.53999228436864 0.028200149536132812 3 0.8700121352198944 3.3852460500324133 18868.0 40.18561232581851 0.0 - - - - - - - 685.375 37 8 MAP3K13 mitogen-activated protein kinase kinase kinase 13 417 53 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23091.[MT7]-VREQNETDIK[MT7].3b7_2.heavy 507.282 / 501.26 N/A 18.44730059305827 38 11 10 7 10 1.17841445667846 74.53999228436864 0.028200149536132812 3 0.8700121352198944 3.3852460500324133 20517.0 13.362100916278594 1.0 - - - - - - - 1770.625 41 8 MAP3K13 mitogen-activated protein kinase kinase kinase 13 419 54 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544400.[MT7]-FYFENLLSK[MT7].2b3_1.heavy 724.905 / 602.31 1254.0 42.74155044555664 34 8 10 6 10 1.6148144639440707 41.28441264009862 0.03350067138671875 3 0.783986936691452 2.6060043839679388 1254.0 3.1166666666666667 1.0 - - - - - - - 222.57142857142858 2 21 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 421 54 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544400.[MT7]-FYFENLLSK[MT7].2y8_1.heavy 724.905 / 1157.63 1824.0 42.74155044555664 34 8 10 6 10 1.6148144639440707 41.28441264009862 0.03350067138671875 3 0.783986936691452 2.6060043839679388 1824.0 44.8 0.0 - - - - - - - 147.25 3 12 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 423 54 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544400.[MT7]-FYFENLLSK[MT7].2y8_2.heavy 724.905 / 579.32 342.0 42.74155044555664 34 8 10 6 10 1.6148144639440707 41.28441264009862 0.03350067138671875 3 0.783986936691452 2.6060043839679388 342.0 0.26666666666666666 29.0 - - - - - - - 0.0 1 0 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 425 54 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544400.[MT7]-FYFENLLSK[MT7].2y7_1.heavy 724.905 / 994.569 2451.0 42.74155044555664 34 8 10 6 10 1.6148144639440707 41.28441264009862 0.03350067138671875 3 0.783986936691452 2.6060043839679388 2451.0 21.5 0.0 - - - - - - - 171.0 4 18 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 427 55 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22777.[MT7]-LTDLLLK[MT7].2y4_1.heavy 552.368 / 630.467 3450.0 39.39362621307373 40 14 10 6 10 1.7491246704463754 38.66747573107453 0.038097381591796875 3 0.9471286242625367 5.343425550334295 3450.0 8.52689544361338 3.0 - - - - - - - 239.54545454545453 6 11 ULK1 unc-51-like kinase 1 (C. elegans) 429 55 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22777.[MT7]-LTDLLLK[MT7].2b4_1.heavy 552.368 / 587.352 1631.0 39.39362621307373 40 14 10 6 10 1.7491246704463754 38.66747573107453 0.038097381591796875 3 0.9471286242625367 5.343425550334295 1631.0 0.6933049946865038 3.0 - - - - - - - 627.4444444444445 3 9 ULK1 unc-51-like kinase 1 (C. elegans) 431 55 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22777.[MT7]-LTDLLLK[MT7].2y3_1.heavy 552.368 / 517.383 3199.0 39.39362621307373 40 14 10 6 10 1.7491246704463754 38.66747573107453 0.038097381591796875 3 0.9471286242625367 5.343425550334295 3199.0 2.194740124740125 2.0 - - - - - - - 1151.909090909091 6 11 ULK1 unc-51-like kinase 1 (C. elegans) 433 55 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22777.[MT7]-LTDLLLK[MT7].2y6_1.heavy 552.368 / 846.542 2635.0 39.39362621307373 40 14 10 6 10 1.7491246704463754 38.66747573107453 0.038097381591796875 3 0.9471286242625367 5.343425550334295 2635.0 23.69610358565737 0.0 - - - - - - - 185.23809523809524 5 21 ULK1 unc-51-like kinase 1 (C. elegans) 435 56 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 705806.0 18.177400588989258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 705806.0 2369.7732316454017 0.0 - - - - - - - 227.5 1411 6 437 56 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 427471.0 18.177400588989258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 427471.0 2046.3383914273952 0.0 - - - - - - - 738.3 854 10 439 56 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 393585.0 18.177400588989258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 393585.0 1913.4457088841036 0.0 - - - - - - - 724.8888888888889 787 9 441 57 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544406.[MT7]-QITLLEC[CAM]VGK[MT7].3b4_1.heavy 483.618 / 600.384 35011.0 35.5359001159668 50 20 10 10 10 5.307019549004511 18.84296808719274 0.0 3 0.9904698681093465 12.63186289004579 35011.0 81.53703085397214 0.0 - - - - - - - 631.1 70 10 ACVR1 activin A receptor, type I 443 57 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544406.[MT7]-QITLLEC[CAM]VGK[MT7].3b5_1.heavy 483.618 / 713.468 18106.0 35.5359001159668 50 20 10 10 10 5.307019549004511 18.84296808719274 0.0 3 0.9904698681093465 12.63186289004579 18106.0 100.72558369265568 0.0 - - - - - - - 225.38888888888889 36 18 ACVR1 activin A receptor, type I 445 57 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544406.[MT7]-QITLLEC[CAM]VGK[MT7].3y4_1.heavy 483.618 / 607.335 21638.0 35.5359001159668 50 20 10 10 10 5.307019549004511 18.84296808719274 0.0 3 0.9904698681093465 12.63186289004579 21638.0 55.36048205194303 0.0 - - - - - - - 659.3333333333334 43 9 ACVR1 activin A receptor, type I 447 57 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544406.[MT7]-QITLLEC[CAM]VGK[MT7].3b3_1.heavy 483.618 / 487.3 N/A 35.5359001159668 50 20 10 10 10 5.307019549004511 18.84296808719274 0.0 3 0.9904698681093465 12.63186289004579 15702.0 6.719721778978936 2.0 - - - - - - - 741.75 37 8 ACVR1 activin A receptor, type I 449 58 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23336.[MT7]-DRFGIDDQDYLVSLTR.3b9_2.heavy 686.352 / 603.779 11186.0 37.61349868774414 41 11 10 10 10 0.9870304619772551 59.97683291108922 0.0 3 0.8648968158649163 3.3190531142201247 11186.0 34.02406864753023 0.0 - - - - - - - 232.31578947368422 22 19 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 451 58 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23336.[MT7]-DRFGIDDQDYLVSLTR.3y7_1.heavy 686.352 / 851.498 3388.0 37.61349868774414 41 11 10 10 10 0.9870304619772551 59.97683291108922 0.0 3 0.8648968158649163 3.3190531142201247 3388.0 7.241969458223908 0.0 - - - - - - - 222.21052631578948 6 19 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 453 58 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23336.[MT7]-DRFGIDDQDYLVSLTR.3b7_1.heavy 686.352 / 963.465 1087.0 37.61349868774414 41 11 10 10 10 0.9870304619772551 59.97683291108922 0.0 3 0.8648968158649163 3.3190531142201247 1087.0 6.227604166666667 0.0 - - - - - - - 154.89473684210526 2 19 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 455 58 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23336.[MT7]-DRFGIDDQDYLVSLTR.3y5_1.heavy 686.352 / 575.351 8310.0 37.61349868774414 41 11 10 10 10 0.9870304619772551 59.97683291108922 0.0 3 0.8648968158649163 3.3190531142201247 8310.0 27.17348081340934 0.0 - - - - - - - 584.1428571428571 16 7 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 457 59 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23339.[MT7]-TILVDWLVEVGEEYK[MT7].2b3_1.heavy 1041.07 / 472.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNA1 cyclin A1 459 59 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23339.[MT7]-TILVDWLVEVGEEYK[MT7].2y8_1.heavy 1041.07 / 1096.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNA1 cyclin A1 461 59 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23339.[MT7]-TILVDWLVEVGEEYK[MT7].2y5_1.heavy 1041.07 / 769.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNA1 cyclin A1 463 59 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23339.[MT7]-TILVDWLVEVGEEYK[MT7].2b5_1.heavy 1041.07 / 686.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNA1 cyclin A1 465 60 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23481.[MT7]-DAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLK[MT7].4y4_1.heavy 1125.36 / 668.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - VHL von Hippel-Lindau tumor suppressor 467 60 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23481.[MT7]-DAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLK[MT7].4b11_1.heavy 1125.36 / 1237.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - VHL von Hippel-Lindau tumor suppressor 469 60 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23481.[MT7]-DAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLK[MT7].4b9_1.heavy 1125.36 / 1024.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - VHL von Hippel-Lindau tumor suppressor 471 60 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23481.[MT7]-DAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLK[MT7].4y6_1.heavy 1125.36 / 864.531 N/A N/A - - - - - - - - - 0.0 - - - - - - - VHL von Hippel-Lindau tumor suppressor 473 61 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543670.[MT7]-EYC[CAM]PQVFR.2b3_1.heavy 621.807 / 597.246 5479.0 29.35420036315918 48 18 10 10 10 5.188751690847646 19.272458186116012 0.0 3 0.9828319503053343 9.405428613686391 5479.0 19.955225573558756 0.0 - - - - - - - 252.5625 10 16 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 475 61 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543670.[MT7]-EYC[CAM]PQVFR.2y5_1.heavy 621.807 / 646.367 6197.0 29.35420036315918 48 18 10 10 10 5.188751690847646 19.272458186116012 0.0 3 0.9828319503053343 9.405428613686391 6197.0 26.02482435151224 0.0 - - - - - - - 192.42857142857142 12 14 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 477 61 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543670.[MT7]-EYC[CAM]PQVFR.2y6_1.heavy 621.807 / 806.398 1976.0 29.35420036315918 48 18 10 10 10 5.188751690847646 19.272458186116012 0.0 3 0.9828319503053343 9.405428613686391 1976.0 17.443648079306072 0.0 - - - - - - - 224.5 3 8 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 479 61 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543670.[MT7]-EYC[CAM]PQVFR.2y7_1.heavy 621.807 / 969.461 6916.0 29.35420036315918 48 18 10 10 10 5.188751690847646 19.272458186116012 0.0 3 0.9828319503053343 9.405428613686391 6916.0 40.916056041668824 0.0 - - - - - - - 206.5 13 10 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 481 62 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541571.[MT7]-TLVIK[MT7].2b3_1.heavy 431.304 / 458.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLCN7;PIP4K2C;SYTL5;CHST2 chloride channel 7;phosphatidylinositol-5-phosphate 4-kinase, type II, gamma;synaptotagmin-like 5;carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2 483 62 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541571.[MT7]-TLVIK[MT7].2y4_1.heavy 431.304 / 616.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLCN7;PIP4K2C;SYTL5;CHST2 chloride channel 7;phosphatidylinositol-5-phosphate 4-kinase, type II, gamma;synaptotagmin-like 5;carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2 485 62 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541571.[MT7]-TLVIK[MT7].2b4_1.heavy 431.304 / 571.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLCN7;PIP4K2C;SYTL5;CHST2 chloride channel 7;phosphatidylinositol-5-phosphate 4-kinase, type II, gamma;synaptotagmin-like 5;carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2 487 62 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541571.[MT7]-TLVIK[MT7].2y3_1.heavy 431.304 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLCN7;PIP4K2C;SYTL5;CHST2 chloride channel 7;phosphatidylinositol-5-phosphate 4-kinase, type II, gamma;synaptotagmin-like 5;carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2 489 63 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22788.[MT7]-SGVVLATVAR.2y9_1.heavy 558.846 / 885.552 3694.0 28.807875156402588 43 17 10 6 10 4.559195654833446 21.933693478143383 0.03949928283691406 3 0.9731926578165446 7.520738650834074 3694.0 23.60055555555555 0.0 - - - - - - - 172.5 7 12 CCNA1 cyclin A1 491 63 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22788.[MT7]-SGVVLATVAR.2y6_1.heavy 558.846 / 630.393 6036.0 28.807875156402588 43 17 10 6 10 4.559195654833446 21.933693478143383 0.03949928283691406 3 0.9731926578165446 7.520738650834074 6036.0 12.449093385908057 0.0 - - - - - - - 761.0 12 9 CCNA1 cyclin A1 493 63 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22788.[MT7]-SGVVLATVAR.2b5_1.heavy 558.846 / 600.384 3874.0 28.807875156402588 43 17 10 6 10 4.559195654833446 21.933693478143383 0.03949928283691406 3 0.9731926578165446 7.520738650834074 3874.0 7.059164967509575 0.0 - - - - - - - 743.5 7 8 CCNA1 cyclin A1 495 63 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22788.[MT7]-SGVVLATVAR.2y7_1.heavy 558.846 / 729.462 4955.0 28.807875156402588 43 17 10 6 10 4.559195654833446 21.933693478143383 0.03949928283691406 3 0.9731926578165446 7.520738650834074 4955.0 13.711712625462228 0.0 - - - - - - - 249.23076923076923 9 13 CCNA1 cyclin A1 497 64 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22588.[MT7]-DLIMK[MT7].2b3_1.heavy 454.28 / 486.304 1738.0 28.06719970703125 32 20 0 6 6 8.820890850413297 11.336723432567421 0.03989982604980469 6 0.9969409462595398 22.30786684171622 1738.0 0.1706109324758842 6.0 - - - - - - - 759.2 37 10 TAF7L;RIPK2 TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa;receptor-interacting serine-threonine kinase 2 499 64 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22588.[MT7]-DLIMK[MT7].2y4_1.heavy 454.28 / 648.424 2653.0 28.06719970703125 32 20 0 6 6 8.820890850413297 11.336723432567421 0.03989982604980469 6 0.9969409462595398 22.30786684171622 2653.0 16.23693989071038 1.0 - - - - - - - 252.7058823529412 11 17 TAF7L;RIPK2 TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa;receptor-interacting serine-threonine kinase 2 501 64 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22588.[MT7]-DLIMK[MT7].2y3_1.heavy 454.28 / 535.339 2470.0 28.06719970703125 32 20 0 6 6 8.820890850413297 11.336723432567421 0.03989982604980469 6 0.9969409462595398 22.30786684171622 2470.0 2.1529544348710092 2.0 - - - - - - - 316.8666666666667 4 15 TAF7L;RIPK2 TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa;receptor-interacting serine-threonine kinase 2 503 65 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38381.[MT7]-SAAQMEVASFLLSK[MT7].3b6_1.heavy 590.662 / 762.357 18306.0 42.007301330566406 47 17 10 10 10 3.047581028431861 25.59686857372013 0.0 3 0.9707805945625262 7.2021719533663875 18306.0 110.32633928571431 0.0 - - - - - - - 216.36363636363637 36 22 CDC20 cell division cycle 20 homolog (S. cerevisiae) 505 65 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38381.[MT7]-SAAQMEVASFLLSK[MT7].3b4_1.heavy 590.662 / 502.274 13939.0 42.007301330566406 47 17 10 10 10 3.047581028431861 25.59686857372013 0.0 3 0.9707805945625262 7.2021719533663875 13939.0 77.99202380952381 0.0 - - - - - - - 236.92307692307693 27 26 CDC20 cell division cycle 20 homolog (S. cerevisiae) 507 65 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38381.[MT7]-SAAQMEVASFLLSK[MT7].3b5_1.heavy 590.662 / 633.315 7725.0 42.007301330566406 47 17 10 10 10 3.047581028431861 25.59686857372013 0.0 3 0.9707805945625262 7.2021719533663875 7725.0 52.87946428571428 0.0 - - - - - - - 168.0 15 23 CDC20 cell division cycle 20 homolog (S. cerevisiae) 509 65 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38381.[MT7]-SAAQMEVASFLLSK[MT7].3b7_1.heavy 590.662 / 861.426 4870.0 42.007301330566406 47 17 10 10 10 3.047581028431861 25.59686857372013 0.0 3 0.9707805945625262 7.2021719533663875 4870.0 27.538690476190474 0.0 - - - - - - - 149.33333333333334 9 18 CDC20 cell division cycle 20 homolog (S. cerevisiae) 511 66 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38380.[MT7]-LLVPANEGDPTETLR.2b3_1.heavy 884.982 / 470.346 37603.0 33.818599700927734 32 2 10 10 10 0.6107429451831251 73.61203827283843 0.0 3 0.4990697199984832 1.6649593128315638 37603.0 96.98679785028534 0.0 - - - - - - - 673.1428571428571 75 7 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 513 66 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38380.[MT7]-LLVPANEGDPTETLR.2y8_1.heavy 884.982 / 888.442 832.0 33.818599700927734 32 2 10 10 10 0.6107429451831251 73.61203827283843 0.0 3 0.4990697199984832 1.6649593128315638 832.0 13.24356286721504 0.0 - - - - - - - 0.0 1 0 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 515 66 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38380.[MT7]-LLVPANEGDPTETLR.2y6_1.heavy 884.982 / 716.394 10255.0 33.818599700927734 32 2 10 10 10 0.6107429451831251 73.61203827283843 0.0 3 0.4990697199984832 1.6649593128315638 10255.0 145.74622979124155 0.0 - - - - - - - 184.57142857142858 20 14 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 517 66 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38380.[MT7]-LLVPANEGDPTETLR.2y11_1.heavy 884.982 / 1202.56 370.0 33.818599700927734 32 2 10 10 10 0.6107429451831251 73.61203827283843 0.0 3 0.4990697199984832 1.6649593128315638 370.0 5.5895652173913035 3.0 - - - - - - - 0.0 0 0 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 519 67 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23060.[MT7]-K[MT7]SEDEGIEK[MT7].3b4_1.heavy 489.607 / 748.408 2181.0 17.463350296020508 42 16 10 6 10 2.959452502012067 33.7900337755082 0.03350067138671875 3 0.9609610289527545 6.225727371954287 2181.0 7.888242157116931 0.0 - - - - - - - 163.69230769230768 4 13 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 521 67 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23060.[MT7]-K[MT7]SEDEGIEK[MT7].3b5_1.heavy 489.607 / 877.451 2891.0 17.463350296020508 42 16 10 6 10 2.959452502012067 33.7900337755082 0.03350067138671875 3 0.9609610289527545 6.225727371954287 2891.0 52.09524752475248 0.0 - - - - - - - 78.45454545454545 5 11 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 523 67 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23060.[MT7]-K[MT7]SEDEGIEK[MT7].3y4_1.heavy 489.607 / 590.363 7302.0 17.463350296020508 42 16 10 6 10 2.959452502012067 33.7900337755082 0.03350067138671875 3 0.9609610289527545 6.225727371954287 7302.0 17.28284023668639 0.0 - - - - - - - 195.2 14 20 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 525 67 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23060.[MT7]-K[MT7]SEDEGIEK[MT7].3y5_1.heavy 489.607 / 719.406 5680.0 17.463350296020508 42 16 10 6 10 2.959452502012067 33.7900337755082 0.03350067138671875 3 0.9609610289527545 6.225727371954287 5680.0 44.471044567704894 0.0 - - - - - - - 175.41666666666666 11 24 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 527 68 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38382.[MT7]-ALYSTAMESIQGEAR.2y4_1.heavy 885.944 / 432.22 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 529 68 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38382.[MT7]-ALYSTAMESIQGEAR.2y8_1.heavy 885.944 / 889.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 531 68 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38382.[MT7]-ALYSTAMESIQGEAR.2y5_1.heavy 885.944 / 560.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 533 68 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38382.[MT7]-ALYSTAMESIQGEAR.2y7_1.heavy 885.944 / 760.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 535 69 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38506.[MT7]-NVFDEAILAALEPPEPK[MT7].3b6_1.heavy 714.396 / 820.396 12437.0 47.862749099731445 37 10 10 7 10 0.7433746955273027 72.11427276643268 0.027698516845703125 3 0.8389207362690296 3.032722491182338 12437.0 37.13256056286214 0.0 - - - - - - - 136.7 24 10 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 537 69 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38506.[MT7]-NVFDEAILAALEPPEPK[MT7].3b5_1.heavy 714.396 / 749.359 5431.0 47.862749099731445 37 10 10 7 10 0.7433746955273027 72.11427276643268 0.027698516845703125 3 0.8389207362690296 3.032722491182338 5431.0 31.548810487427744 0.0 - - - - - - - 223.23076923076923 10 13 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 539 69 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38506.[MT7]-NVFDEAILAALEPPEPK[MT7].3y5_1.heavy 714.396 / 711.416 22594.0 47.862749099731445 37 10 10 7 10 0.7433746955273027 72.11427276643268 0.027698516845703125 3 0.8389207362690296 3.032722491182338 22594.0 39.634440998093915 0.0 - - - - - - - 214.63636363636363 45 11 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 541 69 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38506.[MT7]-NVFDEAILAALEPPEPK[MT7].3b7_1.heavy 714.396 / 933.48 9908.0 47.862749099731445 37 10 10 7 10 0.7433746955273027 72.11427276643268 0.027698516845703125 3 0.8389207362690296 3.032722491182338 9908.0 31.34715037402194 0.0 - - - - - - - 200.33333333333334 19 12 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 543 70 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 2108390.0 36.90769958496094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2108390.0 2226.957094611227 0.0 - - - - - - - 238.71428571428572 4216 7 545 70 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 872670.0 36.90769958496094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 872670.0 2308.6872849748947 0.0 - - - - - - - 219.58333333333334 1745 12 547 70 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1487520.0 36.90769958496094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1487520.0 1825.3104661034708 0.0 - - - - - - - 183.57142857142858 2975 7 549 71 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23064.[MT7]-EYDIPGLVRK[MT7].3b6_1.heavy 493.292 / 819.401 3602.0 31.212499618530273 47 17 10 10 10 2.5743635307528314 38.84455276242847 0.0 3 0.9720246572314373 7.361341524356368 3602.0 22.764543552840767 0.0 - - - - - - - 219.3125 7 16 PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 551 71 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23064.[MT7]-EYDIPGLVRK[MT7].3y6_1.heavy 493.292 / 813.543 13761.0 31.212499618530273 47 17 10 10 10 2.5743635307528314 38.84455276242847 0.0 3 0.9720246572314373 7.361341524356368 13761.0 64.08552346570397 0.0 - - - - - - - 220.55555555555554 27 18 PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 553 71 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23064.[MT7]-EYDIPGLVRK[MT7].3b4_1.heavy 493.292 / 665.326 7850.0 31.212499618530273 47 17 10 10 10 2.5743635307528314 38.84455276242847 0.0 3 0.9720246572314373 7.361341524356368 7850.0 59.46060206548012 0.0 - - - - - - - 240.13333333333333 15 15 PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 555 71 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23064.[MT7]-EYDIPGLVRK[MT7].3b3_1.heavy 493.292 / 552.242 30570.0 31.212499618530273 47 17 10 10 10 2.5743635307528314 38.84455276242847 0.0 3 0.9720246572314373 7.361341524356368 30570.0 59.87162185222203 0.0 - - - - - - - 636.0 61 9 PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 557 72 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23061.[MT7]-YLSEVASGDNK[MT7].2y5_1.heavy 735.888 / 664.338 2276.0 27.86363410949707 45 20 10 5 10 9.615161515508348 10.40024131042515 0.04010009765625 3 0.9966565478894861 21.337510038468793 2276.0 5.919267399267399 0.0 - - - - - - - 231.0 4 13 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 559 72 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23061.[MT7]-YLSEVASGDNK[MT7].2y9_1.heavy 735.888 / 1050.52 1548.0 27.86363410949707 45 20 10 5 10 9.615161515508348 10.40024131042515 0.04010009765625 3 0.9966565478894861 21.337510038468793 1548.0 19.052307692307693 0.0 - - - - - - - 182.0 3 5 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 561 72 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23061.[MT7]-YLSEVASGDNK[MT7].2b4_1.heavy 735.888 / 637.331 4461.0 27.86363410949707 45 20 10 5 10 9.615161515508348 10.40024131042515 0.04010009765625 3 0.9966565478894861 21.337510038468793 4461.0 15.52362637362637 0.0 - - - - - - - 234.68421052631578 8 19 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 563 72 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23061.[MT7]-YLSEVASGDNK[MT7].2y6_1.heavy 735.888 / 735.375 N/A 27.86363410949707 45 20 10 5 10 9.615161515508348 10.40024131042515 0.04010009765625 3 0.9966565478894861 21.337510038468793 16660.0 4.275102115874997 1.0 - - - - - - - 4351.8 33 5 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 565 73 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22581.[MT7]-TVQHK[MT7].2b3_1.heavy 450.779 / 473.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP5K1A;PIP5K1B phosphatidylinositol-4-phosphate 5-kinase, type I, alpha;phosphatidylinositol-4-phosphate 5-kinase, type I, beta 567 73 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22581.[MT7]-TVQHK[MT7].2y4_1.heavy 450.779 / 655.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP5K1A;PIP5K1B phosphatidylinositol-4-phosphate 5-kinase, type I, alpha;phosphatidylinositol-4-phosphate 5-kinase, type I, beta 569 73 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22581.[MT7]-TVQHK[MT7].2y3_1.heavy 450.779 / 556.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP5K1A;PIP5K1B phosphatidylinositol-4-phosphate 5-kinase, type I, alpha;phosphatidylinositol-4-phosphate 5-kinase, type I, beta 571 74 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38222.[MT7]-APFQASSPQDLR.2y8_1.heavy 730.884 / 873.443 1201.0 28.090449810028076 38 12 10 6 10 2.084416185400443 47.97506404930776 0.03980064392089844 3 0.8810096118491758 3.5416274370902463 1201.0 19.155314923619272 0.0 - - - - - - - 250.85714285714286 2 7 ULK1 unc-51-like kinase 1 (C. elegans) 573 74 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38222.[MT7]-APFQASSPQDLR.2y11_1.heavy 730.884 / 1245.62 1848.0 28.090449810028076 38 12 10 6 10 2.084416185400443 47.97506404930776 0.03980064392089844 3 0.8810096118491758 3.5416274370902463 1848.0 24.75119133574007 0.0 - - - - - - - 133.22222222222223 3 9 ULK1 unc-51-like kinase 1 (C. elegans) 575 74 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38222.[MT7]-APFQASSPQDLR.2y5_1.heavy 730.884 / 628.341 924.0 28.090449810028076 38 12 10 6 10 2.084416185400443 47.97506404930776 0.03980064392089844 3 0.8810096118491758 3.5416274370902463 924.0 10.332296122209165 1.0 - - - - - - - 0.0 1 0 ULK1 unc-51-like kinase 1 (C. elegans) 577 74 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38222.[MT7]-APFQASSPQDLR.2y9_1.heavy 730.884 / 1001.5 739.0 28.090449810028076 38 12 10 6 10 2.084416185400443 47.97506404930776 0.03980064392089844 3 0.8810096118491758 3.5416274370902463 739.0 6.391351351351352 1.0 - - - - - - - 0.0 1 0 ULK1 unc-51-like kinase 1 (C. elegans) 579 75 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38285.[MT7]-NLQSPTQFQTPR.2b3_1.heavy 780.916 / 500.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 581 75 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38285.[MT7]-NLQSPTQFQTPR.2y8_1.heavy 780.916 / 974.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 583 75 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38285.[MT7]-NLQSPTQFQTPR.2y9_1.heavy 780.916 / 1061.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 585 75 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38285.[MT7]-NLQSPTQFQTPR.2y10_1.heavy 780.916 / 1189.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 587 76 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23160.[MT7]-WFSDPTLTSLAK[MT7].3b6_1.heavy 551.975 / 878.417 12237.0 39.67975044250488 40 14 10 6 10 2.7698005694060757 36.103682375024874 0.039699554443359375 3 0.9416552620222806 5.084251198293316 12237.0 76.00082066869301 0.0 - - - - - - - 211.8 24 15 ACVR1 activin A receptor, type I 589 76 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23160.[MT7]-WFSDPTLTSLAK[MT7].3b4_1.heavy 551.975 / 680.316 44652.0 39.67975044250488 40 14 10 6 10 2.7698005694060757 36.103682375024874 0.039699554443359375 3 0.9416552620222806 5.084251198293316 44652.0 102.13081198471042 0.0 - - - - - - - 302.7857142857143 89 14 ACVR1 activin A receptor, type I 591 76 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23160.[MT7]-WFSDPTLTSLAK[MT7].3y4_1.heavy 551.975 / 562.368 24532.0 39.67975044250488 40 14 10 6 10 2.7698005694060757 36.103682375024874 0.039699554443359375 3 0.9416552620222806 5.084251198293316 24532.0 63.80405598709551 0.0 - - - - - - - 627.3333333333334 49 9 ACVR1 activin A receptor, type I 593 76 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23160.[MT7]-WFSDPTLTSLAK[MT7].3y5_1.heavy 551.975 / 663.416 24473.0 39.67975044250488 40 14 10 6 10 2.7698005694060757 36.103682375024874 0.039699554443359375 3 0.9416552620222806 5.084251198293316 24473.0 110.71823478464842 0.0 - - - - - - - 219.0 48 18 ACVR1 activin A receptor, type I 595 77 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22781.[MT7]-ADAAEFWR.2y3_1.heavy 555.278 / 508.267 9002.0 33.58002471923828 36 11 10 5 10 0.900055390417504 74.0695154725337 0.0478973388671875 3 0.8751700127341802 3.456034416968887 9002.0 15.003333333333334 0.0 - - - - - - - 756.0 18 10 CBL;CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence;Cas-Br-M (murine) ecotropic retroviral transforming sequence b 597 77 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22781.[MT7]-ADAAEFWR.2y6_1.heavy 555.278 / 779.383 5311.0 33.58002471923828 36 11 10 5 10 0.900055390417504 74.0695154725337 0.0478973388671875 3 0.8751700127341802 3.456034416968887 5311.0 4.8524433621287235 1.0 - - - - - - - 253.63636363636363 11 11 CBL;CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence;Cas-Br-M (murine) ecotropic retroviral transforming sequence b 599 77 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22781.[MT7]-ADAAEFWR.2b5_1.heavy 555.278 / 602.29 4501.0 33.58002471923828 36 11 10 5 10 0.900055390417504 74.0695154725337 0.0478973388671875 3 0.8751700127341802 3.456034416968887 4501.0 6.0325902777777785 0.0 - - - - - - - 726.9230769230769 9 13 CBL;CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence;Cas-Br-M (murine) ecotropic retroviral transforming sequence b 601 77 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22781.[MT7]-ADAAEFWR.2y7_1.heavy 555.278 / 894.41 6751.0 33.58002471923828 36 11 10 5 10 0.900055390417504 74.0695154725337 0.0478973388671875 3 0.8751700127341802 3.456034416968887 6751.0 103.89038888888888 0.0 - - - - - - - 198.0 13 10 CBL;CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence;Cas-Br-M (murine) ecotropic retroviral transforming sequence b 603 78 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38504.[MT7]-NVFDEAILAALEPPEPK[MT7].2y5_1.heavy 1071.09 / 711.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 605 78 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38504.[MT7]-NVFDEAILAALEPPEPK[MT7].2y9_1.heavy 1071.09 / 1095.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 607 78 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38504.[MT7]-NVFDEAILAALEPPEPK[MT7].2b4_1.heavy 1071.09 / 620.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 609 78 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38504.[MT7]-NVFDEAILAALEPPEPK[MT7].2b5_1.heavy 1071.09 / 749.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 611 79 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23271.[MT7]-IMDYSLLLGIHDIIR.3y7_1.heavy 639.365 / 823.479 2113.0 47.17689895629883 42 20 2 10 10 7.22000129731362 13.850413023777083 0.0 3 0.9920562193603312 13.83760195079127 2113.0 27.61306818181818 0.0 - - - - - - - 99.73333333333333 4 15 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 613 79 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23271.[MT7]-IMDYSLLLGIHDIIR.3b5_1.heavy 639.365 / 754.356 1321.0 47.17689895629883 42 20 2 10 10 7.22000129731362 13.850413023777083 0.0 3 0.9920562193603312 13.83760195079127 1321.0 12.709621212121212 0.0 - - - - - - - 125.23076923076923 2 13 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 615 79 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23271.[MT7]-IMDYSLLLGIHDIIR.3b3_1.heavy 639.365 / 504.261 N/A 47.17689895629883 42 20 2 10 10 7.22000129731362 13.850413023777083 0.0 3 0.9920562193603312 13.83760195079127 1057.0 5.696758794958017 1.0 - - - - - - - 111.15789473684211 9 19 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 617 79 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23271.[MT7]-IMDYSLLLGIHDIIR.3y8_1.heavy 639.365 / 936.563 925.0 47.17689895629883 42 20 2 10 10 7.22000129731362 13.850413023777083 0.0 3 0.9920562193603312 13.83760195079127 925.0 22.59943181818182 0.0 - - - - - - - 0.0 1 0 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 619 80 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23466.[MT7]-VVLPVWLNFDGEPQPYPTLPPGTGRR.4b5_1.heavy 763.165 / 652.451 8671.0 45.315874099731445 36 15 10 3 8 2.4475543017332124 40.85711190521327 0.07250213623046875 4 0.9524082935400477 5.634548239446478 8671.0 19.011771330635213 0.0 - - - - - - - 316.6666666666667 17 6 VHL von Hippel-Lindau tumor suppressor 621 80 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23466.[MT7]-VVLPVWLNFDGEPQPYPTLPPGTGRR.4y7_1.heavy 763.165 / 740.416 1544.0 45.315874099731445 36 15 10 3 8 2.4475543017332124 40.85711190521327 0.07250213623046875 4 0.9524082935400477 5.634548239446478 1544.0 2.2175906870982276 2.0 - - - - - - - 240.83333333333334 4 18 VHL von Hippel-Lindau tumor suppressor 623 80 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23466.[MT7]-VVLPVWLNFDGEPQPYPTLPPGTGRR.4b4_1.heavy 763.165 / 553.383 1307.0 45.315874099731445 36 15 10 3 8 2.4475543017332124 40.85711190521327 0.07250213623046875 4 0.9524082935400477 5.634548239446478 1307.0 0.5703865336658354 3.0 - - - - - - - 780.7142857142857 3 7 VHL von Hippel-Lindau tumor suppressor 625 80 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23466.[MT7]-VVLPVWLNFDGEPQPYPTLPPGTGRR.4y14_2.heavy 763.165 / 768.918 8374.0 45.315874099731445 36 15 10 3 8 2.4475543017332124 40.85711190521327 0.07250213623046875 4 0.9524082935400477 5.634548239446478 8374.0 23.01205754726653 1.0 - - - - - - - 207.83333333333334 16 6 VHL von Hippel-Lindau tumor suppressor 627 81 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23158.[MT7]-YLIPNATQPESK[MT7].3y3_1.heavy 550.31 / 507.289 17575.0 30.185400009155273 50 20 10 10 10 14.76270690481963 6.773825467425128 0.0 3 0.994524299478257 16.670328367241815 17575.0 13.589715871201626 0.0 - - - - - - - 448.0 35 4 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 629 81 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23158.[MT7]-YLIPNATQPESK[MT7].3b5_1.heavy 550.31 / 745.437 12643.0 30.185400009155273 50 20 10 10 10 14.76270690481963 6.773825467425128 0.0 3 0.994524299478257 16.670328367241815 12643.0 59.349747376144045 0.0 - - - - - - - 245.06666666666666 25 15 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 631 81 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23158.[MT7]-YLIPNATQPESK[MT7].3b3_1.heavy 550.31 / 534.341 81417.0 30.185400009155273 50 20 10 10 10 14.76270690481963 6.773825467425128 0.0 3 0.994524299478257 16.670328367241815 81417.0 126.83875085023278 0.0 - - - - - - - 322.8 162 5 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 633 81 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23158.[MT7]-YLIPNATQPESK[MT7].3y4_1.heavy 550.31 / 604.342 97378.0 30.185400009155273 50 20 10 10 10 14.76270690481963 6.773825467425128 0.0 3 0.994524299478257 16.670328367241815 97378.0 122.43522747349823 0.0 - - - - - - - 394.4 194 5 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 635 82 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543931.[MT7]-EAFRVFDK[MT7].3y3_1.heavy 433.915 / 553.31 22964.0 30.704299926757812 40 10 10 10 10 1.0291454000285545 62.99252550271132 0.0 3 0.8472385133253264 3.116485491576293 22964.0 60.751149381789304 0.0 - - - - - - - 237.47058823529412 45 17 CALM1;CALM2;CALM3;CALML3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 637 82 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543931.[MT7]-EAFRVFDK[MT7].3y7_2.heavy 433.915 / 513.796 33817.0 30.704299926757812 40 10 10 10 10 1.0291454000285545 62.99252550271132 0.0 3 0.8472385133253264 3.116485491576293 33817.0 68.38788216560509 0.0 - - - - - - - 241.0625 67 16 CALM1;CALM2;CALM3;CALML3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 639 82 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543931.[MT7]-EAFRVFDK[MT7].3y4_1.heavy 433.915 / 652.379 10854.0 30.704299926757812 40 10 10 10 10 1.0291454000285545 62.99252550271132 0.0 3 0.8472385133253264 3.116485491576293 10854.0 92.90740877655709 0.0 - - - - - - - 203.26666666666668 21 15 CALM1;CALM2;CALM3;CALML3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 641 82 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543931.[MT7]-EAFRVFDK[MT7].3b7_2.heavy 433.915 / 505.265 15429.0 30.704299926757812 40 10 10 10 10 1.0291454000285545 62.99252550271132 0.0 3 0.8472385133253264 3.116485491576293 15429.0 38.1365636144279 0.0 - - - - - - - 637.8888888888889 30 9 CALM1;CALM2;CALM3;CALML3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 643 83 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23471.[MT7]-QESYPSSSPIWFVDSEDPNLTSVLER.3b16_2.heavy 1042.84 / 992.458 1206.0 45.016950607299805 40 14 10 6 10 2.9662047793666044 33.7131140424343 0.03620147705078125 3 0.9358111475394372 4.844864776174391 1206.0 11.465739130434782 0.0 - - - - - - - 145.23529411764707 2 17 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 645 83 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23471.[MT7]-QESYPSSSPIWFVDSEDPNLTSVLER.3b4_1.heavy 1042.84 / 652.306 4021.0 45.016950607299805 40 14 10 6 10 2.9662047793666044 33.7131140424343 0.03620147705078125 3 0.9358111475394372 4.844864776174391 4021.0 6.999806576402322 0.0 - - - - - - - 206.73333333333332 8 15 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 647 83 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23471.[MT7]-QESYPSSSPIWFVDSEDPNLTSVLER.3b10_1.heavy 1042.84 / 1220.59 1551.0 45.016950607299805 40 14 10 6 10 2.9662047793666044 33.7131140424343 0.03620147705078125 3 0.9358111475394372 4.844864776174391 1551.0 30.96321281464531 0.0 - - - - - - - 131.64705882352942 3 17 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 649 83 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23471.[MT7]-QESYPSSSPIWFVDSEDPNLTSVLER.3y9_1.heavy 1042.84 / 1028.57 4826.0 45.016950607299805 40 14 10 6 10 2.9662047793666044 33.7131140424343 0.03620147705078125 3 0.9358111475394372 4.844864776174391 4826.0 21.83057124435848 0.0 - - - - - - - 233.6 9 15 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 651 84 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23470.[MT7]-IMLSGAGALTPQDIQALAYGLC[CAM]PTQPER.3y7_1.heavy 1039.21 / 887.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 653 84 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23470.[MT7]-IMLSGAGALTPQDIQALAYGLC[CAM]PTQPER.3b8_1.heavy 1039.21 / 845.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 655 84 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23470.[MT7]-IMLSGAGALTPQDIQALAYGLC[CAM]PTQPER.3b7_1.heavy 1039.21 / 774.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 657 84 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23470.[MT7]-IMLSGAGALTPQDIQALAYGLC[CAM]PTQPER.3y9_1.heavy 1039.21 / 1057.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 659 85 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38212.[MT7]-ITQYLDAGGIPR.2y9_1.heavy 724.405 / 961.51 1870.0 35.35126749674479 44 18 10 6 10 5.53242820172638 18.075245869218016 0.034397125244140625 3 0.9854004572168401 10.20147447299423 1870.0 5.5 0.0 - - - - - - - 212.5 3 16 CAMK2A calcium/calmodulin-dependent protein kinase II alpha 661 85 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38212.[MT7]-ITQYLDAGGIPR.2y6_1.heavy 724.405 / 570.336 2806.0 35.35126749674479 44 18 10 6 10 5.53242820172638 18.075245869218016 0.034397125244140625 3 0.9854004572168401 10.20147447299423 2806.0 32.35152941176471 0.0 - - - - - - - 230.71428571428572 5 14 CAMK2A calcium/calmodulin-dependent protein kinase II alpha 663 85 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38212.[MT7]-ITQYLDAGGIPR.2y11_1.heavy 724.405 / 1190.62 1700.0 35.35126749674479 44 18 10 6 10 5.53242820172638 18.075245869218016 0.034397125244140625 3 0.9854004572168401 10.20147447299423 1700.0 15.613333333333333 0.0 - - - - - - - 187.0 3 5 CAMK2A calcium/calmodulin-dependent protein kinase II alpha 665 85 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38212.[MT7]-ITQYLDAGGIPR.2y7_1.heavy 724.405 / 685.363 N/A 35.35126749674479 44 18 10 6 10 5.53242820172638 18.075245869218016 0.034397125244140625 3 0.9854004572168401 10.20147447299423 1275.0 0.5 2.0 - - - - - - - 680.0 4 8 CAMK2A calcium/calmodulin-dependent protein kinase II alpha 667 86 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22591.[MT7]-RPDLLR.2b3_1.heavy 457.289 / 513.29 2640.0 23.04764986038208 44 18 10 6 10 4.022082040312914 24.862744965843635 0.03579902648925781 3 0.9876193992944563 11.080067900172983 2640.0 10.200000000000001 0.0 - - - - - - - 706.7272727272727 5 11 MAP3K13 mitogen-activated protein kinase kinase kinase 13 669 86 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22591.[MT7]-RPDLLR.2y5_1.heavy 457.289 / 613.367 4034.0 23.04764986038208 44 18 10 6 10 4.022082040312914 24.862744965843635 0.03579902648925781 3 0.9876193992944563 11.080067900172983 4034.0 7.3040667160640815 3.0 - - - - - - - 1283.75 8 8 MAP3K13 mitogen-activated protein kinase kinase kinase 13 671 86 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22591.[MT7]-RPDLLR.2b4_1.heavy 457.289 / 626.374 1320.0 23.04764986038208 44 18 10 6 10 4.022082040312914 24.862744965843635 0.03579902648925781 3 0.9876193992944563 11.080067900172983 1320.0 2.82 0.0 - - - - - - - 225.21428571428572 2 14 MAP3K13 mitogen-activated protein kinase kinase kinase 13 673 86 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22591.[MT7]-RPDLLR.2b5_1.heavy 457.289 / 739.458 1320.0 23.04764986038208 44 18 10 6 10 4.022082040312914 24.862744965843635 0.03579902648925781 3 0.9876193992944563 11.080067900172983 1320.0 6.544709897610923 1.0 - - - - - - - 223.52380952380952 2 21 MAP3K13 mitogen-activated protein kinase kinase kinase 13 675 87 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23056.[MT7]-GSWQGENVAVK[MT7].3b6_1.heavy 488.268 / 789.365 12527.0 25.88129997253418 47 17 10 10 10 3.0934552280674077 25.717217327517954 0.0 3 0.977912765678852 8.288750747170727 12527.0 34.58256500222409 0.0 - - - - - - - 281.9166666666667 25 12 ACVR1 activin A receptor, type I 677 87 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23056.[MT7]-GSWQGENVAVK[MT7].3b4_1.heavy 488.268 / 603.301 20573.0 25.88129997253418 47 17 10 10 10 3.0934552280674077 25.717217327517954 0.0 3 0.977912765678852 8.288750747170727 20573.0 19.426529558167474 0.0 - - - - - - - 1223.125 41 8 ACVR1 activin A receptor, type I 679 87 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23056.[MT7]-GSWQGENVAVK[MT7].3b5_1.heavy 488.268 / 660.322 N/A 25.88129997253418 47 17 10 10 10 3.0934552280674077 25.717217327517954 0.0 3 0.977912765678852 8.288750747170727 12984.0 5.787386217433259 3.0 - - - - - - - 1249.7777777777778 44 9 ACVR1 activin A receptor, type I 681 87 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23056.[MT7]-GSWQGENVAVK[MT7].3b7_1.heavy 488.268 / 903.408 14904.0 25.88129997253418 47 17 10 10 10 3.0934552280674077 25.717217327517954 0.0 3 0.977912765678852 8.288750747170727 14904.0 36.46705776417362 1.0 - - - - - - - 182.69230769230768 32 13 ACVR1 activin A receptor, type I 683 88 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37818.[MT7]-RPAPQK[MT7].2y4_1.heavy 492.813 / 587.363 277.0 13.753299713134766 34 8 10 10 6 1.403109725849508 52.848907876969236 0.0 6 0.7991205700091262 2.70608200277183 277.0 0.3995192307692307 6.0 - - - - - - - 0.0 0 0 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 685 88 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37818.[MT7]-RPAPQK[MT7].2b5_1.heavy 492.813 / 694.412 277.0 13.753299713134766 34 8 10 10 6 1.403109725849508 52.848907876969236 0.0 6 0.7991205700091262 2.70608200277183 277.0 3.610155353977688 0.0 - - - - - - - 0.0 0 0 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 687 88 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37818.[MT7]-RPAPQK[MT7].2y5_1.heavy 492.813 / 684.416 3326.0 13.753299713134766 34 8 10 10 6 1.403109725849508 52.848907876969236 0.0 6 0.7991205700091262 2.70608200277183 3326.0 63.57488648739214 0.0 - - - - - - - 173.25 6 8 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 689 88 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37818.[MT7]-RPAPQK[MT7].2y3_1.heavy 492.813 / 516.326 1455.0 13.753299713134766 34 8 10 10 6 1.403109725849508 52.848907876969236 0.0 6 0.7991205700091262 2.70608200277183 1455.0 19.58653846153846 0.0 - - - - - - - 131.66666666666666 2 15 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 691 89 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37718.[MT7]-INDAK[MT7].2y4_1.heavy 424.758 / 591.322 3761.0 17.34600067138672 46 18 10 10 8 4.8585939700187755 20.582086220226707 0.0 4 0.9815390662127533 9.069119848121803 3761.0 7.20135670291261 0.0 - - - - - - - 689.4 7 10 ACSS1 acyl-CoA synthetase short-chain family member 1 693 89 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37718.[MT7]-INDAK[MT7].2b3_1.heavy 424.758 / 487.263 6165.0 17.34600067138672 46 18 10 10 8 4.8585939700187755 20.582086220226707 0.0 4 0.9815390662127533 9.069119848121803 6165.0 17.156333567909922 0.0 - - - - - - - 757.4 12 10 ACSS1 acyl-CoA synthetase short-chain family member 1 695 89 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37718.[MT7]-INDAK[MT7].2y3_1.heavy 424.758 / 477.279 1672.0 17.34600067138672 46 18 10 10 8 4.8585939700187755 20.582086220226707 0.0 4 0.9815390662127533 9.069119848121803 1672.0 5.7589402943792845 2.0 - - - - - - - 252.89473684210526 3 19 ACSS1 acyl-CoA synthetase short-chain family member 1 697 90 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37819.[MT7]-LFYEK[MT7].2y4_1.heavy 494.291 / 730.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOXHD1;ULK1 lipoxygenase homology domains 1;unc-51-like kinase 1 (C. elegans) 699 90 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37819.[MT7]-LFYEK[MT7].2b4_1.heavy 494.291 / 697.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOXHD1;ULK1 lipoxygenase homology domains 1;unc-51-like kinase 1 (C. elegans) 701 90 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37819.[MT7]-LFYEK[MT7].2y3_1.heavy 494.291 / 583.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOXHD1;ULK1 lipoxygenase homology domains 1;unc-51-like kinase 1 (C. elegans) 703 91 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23366.[MT7]-VYIATQGPIVSTVADFWR.3y3_1.heavy 723.06 / 508.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 705 91 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23366.[MT7]-VYIATQGPIVSTVADFWR.3b4_1.heavy 723.06 / 591.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 707 91 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23366.[MT7]-VYIATQGPIVSTVADFWR.3b3_1.heavy 723.06 / 520.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 709 91 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23366.[MT7]-VYIATQGPIVSTVADFWR.3b7_1.heavy 723.06 / 877.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 711 92 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22596.[MT7]-RHGPGPR.2y4_1.heavy 460.768 / 426.246 N/A 13.358699798583984 41 11 10 10 10 2.2706492244357 44.04026783346597 0.0 3 0.874279486437509 3.4435045240471713 839.0 1.500447093889717 13.0 - - - - - - - 709.0 8 8 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 713 92 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22596.[MT7]-RHGPGPR.2y5_1.heavy 460.768 / 483.267 1141.0 13.358699798583984 41 11 10 10 10 2.2706492244357 44.04026783346597 0.0 3 0.874279486437509 3.4435045240471713 1141.0 26.947234416154522 0.0 - - - - - - - 116.38461538461539 2 13 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 715 92 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22596.[MT7]-RHGPGPR.2y6_1.heavy 460.768 / 620.326 19873.0 13.358699798583984 41 11 10 10 10 2.2706492244357 44.04026783346597 0.0 3 0.874279486437509 3.4435045240471713 19873.0 88.90998111181068 0.0 - - - - - - - 121.75 39 16 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 717 92 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22596.[MT7]-RHGPGPR.2b5_1.heavy 460.768 / 649.365 436.0 13.358699798583984 41 11 10 10 10 2.2706492244357 44.04026783346597 0.0 3 0.874279486437509 3.4435045240471713 436.0 10.284216656959813 2.0 - - - - - - - 0.0 0 0 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 719 93 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22799.[MT7]-YGDAWVK[MT7].2y4_1.heavy 563.81 / 647.4 4490.0 29.17604970932007 34 18 9 3 4 5.243568327075368 19.07098253753005 0.07259941101074219 7 0.9817145893915717 9.112677702769869 4490.0 6.814634114943712 0.0 - - - - - - - 227.1764705882353 8 17 ACSS1 acyl-CoA synthetase short-chain family member 1 721 93 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22799.[MT7]-YGDAWVK[MT7].2b4_1.heavy 563.81 / 551.258 2604.0 29.17604970932007 34 18 9 3 4 5.243568327075368 19.07098253753005 0.07259941101074219 7 0.9817145893915717 9.112677702769869 2604.0 3.381818181818182 1.0 - - - - - - - 317.7692307692308 8 13 ACSS1 acyl-CoA synthetase short-chain family member 1 723 93 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22799.[MT7]-YGDAWVK[MT7].2y6_1.heavy 563.81 / 819.448 1526.0 29.17604970932007 34 18 9 3 4 5.243568327075368 19.07098253753005 0.07259941101074219 7 0.9817145893915717 9.112677702769869 1526.0 7.799555555555556 4.0 - - - - - - - 191.73333333333332 10 15 ACSS1 acyl-CoA synthetase short-chain family member 1 725 93 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22799.[MT7]-YGDAWVK[MT7].2b5_1.heavy 563.81 / 737.338 1167.0 29.17604970932007 34 18 9 3 4 5.243568327075368 19.07098253753005 0.07259941101074219 7 0.9817145893915717 9.112677702769869 1167.0 0.24213036565977752 5.0 - - - - - - - 227.53333333333333 3 15 ACSS1 acyl-CoA synthetase short-chain family member 1 727 94 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23071.[MT7]-YVEC[CAM]SALTQK[MT7].3y3_1.heavy 496.265 / 520.321 34642.0 26.633800506591797 43 13 10 10 10 1.863657779269835 53.65791998527709 0.0 3 0.9030546265865588 3.9312093853676804 34642.0 125.6724850514538 0.0 - - - - - - - 734.6666666666666 69 9 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 729 94 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23071.[MT7]-YVEC[CAM]SALTQK[MT7].3b5_1.heavy 496.265 / 783.346 6426.0 26.633800506591797 43 13 10 10 10 1.863657779269835 53.65791998527709 0.0 3 0.9030546265865588 3.9312093853676804 6426.0 15.56628663208615 1.0 - - - - - - - 172.78571428571428 61 14 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 731 94 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23071.[MT7]-YVEC[CAM]SALTQK[MT7].3y4_1.heavy 496.265 / 633.405 8661.0 26.633800506591797 43 13 10 10 10 1.863657779269835 53.65791998527709 0.0 3 0.9030546265865588 3.9312093853676804 8661.0 14.350294145750002 0.0 - - - - - - - 272.8666666666667 17 15 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 733 94 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23071.[MT7]-YVEC[CAM]SALTQK[MT7].3b3_1.heavy 496.265 / 536.284 9126.0 26.633800506591797 43 13 10 10 10 1.863657779269835 53.65791998527709 0.0 3 0.9030546265865588 3.9312093853676804 9126.0 19.234078359849768 0.0 - - - - - - - 718.4285714285714 18 7 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 735 95 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23361.[MT7]-NVFDEAILAALEPPEPK[MT7].4y5_1.heavy 536.049 / 711.416 10505.0 47.82804870605469 39 12 10 7 10 1.015146860879379 56.60668124439895 0.027801513671875 3 0.895097543881509 3.776572210124441 10505.0 122.04599348785233 0.0 - - - - - - - 133.0 21 8 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 737 95 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23361.[MT7]-NVFDEAILAALEPPEPK[MT7].4b4_1.heavy 536.049 / 620.316 5055.0 47.82804870605469 39 12 10 7 10 1.015146860879379 56.60668124439895 0.027801513671875 3 0.895097543881509 3.776572210124441 5055.0 1.2063477676014525 1.0 - - - - - - - 686.0 14 8 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 739 95 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23361.[MT7]-NVFDEAILAALEPPEPK[MT7].4b5_1.heavy 536.049 / 749.359 6516.0 47.82804870605469 39 12 10 7 10 1.015146860879379 56.60668124439895 0.027801513671875 3 0.895097543881509 3.776572210124441 6516.0 0.23900521238468408 1.0 - - - - - - - 209.30769230769232 15 13 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 741 95 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23361.[MT7]-NVFDEAILAALEPPEPK[MT7].4b6_1.heavy 536.049 / 820.396 8885.0 47.82804870605469 39 12 10 7 10 1.015146860879379 56.60668124439895 0.027801513671875 3 0.895097543881509 3.776572210124441 8885.0 42.74696460759062 0.0 - - - - - - - 190.0909090909091 17 11 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 743 96 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22593.[MT7]-RLDIVR.2b3_1.heavy 458.296 / 529.321 18086.0 24.104299545288086 44 16 10 10 8 1.8377453445497696 43.07862629014655 0.0 4 0.9629726207575403 6.393690746947122 18086.0 20.251174186285613 0.0 - - - - - - - 385.7692307692308 36 13 VHL von Hippel-Lindau tumor suppressor 745 96 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22593.[MT7]-RLDIVR.2y5_1.heavy 458.296 / 615.382 7234.0 24.104299545288086 44 16 10 10 8 1.8377453445497696 43.07862629014655 0.0 4 0.9629726207575403 6.393690746947122 7234.0 10.747446372005445 3.0 - - - - - - - 811.875 14 8 VHL von Hippel-Lindau tumor suppressor 747 96 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22593.[MT7]-RLDIVR.2b4_1.heavy 458.296 / 642.406 4439.0 24.104299545288086 44 16 10 10 8 1.8377453445497696 43.07862629014655 0.0 4 0.9629726207575403 6.393690746947122 4439.0 13.51457087878031 1.0 - - - - - - - 263.7894736842105 24 19 VHL von Hippel-Lindau tumor suppressor 749 96 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22593.[MT7]-RLDIVR.2b5_1.heavy 458.296 / 741.474 9290.0 24.104299545288086 44 16 10 10 8 1.8377453445497696 43.07862629014655 0.0 4 0.9629726207575403 6.393690746947122 9290.0 42.63804026698763 1.0 - - - - - - - 257.53333333333336 23 15 VHL von Hippel-Lindau tumor suppressor 751 97 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22594.[MT7]-ETSAPLR.2b3_1.heavy 459.262 / 462.232 1983.0 18.67657470703125 45 18 10 7 10 4.529610551449453 22.076953164991302 0.02809906005859375 3 0.9853564051475969 10.186080862306886 1983.0 2.5321972286087124 0.0 - - - - - - - 191.75 3 28 ULK1 unc-51-like kinase 1 (C. elegans) 753 97 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22594.[MT7]-ETSAPLR.2y5_1.heavy 459.262 / 543.325 1596.0 18.67657470703125 45 18 10 7 10 4.529610551449453 22.076953164991302 0.02809906005859375 3 0.9853564051475969 10.186080862306886 1596.0 5.690451521219559 1.0 - - - - - - - 306.4166666666667 3 24 ULK1 unc-51-like kinase 1 (C. elegans) 755 97 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22594.[MT7]-ETSAPLR.2b4_1.heavy 459.262 / 533.269 2999.0 18.67657470703125 45 18 10 7 10 4.529610551449453 22.076953164991302 0.02809906005859375 3 0.9853564051475969 10.186080862306886 2999.0 9.320061271017384 0.0 - - - - - - - 292.30434782608694 5 23 ULK1 unc-51-like kinase 1 (C. elegans) 757 97 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22594.[MT7]-ETSAPLR.2y6_1.heavy 459.262 / 644.373 5368.0 18.67657470703125 45 18 10 7 10 4.529610551449453 22.076953164991302 0.02809906005859375 3 0.9853564051475969 10.186080862306886 5368.0 20.40727272727273 0.0 - - - - - - - 243.875 10 24 ULK1 unc-51-like kinase 1 (C. elegans) 759 98 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23260.[MT7]-EGIEYILLNFSFK[MT7].3b6_1.heavy 621.016 / 849.447 543.0 50.066200256347656 45 17 10 10 8 3.1824088975628237 31.422737686719877 0.0 4 0.977207414422166 8.159005254007733 543.0 6.960021786492375 0.0 - - - - - - - 0.0 1 0 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 761 98 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23260.[MT7]-EGIEYILLNFSFK[MT7].3y3_1.heavy 621.016 / 525.315 815.0 50.066200256347656 45 17 10 10 8 3.1824088975628237 31.422737686719877 0.0 4 0.977207414422166 8.159005254007733 815.0 10.40492515692902 1.0 - - - - - - - 125.08695652173913 2 23 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 763 98 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23260.[MT7]-EGIEYILLNFSFK[MT7].3b4_1.heavy 621.016 / 573.3 869.0 50.066200256347656 45 17 10 10 8 3.1824088975628237 31.422737686719877 0.0 4 0.977207414422166 8.159005254007733 869.0 13.946913580246914 0.0 - - - - - - - 0.0 1 0 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 765 98 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23260.[MT7]-EGIEYILLNFSFK[MT7].3b5_1.heavy 621.016 / 736.363 1331.0 50.066200256347656 45 17 10 10 8 3.1824088975628237 31.422737686719877 0.0 4 0.977207414422166 8.159005254007733 1331.0 29.577777777777783 0.0 - - - - - - - 66.73333333333333 2 15 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 767 99 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23457.[MT7]-VVLPVWLNFDGEPQPYPTLPPGTGR.3y6_1.heavy 965.184 / 584.315 57535.0 47.50124931335449 43 17 10 6 10 2.567210534305101 31.696025787342784 0.031902313232421875 3 0.9724537016713011 7.418715888916456 57535.0 30.636242927905265 0.0 - - - - - - - 1290.5 115 2 VHL von Hippel-Lindau tumor suppressor 769 99 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23457.[MT7]-VVLPVWLNFDGEPQPYPTLPPGTGR.3b5_1.heavy 965.184 / 652.451 17527.0 47.50124931335449 43 17 10 6 10 2.567210534305101 31.696025787342784 0.031902313232421875 3 0.9724537016713011 7.418715888916456 17527.0 3.3823403818517757 1.0 - - - - - - - 631.1666666666666 35 6 VHL von Hippel-Lindau tumor suppressor 771 99 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23457.[MT7]-VVLPVWLNFDGEPQPYPTLPPGTGR.3b8_1.heavy 965.184 / 1065.66 2498.0 47.50124931335449 43 17 10 6 10 2.567210534305101 31.696025787342784 0.031902313232421875 3 0.9724537016713011 7.418715888916456 2498.0 0.2353273669335845 1.0 - - - - - - - 692.5454545454545 4 11 VHL von Hippel-Lindau tumor suppressor 773 99 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23457.[MT7]-VVLPVWLNFDGEPQPYPTLPPGTGR.3y9_1.heavy 965.184 / 895.5 16403.0 47.50124931335449 43 17 10 6 10 2.567210534305101 31.696025787342784 0.031902313232421875 3 0.9724537016713011 7.418715888916456 16403.0 13.931965082548832 0.0 - - - - - - - 743.5714285714286 32 7 VHL von Hippel-Lindau tumor suppressor 775 100 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22990.[MT7]-SGHIHHHDVR.3b4_1.heavy 446.901 / 539.306 3846.0 12.366600036621094 47 17 10 10 10 3.381642955700226 29.57142469208235 0.0 3 0.977550890690681 8.22142288242371 3846.0 21.798708021768945 0.0 - - - - - - - 116.73333333333333 7 15 CDC20 cell division cycle 20 homolog (S. cerevisiae) 777 100 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22990.[MT7]-SGHIHHHDVR.3b5_1.heavy 446.901 / 676.365 1593.0 12.366600036621094 47 17 10 10 10 3.381642955700226 29.57142469208235 0.0 3 0.977550890690681 8.22142288242371 1593.0 49.01538461538461 0.0 - - - - - - - 66.2 3 10 CDC20 cell division cycle 20 homolog (S. cerevisiae) 779 100 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22990.[MT7]-SGHIHHHDVR.3y4_1.heavy 446.901 / 526.273 4700.0 12.366600036621094 47 17 10 10 10 3.381642955700226 29.57142469208235 0.0 3 0.977550890690681 8.22142288242371 4700.0 49.41025641025641 0.0 - - - - - - - 96.05882352941177 9 17 CDC20 cell division cycle 20 homolog (S. cerevisiae) 781 100 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22990.[MT7]-SGHIHHHDVR.3y5_1.heavy 446.901 / 663.332 2408.0 12.366600036621094 47 17 10 10 10 3.381642955700226 29.57142469208235 0.0 3 0.977550890690681 8.22142288242371 2408.0 49.39487179487179 0.0 - - - - - - - 88.92857142857143 4 14 CDC20 cell division cycle 20 homolog (S. cerevisiae) 783 101 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37724.[MT7]-TLLPK[MT7].2y4_1.heavy 430.296 / 614.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP5K1C;FBXO11;PIP5K1A;PIP5K1B phosphatidylinositol-4-phosphate 5-kinase, type I, gamma;F-box protein 11;phosphatidylinositol-4-phosphate 5-kinase, type I, alpha;phosphatidylinositol-4-phosphate 5-kinase, type I, beta 785 101 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37724.[MT7]-TLLPK[MT7].2b3_1.heavy 430.296 / 472.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP5K1C;FBXO11;PIP5K1A;PIP5K1B phosphatidylinositol-4-phosphate 5-kinase, type I, gamma;F-box protein 11;phosphatidylinositol-4-phosphate 5-kinase, type I, alpha;phosphatidylinositol-4-phosphate 5-kinase, type I, beta 787 101 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37724.[MT7]-TLLPK[MT7].2y3_1.heavy 430.296 / 501.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP5K1C;FBXO11;PIP5K1A;PIP5K1B phosphatidylinositol-4-phosphate 5-kinase, type I, gamma;F-box protein 11;phosphatidylinositol-4-phosphate 5-kinase, type I, alpha;phosphatidylinositol-4-phosphate 5-kinase, type I, beta 789 102 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23166.[MT7]-DLIGHGAFAVVFK[MT7].3y3_1.heavy 554.659 / 537.352 30080.0 38.41780090332031 39 9 10 10 10 6.20451341813188 16.11729933692513 0.0 3 0.8020656468906381 2.7268621350568325 30080.0 38.799720887101586 0.0 - - - - - - - 1242.142857142857 60 7 ULK1 unc-51-like kinase 1 (C. elegans) 791 102 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23166.[MT7]-DLIGHGAFAVVFK[MT7].3b4_1.heavy 554.659 / 543.326 9855.0 38.41780090332031 39 9 10 10 10 6.20451341813188 16.11729933692513 0.0 3 0.8020656468906381 2.7268621350568325 9855.0 23.961500648275496 0.0 - - - - - - - 657.9285714285714 19 14 ULK1 unc-51-like kinase 1 (C. elegans) 793 102 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23166.[MT7]-DLIGHGAFAVVFK[MT7].3y4_1.heavy 554.659 / 636.42 16103.0 38.41780090332031 39 9 10 10 10 6.20451341813188 16.11729933692513 0.0 3 0.8020656468906381 2.7268621350568325 16103.0 141.7383951230526 0.0 - - - - - - - 213.1875 32 16 ULK1 unc-51-like kinase 1 (C. elegans) 795 102 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23166.[MT7]-DLIGHGAFAVVFK[MT7].3y5_1.heavy 554.659 / 707.457 12496.0 38.41780090332031 39 9 10 10 10 6.20451341813188 16.11729933692513 0.0 3 0.8020656468906381 2.7268621350568325 12496.0 29.307210394802595 0.0 - - - - - - - 236.2 24 15 ULK1 unc-51-like kinase 1 (C. elegans) 797 103 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23066.[MT7]-LSDEEVDEMIR.2y4_1.heavy 740.359 / 548.286 N/A N/A - - - - - - - - - 0.0 - - - - - - - CALML3 calmodulin-like 3 799 103 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23066.[MT7]-LSDEEVDEMIR.2y8_1.heavy 740.359 / 1020.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - CALML3 calmodulin-like 3 801 103 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23066.[MT7]-LSDEEVDEMIR.2y10_1.heavy 740.359 / 1222.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - CALML3 calmodulin-like 3 803 103 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23066.[MT7]-LSDEEVDEMIR.2b5_1.heavy 740.359 / 718.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - CALML3 calmodulin-like 3 805 104 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22998.[MT7]-EPAAFWGPLAR.2y8_1.heavy 679.87 / 917.499 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSS1 acyl-CoA synthetase short-chain family member 1 807 104 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22998.[MT7]-EPAAFWGPLAR.2y3_1.heavy 679.87 / 359.24 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSS1 acyl-CoA synthetase short-chain family member 1 809 104 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22998.[MT7]-EPAAFWGPLAR.2y6_1.heavy 679.87 / 699.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSS1 acyl-CoA synthetase short-chain family member 1 811 104 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22998.[MT7]-EPAAFWGPLAR.2y10_1.heavy 679.87 / 1085.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSS1 acyl-CoA synthetase short-chain family member 1 813 105 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38369.[MT7]-AVTEQGHELSNEER.3y7_1.heavy 581.619 / 876.406 16697.0 19.205299377441406 47 17 10 10 10 2.974637825369179 33.617537956100286 0.0 3 0.9788526945283086 8.471621019453188 16697.0 210.96885135135136 0.0 - - - - - - - 139.41176470588235 33 17 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 815 105 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38369.[MT7]-AVTEQGHELSNEER.3b6_1.heavy 581.619 / 730.385 14572.0 19.205299377441406 47 17 10 10 10 2.974637825369179 33.617537956100286 0.0 3 0.9788526945283086 8.471621019453188 14572.0 65.26654772019258 0.0 - - - - - - - 175.13636363636363 29 22 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 817 105 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38369.[MT7]-AVTEQGHELSNEER.3y6_1.heavy 581.619 / 747.363 21389.0 19.205299377441406 47 17 10 10 10 2.974637825369179 33.617537956100286 0.0 3 0.9788526945283086 8.471621019453188 21389.0 166.0877323845745 0.0 - - - - - - - 142.89473684210526 42 19 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 819 105 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38369.[MT7]-AVTEQGHELSNEER.3y5_1.heavy 581.619 / 634.279 16499.0 19.205299377441406 47 17 10 10 10 2.974637825369179 33.617537956100286 0.0 3 0.9788526945283086 8.471621019453188 16499.0 177.6722756466398 0.0 - - - - - - - 197.57894736842104 32 19 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 821 106 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 671046.0 34.121700286865234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 671046.0 178.37303656865313 0.0 - - - - - - - 274.7142857142857 1342 7 823 106 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 181441.0 34.121700286865234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 181441.0 290.4439537037037 0.0 - - - - - - - 273.25 362 8 825 106 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 252410.0 34.121700286865234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 252410.0 142.10593006908917 0.0 - - - - - - - 327.875 504 8 827 107 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23067.[MT7]-INQFYGAPTAVR.2y8_1.heavy 740.905 / 834.447 4983.0 31.33049964904785 44 18 10 6 10 8.673669232156918 11.529146122987743 0.03639984130859375 3 0.9894358534742103 11.996708041746816 4983.0 29.244202127659573 0.0 - - - - - - - 231.3846153846154 9 13 ACSS1 acyl-CoA synthetase short-chain family member 1 829 107 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23067.[MT7]-INQFYGAPTAVR.2y9_1.heavy 740.905 / 981.515 3949.0 31.33049964904785 44 18 10 6 10 8.673669232156918 11.529146122987743 0.03639984130859375 3 0.9894358534742103 11.996708041746816 3949.0 21.355407801418437 0.0 - - - - - - - 174.57142857142858 7 7 ACSS1 acyl-CoA synthetase short-chain family member 1 831 107 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23067.[MT7]-INQFYGAPTAVR.2y11_1.heavy 740.905 / 1223.62 3855.0 31.33049964904785 44 18 10 6 10 8.673669232156918 11.529146122987743 0.03639984130859375 3 0.9894358534742103 11.996708041746816 3855.0 52.90372340425532 0.0 - - - - - - - 196.54545454545453 7 11 ACSS1 acyl-CoA synthetase short-chain family member 1 833 107 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23067.[MT7]-INQFYGAPTAVR.2y7_1.heavy 740.905 / 671.383 5077.0 31.33049964904785 44 18 10 6 10 8.673669232156918 11.529146122987743 0.03639984130859375 3 0.9894358534742103 11.996708041746816 5077.0 22.6484609929078 0.0 - - - - - - - 231.86666666666667 10 15 ACSS1 acyl-CoA synthetase short-chain family member 1 835 108 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544905.[MT7]-SLYEDLEDHPNVQK[MT7].4y4_1.heavy 494.506 / 632.385 12133.0 31.357799530029297 43 13 10 10 10 2.547652378820191 39.25182290619635 0.0 3 0.9232494678095454 4.425924943630485 12133.0 48.77479940635772 0.0 - - - - - - - 217.77777777777777 24 9 VHL von Hippel-Lindau tumor suppressor 837 108 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544905.[MT7]-SLYEDLEDHPNVQK[MT7].4b5_1.heavy 494.506 / 752.358 61782.0 31.357799530029297 43 13 10 10 10 2.547652378820191 39.25182290619635 0.0 3 0.9232494678095454 4.425924943630485 61782.0 176.20984939759035 0.0 - - - - - - - 301.53846153846155 123 13 VHL von Hippel-Lindau tumor suppressor 839 108 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544905.[MT7]-SLYEDLEDHPNVQK[MT7].4y3_1.heavy 494.506 / 518.342 12412.0 31.357799530029297 43 13 10 10 10 2.547652378820191 39.25182290619635 0.0 3 0.9232494678095454 4.425924943630485 12412.0 23.24661425823421 0.0 - - - - - - - 1213.3333333333333 24 9 VHL von Hippel-Lindau tumor suppressor 841 108 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544905.[MT7]-SLYEDLEDHPNVQK[MT7].4b3_1.heavy 494.506 / 508.289 71115.0 31.357799530029297 43 13 10 10 10 2.547652378820191 39.25182290619635 0.0 3 0.9232494678095454 4.425924943630485 71115.0 150.2489782312463 0.0 - - - - - - - 1190.125 142 8 VHL von Hippel-Lindau tumor suppressor 843 109 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544903.[MT7]-SLYEDLEDHPNVQK[MT7].3y3_1.heavy 659.005 / 518.342 5708.0 31.34869956970215 46 20 10 6 10 8.27668999689596 12.082124621980935 0.03639984130859375 3 0.9929371710475363 14.676316926141986 5708.0 19.840641711229942 0.0 - - - - - - - 318.2 11 15 VHL von Hippel-Lindau tumor suppressor 845 109 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544903.[MT7]-SLYEDLEDHPNVQK[MT7].3b5_1.heavy 659.005 / 752.358 11604.0 31.34869956970215 46 20 10 6 10 8.27668999689596 12.082124621980935 0.03639984130859375 3 0.9929371710475363 14.676316926141986 11604.0 140.00888922541077 0.0 - - - - - - - 259.3076923076923 23 13 VHL von Hippel-Lindau tumor suppressor 847 109 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544903.[MT7]-SLYEDLEDHPNVQK[MT7].3y4_1.heavy 659.005 / 632.385 5896.0 31.34869956970215 46 20 10 6 10 8.27668999689596 12.082124621980935 0.03639984130859375 3 0.9929371710475363 14.676316926141986 5896.0 17.74831792262021 0.0 - - - - - - - 300.85714285714283 11 14 VHL von Hippel-Lindau tumor suppressor 849 109 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544903.[MT7]-SLYEDLEDHPNVQK[MT7].3b8_1.heavy 659.005 / 1109.51 7486.0 31.34869956970215 46 20 10 6 10 8.27668999689596 12.082124621980935 0.03639984130859375 3 0.9929371710475363 14.676316926141986 7486.0 95.77889407213561 0.0 - - - - - - - 156.33333333333334 14 6 VHL von Hippel-Lindau tumor suppressor 851 110 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23393.[MT7]-TGRDASVHTLLDALETLGER.4b12_2.heavy 575.31 / 705.877 4710.0 43.83660125732422 44 14 10 10 10 2.425008628343681 41.23696667764088 0.0 3 0.9396586898845758 4.9985795570941445 4710.0 32.28629032258065 0.0 - - - - - - - 159.42857142857142 9 14 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 853 110 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23393.[MT7]-TGRDASVHTLLDALETLGER.4y7_1.heavy 575.31 / 817.441 1239.0 43.83660125732422 44 14 10 10 10 2.425008628343681 41.23696667764088 0.0 3 0.9396586898845758 4.9985795570941445 1239.0 2.482711286772537 3.0 - - - - - - - 195.53846153846155 2 13 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 855 110 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23393.[MT7]-TGRDASVHTLLDALETLGER.4y6_1.heavy 575.31 / 704.357 4710.0 43.83660125732422 44 14 10 10 10 2.425008628343681 41.23696667764088 0.0 3 0.9396586898845758 4.9985795570941445 4710.0 11.612211981566821 0.0 - - - - - - - 233.41176470588235 9 17 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 857 110 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23393.[MT7]-TGRDASVHTLLDALETLGER.4b9_2.heavy 575.31 / 535.279 4462.0 43.83660125732422 44 14 10 10 10 2.425008628343681 41.23696667764088 0.0 3 0.9396586898845758 4.9985795570941445 4462.0 12.830612577386772 0.0 - - - - - - - 190.42857142857142 8 14 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 859 111 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23394.[MT7]-NSPPYILDLLPDTYQHLR.3y6_1.heavy 767.078 / 817.432 2361.0 44.09705066680908 44 18 10 6 10 11.977546957623831 8.348954953280227 0.039798736572265625 3 0.9876271670603298 11.083552640409586 2361.0 4.472716162368423 1.0 - - - - - - - 161.4 4 10 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 861 111 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23394.[MT7]-NSPPYILDLLPDTYQHLR.3b6_1.heavy 767.078 / 816.437 4411.0 44.09705066680908 44 18 10 6 10 11.977546957623831 8.348954953280227 0.039798736572265625 3 0.9876271670603298 11.083552640409586 4411.0 16.884738320034753 1.0 - - - - - - - 226.0 8 11 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 863 111 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23394.[MT7]-NSPPYILDLLPDTYQHLR.3b5_1.heavy 767.078 / 703.353 7145.0 44.09705066680908 44 18 10 6 10 11.977546957623831 8.348954953280227 0.039798736572265625 3 0.9876271670603298 11.083552640409586 7145.0 19.721611487104443 0.0 - - - - - - - 727.8571428571429 14 7 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 865 111 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23394.[MT7]-NSPPYILDLLPDTYQHLR.3y8_1.heavy 767.078 / 1029.51 10252.0 44.09705066680908 44 18 10 6 10 11.977546957623831 8.348954953280227 0.039798736572265625 3 0.9876271670603298 11.083552640409586 10252.0 44.13807390639163 0.0 - - - - - - - 236.2 20 10 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 867 112 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23180.[MT7]-GIFPSGLFQGDTFR.3y7_1.heavy 562.63 / 870.41 6560.0 43.81599998474121 41 18 10 5 8 3.373700824814172 23.54652246634278 0.041202545166015625 4 0.984078925016425 9.767834299819317 6560.0 3.3851576958696805 1.0 - - - - - - - 155.0 13 6 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 869 112 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23180.[MT7]-GIFPSGLFQGDTFR.3y6_1.heavy 562.63 / 723.342 12439.0 43.81599998474121 41 18 10 5 8 3.373700824814172 23.54652246634278 0.041202545166015625 4 0.984078925016425 9.767834299819317 12439.0 50.13884614370597 1.0 - - - - - - - 268.3333333333333 24 6 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 871 112 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23180.[MT7]-GIFPSGLFQGDTFR.3b6_1.heavy 562.63 / 703.39 11201.0 43.81599998474121 41 18 10 5 8 3.373700824814172 23.54652246634278 0.041202545166015625 4 0.984078925016425 9.767834299819317 11201.0 18.11887164211154 1.0 - - - - - - - 257.8333333333333 22 6 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 873 112 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23180.[MT7]-GIFPSGLFQGDTFR.3y5_1.heavy 562.63 / 595.284 17947.0 43.81599998474121 41 18 10 5 8 3.373700824814172 23.54652246634278 0.041202545166015625 4 0.984078925016425 9.767834299819317 17947.0 36.44989755358171 1.0 - - - - - - - 371.25 37 4 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 875 113 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38266.[MT7]-VQTTPSK[MT7]PGGDR.3y11_2.heavy 510.954 / 644.342 4594.0 16.956199645996094 44 14 10 10 10 0.7857669261648235 78.85391905078447 0.0 3 0.9304976177823342 4.65387238281697 4594.0 23.45636558563388 0.0 - - - - - - - 236.05263157894737 9 19 CDC20 cell division cycle 20 homolog (S. cerevisiae) 877 113 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38266.[MT7]-VQTTPSK[MT7]PGGDR.3y8_1.heavy 510.954 / 957.523 2461.0 16.956199645996094 44 14 10 10 10 0.7857669261648235 78.85391905078447 0.0 3 0.9304976177823342 4.65387238281697 2461.0 37.34329329827702 0.0 - - - - - - - 173.8181818181818 4 11 CDC20 cell division cycle 20 homolog (S. cerevisiae) 879 113 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38266.[MT7]-VQTTPSK[MT7]PGGDR.3y9_2.heavy 510.954 / 529.789 2297.0 16.956199645996094 44 14 10 10 10 0.7857669261648235 78.85391905078447 0.0 3 0.9304976177823342 4.65387238281697 2297.0 8.403658536585365 0.0 - - - - - - - 167.66666666666666 4 15 CDC20 cell division cycle 20 homolog (S. cerevisiae) 881 113 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38266.[MT7]-VQTTPSK[MT7]PGGDR.3y5_1.heavy 510.954 / 501.242 11540.0 16.956199645996094 44 14 10 10 10 0.7857669261648235 78.85391905078447 0.0 3 0.9304976177823342 4.65387238281697 11540.0 32.60433004013584 0.0 - - - - - - - 280.1875 23 16 CDC20 cell division cycle 20 homolog (S. cerevisiae) 883 114 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544907.[MT7]-GLLLPSSEEPGPAQEASR.3y7_1.heavy 661.349 / 758.379 13153.0 32.52180099487305 50 20 10 10 10 6.4750307021800895 15.443942214255575 0.0 3 0.9909272706143905 12.946861155347959 13153.0 40.64642361111111 0.0 - - - - - - - 296.0 26 12 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 885 114 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544907.[MT7]-GLLLPSSEEPGPAQEASR.3b4_1.heavy 661.349 / 541.383 46562.0 32.52180099487305 50 20 10 10 10 6.4750307021800895 15.443942214255575 0.0 3 0.9909272706143905 12.946861155347959 46562.0 37.03454378488876 1.0 - - - - - - - 259.2 123 10 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 887 114 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544907.[MT7]-GLLLPSSEEPGPAQEASR.3y8_1.heavy 661.349 / 815.401 19201.0 32.52180099487305 50 20 10 10 10 6.4750307021800895 15.443942214255575 0.0 3 0.9909272706143905 12.946861155347959 19201.0 62.003229166666664 0.0 - - - - - - - 312.0 38 12 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 889 114 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544907.[MT7]-GLLLPSSEEPGPAQEASR.3y9_1.heavy 661.349 / 912.453 43778.0 32.52180099487305 50 20 10 10 10 6.4750307021800895 15.443942214255575 0.0 3 0.9909272706143905 12.946861155347959 43778.0 62.88020601851852 0.0 - - - - - - - 253.0909090909091 87 11 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 891 115 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38237.[MT7]-YVEC[CAM]SALTQK[MT7].2b3_1.heavy 743.894 / 536.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 893 115 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38237.[MT7]-YVEC[CAM]SALTQK[MT7].2y8_1.heavy 743.894 / 1080.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 895 115 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38237.[MT7]-YVEC[CAM]SALTQK[MT7].2y3_1.heavy 743.894 / 520.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 897 115 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38237.[MT7]-YVEC[CAM]SALTQK[MT7].2y7_1.heavy 743.894 / 951.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 899 116 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23177.[MT7]-FQEDIISIWNK[MT7].3y3_1.heavy 560.978 / 591.337 31470.0 41.45805072784424 36 10 10 6 10 0.8512180887465653 71.73358813637631 0.030597686767578125 3 0.83803574355352 3.0241883571757486 31470.0 63.85505689001265 0.0 - - - - - - - 672.7272727272727 62 11 EIF4E2 eukaryotic translation initiation factor 4E family member 2 901 116 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23177.[MT7]-FQEDIISIWNK[MT7].3b4_1.heavy 560.978 / 664.306 24238.0 41.45805072784424 36 10 10 6 10 0.8512180887465653 71.73358813637631 0.030597686767578125 3 0.83803574355352 3.0241883571757486 24238.0 82.54723985405329 0.0 - - - - - - - 643.7 48 10 EIF4E2 eukaryotic translation initiation factor 4E family member 2 903 116 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23177.[MT7]-FQEDIISIWNK[MT7].3b5_1.heavy 560.978 / 777.39 17119.0 41.45805072784424 36 10 10 6 10 0.8512180887465653 71.73358813637631 0.030597686767578125 3 0.83803574355352 3.0241883571757486 17119.0 69.34278481012659 0.0 - - - - - - - 282.2105263157895 34 19 EIF4E2 eukaryotic translation initiation factor 4E family member 2 905 116 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23177.[MT7]-FQEDIISIWNK[MT7].3y5_1.heavy 560.978 / 791.453 9548.0 41.45805072784424 36 10 10 6 10 0.8512180887465653 71.73358813637631 0.030597686767578125 3 0.83803574355352 3.0241883571757486 9548.0 61.4001179941003 0.0 - - - - - - - 215.0952380952381 19 21 EIF4E2 eukaryotic translation initiation factor 4E family member 2 907 117 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37739.[MT7]-ELAGAK[MT7].2y4_1.heavy 438.773 / 490.311 2584.0 18.38159942626953 27 13 0 10 4 2.056488177307194 36.34373046437548 0.0 7 0.9118728605344306 4.126342625180519 2584.0 8.670167818361303 0.0 - - - - - - - 255.63636363636363 5 22 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 909 117 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37739.[MT7]-ELAGAK[MT7].2y5_1.heavy 438.773 / 603.395 3801.0 18.38159942626953 27 13 0 10 4 2.056488177307194 36.34373046437548 0.0 7 0.9118728605344306 4.126342625180519 3801.0 26.702203011170475 1.0 - - - - - - - 234.04761904761904 7 21 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 911 117 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37739.[MT7]-ELAGAK[MT7].2b4_1.heavy 438.773 / 515.295 760.0 18.38159942626953 27 13 0 10 4 2.056488177307194 36.34373046437548 0.0 7 0.9118728605344306 4.126342625180519 760.0 -0.19876973372908327 12.0 - - - - - - - 301.96 3 25 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 913 117 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37739.[MT7]-ELAGAK[MT7].2y3_1.heavy 438.773 / 419.273 N/A 18.38159942626953 27 13 0 10 4 2.056488177307194 36.34373046437548 0.0 7 0.9118728605344306 4.126342625180519 2179.0 3.106050001119181 8.0 - - - - - - - 1197.125 68 8 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 915 118 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 228677.0 22.577499389648438 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 228677.0 397.2760387757552 0.0 - - - - - - - 656.2222222222222 457 9 917 118 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 365534.0 22.577499389648438 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 365534.0 2803.5606775595147 0.0 - - - - - - - 249.28571428571428 731 7 919 118 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 1379430.0 22.577499389648438 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1379430.0 5344.82637913783 0.0 - - - - - - - 380.6666666666667 2758 3 921 119 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23389.[MT7]-HFNPGESSEIFEFTTQK[MT7].4y5_1.heavy 572.287 / 768.437 3565.0 35.33980178833008 34 14 4 10 6 2.916521054788545 34.287426053658386 0.0 5 0.941234878321961 5.065851767900854 3565.0 4.866976738646244 1.0 - - - - - - - 763.7142857142857 7 7 CACNG1 calcium channel, voltage-dependent, gamma subunit 1 923 119 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23389.[MT7]-HFNPGESSEIFEFTTQK[MT7].4y4_1.heavy 572.287 / 621.369 9283.0 35.33980178833008 34 14 4 10 6 2.916521054788545 34.287426053658386 0.0 5 0.941234878321961 5.065851767900854 9283.0 14.369927745705855 0.0 - - - - - - - 657.7142857142857 18 14 CACNG1 calcium channel, voltage-dependent, gamma subunit 1 925 119 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23389.[MT7]-HFNPGESSEIFEFTTQK[MT7].4y3_1.heavy 572.287 / 520.321 12550.0 35.33980178833008 34 14 4 10 6 2.916521054788545 34.287426053658386 0.0 5 0.941234878321961 5.065851767900854 12550.0 29.30283605283605 2.0 - - - - - - - 727.6666666666666 50 15 CACNG1 calcium channel, voltage-dependent, gamma subunit 1 927 119 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23389.[MT7]-HFNPGESSEIFEFTTQK[MT7].4b3_1.heavy 572.287 / 543.28 13961.0 35.33980178833008 34 14 4 10 6 2.916521054788545 34.287426053658386 0.0 5 0.941234878321961 5.065851767900854 13961.0 19.061180930629114 0.0 - - - - - - - 1216.0 27 8 CACNG1 calcium channel, voltage-dependent, gamma subunit 1 929 120 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23050.[MT7]-SLGQNPTEAELR.2b4_1.heavy 729.887 / 530.305 3276.0 25.780699729919434 42 16 10 6 10 6.33525535905282 15.78468338408871 0.03940010070800781 3 0.9673698014946935 6.8134089525665695 3276.0 40.8 0.0 - - - - - - - 121.33333333333333 6 6 CALML3 calmodulin-like 3 931 120 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23050.[MT7]-SLGQNPTEAELR.2y10_1.heavy 729.887 / 1114.55 2366.0 25.780699729919434 42 16 10 6 10 6.33525535905282 15.78468338408871 0.03940010070800781 3 0.9673698014946935 6.8134089525665695 2366.0 32.06666666666667 0.0 - - - - - - - 204.75 4 4 CALML3 calmodulin-like 3 933 120 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23050.[MT7]-SLGQNPTEAELR.2b5_1.heavy 729.887 / 644.348 5005.0 25.780699729919434 42 16 10 6 10 6.33525535905282 15.78468338408871 0.03940010070800781 3 0.9673698014946935 6.8134089525665695 5005.0 20.166666666666664 0.0 - - - - - - - 192.11111111111111 10 9 CALML3 calmodulin-like 3 935 120 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23050.[MT7]-SLGQNPTEAELR.2y7_1.heavy 729.887 / 815.426 5096.0 25.780699729919434 42 16 10 6 10 6.33525535905282 15.78468338408871 0.03940010070800781 3 0.9673698014946935 6.8134089525665695 5096.0 78.4 0.0 - - - - - - - 163.8 10 5 CALML3 calmodulin-like 3 937 121 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23436.[MT7]-VLAFDLTVPTTNQFLLQYLRR.3b5_1.heavy 884.838 / 690.394 2346.0 47.73780059814453 45 15 10 10 10 2.7073272137607716 36.93679858560176 0.0 3 0.9560167780817185 5.862921110154376 2346.0 10.246669275458295 0.0 - - - - - - - 167.57894736842104 4 19 CCNA1 cyclin A1 939 121 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23436.[MT7]-VLAFDLTVPTTNQFLLQYLRR.3y19_2.heavy 884.838 / 1148.63 1153.0 47.73780059814453 45 15 10 10 10 2.7073272137607716 36.93679858560176 0.0 3 0.9560167780817185 5.862921110154376 1153.0 20.08182037815126 0.0 - - - - - - - 138.1764705882353 2 17 CCNA1 cyclin A1 941 121 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23436.[MT7]-VLAFDLTVPTTNQFLLQYLRR.3y13_2.heavy 884.838 / 825.46 1551.0 47.73780059814453 45 15 10 10 10 2.7073272137607716 36.93679858560176 0.0 3 0.9560167780817185 5.862921110154376 1551.0 5.626684743227134 0.0 - - - - - - - 152.84 3 25 CCNA1 cyclin A1 943 121 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23436.[MT7]-VLAFDLTVPTTNQFLLQYLRR.3y16_2.heavy 884.838 / 982.06 1710.0 47.73780059814453 45 15 10 10 10 2.7073272137607716 36.93679858560176 0.0 3 0.9560167780817185 5.862921110154376 1710.0 13.777627633968159 0.0 - - - - - - - 112.52941176470588 3 17 CCNA1 cyclin A1 945 122 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542863.[MT7]-TYAPVAFR.2y5_1.heavy 534.802 / 589.346 32714.0 30.142799377441406 46 20 10 6 10 5.970981223303442 16.747666130605428 0.03639984130859375 3 0.9913341461544655 13.247763379770136 32714.0 50.04142028449152 0.0 - - - - - - - 757.75 65 8 PIP5K1C;PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, gamma;phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 947 122 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542863.[MT7]-TYAPVAFR.2y6_1.heavy 534.802 / 660.383 16758.0 30.142799377441406 46 20 10 6 10 5.970981223303442 16.747666130605428 0.03639984130859375 3 0.9913341461544655 13.247763379770136 16758.0 43.004495920745924 0.0 - - - - - - - 725.7142857142857 33 7 PIP5K1C;PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, gamma;phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 949 122 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542863.[MT7]-TYAPVAFR.2b5_1.heavy 534.802 / 676.379 6507.0 30.142799377441406 46 20 10 6 10 5.970981223303442 16.747666130605428 0.03639984130859375 3 0.9913341461544655 13.247763379770136 6507.0 18.79511478175011 0.0 - - - - - - - 261.875 13 16 PIP5K1C;PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, gamma;phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 951 122 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542863.[MT7]-TYAPVAFR.2y7_1.heavy 534.802 / 823.446 29416.0 30.142799377441406 46 20 10 6 10 5.970981223303442 16.747666130605428 0.03639984130859375 3 0.9913341461544655 13.247763379770136 29416.0 25.29822391916054 0.0 - - - - - - - 231.6 58 10 PIP5K1C;PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, gamma;phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 953 123 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23382.[MT7]-GIVHTQAGYLLYAALTHK[MT7].4b9_1.heavy 561.824 / 1071.57 614.0 39.14619827270508 46 16 10 10 10 3.1007516641473543 25.836896741691234 0.0 3 0.9657286573032974 6.647351148985231 614.0 14.755476476076236 0.0 - - - - - - - 0.0 1 0 ACSS1 acyl-CoA synthetase short-chain family member 1 955 123 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23382.[MT7]-GIVHTQAGYLLYAALTHK[MT7].4y3_1.heavy 561.824 / 529.321 16754.0 39.14619827270508 46 16 10 10 10 3.1007516641473543 25.836896741691234 0.0 3 0.9657286573032974 6.647351148985231 16754.0 42.755456658463224 0.0 - - - - - - - 276.2 33 10 ACSS1 acyl-CoA synthetase short-chain family member 1 957 123 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23382.[MT7]-GIVHTQAGYLLYAALTHK[MT7].4b10_2.heavy 561.824 / 592.831 18840.0 39.14619827270508 46 16 10 10 10 3.1007516641473543 25.836896741691234 0.0 3 0.9657286573032974 6.647351148985231 18840.0 95.0701611170784 0.0 - - - - - - - 237.26666666666668 37 15 ACSS1 acyl-CoA synthetase short-chain family member 1 959 123 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23382.[MT7]-GIVHTQAGYLLYAALTHK[MT7].4b9_2.heavy 561.824 / 536.289 17490.0 39.14619827270508 46 16 10 10 10 3.1007516641473543 25.836896741691234 0.0 3 0.9657286573032974 6.647351148985231 17490.0 51.78235632692819 0.0 - - - - - - - 628.875 34 8 ACSS1 acyl-CoA synthetase short-chain family member 1 961 124 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542864.[MT7]-ILDAPEIR.2y5_1.heavy 535.82 / 585.336 17394.0 32.34749984741211 32 14 0 10 8 3.1403928173897437 31.843150145502747 0.0 4 0.9388767083794728 4.966170914554394 17394.0 26.966808298720164 0.0 - - - - - - - 697.0 34 8 CDC20 cell division cycle 20 homolog (S. cerevisiae) 963 124 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542864.[MT7]-ILDAPEIR.2b4_1.heavy 535.82 / 557.341 7400.0 32.34749984741211 32 14 0 10 8 3.1403928173897437 31.843150145502747 0.0 4 0.9388767083794728 4.966170914554394 7400.0 9.177337092941961 1.0 - - - - - - - 769.0 435 7 CDC20 cell division cycle 20 homolog (S. cerevisiae) 965 124 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542864.[MT7]-ILDAPEIR.2y6_1.heavy 535.82 / 700.362 3844.0 32.34749984741211 32 14 0 10 8 3.1403928173897437 31.843150145502747 0.0 4 0.9388767083794728 4.966170914554394 3844.0 3.0297985388532216 1.0 - - - - - - - 730.6 9 10 CDC20 cell division cycle 20 homolog (S. cerevisiae) 967 124 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542864.[MT7]-ILDAPEIR.2y7_1.heavy 535.82 / 813.446 14703.0 32.34749984741211 32 14 0 10 8 3.1403928173897437 31.843150145502747 0.0 4 0.9388767083794728 4.966170914554394 14703.0 63.11631033236994 0.0 - - - - - - - 169.84615384615384 29 13 CDC20 cell division cycle 20 homolog (S. cerevisiae) 969 125 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541606.[MT7]-SLLNK[MT7].2b3_1.heavy 431.784 / 458.31 3688.0 24.729700088500977 40 14 10 10 6 2.223985711999201 34.9902701489631 0.0 5 0.9348555948883631 4.808808465149163 3688.0 6.507834441980783 0.0 - - - - - - - 710.6666666666666 7 9 DNMT1;RSL1D1;CAMK2B;CAMK2G;ALDH4A1;C6orf142 DNA (cytosine-5-)-methyltransferase 1;ribosomal L1 domain containing 1;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma;aldehyde dehydrogenase 4 family, member A1;chromosome 6 open reading frame 142 971 125 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541606.[MT7]-SLLNK[MT7].2y4_1.heavy 431.784 / 631.426 8114.0 24.729700088500977 40 14 10 10 6 2.223985711999201 34.9902701489631 0.0 5 0.9348555948883631 4.808808465149163 8114.0 21.380531358885015 0.0 - - - - - - - 241.68421052631578 16 19 DNMT1;RSL1D1;CAMK2B;CAMK2G;ALDH4A1;C6orf142 DNA (cytosine-5-)-methyltransferase 1;ribosomal L1 domain containing 1;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma;aldehyde dehydrogenase 4 family, member A1;chromosome 6 open reading frame 142 973 125 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541606.[MT7]-SLLNK[MT7].2b4_1.heavy 431.784 / 572.352 2705.0 24.729700088500977 40 14 10 10 6 2.223985711999201 34.9902701489631 0.0 5 0.9348555948883631 4.808808465149163 2705.0 11.270833333333332 2.0 - - - - - - - 259.6666666666667 9 18 DNMT1;RSL1D1;CAMK2B;CAMK2G;ALDH4A1;C6orf142 DNA (cytosine-5-)-methyltransferase 1;ribosomal L1 domain containing 1;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma;aldehyde dehydrogenase 4 family, member A1;chromosome 6 open reading frame 142 975 125 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541606.[MT7]-SLLNK[MT7].2y3_1.heavy 431.784 / 518.342 6721.0 24.729700088500977 40 14 10 10 6 2.223985711999201 34.9902701489631 0.0 5 0.9348555948883631 4.808808465149163 6721.0 14.143943089430895 4.0 - - - - - - - 726.2857142857143 17 7 DNMT1;RSL1D1;CAMK2B;CAMK2G;ALDH4A1;C6orf142 DNA (cytosine-5-)-methyltransferase 1;ribosomal L1 domain containing 1;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma;aldehyde dehydrogenase 4 family, member A1;chromosome 6 open reading frame 142 977 126 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23235.[MT7]-FGIDDQDYLVSLTR.2b4_1.heavy 893.461 / 577.31 3023.0 40.4317741394043 39 13 10 6 10 1.9595963160010705 43.20645844090313 0.0363006591796875 3 0.9114196299401026 4.115611984867901 3023.0 6.1615981240981235 0.0 - - - - - - - 217.77777777777777 6 18 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 979 126 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23235.[MT7]-FGIDDQDYLVSLTR.2y10_1.heavy 893.461 / 1209.61 1399.0 40.4317741394043 39 13 10 6 10 1.9595963160010705 43.20645844090313 0.0363006591796875 3 0.9114196299401026 4.115611984867901 1399.0 35.22482142857143 0.0 - - - - - - - 108.88888888888889 2 18 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 981 126 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23235.[MT7]-FGIDDQDYLVSLTR.2b7_1.heavy 893.461 / 935.423 896.0 40.4317741394043 39 13 10 6 10 1.9595963160010705 43.20645844090313 0.0363006591796875 3 0.9114196299401026 4.115611984867901 896.0 4.8 1.0 - - - - - - - 0.0 1 0 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 983 126 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23235.[MT7]-FGIDDQDYLVSLTR.2y7_1.heavy 893.461 / 851.498 1176.0 40.4317741394043 39 13 10 6 10 1.9595963160010705 43.20645844090313 0.0363006591796875 3 0.9114196299401026 4.115611984867901 1176.0 4.6575 3.0 - - - - - - - 259.6363636363636 2 22 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 985 127 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38224.[MT7]-GSWQGENVAVK[MT7].2b8_1.heavy 731.898 / 1002.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR1 activin A receptor, type I 987 127 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38224.[MT7]-GSWQGENVAVK[MT7].2b4_1.heavy 731.898 / 603.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR1 activin A receptor, type I 989 127 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38224.[MT7]-GSWQGENVAVK[MT7].2b7_1.heavy 731.898 / 903.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR1 activin A receptor, type I 991 127 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38224.[MT7]-GSWQGENVAVK[MT7].2y7_1.heavy 731.898 / 860.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR1 activin A receptor, type I 993 128 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23189.[MT7]-ITYRELLETTC[CAM]R.3y6_1.heavy 566.97 / 779.372 4129.0 33.68539810180664 48 18 10 10 10 5.1368903557673535 19.467030260384426 0.0 3 0.9828832747001158 9.419559661455317 4129.0 26.516731136040345 0.0 - - - - - - - 615.0 8 8 ACSS1 acyl-CoA synthetase short-chain family member 1 995 128 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23189.[MT7]-ITYRELLETTC[CAM]R.3y11_2.heavy 566.97 / 721.359 8346.0 33.68539810180664 48 18 10 10 10 5.1368903557673535 19.467030260384426 0.0 3 0.9828832747001158 9.419559661455317 8346.0 24.883108251955385 0.0 - - - - - - - 243.3846153846154 16 13 ACSS1 acyl-CoA synthetase short-chain family member 1 997 128 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23189.[MT7]-ITYRELLETTC[CAM]R.3y4_1.heavy 566.97 / 537.245 7468.0 33.68539810180664 48 18 10 10 10 5.1368903557673535 19.467030260384426 0.0 3 0.9828832747001158 9.419559661455317 7468.0 12.04692521335151 1.0 - - - - - - - 779.75 14 8 ACSS1 acyl-CoA synthetase short-chain family member 1 999 128 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23189.[MT7]-ITYRELLETTC[CAM]R.3y5_1.heavy 566.97 / 666.288 N/A 33.68539810180664 48 18 10 10 10 5.1368903557673535 19.467030260384426 0.0 3 0.9828832747001158 9.419559661455317 5359.0 11.94993576506307 1.0 - - - - - - - 757.875 16 8 ACSS1 acyl-CoA synthetase short-chain family member 1 1001 129 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23237.[MT7]-LSLIFSHMLAELK[MT7].3b4_1.heavy 597.354 / 571.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1003 129 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23237.[MT7]-LSLIFSHMLAELK[MT7].3b5_1.heavy 597.354 / 718.462 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1005 129 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23237.[MT7]-LSLIFSHMLAELK[MT7].3y4_1.heavy 597.354 / 604.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1007 129 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23237.[MT7]-LSLIFSHMLAELK[MT7].3y5_1.heavy 597.354 / 717.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1009 130 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23188.[MT7]-SHSAGRTPGRTPGK[MT7].3y7_1.heavy 566.32 / 856.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1011 130 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23188.[MT7]-SHSAGRTPGRTPGK[MT7].3y4_1.heavy 566.32 / 546.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1013 130 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23188.[MT7]-SHSAGRTPGRTPGK[MT7].3y12_2.heavy 566.32 / 664.879 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1015 130 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23188.[MT7]-SHSAGRTPGRTPGK[MT7].3y13_2.heavy 566.32 / 733.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1017 131 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544302.[MT7]-FYFENLWSR.2y8_1.heavy 703.355 / 1114.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A calcium/calmodulin-dependent protein kinase II alpha 1019 131 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544302.[MT7]-FYFENLWSR.2y6_1.heavy 703.355 / 804.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A calcium/calmodulin-dependent protein kinase II alpha 1021 131 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544302.[MT7]-FYFENLWSR.2b5_1.heavy 703.355 / 845.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A calcium/calmodulin-dependent protein kinase II alpha 1023 131 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544302.[MT7]-FYFENLWSR.2y7_1.heavy 703.355 / 951.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A calcium/calmodulin-dependent protein kinase II alpha 1025 132 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38227.[MT7]-K[MT7]SEDEGIEK[MT7].2y4_1.heavy 733.907 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1027 132 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38227.[MT7]-K[MT7]SEDEGIEK[MT7].2b4_1.heavy 733.907 / 748.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1029 132 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38227.[MT7]-K[MT7]SEDEGIEK[MT7].2y3_1.heavy 733.907 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1031 132 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38227.[MT7]-K[MT7]SEDEGIEK[MT7].2b6_1.heavy 733.907 / 934.472 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1033 133 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 561675.0 31.588499069213867 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 561675.0 825.4248870491956 0.0 - - - - - - - 376.0 1123 2 1035 133 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 559450.0 31.588499069213867 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 559450.0 818.0363128028565 0.0 - - - - - - - 282.0 1118 3 1037 133 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 906952.0 31.588499069213867 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 906952.0 490.3467654726069 0.0 - - - - - - - 470.0 1813 1 1039 134 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37805.[MT7]-TENLAK[MT7].2y4_1.heavy 482.289 / 589.379 2428.0 18.236099243164062 36 18 0 10 8 2.6293457847175317 25.761805411265374 0.0 4 0.9827914138035274 9.394312444629808 2428.0 6.064475469235656 0.0 - - - - - - - 662.7 4 10 CCNA1 cyclin A1 1041 134 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37805.[MT7]-TENLAK[MT7].2b3_1.heavy 482.289 / 489.242 1872.0 18.236099243164062 36 18 0 10 8 2.6293457847175317 25.761805411265374 0.0 4 0.9827914138035274 9.394312444629808 1872.0 6.582857142857142 4.0 - - - - - - - 272.0 19 16 CCNA1 cyclin A1 1043 134 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37805.[MT7]-TENLAK[MT7].2y5_1.heavy 482.289 / 718.422 2378.0 18.236099243164062 36 18 0 10 8 2.6293457847175317 25.761805411265374 0.0 4 0.9827914138035274 9.394312444629808 2378.0 7.745692914764942 0.0 - - - - - - - 200.46153846153845 4 26 CCNA1 cyclin A1 1045 134 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37805.[MT7]-TENLAK[MT7].2b4_1.heavy 482.289 / 602.327 1568.0 18.236099243164062 36 18 0 10 8 2.6293457847175317 25.761805411265374 0.0 4 0.9827914138035274 9.394312444629808 1568.0 3.4414928950522174 1.0 - - - - - - - 216.76190476190476 3 21 CCNA1 cyclin A1 1047 135 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23376.[MT7]-LQGLTVPSNSHLVLVLDK[MT7].3b6_1.heavy 741.11 / 756.474 2383.0 38.20109939575195 48 18 10 10 10 3.7666492972575822 21.15081794611802 0.0 3 0.9847375479967899 9.976915535064332 2383.0 19.591566758149163 0.0 - - - - - - - 190.05 4 20 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1049 135 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23376.[MT7]-LQGLTVPSNSHLVLVLDK[MT7].3b4_1.heavy 741.11 / 556.357 1739.0 38.20109939575195 48 18 10 10 10 3.7666492972575822 21.15081794611802 0.0 3 0.9847375479967899 9.976915535064332 1739.0 9.023234641006663 0.0 - - - - - - - 246.0 3 22 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1051 135 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23376.[MT7]-LQGLTVPSNSHLVLVLDK[MT7].3y4_1.heavy 741.11 / 618.394 3091.0 38.20109939575195 48 18 10 10 10 3.7666492972575822 21.15081794611802 0.0 3 0.9847375479967899 9.976915535064332 3091.0 14.367062848993346 0.0 - - - - - - - 215.88235294117646 6 17 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1053 135 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23376.[MT7]-LQGLTVPSNSHLVLVLDK[MT7].3y5_1.heavy 741.11 / 731.478 3735.0 38.20109939575195 48 18 10 10 10 3.7666492972575822 21.15081794611802 0.0 3 0.9847375479967899 9.976915535064332 3735.0 14.392384798318073 0.0 - - - - - - - 243.94736842105263 7 19 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1055 136 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23378.[MT7]-GVVGEVPRPEQVQEALTK[MT7].4y4_1.heavy 556.819 / 576.384 19608.0 32.85020065307617 38 8 10 10 10 2.5646363769428677 30.765652936827035 0.0 3 0.7540746539937007 2.435732031499491 19608.0 63.564386700057035 0.0 - - - - - - - 223.2 39 5 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1057 136 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23378.[MT7]-GVVGEVPRPEQVQEALTK[MT7].4b11_2.heavy 556.819 / 646.858 42004.0 32.85020065307617 38 8 10 10 10 2.5646363769428677 30.765652936827035 0.0 3 0.7540746539937007 2.435732031499491 42004.0 79.44416555300478 0.0 - - - - - - - 465.0 84 2 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1059 136 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23378.[MT7]-GVVGEVPRPEQVQEALTK[MT7].4b5_1.heavy 556.819 / 586.332 16635.0 32.85020065307617 38 8 10 10 10 2.5646363769428677 30.765652936827035 0.0 3 0.7540746539937007 2.435732031499491 16635.0 28.91747311827957 1.0 - - - - - - - 255.75 34 4 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1061 136 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23378.[MT7]-GVVGEVPRPEQVQEALTK[MT7].4y3_1.heavy 556.819 / 505.347 29459.0 32.85020065307617 38 8 10 10 10 2.5646363769428677 30.765652936827035 0.0 3 0.7540746539937007 2.435732031499491 29459.0 53.924449641518876 0.0 - - - - - - - 279.0 58 1 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1063 137 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23377.[MT7]-GVVGEVPRPEQVQEALTK[MT7].3y15_2.heavy 742.089 / 913 N/A N/A - - - - - - - - - 0.0 - - - - - - - ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1065 137 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23377.[MT7]-GVVGEVPRPEQVQEALTK[MT7].3b6_1.heavy 742.089 / 685.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1067 137 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23377.[MT7]-GVVGEVPRPEQVQEALTK[MT7].3b5_1.heavy 742.089 / 586.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1069 137 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23377.[MT7]-GVVGEVPRPEQVQEALTK[MT7].3y13_2.heavy 742.089 / 819.968 N/A N/A - - - - - - - - - 0.0 - - - - - - - ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1071 138 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23045.[MT7]-FYFENLLSK[MT7].3y3_1.heavy 483.606 / 491.331 109023.0 42.72480010986328 42 12 10 10 10 2.9374738709747987 34.042856002261246 0.0 3 0.8847570438578016 3.5999242670685607 109023.0 249.582825456865 0.0 - - - - - - - 347.2 218 5 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1073 138 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23045.[MT7]-FYFENLLSK[MT7].3b4_1.heavy 483.606 / 731.352 45450.0 42.72480010986328 42 12 10 10 10 2.9374738709747987 34.042856002261246 0.0 3 0.8847570438578016 3.5999242670685607 45450.0 282.1786517969422 0.0 - - - - - - - 193.08333333333334 90 12 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1075 138 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23045.[MT7]-FYFENLLSK[MT7].3b5_1.heavy 483.606 / 845.395 40934.0 42.72480010986328 42 12 10 10 10 2.9374738709747987 34.042856002261246 0.0 3 0.8847570438578016 3.5999242670685607 40934.0 223.37336560661353 0.0 - - - - - - - 202.75 81 12 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1077 138 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23045.[MT7]-FYFENLLSK[MT7].3b3_1.heavy 483.606 / 602.31 51819.0 42.72480010986328 42 12 10 10 10 2.9374738709747987 34.042856002261246 0.0 3 0.8847570438578016 3.5999242670685607 51819.0 153.5356308674589 0.0 - - - - - - - 260.5 103 16 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1079 139 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23379.[MT7]-SGVVLATVARGPDAC[CAM]QILTR.3y7_1.heavy 743.415 / 861.461 1674.0 34.29932403564453 29 10 6 5 8 0.8186771589319174 64.33920894640659 0.0417022705078125 4 0.8497043507819837 3.142630895386767 1674.0 7.032488411186389 0.0 - - - - - - - 167.4 3 10 CCNA1 cyclin A1 1081 139 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23379.[MT7]-SGVVLATVARGPDAC[CAM]QILTR.3y17_2.heavy 743.415 / 921.007 2092.0 34.29932403564453 29 10 6 5 8 0.8186771589319174 64.33920894640659 0.0417022705078125 4 0.8497043507819837 3.142630895386767 2092.0 15.528618170357849 0.0 - - - - - - - 205.45454545454547 4 11 CCNA1 cyclin A1 1083 139 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23379.[MT7]-SGVVLATVARGPDAC[CAM]QILTR.3b3_1.heavy 743.415 / 388.231 4435.0 34.29932403564453 29 10 6 5 8 0.8186771589319174 64.33920894640659 0.0417022705078125 4 0.8497043507819837 3.142630895386767 4435.0 5.476830244369795 2.0 - - - - - - - 1223.625 14 8 CCNA1 cyclin A1 1085 139 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23379.[MT7]-SGVVLATVARGPDAC[CAM]QILTR.3y10_1.heavy 743.415 / 1130.56 335.0 34.29932403564453 29 10 6 5 8 0.8186771589319174 64.33920894640659 0.0417022705078125 4 0.8497043507819837 3.142630895386767 335.0 1.0433057330315445 8.0 - - - - - - - 219.625 2 8 CCNA1 cyclin A1 1087 140 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38449.[MT7]-LWC[CAM]C[CAM]LSDPSPPGLAAR.2b3_1.heavy 972.483 / 604.303 642.0 37.703073501586914 39 13 10 6 10 1.0357835909003168 63.116833357057395 0.03170013427734375 3 0.9236523860317047 4.437741622741593 642.0 0.3335064935064934 1.0 - - - - - - - 0.0 1 0 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1089 140 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38449.[MT7]-LWC[CAM]C[CAM]LSDPSPPGLAAR.2y9_1.heavy 972.483 / 865.489 3855.0 37.703073501586914 39 13 10 6 10 1.0357835909003168 63.116833357057395 0.03170013427734375 3 0.9236523860317047 4.437741622741593 3855.0 7.649987880093727 0.0 - - - - - - - 215.15 7 20 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1091 140 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38449.[MT7]-LWC[CAM]C[CAM]LSDPSPPGLAAR.2b7_1.heavy 972.483 / 1079.48 2056.0 37.703073501586914 39 13 10 6 10 1.0357835909003168 63.116833357057395 0.03170013427734375 3 0.9236523860317047 4.437741622741593 2056.0 6.672207792207793 0.0 - - - - - - - 162.2941176470588 4 17 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1093 140 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38449.[MT7]-LWC[CAM]C[CAM]LSDPSPPGLAAR.2y7_1.heavy 972.483 / 681.404 1221.0 37.703073501586914 39 13 10 6 10 1.0357835909003168 63.116833357057395 0.03170013427734375 3 0.9236523860317047 4.437741622741593 1221.0 11.41721988341969 0.0 - - - - - - - 182.9 2 20 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1095 141 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23014.[MT7]-IEDHLLSSGK[MT7].3b4_1.heavy 462.933 / 639.322 33505.0 27.096900939941406 41 11 10 10 10 0.8453224914901273 71.34081103555368 0.0 3 0.8713313202458071 3.4029483529402325 33505.0 71.64803795154151 0.0 - - - - - - - 247.66666666666666 67 9 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1097 141 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23014.[MT7]-IEDHLLSSGK[MT7].3b5_1.heavy 462.933 / 752.406 2970.0 27.096900939941406 41 11 10 10 10 0.8453224914901273 71.34081103555368 0.0 3 0.8713313202458071 3.4029483529402325 2970.0 36.29151140155728 0.0 - - - - - - - 185.77777777777777 5 9 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1099 141 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23014.[MT7]-IEDHLLSSGK[MT7].3b3_1.heavy 462.933 / 502.263 19862.0 27.096900939941406 41 11 10 10 10 0.8453224914901273 71.34081103555368 0.0 3 0.8713313202458071 3.4029483529402325 19862.0 15.150473894849478 0.0 - - - - - - - 676.1428571428571 39 7 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1101 141 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23014.[MT7]-IEDHLLSSGK[MT7].3y5_1.heavy 462.933 / 635.385 25616.0 27.096900939941406 41 11 10 10 10 0.8453224914901273 71.34081103555368 0.0 3 0.8713313202458071 3.4029483529402325 25616.0 40.000292117342205 0.0 - - - - - - - 278.44444444444446 51 9 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1103 142 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38026.[MT7]-DDPSTIEK[MT7].2y4_1.heavy 596.819 / 634.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 1105 142 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38026.[MT7]-DDPSTIEK[MT7].2y5_1.heavy 596.819 / 721.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 1107 142 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38026.[MT7]-DDPSTIEK[MT7].2y3_1.heavy 596.819 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 1109 142 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38026.[MT7]-DDPSTIEK[MT7].2y6_1.heavy 596.819 / 818.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 1111 143 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544728.[MT7]-SHSAGRTPGRTPGK[MT7].4y4_1.heavy 424.992 / 546.337 971.0 13.224800109863281 46 18 10 10 8 6.513664765614463 15.352340594483534 0.0 4 0.9886073655540428 11.551466193739765 971.0 13.112649572649573 1.0 - - - - - - - 130.71428571428572 3 14 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1113 143 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544728.[MT7]-SHSAGRTPGRTPGK[MT7].4b5_1.heavy 424.992 / 584.291 272.0 13.224800109863281 46 18 10 10 8 6.513664765614463 15.352340594483534 0.0 4 0.9886073655540428 11.551466193739765 272.0 2.0923076923076924 2.0 - - - - - - - 0.0 0 0 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1115 143 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544728.[MT7]-SHSAGRTPGRTPGK[MT7].4y7_2.heavy 424.992 / 428.76 2098.0 13.224800109863281 46 18 10 10 8 6.513664765614463 15.352340594483534 0.0 4 0.9886073655540428 11.551466193739765 2098.0 22.466589467879793 0.0 - - - - - - - 150.07142857142858 4 14 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1117 143 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544728.[MT7]-SHSAGRTPGRTPGK[MT7].4y3_1.heavy 424.992 / 445.289 3457.0 13.224800109863281 46 18 10 10 8 6.513664765614463 15.352340594483534 0.0 4 0.9886073655540428 11.551466193739765 3457.0 15.37896091103718 0.0 - - - - - - - 141.64705882352942 6 17 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1119 144 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23017.[MT7]-LFQPWSSLLR.2b3_1.heavy 695.902 / 533.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1121 144 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23017.[MT7]-LFQPWSSLLR.2y9_1.heavy 695.902 / 1133.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1123 144 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23017.[MT7]-LFQPWSSLLR.2y6_1.heavy 695.902 / 761.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1125 144 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23017.[MT7]-LFQPWSSLLR.2y7_1.heavy 695.902 / 858.483 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1127 145 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38127.[MT7]-AVPSFDFPK[MT7].2b4_1.heavy 648.366 / 499.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 1129 145 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38127.[MT7]-AVPSFDFPK[MT7].2y3_1.heavy 648.366 / 535.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 1131 145 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38127.[MT7]-AVPSFDFPK[MT7].2y7_1.heavy 648.366 / 981.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 1133 146 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 309568.0 26.156299591064453 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 309568.0 459.82331758039464 0.0 - - - - - - - 1146.8333333333333 619 12 1135 146 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 400218.0 26.156299591064453 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 400218.0 1411.9603969446337 0.0 - - - - - - - 2228.1428571428573 800 7 1137 146 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 411319.0 26.156299591064453 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 411319.0 1471.5764376393804 0.0 - - - - - - - 1730.2857142857142 822 7 1139 147 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38550.[MT7]-AVAWC[CAM]PWQSNVLATGGGTSDR.2b3_1.heavy 1189.08 / 386.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1141 147 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38550.[MT7]-AVAWC[CAM]PWQSNVLATGGGTSDR.2y9_1.heavy 1189.08 / 821.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1143 147 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38550.[MT7]-AVAWC[CAM]PWQSNVLATGGGTSDR.2b5_1.heavy 1189.08 / 732.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1145 147 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38550.[MT7]-AVAWC[CAM]PWQSNVLATGGGTSDR.2y7_1.heavy 1189.08 / 649.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1147 148 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22807.[MT7]-AYSTDYK[MT7].2y4_1.heavy 568.297 / 670.353 1419.0 20.584274768829346 43 17 10 6 10 3.06120078780721 25.40716502070277 0.03190040588378906 3 0.9726600151986967 7.44678424187682 1419.0 0.5780040733197555 1.0 - - - - - - - 186.5 2 24 MAP3K13 mitogen-activated protein kinase kinase kinase 13 1149 148 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22807.[MT7]-AYSTDYK[MT7].2y5_1.heavy 568.297 / 757.385 2347.0 20.584274768829346 43 17 10 6 10 3.06120078780721 25.40716502070277 0.03190040588378906 3 0.9726600151986967 7.44678424187682 2347.0 11.692014652014652 0.0 - - - - - - - 160.72222222222223 4 18 MAP3K13 mitogen-activated protein kinase kinase kinase 13 1151 148 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22807.[MT7]-AYSTDYK[MT7].2y6_1.heavy 568.297 / 920.448 3220.0 20.584274768829346 43 17 10 6 10 3.06120078780721 25.40716502070277 0.03190040588378906 3 0.9726600151986967 7.44678424187682 3220.0 23.468007527640555 0.0 - - - - - - - 109.33333333333333 6 15 MAP3K13 mitogen-activated protein kinase kinase kinase 13 1153 148 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22807.[MT7]-AYSTDYK[MT7].2b5_1.heavy 568.297 / 682.316 6550.0 20.584274768829346 43 17 10 6 10 3.06120078780721 25.40716502070277 0.03190040588378906 3 0.9726600151986967 7.44678424187682 6550.0 20.739443312966735 0.0 - - - - - - - 228.76190476190476 13 21 MAP3K13 mitogen-activated protein kinase kinase kinase 13 1155 149 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23413.[MT7]-NVFDEAILAALEPPEPK[MT7]K[MT7].4b4_1.heavy 604.098 / 620.316 1915.0 45.116600036621094 43 17 10 6 10 4.146730862209019 24.115382290985885 0.03620147705078125 3 0.9705340905251634 7.17183401576924 1915.0 1.1641337386018238 1.0 - - - - - - - 224.5625 3 16 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 1157 149 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23413.[MT7]-NVFDEAILAALEPPEPK[MT7]K[MT7].4b5_1.heavy 604.098 / 749.359 1856.0 45.116600036621094 43 17 10 6 10 4.146730862209019 24.115382290985885 0.03620147705078125 3 0.9705340905251634 7.17183401576924 1856.0 20.373583054626533 0.0 - - - - - - - 198.25 3 16 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 1159 149 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23413.[MT7]-NVFDEAILAALEPPEPK[MT7]K[MT7].4y3_1.heavy 604.098 / 660.465 2275.0 45.116600036621094 43 17 10 6 10 4.146730862209019 24.115382290985885 0.03620147705078125 3 0.9705340905251634 7.17183401576924 2275.0 8.393573980852269 0.0 - - - - - - - 288.45454545454544 4 11 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 1161 149 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23413.[MT7]-NVFDEAILAALEPPEPK[MT7]K[MT7].4b6_1.heavy 604.098 / 820.396 4968.0 45.116600036621094 43 17 10 6 10 4.146730862209019 24.115382290985885 0.03620147705078125 3 0.9705340905251634 7.17183401576924 4968.0 16.49141585672808 0.0 - - - - - - - 259.5 9 12 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 1163 150 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22804.[MT7]-TIYGDHQR.2y6_1.heavy 567.295 / 775.348 1514.0 17.42984962463379 42 16 10 6 10 3.2861497263839663 23.886346062385766 0.03350067138671875 3 0.9606991344531373 6.204811691419673 1514.0 14.037086092715231 0.0 - - - - - - - 127.6 3 15 ACSS1 acyl-CoA synthetase short-chain family member 1 1165 150 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22804.[MT7]-TIYGDHQR.2b5_1.heavy 567.295 / 694.353 1968.0 17.42984962463379 42 16 10 6 10 3.2861497263839663 23.886346062385766 0.03350067138671875 3 0.9606991344531373 6.204811691419673 1968.0 73.2096 0.0 - - - - - - - 96.0 3 11 ACSS1 acyl-CoA synthetase short-chain family member 1 1167 150 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22804.[MT7]-TIYGDHQR.2y5_1.heavy 567.295 / 612.285 959.0 17.42984962463379 42 16 10 6 10 3.2861497263839663 23.886346062385766 0.03350067138671875 3 0.9606991344531373 6.204811691419673 959.0 11.963762376237623 0.0 - - - - - - - 0.0 1 0 ACSS1 acyl-CoA synthetase short-chain family member 1 1169 150 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22804.[MT7]-TIYGDHQR.2y7_1.heavy 567.295 / 888.432 908.0 17.42984962463379 42 16 10 6 10 3.2861497263839663 23.886346062385766 0.03350067138671875 3 0.9606991344531373 6.204811691419673 908.0 19.023049504950496 0.0 - - - - - - - 0.0 1 0 ACSS1 acyl-CoA synthetase short-chain family member 1 1171 151 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22697.[MT7]-LDEELIR.2b3_1.heavy 516.296 / 502.263 N/A 32.185699462890625 32 11 10 10 1 1.1364996467564839 79.02195596499139 0.0 16 0.8781235339169547 3.498562059775696 3323.0 2.401266762997738 9.0 - - - - - - - 1749.7142857142858 7 7 MAP3K13 mitogen-activated protein kinase kinase kinase 13 1173 151 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22697.[MT7]-LDEELIR.2y5_1.heavy 516.296 / 659.372 570.0 32.185699462890625 32 11 10 10 1 1.1364996467564839 79.02195596499139 0.0 16 0.8781235339169547 3.498562059775696 570.0 0.36 30.0 - - - - - - - 760.0 5 8 MAP3K13 mitogen-activated protein kinase kinase kinase 13 1175 151 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22697.[MT7]-LDEELIR.2b4_1.heavy 516.296 / 631.305 6077.0 32.185699462890625 32 11 10 10 1 1.1364996467564839 79.02195596499139 0.0 16 0.8781235339169547 3.498562059775696 6077.0 6.538598834255179 0.0 - - - - - - - 1103.375 12 8 MAP3K13 mitogen-activated protein kinase kinase kinase 13 1177 151 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22697.[MT7]-LDEELIR.2y6_1.heavy 516.296 / 774.399 8641.0 32.185699462890625 32 11 10 10 1 1.1364996467564839 79.02195596499139 0.0 16 0.8781235339169547 3.498562059775696 8641.0 23.83199006114796 0.0 - - - - - - - 261.25 17 8 MAP3K13 mitogen-activated protein kinase kinase kinase 13 1179 152 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22559.[MT7]-IINTK[MT7].2b3_1.heavy 438.791 / 485.32 4438.0 22.137150287628174 44 18 10 6 10 5.396139089257913 18.53176842662745 0.03619956970214844 3 0.9862648417944762 10.518339593205976 4438.0 14.504298401420959 0.0 - - - - - - - 569.6666666666666 8 9 OR5D16;CAMK2A;CAMK2B;CAMK2D;CAMK2G olfactory receptor, family 5, subfamily D, member 16;calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1181 152 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22559.[MT7]-IINTK[MT7].2y4_1.heavy 438.791 / 619.39 34131.0 22.137150287628174 44 18 10 6 10 5.396139089257913 18.53176842662745 0.03619956970214844 3 0.9862648417944762 10.518339593205976 34131.0 42.95432906867356 0.0 - - - - - - - 1223.5714285714287 68 7 OR5D16;CAMK2A;CAMK2B;CAMK2D;CAMK2G olfactory receptor, family 5, subfamily D, member 16;calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1183 152 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22559.[MT7]-IINTK[MT7].2b4_1.heavy 438.791 / 586.368 2313.0 22.137150287628174 44 18 10 6 10 5.396139089257913 18.53176842662745 0.03619956970214844 3 0.9862648417944762 10.518339593205976 2313.0 3.7008 7.0 - - - - - - - 287.73333333333335 28 15 OR5D16;CAMK2A;CAMK2B;CAMK2D;CAMK2G olfactory receptor, family 5, subfamily D, member 16;calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1185 152 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22559.[MT7]-IINTK[MT7].2y3_1.heavy 438.791 / 506.306 23254.0 22.137150287628174 44 18 10 6 10 5.396139089257913 18.53176842662745 0.03619956970214844 3 0.9862648417944762 10.518339593205976 23254.0 49.792793599999996 0.0 - - - - - - - 634.1428571428571 46 7 OR5D16;CAMK2A;CAMK2B;CAMK2D;CAMK2G olfactory receptor, family 5, subfamily D, member 16;calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1187 153 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38543.[MT7]-SPESVALIWERDEPGTEVR.3y18_2.heavy 772.065 / 1042.03 22563.0 36.64015007019043 35 12 10 3 10 1.4170267355571962 44.27932428009991 0.0594024658203125 3 0.8938055741655602 3.7531084197404665 22563.0 96.24849135073232 0.0 - - - - - - - 245.21052631578948 45 19 ACSS1 acyl-CoA synthetase short-chain family member 1 1189 153 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38543.[MT7]-SPESVALIWERDEPGTEVR.3y7_1.heavy 772.065 / 787.394 4654.0 36.64015007019043 35 12 10 3 10 1.4170267355571962 44.27932428009991 0.0594024658203125 3 0.8938055741655602 3.7531084197404665 4654.0 8.454448177180542 0.0 - - - - - - - 262.14285714285717 9 21 ACSS1 acyl-CoA synthetase short-chain family member 1 1191 153 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38543.[MT7]-SPESVALIWERDEPGTEVR.3y6_1.heavy 772.065 / 658.352 8461.0 36.64015007019043 35 12 10 3 10 1.4170267355571962 44.27932428009991 0.0594024658203125 3 0.8938055741655602 3.7531084197404665 8461.0 26.41685549427779 0.0 - - - - - - - 338.75 16 20 ACSS1 acyl-CoA synthetase short-chain family member 1 1193 153 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38543.[MT7]-SPESVALIWERDEPGTEVR.3y5_1.heavy 772.065 / 561.299 1058.0 36.64015007019043 35 12 10 3 10 1.4170267355571962 44.27932428009991 0.0594024658203125 3 0.8938055741655602 3.7531084197404665 1058.0 0.5751773049645389 4.0 - - - - - - - 252.04761904761904 2 21 ACSS1 acyl-CoA synthetase short-chain family member 1 1195 154 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22693.[MT7]-EYHYK[MT7].2b3_1.heavy 514.276 / 574.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS4;SOCS5 suppressor of cytokine signaling 4;suppressor of cytokine signaling 5 1197 154 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22693.[MT7]-EYHYK[MT7].2y4_1.heavy 514.276 / 754.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS4;SOCS5 suppressor of cytokine signaling 4;suppressor of cytokine signaling 5 1199 154 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22693.[MT7]-EYHYK[MT7].2y3_1.heavy 514.276 / 591.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS4;SOCS5 suppressor of cytokine signaling 4;suppressor of cytokine signaling 5 1201 155 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541499.[MT7]-RLLHR.2b3_1.heavy 419.778 / 527.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDKN2D;ABCC10;C15orf42;SFI1 cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4);ATP-binding cassette, sub-family C (CFTR/MRP), member 10;chromosome 15 open reading frame 42;Sfi1 homolog, spindle assembly associated (yeast) 1203 155 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541499.[MT7]-RLLHR.2y4_1.heavy 419.778 / 538.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDKN2D;ABCC10;C15orf42;SFI1 cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4);ATP-binding cassette, sub-family C (CFTR/MRP), member 10;chromosome 15 open reading frame 42;Sfi1 homolog, spindle assembly associated (yeast) 1205 155 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541499.[MT7]-RLLHR.2b4_1.heavy 419.778 / 664.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDKN2D;ABCC10;C15orf42;SFI1 cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4);ATP-binding cassette, sub-family C (CFTR/MRP), member 10;chromosome 15 open reading frame 42;Sfi1 homolog, spindle assembly associated (yeast) 1207 155 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541499.[MT7]-RLLHR.2y3_1.heavy 419.778 / 425.262 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDKN2D;ABCC10;C15orf42;SFI1 cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4);ATP-binding cassette, sub-family C (CFTR/MRP), member 10;chromosome 15 open reading frame 42;Sfi1 homolog, spindle assembly associated (yeast) 1209 156 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22692.[MT7]-GYGGEEK[MT7].2y4_1.heavy 514.269 / 606.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 1211 156 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22692.[MT7]-GYGGEEK[MT7].2y5_1.heavy 514.269 / 663.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 1213 156 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22692.[MT7]-GYGGEEK[MT7].2y6_1.heavy 514.269 / 826.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 1215 156 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22692.[MT7]-GYGGEEK[MT7].2b5_1.heavy 514.269 / 608.28 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 1217 157 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38450.[MT7]-VAELLSSGLQSAIDQIR.3y7_1.heavy 648.701 / 802.442 1246.0 48.0755500793457 42 17 10 7 8 4.113833416910843 24.308227841440385 0.02629852294921875 4 0.9745255671422094 7.715850796911017 1246.0 31.94871794871795 0.0 - - - - - - - 138.44444444444446 2 9 ULK1 unc-51-like kinase 1 (C. elegans) 1219 157 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38450.[MT7]-VAELLSSGLQSAIDQIR.3y6_1.heavy 648.701 / 715.41 662.0 48.0755500793457 42 17 10 7 8 4.113833416910843 24.308227841440385 0.02629852294921875 4 0.9745255671422094 7.715850796911017 662.0 11.542564102564103 2.0 - - - - - - - 0.0 1 0 ULK1 unc-51-like kinase 1 (C. elegans) 1221 157 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38450.[MT7]-VAELLSSGLQSAIDQIR.3y5_1.heavy 648.701 / 644.373 896.0 48.0755500793457 42 17 10 7 8 4.113833416910843 24.308227841440385 0.02629852294921875 4 0.9745255671422094 7.715850796911017 896.0 22.055384615384618 1.0 - - - - - - - 132.9090909090909 3 22 ULK1 unc-51-like kinase 1 (C. elegans) 1223 157 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38450.[MT7]-VAELLSSGLQSAIDQIR.3b4_1.heavy 648.701 / 557.341 1636.0 48.0755500793457 42 17 10 7 8 4.113833416910843 24.308227841440385 0.02629852294921875 4 0.9745255671422094 7.715850796911017 1636.0 6.292307692307692 0.0 - - - - - - - 95.55 3 20 ULK1 unc-51-like kinase 1 (C. elegans) 1225 158 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23419.[MT7]-VLAFDLTVPTTNQFLLQYLR.4y5_1.heavy 624.855 / 692.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNA1 cyclin A1 1227 158 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23419.[MT7]-VLAFDLTVPTTNQFLLQYLR.4y8_1.heavy 624.855 / 1080.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNA1 cyclin A1 1229 158 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23419.[MT7]-VLAFDLTVPTTNQFLLQYLR.4b5_1.heavy 624.855 / 690.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNA1 cyclin A1 1231 158 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23419.[MT7]-VLAFDLTVPTTNQFLLQYLR.4y6_1.heavy 624.855 / 805.493 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNA1 cyclin A1 1233 159 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23417.[MT7]-ITEQLIEAINNGDFEAYTK[MT7].3b6_1.heavy 819.763 / 842.51 620.0 44.31857490539551 42 17 10 5 10 2.5559133283892415 39.124957364270585 0.04129791259765625 3 0.9702642279930923 7.139054078967608 620.0 1.6666666666666667 2.0 - - - - - - - 0.0 1 0 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1235 159 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23417.[MT7]-ITEQLIEAINNGDFEAYTK[MT7].3y3_1.heavy 819.763 / 555.326 1549.0 44.31857490539551 42 17 10 5 10 2.5559133283892415 39.124957364270585 0.04129791259765625 3 0.9702642279930923 7.139054078967608 1549.0 6.84558064516129 0.0 - - - - - - - 251.44444444444446 3 18 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1237 159 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23417.[MT7]-ITEQLIEAINNGDFEAYTK[MT7].3b4_1.heavy 819.763 / 616.342 2913.0 44.31857490539551 42 17 10 5 10 2.5559133283892415 39.124957364270585 0.04129791259765625 3 0.9702642279930923 7.139054078967608 2913.0 9.545929339477727 0.0 - - - - - - - 313.6470588235294 5 17 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1239 159 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23417.[MT7]-ITEQLIEAINNGDFEAYTK[MT7].3b5_1.heavy 819.763 / 729.426 2727.0 44.31857490539551 42 17 10 5 10 2.5559133283892415 39.124957364270585 0.04129791259765625 3 0.9702642279930923 7.139054078967608 2727.0 9.174744737298852 0.0 - - - - - - - 219.3846153846154 5 13 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1241 160 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544721.[MT7]-GIFPSGLFQGDTFR.2y5_1.heavy 843.442 / 595.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1243 160 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544721.[MT7]-GIFPSGLFQGDTFR.2y9_1.heavy 843.442 / 1040.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1245 160 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544721.[MT7]-GIFPSGLFQGDTFR.2y10_1.heavy 843.442 / 1127.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1247 160 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544721.[MT7]-GIFPSGLFQGDTFR.2y11_1.heavy 843.442 / 1224.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1249 161 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22953.[MT7]-LLEDQQEK[MT7].2y4_1.heavy 645.861 / 676.375 1932.0 24.493900299072266 43 13 10 10 10 1.755767094810516 45.04276547116655 0.0 3 0.9265275920141871 4.524854485456791 1932.0 13.210625 0.0 - - - - - - - 183.27272727272728 3 11 MAP3K13 mitogen-activated protein kinase kinase kinase 13 1251 161 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22953.[MT7]-LLEDQQEK[MT7].2y5_1.heavy 645.861 / 791.402 1176.0 24.493900299072266 43 13 10 10 10 1.755767094810516 45.04276547116655 0.0 3 0.9265275920141871 4.524854485456791 1176.0 0.9333333333333335 1.0 - - - - - - - 109.2 2 10 MAP3K13 mitogen-activated protein kinase kinase kinase 13 1253 161 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22953.[MT7]-LLEDQQEK[MT7].2b4_1.heavy 645.861 / 615.347 3611.0 24.493900299072266 43 13 10 10 10 1.755767094810516 45.04276547116655 0.0 3 0.9265275920141871 4.524854485456791 3611.0 9.703027210884354 0.0 - - - - - - - 556.5 7 8 MAP3K13 mitogen-activated protein kinase kinase kinase 13 1255 161 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22953.[MT7]-LLEDQQEK[MT7].2y7_1.heavy 645.861 / 1033.53 2771.0 24.493900299072266 43 13 10 10 10 1.755767094810516 45.04276547116655 0.0 3 0.9265275920141871 4.524854485456791 2771.0 20.617559523809526 0.0 - - - - - - - 201.6 5 5 MAP3K13 mitogen-activated protein kinase kinase kinase 13 1257 162 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22955.[MT7]-GAILTTMLATR.2y8_1.heavy 646.38 / 906.508 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A;CAMK2B;CAMK2D calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta 1259 162 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22955.[MT7]-GAILTTMLATR.2y9_1.heavy 646.38 / 1019.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A;CAMK2B;CAMK2D calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta 1261 162 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22955.[MT7]-GAILTTMLATR.2y10_1.heavy 646.38 / 1090.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A;CAMK2B;CAMK2D calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta 1263 162 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22955.[MT7]-GAILTTMLATR.2y7_1.heavy 646.38 / 793.424 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A;CAMK2B;CAMK2D calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta 1265 163 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22954.[MT7]-VVITFNQGLR.2y8_1.heavy 645.886 / 948.526 5881.0 35.27220153808594 47 17 10 10 10 20.32657156923232 4.919668801961999 0.0 3 0.979530510838239 8.61123132886259 5881.0 83.34143807965086 0.0 - - - - - - - 200.27777777777777 11 18 ACSS1 acyl-CoA synthetase short-chain family member 1 1267 163 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22954.[MT7]-VVITFNQGLR.2y9_1.heavy 645.886 / 1047.59 9645.0 35.27220153808594 47 17 10 10 10 20.32657156923232 4.919668801961999 0.0 3 0.979530510838239 8.61123132886259 9645.0 52.932329570125916 0.0 - - - - - - - 175.1764705882353 19 17 ACSS1 acyl-CoA synthetase short-chain family member 1 1269 163 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22954.[MT7]-VVITFNQGLR.2y6_1.heavy 645.886 / 734.394 4626.0 35.27220153808594 47 17 10 10 10 20.32657156923232 4.919668801961999 0.0 3 0.979530510838239 8.61123132886259 4626.0 15.92010269075783 0.0 - - - - - - - 248.33333333333334 9 18 ACSS1 acyl-CoA synthetase short-chain family member 1 1271 163 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22954.[MT7]-VVITFNQGLR.2y7_1.heavy 645.886 / 835.442 6744.0 35.27220153808594 47 17 10 10 10 20.32657156923232 4.919668801961999 0.0 3 0.979530510838239 8.61123132886259 6744.0 18.975618648994306 1.0 - - - - - - - 254.7 13 20 ACSS1 acyl-CoA synthetase short-chain family member 1 1273 164 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 119903.0 35.96139907836914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 119903.0 129.39971746178787 0.0 - - - - - - - 212.0 239 17 1275 164 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 264820.0 35.96139907836914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 264820.0 122.29655183749645 0.0 - - - - - - - 249.33333333333334 529 18 1277 164 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 267403.0 35.96139907836914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 267403.0 133.03196683368358 0.0 - - - - - - - 262.93333333333334 534 15 1279 165 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23127.[MT7]-GTEPIVVDPFDPR.2b3_1.heavy 793.421 / 432.221 5414.0 37.907124519348145 38 18 10 6 4 4.122548113930664 24.256842427644706 0.034297943115234375 8 0.9866258280809053 10.659668533805258 5414.0 28.15906608797365 0.0 - - - - - - - 619.0 10 7 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1281 165 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23127.[MT7]-GTEPIVVDPFDPR.2y5_1.heavy 793.421 / 631.32 4458.0 37.907124519348145 38 18 10 6 4 4.122548113930664 24.256842427644706 0.034297943115234375 8 0.9866258280809053 10.659668533805258 4458.0 17.332538210504076 0.0 - - - - - - - 672.5555555555555 8 9 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1283 165 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23127.[MT7]-GTEPIVVDPFDPR.2b6_1.heavy 793.421 / 741.426 1465.0 37.907124519348145 38 18 10 6 4 4.122548113930664 24.256842427644706 0.034297943115234375 8 0.9866258280809053 10.659668533805258 1465.0 1.7270212412614327 7.0 - - - - - - - 681.0 7 13 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1285 165 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23127.[MT7]-GTEPIVVDPFDPR.2b7_1.heavy 793.421 / 840.495 1401.0 37.907124519348145 38 18 10 6 4 4.122548113930664 24.256842427644706 0.034297943115234375 8 0.9866258280809053 10.659668533805258 1401.0 5.651796359799525 1.0 - - - - - - - 211.22727272727272 2 22 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1287 166 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541933.[MT7]-AQVTTK[MT7].2y4_1.heavy 468.292 / 592.379 2505.0 15.576550006866455 42 16 10 6 10 2.303289159247628 34.08371905095075 0.03229999542236328 3 0.9699042177698637 7.096011148448434 2505.0 15.16788990825688 0.0 - - - - - - - 165.9047619047619 5 21 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1289 166 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541933.[MT7]-AQVTTK[MT7].2y5_1.heavy 468.292 / 720.437 3758.0 15.576550006866455 42 16 10 6 10 2.303289159247628 34.08371905095075 0.03229999542236328 3 0.9699042177698637 7.096011148448434 3758.0 27.666257668711655 0.0 - - - - - - - 142.23076923076923 7 13 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1291 166 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541933.[MT7]-AQVTTK[MT7].2b4_1.heavy 468.292 / 544.321 654.0 15.576550006866455 42 16 10 6 10 2.303289159247628 34.08371905095075 0.03229999542236328 3 0.9699042177698637 7.096011148448434 654.0 1.579212598425197 4.0 - - - - - - - 0.0 1 0 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1293 166 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541933.[MT7]-AQVTTK[MT7].2y3_1.heavy 468.292 / 493.31 5283.0 15.576550006866455 42 16 10 6 10 2.303289159247628 34.08371905095075 0.03229999542236328 3 0.9699042177698637 7.096011148448434 5283.0 27.766310806241247 0.0 - - - - - - - 186.26315789473685 10 19 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1295 167 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37958.[MT7]-RTHTGEK[MT7].2y4_1.heavy 558.822 / 578.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF443;ZNF267;CTCF;PRDM5;KLF12;ZNF554;ZNF543;ZNF441;ZNF440;ZNF599;ZNF497;ZNF791;ZNF433;ZNF778;ZNF48;ZNF498;ZNF652;ZNF629;ZNF500;ZNF544;ZNF615;ZNF844;ZNF774;ZNF322B;ZNF716;KLF3;ZSCAN2;ZNF253;SP1;SP3;SP4;KLF10;ZNF878;ZIC1;ZIC2;ZIC3;ZNF8;ZNF14;ZSCAN21;ZNF133;ZNF157;ZNF177;ZNF205;ZNF322A;ZNF672;ZNF613;ZNF606;ZSCAN16;ZNF34;ZIC4;ZNF559;KLF11;ZIC5;ZNF799;ZNF625;ZNF486;ZNF479;ZBTB47 zinc finger protein 443;zinc finger protein 267;CCCTC-binding factor (zinc finger protein);PR domain containing 5;Kruppel-like factor 12;zinc finger protein 554;zinc finger protein 543;zinc finger protein 441;zinc finger protein 440;zinc finger protein 599;zinc finger protein 497;zinc finger protein 791;zinc finger protein 433;zinc finger protein 778;zinc finger protein 48;zinc finger protein 498;zinc finger protein 652;zinc finger protein 629;zinc finger protein 500;zinc finger protein 544;zinc finger protein 615;zinc finger protein 844;zinc finger protein 774;zinc finger protein 322B;zinc finger protein 716;Kruppel-like factor 3 (basic);zinc finger and SCAN domain containing 2;zinc finger protein 253;Sp1 transcription factor;Sp3 transcription factor;Sp4 transcription factor;Kruppel-like factor 10;zinc finger protein 878;Zic family member 1 (odd-paired homolog, Drosophila);Zic family member 2 (odd-paired homolog, Drosophila);Zic family member 3 (odd-paired homolog, Drosophila);zinc finger protein 8;zinc finger protein 14;zinc finger and SCAN domain containing 21;zinc finger protein 133;zinc finger protein 157;zinc finger protein 177;zinc finger protein 205;zinc finger protein 322A;zinc finger protein 672;zinc finger protein 613;zinc finger protein 606;zinc finger and SCAN domain containing 16;zinc finger protein 34;Zic family member 4;zinc finger protein 559;Kruppel-like factor 11;Zic family member 5 (odd-paired homolog, Drosophila);zinc finger protein 799;zinc finger protein 625;zinc finger protein 486;zinc finger protein 479;zinc finger and BTB domain containing 47 1297 167 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37958.[MT7]-RTHTGEK[MT7].2y5_1.heavy 558.822 / 715.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF443;ZNF267;CTCF;PRDM5;KLF12;ZNF554;ZNF543;ZNF441;ZNF440;ZNF599;ZNF497;ZNF791;ZNF433;ZNF778;ZNF48;ZNF498;ZNF652;ZNF629;ZNF500;ZNF544;ZNF615;ZNF844;ZNF774;ZNF322B;ZNF716;KLF3;ZSCAN2;ZNF253;SP1;SP3;SP4;KLF10;ZNF878;ZIC1;ZIC2;ZIC3;ZNF8;ZNF14;ZSCAN21;ZNF133;ZNF157;ZNF177;ZNF205;ZNF322A;ZNF672;ZNF613;ZNF606;ZSCAN16;ZNF34;ZIC4;ZNF559;KLF11;ZIC5;ZNF799;ZNF625;ZNF486;ZNF479;ZBTB47 zinc finger protein 443;zinc finger protein 267;CCCTC-binding factor (zinc finger protein);PR domain containing 5;Kruppel-like factor 12;zinc finger protein 554;zinc finger protein 543;zinc finger protein 441;zinc finger protein 440;zinc finger protein 599;zinc finger protein 497;zinc finger protein 791;zinc finger protein 433;zinc finger protein 778;zinc finger protein 48;zinc finger protein 498;zinc finger protein 652;zinc finger protein 629;zinc finger protein 500;zinc finger protein 544;zinc finger protein 615;zinc finger protein 844;zinc finger protein 774;zinc finger protein 322B;zinc finger protein 716;Kruppel-like factor 3 (basic);zinc finger and SCAN domain containing 2;zinc finger protein 253;Sp1 transcription factor;Sp3 transcription factor;Sp4 transcription factor;Kruppel-like factor 10;zinc finger protein 878;Zic family member 1 (odd-paired homolog, Drosophila);Zic family member 2 (odd-paired homolog, Drosophila);Zic family member 3 (odd-paired homolog, Drosophila);zinc finger protein 8;zinc finger protein 14;zinc finger and SCAN domain containing 21;zinc finger protein 133;zinc finger protein 157;zinc finger protein 177;zinc finger protein 205;zinc finger protein 322A;zinc finger protein 672;zinc finger protein 613;zinc finger protein 606;zinc finger and SCAN domain containing 16;zinc finger protein 34;Zic family member 4;zinc finger protein 559;Kruppel-like factor 11;Zic family member 5 (odd-paired homolog, Drosophila);zinc finger protein 799;zinc finger protein 625;zinc finger protein 486;zinc finger protein 479;zinc finger and BTB domain containing 47 1299 167 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37958.[MT7]-RTHTGEK[MT7].2b6_1.heavy 558.822 / 826.429 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF443;ZNF267;CTCF;PRDM5;KLF12;ZNF554;ZNF543;ZNF441;ZNF440;ZNF599;ZNF497;ZNF791;ZNF433;ZNF778;ZNF48;ZNF498;ZNF652;ZNF629;ZNF500;ZNF544;ZNF615;ZNF844;ZNF774;ZNF322B;ZNF716;KLF3;ZSCAN2;ZNF253;SP1;SP3;SP4;KLF10;ZNF878;ZIC1;ZIC2;ZIC3;ZNF8;ZNF14;ZSCAN21;ZNF133;ZNF157;ZNF177;ZNF205;ZNF322A;ZNF672;ZNF613;ZNF606;ZSCAN16;ZNF34;ZIC4;ZNF559;KLF11;ZIC5;ZNF799;ZNF625;ZNF486;ZNF479;ZBTB47 zinc finger protein 443;zinc finger protein 267;CCCTC-binding factor (zinc finger protein);PR domain containing 5;Kruppel-like factor 12;zinc finger protein 554;zinc finger protein 543;zinc finger protein 441;zinc finger protein 440;zinc finger protein 599;zinc finger protein 497;zinc finger protein 791;zinc finger protein 433;zinc finger protein 778;zinc finger protein 48;zinc finger protein 498;zinc finger protein 652;zinc finger protein 629;zinc finger protein 500;zinc finger protein 544;zinc finger protein 615;zinc finger protein 844;zinc finger protein 774;zinc finger protein 322B;zinc finger protein 716;Kruppel-like factor 3 (basic);zinc finger and SCAN domain containing 2;zinc finger protein 253;Sp1 transcription factor;Sp3 transcription factor;Sp4 transcription factor;Kruppel-like factor 10;zinc finger protein 878;Zic family member 1 (odd-paired homolog, Drosophila);Zic family member 2 (odd-paired homolog, Drosophila);Zic family member 3 (odd-paired homolog, Drosophila);zinc finger protein 8;zinc finger protein 14;zinc finger and SCAN domain containing 21;zinc finger protein 133;zinc finger protein 157;zinc finger protein 177;zinc finger protein 205;zinc finger protein 322A;zinc finger protein 672;zinc finger protein 613;zinc finger protein 606;zinc finger and SCAN domain containing 16;zinc finger protein 34;Zic family member 4;zinc finger protein 559;Kruppel-like factor 11;Zic family member 5 (odd-paired homolog, Drosophila);zinc finger protein 799;zinc finger protein 625;zinc finger protein 486;zinc finger protein 479;zinc finger and BTB domain containing 47 1301 167 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37958.[MT7]-RTHTGEK[MT7].2y6_1.heavy 558.822 / 816.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF443;ZNF267;CTCF;PRDM5;KLF12;ZNF554;ZNF543;ZNF441;ZNF440;ZNF599;ZNF497;ZNF791;ZNF433;ZNF778;ZNF48;ZNF498;ZNF652;ZNF629;ZNF500;ZNF544;ZNF615;ZNF844;ZNF774;ZNF322B;ZNF716;KLF3;ZSCAN2;ZNF253;SP1;SP3;SP4;KLF10;ZNF878;ZIC1;ZIC2;ZIC3;ZNF8;ZNF14;ZSCAN21;ZNF133;ZNF157;ZNF177;ZNF205;ZNF322A;ZNF672;ZNF613;ZNF606;ZSCAN16;ZNF34;ZIC4;ZNF559;KLF11;ZIC5;ZNF799;ZNF625;ZNF486;ZNF479;ZBTB47 zinc finger protein 443;zinc finger protein 267;CCCTC-binding factor (zinc finger protein);PR domain containing 5;Kruppel-like factor 12;zinc finger protein 554;zinc finger protein 543;zinc finger protein 441;zinc finger protein 440;zinc finger protein 599;zinc finger protein 497;zinc finger protein 791;zinc finger protein 433;zinc finger protein 778;zinc finger protein 48;zinc finger protein 498;zinc finger protein 652;zinc finger protein 629;zinc finger protein 500;zinc finger protein 544;zinc finger protein 615;zinc finger protein 844;zinc finger protein 774;zinc finger protein 322B;zinc finger protein 716;Kruppel-like factor 3 (basic);zinc finger and SCAN domain containing 2;zinc finger protein 253;Sp1 transcription factor;Sp3 transcription factor;Sp4 transcription factor;Kruppel-like factor 10;zinc finger protein 878;Zic family member 1 (odd-paired homolog, Drosophila);Zic family member 2 (odd-paired homolog, Drosophila);Zic family member 3 (odd-paired homolog, Drosophila);zinc finger protein 8;zinc finger protein 14;zinc finger and SCAN domain containing 21;zinc finger protein 133;zinc finger protein 157;zinc finger protein 177;zinc finger protein 205;zinc finger protein 322A;zinc finger protein 672;zinc finger protein 613;zinc finger protein 606;zinc finger and SCAN domain containing 16;zinc finger protein 34;Zic family member 4;zinc finger protein 559;Kruppel-like factor 11;Zic family member 5 (odd-paired homolog, Drosophila);zinc finger protein 799;zinc finger protein 625;zinc finger protein 486;zinc finger protein 479;zinc finger and BTB domain containing 47 1303 168 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37853.[MT7]-NQYNLAR.2b3_1.heavy 511.779 / 550.274 3244.0 21.265499114990234 42 12 10 10 10 1.0062220114946367 60.56170612983296 0.0 3 0.8972717456615673 3.8170467947294284 3244.0 10.681332104001473 0.0 - - - - - - - 247.42307692307693 6 26 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1305 168 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37853.[MT7]-NQYNLAR.2y5_1.heavy 511.779 / 636.346 7285.0 21.265499114990234 42 12 10 10 10 1.0062220114946367 60.56170612983296 0.0 3 0.8972717456615673 3.8170467947294284 7285.0 25.61794670846395 0.0 - - - - - - - 729.4285714285714 14 7 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1307 168 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37853.[MT7]-NQYNLAR.2b4_1.heavy 511.779 / 664.317 8030.0 21.265499114990234 42 12 10 10 10 1.0062220114946367 60.56170612983296 0.0 3 0.8972717456615673 3.8170467947294284 8030.0 41.4191931441507 0.0 - - - - - - - 226.52173913043478 16 23 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1309 168 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37853.[MT7]-NQYNLAR.2y6_1.heavy 511.779 / 764.405 11912.0 21.265499114990234 42 12 10 10 10 1.0062220114946367 60.56170612983296 0.0 3 0.8972717456615673 3.8170467947294284 11912.0 47.786136186862144 0.0 - - - - - - - 186.11111111111111 23 18 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1311 169 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542653.[MT7]-QLELNER.2y4_1.heavy 523.292 / 531.289 9949.0 24.53339958190918 50 20 10 10 10 6.952386171450138 14.383550846276117 0.0 3 0.9964908720851117 20.827430248769925 9949.0 21.60992976744769 0.0 - - - - - - - 792.2857142857143 19 7 VEGFA vascular endothelial growth factor A 1313 169 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542653.[MT7]-QLELNER.2b3_1.heavy 523.292 / 515.295 14598.0 24.53339958190918 50 20 10 10 10 6.952386171450138 14.383550846276117 0.0 3 0.9964908720851117 20.827430248769925 14598.0 14.22575951225353 0.0 - - - - - - - 1250.5 29 12 VEGFA vascular endothelial growth factor A 1315 169 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542653.[MT7]-QLELNER.2y5_1.heavy 523.292 / 660.331 9378.0 24.53339958190918 50 20 10 10 10 6.952386171450138 14.383550846276117 0.0 3 0.9964908720851117 20.827430248769925 9378.0 7.601313485113835 1.0 - - - - - - - 761.3333333333334 18 9 VEGFA vascular endothelial growth factor A 1317 169 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542653.[MT7]-QLELNER.2y6_1.heavy 523.292 / 773.415 19491.0 24.53339958190918 50 20 10 10 10 6.952386171450138 14.383550846276117 0.0 3 0.9964908720851117 20.827430248769925 19491.0 76.10482190687134 0.0 - - - - - - - 715.8888888888889 38 9 VEGFA vascular endothelial growth factor A 1319 170 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38554.[MT7]-VLSLTMSPDGATVASAAADETLR.3b4_1.heavy 807.42 / 557.378 2051.0 39.14619827270508 48 20 10 10 8 8.5435812191498 11.704693551207479 0.0 4 0.992523937792134 14.264448231386279 2051.0 2.4110459989323902 2.0 - - - - - - - 226.33333333333334 4 15 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1321 170 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38554.[MT7]-VLSLTMSPDGATVASAAADETLR.3b5_1.heavy 807.42 / 658.426 2628.0 39.14619827270508 48 20 10 10 8 8.5435812191498 11.704693551207479 0.0 4 0.992523937792134 14.264448231386279 2628.0 8.653011329096435 0.0 - - - - - - - 248.7058823529412 5 17 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1323 170 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38554.[MT7]-VLSLTMSPDGATVASAAADETLR.3b7_1.heavy 807.42 / 876.498 4230.0 39.14619827270508 48 20 10 10 8 8.5435812191498 11.704693551207479 0.0 4 0.992523937792134 14.264448231386279 4230.0 6.4023654823152425 2.0 - - - - - - - 183.53333333333333 11 15 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1325 170 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38554.[MT7]-VLSLTMSPDGATVASAAADETLR.3y10_1.heavy 807.42 / 1004.5 6024.0 39.14619827270508 48 20 10 10 8 8.5435812191498 11.704693551207479 0.0 4 0.992523937792134 14.264448231386279 6024.0 75.143125 0.0 - - - - - - - 164.0 12 16 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1327 171 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23420.[MT7]-VLAFDLTVPTTNQFLLQYLR.3y7_1.heavy 832.804 / 952.562 1449.0 50.09920120239258 33 3 10 10 10 0.8001623758812184 64.38956789420577 0.0 3 0.5408502530854197 1.7464667502887994 1449.0 21.131249999999998 0.0 - - - - - - - 35.833333333333336 2 6 CCNA1 cyclin A1 1329 171 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23420.[MT7]-VLAFDLTVPTTNQFLLQYLR.3y6_1.heavy 832.804 / 805.493 1449.0 50.09920120239258 33 3 10 10 10 0.8001623758812184 64.38956789420577 0.0 3 0.5408502530854197 1.7464667502887994 1449.0 -3.0505263157894733 0.0 - - - - - - - 70.4 2 25 CCNA1 cyclin A1 1331 171 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23420.[MT7]-VLAFDLTVPTTNQFLLQYLR.3b5_1.heavy 832.804 / 690.394 1021.0 50.09920120239258 33 3 10 10 10 0.8001623758812184 64.38956789420577 0.0 3 0.5408502530854197 1.7464667502887994 1021.0 14.634051367025684 0.0 - - - - - - - 51.869565217391305 2 23 CCNA1 cyclin A1 1333 171 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23420.[MT7]-VLAFDLTVPTTNQFLLQYLR.3y5_1.heavy 832.804 / 692.409 3848.0 50.09920120239258 33 3 10 10 10 0.8001623758812184 64.38956789420577 0.0 3 0.5408502530854197 1.7464667502887994 3848.0 8.101052631578947 0.0 - - - - - - - 58.5 7 22 CCNA1 cyclin A1 1335 172 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22811.[MT7]-ISDFGTSK[MT7].2y4_1.heavy 571.818 / 536.316 N/A 26.094799995422363 46 20 10 6 10 560.8023636966445 0.17831593886450364 0.03899955749511719 2 0.9999951570963709 560.8016477697324 5521.0 3.2372900902800796 0.0 - - - - - - - 1165.3333333333333 11 9 MAP3K15;MAP3K5;MAP3K12;MAP3K6;MAP3K13 mitogen-activated protein kinase kinase kinase 15;mitogen-activated protein kinase kinase kinase 5;mitogen-activated protein kinase kinase kinase 12;mitogen-activated protein kinase kinase kinase 6;mitogen-activated protein kinase kinase kinase 13 1337 172 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22811.[MT7]-ISDFGTSK[MT7].2y5_1.heavy 571.818 / 683.385 6349.0 26.094799995422363 46 20 10 6 10 560.8023636966445 0.17831593886450364 0.03899955749511719 2 0.9999951570963709 560.8016477697324 6349.0 20.67861413043478 0.0 - - - - - - - 184.0 12 13 MAP3K15;MAP3K5;MAP3K12;MAP3K6;MAP3K13 mitogen-activated protein kinase kinase kinase 15;mitogen-activated protein kinase kinase kinase 5;mitogen-activated protein kinase kinase kinase 12;mitogen-activated protein kinase kinase kinase 6;mitogen-activated protein kinase kinase kinase 13 1339 172 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22811.[MT7]-ISDFGTSK[MT7].2y6_1.heavy 571.818 / 798.411 N/A 26.094799995422363 46 20 10 6 10 560.8023636966445 0.17831593886450364 0.03899955749511719 2 0.9999951570963709 560.8016477697324 2024.0 4.477481623521893 1.0 - - - - - - - 211.6 6 10 MAP3K15;MAP3K5;MAP3K12;MAP3K6;MAP3K13 mitogen-activated protein kinase kinase kinase 15;mitogen-activated protein kinase kinase kinase 5;mitogen-activated protein kinase kinase kinase 12;mitogen-activated protein kinase kinase kinase 6;mitogen-activated protein kinase kinase kinase 13 1341 172 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22811.[MT7]-ISDFGTSK[MT7].2y7_1.heavy 571.818 / 885.443 7177.0 26.094799995422363 46 20 10 6 10 560.8023636966445 0.17831593886450364 0.03899955749511719 2 0.9999951570963709 560.8016477697324 7177.0 38.3549517546162 1.0 - - - - - - - 207.0 14 12 MAP3K15;MAP3K5;MAP3K12;MAP3K6;MAP3K13 mitogen-activated protein kinase kinase kinase 15;mitogen-activated protein kinase kinase kinase 5;mitogen-activated protein kinase kinase kinase 12;mitogen-activated protein kinase kinase kinase 6;mitogen-activated protein kinase kinase kinase 13 1343 173 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22812.[MT7]-GQNAPAASGAR.2y8_1.heavy 572.303 / 700.374 3949.0 13.61970043182373 47 17 10 10 10 3.6061813987123146 27.73016355630577 0.0 3 0.9735743364920398 7.575100087426879 3949.0 67.34728682170542 0.0 - - - - - - - 186.16666666666666 7 12 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1345 173 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22812.[MT7]-GQNAPAASGAR.2y9_1.heavy 572.303 / 814.417 5623.0 13.61970043182373 47 17 10 10 10 3.6061813987123146 27.73016355630577 0.0 3 0.9735743364920398 7.575100087426879 5623.0 19.986414507772018 0.0 - - - - - - - 166.0 11 15 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1347 173 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22812.[MT7]-GQNAPAASGAR.2b4_1.heavy 572.303 / 515.269 12962.0 13.61970043182373 47 17 10 10 10 3.6061813987123146 27.73016355630577 0.0 3 0.9735743364920398 7.575100087426879 12962.0 81.08493384511176 0.0 - - - - - - - 227.35294117647058 25 17 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1349 173 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22812.[MT7]-GQNAPAASGAR.2y7_1.heavy 572.303 / 629.337 18155.0 13.61970043182373 47 17 10 10 10 3.6061813987123146 27.73016355630577 0.0 3 0.9735743364920398 7.575100087426879 18155.0 145.66220930232558 0.0 - - - - - - - 144.28571428571428 36 14 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1351 174 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23429.[MT7]-TGIYSVELINDSLYDWHVK[MT7].4b7_1.heavy 635.837 / 894.469 2418.0 43.75410079956055 50 20 10 10 10 7.904512161772091 12.651002105306556 0.0 3 0.9962581356160976 20.168928784282613 2418.0 53.040000000000006 0.0 - - - - - - - 124.0 4 14 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1353 174 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23429.[MT7]-TGIYSVELINDSLYDWHVK[MT7].4b4_1.heavy 635.837 / 579.326 1612.0 43.75410079956055 50 20 10 10 10 7.904512161772091 12.651002105306556 0.0 3 0.9962581356160976 20.168928784282613 1612.0 3.2873563218390807 1.0 - - - - - - - 234.22222222222223 3 18 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1355 174 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23429.[MT7]-TGIYSVELINDSLYDWHVK[MT7].4b5_1.heavy 635.837 / 666.358 1674.0 43.75410079956055 50 20 10 10 10 7.904512161772091 12.651002105306556 0.0 3 0.9962581356160976 20.168928784282613 1674.0 11.309999999999999 0.0 - - - - - - - 226.11764705882354 3 17 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1357 174 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23429.[MT7]-TGIYSVELINDSLYDWHVK[MT7].4y6_1.heavy 635.837 / 991.512 1116.0 43.75410079956055 50 20 10 10 10 7.904512161772091 12.651002105306556 0.0 3 0.9962581356160976 20.168928784282613 1116.0 34.019999999999996 0.0 - - - - - - - 178.25 2 8 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1359 175 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541894.[MT7]-SIVPSLR.2y4_1.heavy 458.291 / 472.288 17493.0 30.583749771118164 32 20 0 6 6 13.51420965989452 7.399618809878705 0.0345001220703125 5 0.9984034055490258 30.882131107083822 17493.0 19.097864877636454 1.0 - - - - - - - 269.25 168 4 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1361 175 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541894.[MT7]-SIVPSLR.2y5_1.heavy 458.291 / 571.356 8433.0 30.583749771118164 32 20 0 6 6 13.51420965989452 7.399618809878705 0.0345001220703125 5 0.9984034055490258 30.882131107083822 8433.0 12.62264331210191 1.0 - - - - - - - 707.6666666666666 16 9 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1363 175 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541894.[MT7]-SIVPSLR.2y6_1.heavy 458.291 / 684.44 9778.0 30.583749771118164 32 20 0 6 6 13.51420965989452 7.399618809878705 0.0345001220703125 5 0.9984034055490258 30.882131107083822 9778.0 0.703200287666307 1.0 - - - - - - - 693.2727272727273 21 11 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1365 175 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541894.[MT7]-SIVPSLR.2b5_1.heavy 458.291 / 628.379 2243.0 30.583749771118164 32 20 0 6 6 13.51420965989452 7.399618809878705 0.0345001220703125 5 0.9984034055490258 30.882131107083822 2243.0 0.1190552016985138 2.0 - - - - - - - 247.9047619047619 6 21 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1367 176 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22689.[MT7]-VLYSQK[MT7].2b3_1.heavy 513.315 / 520.325 4547.0 23.31605052947998 46 20 10 6 10 31.29003040339273 3.1959061308280847 0.035800933837890625 3 0.99470565778081 16.95370296253547 4547.0 8.819552110463434 0.0 - - - - - - - 579.9090909090909 9 11 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1369 176 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22689.[MT7]-VLYSQK[MT7].2y4_1.heavy 513.315 / 669.369 14963.0 23.31605052947998 46 20 10 6 10 31.29003040339273 3.1959061308280847 0.035800933837890625 3 0.99470565778081 16.95370296253547 14963.0 59.33523540343813 0.0 - - - - - - - 198.47058823529412 29 17 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1371 176 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22689.[MT7]-VLYSQK[MT7].2y5_1.heavy 513.315 / 782.453 17896.0 23.31605052947998 46 20 10 6 10 31.29003040339273 3.1959061308280847 0.035800933837890625 3 0.99470565778081 16.95370296253547 17896.0 65.70479873724793 0.0 - - - - - - - 256.64285714285717 35 14 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1373 176 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22689.[MT7]-VLYSQK[MT7].2y3_1.heavy 513.315 / 506.306 11809.0 23.31605052947998 46 20 10 6 10 31.29003040339273 3.1959061308280847 0.035800933837890625 3 0.99470565778081 16.95370296253547 11809.0 18.21440757356421 0.0 - - - - - - - 790.2222222222222 23 9 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1375 177 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22542.[MT7]-AEAAGHR.2y5_1.heavy 428.231 / 511.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1377 177 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22542.[MT7]-AEAAGHR.2b4_1.heavy 428.231 / 487.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1379 177 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22542.[MT7]-AEAAGHR.2y6_1.heavy 428.231 / 640.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1381 177 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22542.[MT7]-AEAAGHR.2b5_1.heavy 428.231 / 544.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1383 178 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22580.[MT7]-SQSYK[MT7].2y4_1.heavy 450.755 / 669.369 2456.0 14.873000144958496 45 15 10 10 10 5.534050257362812 18.069947931346373 0.0 3 0.9506785576484639 5.534050520084512 2456.0 17.766875239433023 1.0 - - - - - - - 166.94444444444446 5 18 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1385 178 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22580.[MT7]-SQSYK[MT7].2y3_1.heavy 450.755 / 541.31 3656.0 14.873000144958496 45 15 10 10 10 5.534050257362812 18.069947931346373 0.0 3 0.9506785576484639 5.534050520084512 3656.0 40.77643245643245 0.0 - - - - - - - 267.5 7 20 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1387 179 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37982.[MT7]-REQAVEK[MT7].2y4_1.heavy 574.337 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K13 mitogen-activated protein kinase kinase kinase 13 1389 179 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37982.[MT7]-REQAVEK[MT7].2y3_1.heavy 574.337 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K13 mitogen-activated protein kinase kinase kinase 13 1391 179 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37982.[MT7]-REQAVEK[MT7].2b6_1.heavy 574.337 / 857.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K13 mitogen-activated protein kinase kinase kinase 13 1393 179 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37982.[MT7]-REQAVEK[MT7].2y6_1.heavy 574.337 / 847.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K13 mitogen-activated protein kinase kinase kinase 13 1395 180 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22968.[MT7]-GAILTTMLVSR.2y8_1.heavy 653.388 / 920.523 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1397 180 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22968.[MT7]-GAILTTMLVSR.2y9_1.heavy 653.388 / 1033.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1399 180 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22968.[MT7]-GAILTTMLVSR.2y10_1.heavy 653.388 / 1104.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1401 180 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22968.[MT7]-GAILTTMLVSR.2y7_1.heavy 653.388 / 807.439 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1403 181 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38003.[MT7]-TASDQATTAR.2b3_1.heavy 583.3 / 404.226 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4E2 eukaryotic translation initiation factor 4E family member 2 1405 181 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38003.[MT7]-TASDQATTAR.2y8_1.heavy 583.3 / 849.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4E2 eukaryotic translation initiation factor 4E family member 2 1407 181 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38003.[MT7]-TASDQATTAR.2b6_1.heavy 583.3 / 718.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4E2 eukaryotic translation initiation factor 4E family member 2 1409 181 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38003.[MT7]-TASDQATTAR.2y7_1.heavy 583.3 / 762.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4E2 eukaryotic translation initiation factor 4E family member 2 1411 182 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22967.[MT7]-LEVAESEFTH.2b4_1.heavy 653.326 / 557.341 1730.0 31.955425262451172 38 12 10 6 10 0.9489885841686716 68.05314796597781 0.038299560546875 3 0.8894097147904192 3.6763577821434317 1730.0 4.793416707941225 0.0 - - - - - - - 262.6666666666667 3 15 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1413 182 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22967.[MT7]-LEVAESEFTH.2b6_1.heavy 653.326 / 773.416 961.0 31.955425262451172 38 12 10 6 10 0.9489885841686716 68.05314796597781 0.038299560546875 3 0.8894097147904192 3.6763577821434317 961.0 2.002083333333333 2.0 - - - - - - - 0.0 1 0 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1415 182 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22967.[MT7]-LEVAESEFTH.2b7_1.heavy 653.326 / 902.459 3365.0 31.955425262451172 38 12 10 6 10 0.9489885841686716 68.05314796597781 0.038299560546875 3 0.8894097147904192 3.6763577821434317 3365.0 24.478038194444444 0.0 - - - - - - - 211.3 6 10 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1417 182 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22967.[MT7]-LEVAESEFTH.2b5_1.heavy 653.326 / 686.384 3653.0 31.955425262451172 38 12 10 6 10 0.9489885841686716 68.05314796597781 0.038299560546875 3 0.8894097147904192 3.6763577821434317 3653.0 35.55547132034632 0.0 - - - - - - - 208.08333333333334 7 12 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1419 183 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37847.[MT7]-WHFIK[MT7].2y4_1.heavy 509.807 / 688.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS4;RELL1 suppressor of cytokine signaling 4;RELT-like 1 1421 183 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37847.[MT7]-WHFIK[MT7].2y3_1.heavy 509.807 / 551.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS4;RELL1 suppressor of cytokine signaling 4;RELT-like 1 1423 184 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22965.[MT7]-RITADQALK[MT7].3b6_1.heavy 435.269 / 829.465 4867.0 22.00550079345703 43 13 10 10 10 1.2979867383494683 54.56433988702898 0.0 3 0.9112345221240487 4.1112529228843595 4867.0 111.95984 0.0 - - - - - - - 107.0 9 7 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1425 184 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22965.[MT7]-RITADQALK[MT7].3y3_1.heavy 435.269 / 475.336 36752.0 22.00550079345703 43 13 10 10 10 1.2979867383494683 54.56433988702898 0.0 3 0.9112345221240487 4.1112529228843595 36752.0 87.50819615758391 0.0 - - - - - - - 232.33333333333334 73 18 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1427 184 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22965.[MT7]-RITADQALK[MT7].3b4_1.heavy 435.269 / 586.379 22089.0 22.00550079345703 43 13 10 10 10 1.2979867383494683 54.56433988702898 0.0 3 0.9112345221240487 4.1112529228843595 22089.0 84.98129750509068 0.0 - - - - - - - 224.53333333333333 44 15 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1429 184 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22965.[MT7]-RITADQALK[MT7].3b5_1.heavy 435.269 / 701.406 26831.0 22.00550079345703 43 13 10 10 10 1.2979867383494683 54.56433988702898 0.0 3 0.9112345221240487 4.1112529228843595 26831.0 270.5665558974359 0.0 - - - - - - - 138.55555555555554 53 18 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1431 185 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38326.[MT7]-DLIGHGAFAVVFK[MT7].2y8_1.heavy 831.484 / 982.584 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 1433 185 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38326.[MT7]-DLIGHGAFAVVFK[MT7].2b4_1.heavy 831.484 / 543.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 1435 185 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38326.[MT7]-DLIGHGAFAVVFK[MT7].2y3_1.heavy 831.484 / 537.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 1437 185 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38326.[MT7]-DLIGHGAFAVVFK[MT7].2y6_1.heavy 831.484 / 854.526 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 1439 186 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38323.[MT7]-ENQPENSQTPTK[MT7].3b6_1.heavy 554.284 / 856.392 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1441 186 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38323.[MT7]-ENQPENSQTPTK[MT7].3b5_1.heavy 554.284 / 742.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1443 186 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38323.[MT7]-ENQPENSQTPTK[MT7].3y4_1.heavy 554.284 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1445 186 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38323.[MT7]-ENQPENSQTPTK[MT7].3b3_1.heavy 554.284 / 516.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1447 187 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23285.[MT7]-DLK[MT7]PQNILLSNPAGR.3y7_1.heavy 642.045 / 714.389 6633.0 32.36845016479492 38 13 10 5 10 1.011020406954577 59.10825138783457 0.041900634765625 3 0.9214149448588274 4.373271241026607 6633.0 21.968140018921474 0.0 - - - - - - - 211.4 13 15 ULK1 unc-51-like kinase 1 (C. elegans) 1449 187 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23285.[MT7]-DLK[MT7]PQNILLSNPAGR.3y6_1.heavy 642.045 / 601.305 6633.0 32.36845016479492 38 13 10 5 10 1.011020406954577 59.10825138783457 0.041900634765625 3 0.9214149448588274 4.373271241026607 6633.0 30.71677470282318 0.0 - - - - - - - 281.42857142857144 13 14 ULK1 unc-51-like kinase 1 (C. elegans) 1451 187 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23285.[MT7]-DLK[MT7]PQNILLSNPAGR.3y8_1.heavy 642.045 / 827.473 4422.0 32.36845016479492 38 13 10 5 10 1.011020406954577 59.10825138783457 0.041900634765625 3 0.9214149448588274 4.373271241026607 4422.0 53.40498214285714 0.0 - - - - - - - 296.5 8 12 ULK1 unc-51-like kinase 1 (C. elegans) 1453 187 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23285.[MT7]-DLK[MT7]PQNILLSNPAGR.3b7_2.heavy 642.045 / 549.331 8075.0 32.36845016479492 38 13 10 5 10 1.011020406954577 59.10825138783457 0.041900634765625 3 0.9214149448588274 4.373271241026607 8075.0 21.276950741827875 0.0 - - - - - - - 278.8 16 10 ULK1 unc-51-like kinase 1 (C. elegans) 1455 188 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23286.[MT7]-RLLVPANEGDPTETLR.3b6_1.heavy 642.357 / 794.537 2328.0 30.002300262451172 48 18 10 10 10 4.509001828302797 22.177857496598165 0.0 3 0.9865223632164866 10.618581727593678 2328.0 24.493402829486225 0.0 - - - - - - - 134.5 4 10 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1457 188 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23286.[MT7]-RLLVPANEGDPTETLR.3y6_1.heavy 642.357 / 716.394 6626.0 30.002300262451172 48 18 10 10 10 4.509001828302797 22.177857496598165 0.0 3 0.9865223632164866 10.618581727593678 6626.0 81.42453258845437 0.0 - - - - - - - 171.91666666666666 13 12 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1459 188 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23286.[MT7]-RLLVPANEGDPTETLR.3b4_1.heavy 642.357 / 626.447 4656.0 30.002300262451172 48 18 10 10 10 4.509001828302797 22.177857496598165 0.0 3 0.9865223632164866 10.618581727593678 4656.0 18.980027932960894 0.0 - - - - - - - 253.88888888888889 9 18 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1461 188 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23286.[MT7]-RLLVPANEGDPTETLR.3b3_1.heavy 642.357 / 527.379 1164.0 30.002300262451172 48 18 10 10 10 4.509001828302797 22.177857496598165 0.0 3 0.9865223632164866 10.618581727593678 1164.0 4.847746282527881 8.0 - - - - - - - 699.9090909090909 12 11 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1463 189 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38322.[MT7]-WFSDPTLTSLAK[MT7].2y4_1.heavy 827.458 / 562.368 951.0 39.68967533111572 40 14 10 6 10 2.1934658757223926 45.58995018195401 0.039699554443359375 3 0.9314942681414383 4.688002876760893 951.0 -0.5 7.0 - - - - - - - 0.0 1 0 ACVR1 activin A receptor, type I 1465 189 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38322.[MT7]-WFSDPTLTSLAK[MT7].2y8_1.heavy 827.458 / 974.6 3993.0 39.68967533111572 40 14 10 6 10 2.1934658757223926 45.58995018195401 0.039699554443359375 3 0.9314942681414383 4.688002876760893 3993.0 9.83227181661464 0.0 - - - - - - - 178.25 7 16 ACVR1 activin A receptor, type I 1467 189 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38322.[MT7]-WFSDPTLTSLAK[MT7].2y5_1.heavy 827.458 / 663.416 1268.0 39.68967533111572 40 14 10 6 10 2.1934658757223926 45.58995018195401 0.039699554443359375 3 0.9314942681414383 4.688002876760893 1268.0 11.785826771653543 1.0 - - - - - - - 217.875 2 16 ACVR1 activin A receptor, type I 1469 189 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38322.[MT7]-WFSDPTLTSLAK[MT7].2b4_1.heavy 827.458 / 680.316 6021.0 39.68967533111572 40 14 10 6 10 2.1934658757223926 45.58995018195401 0.039699554443359375 3 0.9314942681414383 4.688002876760893 6021.0 22.573280909374027 0.0 - - - - - - - 257.5 12 16 ACVR1 activin A receptor, type I 1471 190 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 274646.0 38.7150993347168 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 274646.0 182.02660462670872 0.0 - - - - - - - 231.9 549 10 1473 190 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 524271.0 38.7150993347168 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 524271.0 251.8976793532815 0.0 - - - - - - - 80.25 1048 4 1475 190 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 674174.0 38.7150993347168 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 674174.0 263.2562379147782 0.0 - - - - - - - 290.0 1348 4 1477 191 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38525.[MT7]-ELISGHGFAQNQLVIWK[MT7].3y7_1.heavy 743.419 / 1044.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1479 191 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38525.[MT7]-ELISGHGFAQNQLVIWK[MT7].3y3_1.heavy 743.419 / 590.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1481 191 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38525.[MT7]-ELISGHGFAQNQLVIWK[MT7].3b5_1.heavy 743.419 / 644.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1483 191 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38525.[MT7]-ELISGHGFAQNQLVIWK[MT7].3y4_1.heavy 743.419 / 689.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1485 192 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38156.[MT7]-VLAGQEYAAK[MT7].2y4_1.heavy 669.387 / 596.352 1100.0 25.183124542236328 44 18 10 6 10 10.620812020562873 9.415475935963348 0.03910064697265625 3 0.985878667059485 10.37318508948053 1100.0 5.829923919982975 1.0 - - - - - - - 127.14285714285714 2 14 CAMK2A calcium/calmodulin-dependent protein kinase II alpha 1487 192 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38156.[MT7]-VLAGQEYAAK[MT7].2y8_1.heavy 669.387 / 981.512 2201.0 25.183124542236328 44 18 10 6 10 10.620812020562873 9.415475935963348 0.03910064697265625 3 0.985878667059485 10.37318508948053 2201.0 15.838626939384055 0.0 - - - - - - - 192.36363636363637 4 11 CAMK2A calcium/calmodulin-dependent protein kinase II alpha 1489 192 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38156.[MT7]-VLAGQEYAAK[MT7].2y9_1.heavy 669.387 / 1094.6 2031.0 25.183124542236328 44 18 10 6 10 10.620812020562873 9.415475935963348 0.03910064697265625 3 0.985878667059485 10.37318508948053 2031.0 29.8852680895367 0.0 - - - - - - - 85.0 4 1 CAMK2A calcium/calmodulin-dependent protein kinase II alpha 1491 192 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38156.[MT7]-VLAGQEYAAK[MT7].2y7_1.heavy 669.387 / 910.475 2539.0 25.183124542236328 44 18 10 6 10 10.620812020562873 9.415475935963348 0.03910064697265625 3 0.985878667059485 10.37318508948053 2539.0 28.469852071005917 0.0 - - - - - - - 121.0 5 7 CAMK2A calcium/calmodulin-dependent protein kinase II alpha 1493 193 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23292.[MT7]-LRAETLYLAVNFLDR.3y6_1.heavy 646.703 / 763.41 1369.0 44.707000732421875 39 14 10 5 10 3.688335580817292 27.11250042433535 0.04019927978515625 3 0.9326331572325959 4.7279241643184795 1369.0 7.028962979520952 0.0 - - - - - - - 168.71428571428572 2 14 CCNA1 cyclin A1 1495 193 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23292.[MT7]-LRAETLYLAVNFLDR.3b6_1.heavy 646.703 / 828.506 996.0 44.707000732421875 39 14 10 5 10 3.688335580817292 27.11250042433535 0.04019927978515625 3 0.9326331572325959 4.7279241643184795 996.0 9.22258064516129 0.0 - - - - - - - 0.0 1 0 CCNA1 cyclin A1 1497 193 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23292.[MT7]-LRAETLYLAVNFLDR.3y5_1.heavy 646.703 / 664.341 1618.0 44.707000732421875 39 14 10 5 10 3.688335580817292 27.11250042433535 0.04019927978515625 3 0.9326331572325959 4.7279241643184795 1618.0 11.652366886902449 0.0 - - - - - - - 186.46666666666667 3 15 CCNA1 cyclin A1 1499 193 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23292.[MT7]-LRAETLYLAVNFLDR.3b5_1.heavy 646.703 / 715.422 436.0 44.707000732421875 39 14 10 5 10 3.688335580817292 27.11250042433535 0.04019927978515625 3 0.9326331572325959 4.7279241643184795 436.0 0.2337801608579088 4.0 - - - - - - - 0.0 0 0 CCNA1 cyclin A1 1501 194 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23295.[MT7]-LSGK[MT7]PQNAPEGYQNR.3y7_1.heavy 649.681 / 863.401 3625.0 20.24537467956543 43 18 10 7 8 2.99262585029572 33.41547022663003 0.028900146484375 4 0.9812750169582517 9.004749482699248 3625.0 12.667514158868626 1.0 - - - - - - - 160.6 7 10 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1503 194 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23295.[MT7]-LSGK[MT7]PQNAPEGYQNR.3y6_1.heavy 649.681 / 766.348 1243.0 20.24537467956543 43 18 10 7 8 2.99262585029572 33.41547022663003 0.028900146484375 4 0.9812750169582517 9.004749482699248 1243.0 28.684615384615384 0.0 - - - - - - - 125.85714285714286 2 14 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1505 194 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23295.[MT7]-LSGK[MT7]PQNAPEGYQNR.3b7_2.heavy 649.681 / 507.303 2227.0 20.24537467956543 43 18 10 7 8 2.99262585029572 33.41547022663003 0.028900146484375 4 0.9812750169582517 9.004749482699248 2227.0 2.2921252413596895 1.0 - - - - - - - 192.0 5 17 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1507 194 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23295.[MT7]-LSGK[MT7]PQNAPEGYQNR.3y9_1.heavy 649.681 / 1048.48 518.0 20.24537467956543 43 18 10 7 8 2.99262585029572 33.41547022663003 0.028900146484375 4 0.9812750169582517 9.004749482699248 518.0 8.715143069490896 1.0 - - - - - - - 0.0 1 0 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1509 195 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23141.[MT7]-LK[MT7]HPNIIAFK[MT7].3y6_1.heavy 538.347 / 849.531 984.0 29.501450061798096 46 20 10 6 10 23.000824065638465 4.3476703145341915 0.03380012512207031 3 0.9985061590603915 31.926852978502396 984.0 6.63370786516854 1.0 - - - - - - - 0.0 1 0 MAP3K13 mitogen-activated protein kinase kinase kinase 13 1511 195 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23141.[MT7]-LK[MT7]HPNIIAFK[MT7].3y3_1.heavy 538.347 / 509.32 11006.0 29.501450061798096 46 20 10 6 10 23.000824065638465 4.3476703145341915 0.03380012512207031 3 0.9985061590603915 31.926852978502396 11006.0 14.299244419744284 0.0 - - - - - - - 685.8888888888889 22 9 MAP3K13 mitogen-activated protein kinase kinase kinase 13 1513 195 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23141.[MT7]-LK[MT7]HPNIIAFK[MT7].3b3_1.heavy 538.347 / 667.449 6890.0 29.501450061798096 46 20 10 6 10 23.000824065638465 4.3476703145341915 0.03380012512207031 3 0.9985061590603915 31.926852978502396 6890.0 21.077236421725242 0.0 - - - - - - - 229.85714285714286 13 14 MAP3K13 mitogen-activated protein kinase kinase kinase 13 1515 195 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23141.[MT7]-LK[MT7]HPNIIAFK[MT7].3y4_1.heavy 538.347 / 622.404 8411.0 29.501450061798096 46 20 10 6 10 23.000824065638465 4.3476703145341915 0.03380012512207031 3 0.9985061590603915 31.926852978502396 8411.0 33.8487745741317 0.0 - - - - - - - 278.1666666666667 16 18 MAP3K13 mitogen-activated protein kinase kinase kinase 13 1517 196 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23290.[MT7]-AQQSYNSIVQIHEK[MT7].3y6_1.heavy 645.018 / 897.527 2501.0 27.164325714111328 41 15 10 6 10 2.707025151270401 28.737440373702306 0.03910064697265625 3 0.9525630225246079 5.643804151080687 2501.0 28.244345419238904 0.0 - - - - - - - 151.8181818181818 5 11 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1519 196 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23290.[MT7]-AQQSYNSIVQIHEK[MT7].3b6_1.heavy 645.018 / 836.402 1853.0 27.164325714111328 41 15 10 6 10 2.707025151270401 28.737440373702306 0.03910064697265625 3 0.9525630225246079 5.643804151080687 1853.0 18.63016216216216 0.0 - - - - - - - 173.625 3 8 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1521 196 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23290.[MT7]-AQQSYNSIVQIHEK[MT7].3y3_1.heavy 645.018 / 557.316 5280.0 27.164325714111328 41 15 10 6 10 2.707025151270401 28.737440373702306 0.03910064697265625 3 0.9525630225246079 5.643804151080687 5280.0 56.7416985995959 0.0 - - - - - - - 177.75 10 12 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1523 196 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23290.[MT7]-AQQSYNSIVQIHEK[MT7].3b7_1.heavy 645.018 / 923.434 1204.0 27.164325714111328 41 15 10 6 10 2.707025151270401 28.737440373702306 0.03910064697265625 3 0.9525630225246079 5.643804151080687 1204.0 25.23221505376344 0.0 - - - - - - - 129.8 2 5 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1525 197 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543504.[MT7]-QLLLALLQR.2y8_1.heavy 606.401 / 939.635 7464.0 45.53779983520508 46 20 10 6 10 6.446508961684813 15.512271928008726 0.0337982177734375 3 0.9920305292184273 13.815251049940448 7464.0 151.68774193548387 0.0 - - - - - - - 124.125 14 8 ULK1 unc-51-like kinase 1 (C. elegans) 1527 197 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543504.[MT7]-QLLLALLQR.2y5_1.heavy 606.401 / 600.383 4478.0 45.53779983520508 46 20 10 6 10 6.446508961684813 15.512271928008726 0.0337982177734375 3 0.9920305292184273 13.815251049940448 4478.0 19.760549751933684 0.0 - - - - - - - 242.85714285714286 8 21 ULK1 unc-51-like kinase 1 (C. elegans) 1529 197 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543504.[MT7]-QLLLALLQR.2y6_1.heavy 606.401 / 713.467 6158.0 45.53779983520508 46 20 10 6 10 6.446508961684813 15.512271928008726 0.0337982177734375 3 0.9920305292184273 13.815251049940448 6158.0 97.07060333927704 0.0 - - - - - - - 195.5 12 14 ULK1 unc-51-like kinase 1 (C. elegans) 1531 197 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543504.[MT7]-QLLLALLQR.2y7_1.heavy 606.401 / 826.551 6096.0 45.53779983520508 46 20 10 6 10 6.446508961684813 15.512271928008726 0.0337982177734375 3 0.9920305292184273 13.815251049940448 6096.0 112.99199378157792 0.0 - - - - - - - 176.16666666666666 12 12 ULK1 unc-51-like kinase 1 (C. elegans) 1533 198 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542250.[MT7]-C[CAM]C[CAM]VLER.2y4_1.heavy 490.742 / 516.314 3338.0 22.00550079345703 47 17 10 10 10 3.399868676240951 29.41290076843925 0.0 3 0.9766747632312204 8.064947368813307 3338.0 12.079315458054033 0.0 - - - - - - - 281.95 6 20 LOC100505679;UBE2Q2 hypothetical protein LOC100505679;ubiquitin-conjugating enzyme E2Q family member 2 1535 198 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542250.[MT7]-C[CAM]C[CAM]VLER.2b3_1.heavy 490.742 / 564.239 10821.0 22.00550079345703 47 17 10 10 10 3.399868676240951 29.41290076843925 0.0 3 0.9766747632312204 8.064947368813307 10821.0 54.575478260869566 0.0 - - - - - - - 239.31578947368422 21 19 LOC100505679;UBE2Q2 hypothetical protein LOC100505679;ubiquitin-conjugating enzyme E2Q family member 2 1537 198 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542250.[MT7]-C[CAM]C[CAM]VLER.2y5_1.heavy 490.742 / 676.345 15887.0 22.00550079345703 47 17 10 10 10 3.399868676240951 29.41290076843925 0.0 3 0.9766747632312204 8.064947368813307 15887.0 86.30401690821256 0.0 - - - - - - - 203.1764705882353 31 17 LOC100505679;UBE2Q2 hypothetical protein LOC100505679;ubiquitin-conjugating enzyme E2Q family member 2 1539 198 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542250.[MT7]-C[CAM]C[CAM]VLER.2b4_1.heavy 490.742 / 677.323 9613.0 22.00550079345703 47 17 10 10 10 3.399868676240951 29.41290076843925 0.0 3 0.9766747632312204 8.064947368813307 9613.0 158.22777011494253 0.0 - - - - - - - 216.76470588235293 19 17 LOC100505679;UBE2Q2 hypothetical protein LOC100505679;ubiquitin-conjugating enzyme E2Q family member 2 1541 199 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 672743.0 34.247100830078125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 672743.0 527.815558882987 0.0 - - - - - - - 664.0 1345 7 1543 199 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 111592.0 34.247100830078125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 111592.0 269.43315589353614 0.0 - - - - - - - 1239.7142857142858 223 7 1545 199 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 92745.0 34.247100830078125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 92745.0 167.8200732275169 0.0 - - - - - - - 1168.888888888889 185 9 1547 200 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544743.[MT7]-EYGASPVLSQGVDPR.3y7_1.heavy 573.633 / 758.379 25577.0 29.075174808502197 42 18 10 6 8 2.577882537350208 30.578751239327698 0.03669929504394531 4 0.9836259457674518 9.63141006612616 25577.0 39.42565498930081 0.0 - - - - - - - 280.5 51 8 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1549 200 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544743.[MT7]-EYGASPVLSQGVDPR.3b4_1.heavy 573.633 / 565.274 27821.0 29.075174808502197 42 18 10 6 8 2.577882537350208 30.578751239327698 0.03669929504394531 4 0.9836259457674518 9.63141006612616 27821.0 21.98468079643562 1.0 - - - - - - - 762.5 69 2 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1551 200 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544743.[MT7]-EYGASPVLSQGVDPR.3b5_1.heavy 573.633 / 652.306 62552.0 29.075174808502197 42 18 10 6 8 2.577882537350208 30.578751239327698 0.03669929504394531 4 0.9836259457674518 9.63141006612616 62552.0 91.67550301334481 0.0 - - - - - - - 346.14285714285717 125 7 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1553 200 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544743.[MT7]-EYGASPVLSQGVDPR.3b7_1.heavy 573.633 / 848.427 39129.0 29.075174808502197 42 18 10 6 8 2.577882537350208 30.578751239327698 0.03669929504394531 4 0.9836259457674518 9.63141006612616 39129.0 49.86495125348189 0.0 - - - - - - - 249.22222222222223 78 9 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1555 201 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541378.[MT7]-GSGSLLR.2b4_1.heavy 417.252 / 433.216 1603.0 23.16390037536621 28 12 4 6 6 0.9387534958884323 63.08401594366967 0.035800933837890625 5 0.889749633627529 3.6821295347154983 1603.0 4.48988326848249 2.0 - - - - - - - 192.46666666666667 5 15 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1557 201 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541378.[MT7]-GSGSLLR.2b6_1.heavy 417.252 / 659.385 1347.0 23.16390037536621 28 12 4 6 6 0.9387534958884323 63.08401594366967 0.035800933837890625 5 0.889749633627529 3.6821295347154983 1347.0 0.5600831600831601 5.0 - - - - - - - 705.4285714285714 3 7 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1559 201 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541378.[MT7]-GSGSLLR.2y6_1.heavy 417.252 / 632.373 2693.0 23.16390037536621 28 12 4 6 6 0.9387534958884323 63.08401594366967 0.035800933837890625 5 0.889749633627529 3.6821295347154983 2693.0 7.9685236874199745 0.0 - - - - - - - 276.5625 5 16 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1561 201 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541378.[MT7]-GSGSLLR.2b5_1.heavy 417.252 / 546.3 3270.0 23.16390037536621 28 12 4 6 6 0.9387534958884323 63.08401594366967 0.035800933837890625 5 0.889749633627529 3.6821295347154983 3270.0 15.401981558187458 2.0 - - - - - - - 256.5625 12 16 CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1563 202 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541508.[MT7]-VAELK[MT7].2b3_1.heavy 424.278 / 444.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMACHC;CDNF;BDP1;MKL1;TNIP3;ZNF830;CDC20 methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria;cerebral dopamine neurotrophic factor;B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB;megakaryoblastic leukemia (translocation) 1;TNFAIP3 interacting protein 3;zinc finger protein 830;cell division cycle 20 homolog (S. cerevisiae) 1565 202 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541508.[MT7]-VAELK[MT7].2y4_1.heavy 424.278 / 604.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMACHC;CDNF;BDP1;MKL1;TNIP3;ZNF830;CDC20 methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria;cerebral dopamine neurotrophic factor;B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB;megakaryoblastic leukemia (translocation) 1;TNFAIP3 interacting protein 3;zinc finger protein 830;cell division cycle 20 homolog (S. cerevisiae) 1567 202 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541508.[MT7]-VAELK[MT7].2b4_1.heavy 424.278 / 557.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMACHC;CDNF;BDP1;MKL1;TNIP3;ZNF830;CDC20 methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria;cerebral dopamine neurotrophic factor;B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB;megakaryoblastic leukemia (translocation) 1;TNFAIP3 interacting protein 3;zinc finger protein 830;cell division cycle 20 homolog (S. cerevisiae) 1569 202 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541508.[MT7]-VAELK[MT7].2y3_1.heavy 424.278 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMACHC;CDNF;BDP1;MKL1;TNIP3;ZNF830;CDC20 methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria;cerebral dopamine neurotrophic factor;B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB;megakaryoblastic leukemia (translocation) 1;TNFAIP3 interacting protein 3;zinc finger protein 830;cell division cycle 20 homolog (S. cerevisiae) 1571 203 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37990.[MT7]-SSLIHQGIR.2y8_1.heavy 577.842 / 923.542 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1573 203 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37990.[MT7]-SSLIHQGIR.2y5_1.heavy 577.842 / 610.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1575 203 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37990.[MT7]-SSLIHQGIR.2b4_1.heavy 577.842 / 545.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1577 203 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37990.[MT7]-SSLIHQGIR.2y6_1.heavy 577.842 / 723.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC20 cell division cycle 20 homolog (S. cerevisiae) 1579 204 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542629.[MT7]-IADFGFAR.2y5_1.heavy 520.786 / 597.314 58173.0 35.726600646972656 48 18 10 10 10 7.675600642226319 13.028296371995046 0.0 3 0.9861900942890471 10.48976951155935 58173.0 68.32776052631579 0.0 - - - - - - - 388.625 116 8 ULK1;ULK2 unc-51-like kinase 1 (C. elegans);unc-51-like kinase 2 (C. elegans) 1581 204 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542629.[MT7]-IADFGFAR.2y6_1.heavy 520.786 / 712.341 12191.0 35.726600646972656 48 18 10 10 10 7.675600642226319 13.028296371995046 0.0 3 0.9861900942890471 10.48976951155935 12191.0 43.61370516587783 0.0 - - - - - - - 214.6875 24 16 ULK1;ULK2 unc-51-like kinase 1 (C. elegans);unc-51-like kinase 2 (C. elegans) 1583 204 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542629.[MT7]-IADFGFAR.2b5_1.heavy 520.786 / 648.347 9818.0 35.726600646972656 48 18 10 10 10 7.675600642226319 13.028296371995046 0.0 3 0.9861900942890471 10.48976951155935 9818.0 21.914506483549452 0.0 - - - - - - - 774.6666666666666 19 15 ULK1;ULK2 unc-51-like kinase 1 (C. elegans);unc-51-like kinase 2 (C. elegans) 1585 204 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542629.[MT7]-IADFGFAR.2y7_1.heavy 520.786 / 783.378 49909.0 35.726600646972656 48 18 10 10 10 7.675600642226319 13.028296371995046 0.0 3 0.9861900942890471 10.48976951155935 49909.0 128.8471422659047 0.0 - - - - - - - 736.4444444444445 99 9 ULK1;ULK2 unc-51-like kinase 1 (C. elegans);unc-51-like kinase 2 (C. elegans) 1587 205 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22571.[MT7]-DLINK[MT7].2b3_1.heavy 445.781 / 486.304 16516.0 24.805599212646484 24 0 10 10 4 0.5088507687475788 105.46100430386932 0.0 8 0.3885921505797291 1.489578770436803 16516.0 13.291132624225327 0.0 - - - - - - - 238.07142857142858 33 14 CAMK2A;CAMK2D calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II delta 1589 205 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22571.[MT7]-DLINK[MT7].2y4_1.heavy 445.781 / 631.426 715.0 24.805599212646484 24 0 10 10 4 0.5088507687475788 105.46100430386932 0.0 8 0.3885921505797291 1.489578770436803 715.0 1.9375288430278503 26.0 - - - - - - - 268.0 13 8 CAMK2A;CAMK2D calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II delta 1591 205 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22571.[MT7]-DLINK[MT7].2b4_1.heavy 445.781 / 600.347 1112.0 24.805599212646484 24 0 10 10 4 0.5088507687475788 105.46100430386932 0.0 8 0.3885921505797291 1.489578770436803 1112.0 -0.46683459277917716 15.0 - - - - - - - 645.125 3 8 CAMK2A;CAMK2D calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II delta 1593 205 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22571.[MT7]-DLINK[MT7].2y3_1.heavy 445.781 / 518.342 1588.0 24.805599212646484 24 0 10 10 4 0.5088507687475788 105.46100430386932 0.0 8 0.3885921505797291 1.489578770436803 1588.0 3.5757480314960626 9.0 - - - - - - - 750.0 13 9 CAMK2A;CAMK2D calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II delta 1595 206 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38479.[MT7]-AADTDGDGQVNYEEFVR.2y4_1.heavy 1015.46 / 550.298 475.0 32.43349838256836 45 15 10 10 10 7.469536488793693 13.387711560151931 0.0 3 0.9562386701141187 5.877876768090162 475.0 2.1666666666666665 0.0 - - - - - - - 0.0 0 0 CALML3 calmodulin-like 3 1597 206 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38479.[MT7]-AADTDGDGQVNYEEFVR.2b7_1.heavy 1015.46 / 790.333 1615.0 32.43349838256836 45 15 10 10 10 7.469536488793693 13.387711560151931 0.0 3 0.9562386701141187 5.877876768090162 1615.0 16.6515 0.0 - - - - - - - 155.45454545454547 3 11 CALML3 calmodulin-like 3 1599 206 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38479.[MT7]-AADTDGDGQVNYEEFVR.2y10_1.heavy 1015.46 / 1240.6 1140.0 32.43349838256836 45 15 10 10 10 7.469536488793693 13.387711560151931 0.0 3 0.9562386701141187 5.877876768090162 1140.0 17.508 0.0 - - - - - - - 135.71428571428572 2 7 CALML3 calmodulin-like 3 1601 206 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38479.[MT7]-AADTDGDGQVNYEEFVR.2b5_1.heavy 1015.46 / 618.285 1710.0 32.43349838256836 45 15 10 10 10 7.469536488793693 13.387711560151931 0.0 3 0.9562386701141187 5.877876768090162 1710.0 11.61 0.0 - - - - - - - 241.8181818181818 3 11 CALML3 calmodulin-like 3 1603 207 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23006.[MT7]-FLLSYSIIK[MT7].2b3_1.heavy 686.428 / 518.346 5340.0 42.14820098876953 43 13 10 10 10 1.0271857431247442 59.745990717010805 0.0 3 0.9235648858165317 4.435167535146647 5340.0 18.65636279991507 0.0 - - - - - - - 306.17391304347825 10 23 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1605 207 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23006.[MT7]-FLLSYSIIK[MT7].2y4_1.heavy 686.428 / 604.415 3579.0 42.14820098876953 43 13 10 10 10 1.0271857431247442 59.745990717010805 0.0 3 0.9235648858165317 4.435167535146647 3579.0 18.779235294117647 1.0 - - - - - - - 183.57692307692307 7 26 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1607 207 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23006.[MT7]-FLLSYSIIK[MT7].2y6_1.heavy 686.428 / 854.51 5169.0 42.14820098876953 43 13 10 10 10 1.0271857431247442 59.745990717010805 0.0 3 0.9235648858165317 4.435167535146647 5169.0 42.52632689322063 0.0 - - - - - - - 177.82608695652175 10 23 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1609 207 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23006.[MT7]-FLLSYSIIK[MT7].2y7_1.heavy 686.428 / 967.594 2499.0 42.14820098876953 43 13 10 10 10 1.0271857431247442 59.745990717010805 0.0 3 0.9235648858165317 4.435167535146647 2499.0 21.363453479670742 0.0 - - - - - - - 116.73684210526316 4 19 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1611 208 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22975.[MT7]-IVVMNNLLPR.2y8_1.heavy 656.898 / 956.535 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1613 208 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22975.[MT7]-IVVMNNLLPR.2y9_1.heavy 656.898 / 1055.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1615 208 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22975.[MT7]-IVVMNNLLPR.2y6_1.heavy 656.898 / 726.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1617 208 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22975.[MT7]-IVVMNNLLPR.2y7_1.heavy 656.898 / 857.466 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1619 209 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544757.[MT7]-SVDSSGETTYK[MT7]K[MT7].4y5_2.heavy 434.237 / 464.789 22813.0 17.808799743652344 42 12 10 10 10 1.4329793907006492 55.14669803147803 0.0 3 0.8850886216408425 3.605218362117199 22813.0 158.3669253172457 0.0 - - - - - - - 207.1904761904762 45 21 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1621 209 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544757.[MT7]-SVDSSGETTYK[MT7]K[MT7].4b4_1.heavy 434.237 / 533.269 5514.0 17.808799743652344 42 12 10 10 10 1.4329793907006492 55.14669803147803 0.0 3 0.8850886216408425 3.605218362117199 5514.0 23.95007227396724 0.0 - - - - - - - 665.0 11 7 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1623 209 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544757.[MT7]-SVDSSGETTYK[MT7]K[MT7].4y7_2.heavy 434.237 / 557.821 9611.0 17.808799743652344 42 12 10 10 10 1.4329793907006492 55.14669803147803 0.0 3 0.8850886216408425 3.605218362117199 9611.0 78.73963190383367 0.0 - - - - - - - 210.875 19 24 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1625 209 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544757.[MT7]-SVDSSGETTYK[MT7]K[MT7].4b3_1.heavy 434.237 / 446.237 10572.0 17.808799743652344 42 12 10 10 10 1.4329793907006492 55.14669803147803 0.0 3 0.8850886216408425 3.605218362117199 10572.0 37.94168703192747 0.0 - - - - - - - 257.85714285714283 21 21 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1627 210 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23145.[MT7]-TPFLLVGTQIDLR.2y8_1.heavy 808.978 / 901.51 1965.0 43.97362422943115 37 14 10 5 8 2.0532810337879064 39.04886506554548 0.041301727294921875 4 0.9483454872377898 5.406557621947713 1965.0 34.76498104341326 0.0 - - - - - - - 140.28571428571428 3 14 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 1629 210 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23145.[MT7]-TPFLLVGTQIDLR.2b4_1.heavy 808.978 / 603.362 3071.0 43.97362422943115 37 14 10 5 8 2.0532810337879064 39.04886506554548 0.041301727294921875 4 0.9483454872377898 5.406557621947713 3071.0 17.059755656188482 0.0 - - - - - - - 216.7058823529412 6 17 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 1631 210 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23145.[MT7]-TPFLLVGTQIDLR.2y9_1.heavy 808.978 / 1014.59 1904.0 43.97362422943115 37 14 10 5 8 2.0532810337879064 39.04886506554548 0.041301727294921875 4 0.9483454872377898 5.406557621947713 1904.0 17.187168049277233 0.0 - - - - - - - 249.0 3 18 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 1633 210 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23145.[MT7]-TPFLLVGTQIDLR.2y7_1.heavy 808.978 / 802.442 3501.0 43.97362422943115 37 14 10 5 8 2.0532810337879064 39.04886506554548 0.041301727294921875 4 0.9483454872377898 5.406557621947713 3501.0 26.661375384717214 0.0 - - - - - - - 272.5 7 16 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 1635 211 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544890.[MT7]-AQQSYNSIVQIHEK[MT7].4y4_1.heavy 484.015 / 670.4 5372.0 27.174100875854492 41 13 10 10 8 1.8005848526075023 43.20841419934895 0.0 4 0.9059368791997628 3.991978040710423 5372.0 18.035491606714626 0.0 - - - - - - - 231.57142857142858 10 14 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1637 211 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544890.[MT7]-AQQSYNSIVQIHEK[MT7].4b4_1.heavy 484.015 / 559.296 19080.0 27.174100875854492 41 13 10 10 8 1.8005848526075023 43.20841419934895 0.0 4 0.9059368791997628 3.991978040710423 19080.0 16.07983208103915 0.0 - - - - - - - 314.8 38 5 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1639 211 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544890.[MT7]-AQQSYNSIVQIHEK[MT7].4y6_1.heavy 484.015 / 897.527 2964.0 27.174100875854492 41 13 10 10 8 1.8005848526075023 43.20841419934895 0.0 4 0.9059368791997628 3.991978040710423 2964.0 20.810818588372545 0.0 - - - - - - - 210.54545454545453 5 11 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1641 211 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544890.[MT7]-AQQSYNSIVQIHEK[MT7].4y3_1.heavy 484.015 / 557.316 12782.0 27.174100875854492 41 13 10 10 8 1.8005848526075023 43.20841419934895 0.0 4 0.9059368791997628 3.991978040710423 12782.0 26.770483596928123 1.0 - - - - - - - 750.3 34 10 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1643 212 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37978.[MT7]-IEYQDGK[MT7].2b3_1.heavy 570.811 / 550.299 N/A 21.59833335876465 39 13 10 6 10 1.043776152611406 55.51248696629272 0.031299591064453125 3 0.9036727038206405 3.9440120158507876 1027.0 1.8979466119096509 16.0 - - - - - - - 276.70588235294116 2 17 SOCS2 suppressor of cytokine signaling 2 1645 212 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37978.[MT7]-IEYQDGK[MT7].2y5_1.heavy 570.811 / 754.385 1136.0 21.59833335876465 39 13 10 6 10 1.043776152611406 55.51248696629272 0.031299591064453125 3 0.9036727038206405 3.9440120158507876 1136.0 13.148148148148149 0.0 - - - - - - - 126.9 2 20 SOCS2 suppressor of cytokine signaling 2 1647 212 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37978.[MT7]-IEYQDGK[MT7].2y6_1.heavy 570.811 / 883.428 1568.0 21.59833335876465 39 13 10 6 10 1.043776152611406 55.51248696629272 0.031299591064453125 3 0.9036727038206405 3.9440120158507876 1568.0 13.211851851851852 0.0 - - - - - - - 127.11764705882354 3 17 SOCS2 suppressor of cytokine signaling 2 1649 212 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37978.[MT7]-IEYQDGK[MT7].2b5_1.heavy 570.811 / 793.385 2055.0 21.59833335876465 39 13 10 6 10 1.043776152611406 55.51248696629272 0.031299591064453125 3 0.9036727038206405 3.9440120158507876 2055.0 18.266666666666666 0.0 - - - - - - - 126.0 4 15 SOCS2 suppressor of cytokine signaling 2 1651 213 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23279.[MT7]-FTEEYQLFEELGK[MT7].3b6_1.heavy 640.999 / 942.432 14977.0 42.24674987792969 47 20 10 7 10 19.866861459312563 5.0335076934421945 0.02809906005859375 3 0.9989818325394049 38.67371633878241 14977.0 323.2428861869643 0.0 - - - - - - - 158.9375 29 16 CAMK2A calcium/calmodulin-dependent protein kinase II alpha 1653 213 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23279.[MT7]-FTEEYQLFEELGK[MT7].3b4_1.heavy 640.999 / 651.311 25155.0 42.24674987792969 47 20 10 7 10 19.866861459312563 5.0335076934421945 0.02809906005859375 3 0.9989818325394049 38.67371633878241 25155.0 101.85625 0.0 - - - - - - - 210.22727272727272 50 22 CAMK2A calcium/calmodulin-dependent protein kinase II alpha 1655 213 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23279.[MT7]-FTEEYQLFEELGK[MT7].3b5_1.heavy 640.999 / 814.374 9079.0 42.24674987792969 47 20 10 7 10 19.866861459312563 5.0335076934421945 0.02809906005859375 3 0.9989818325394049 38.67371633878241 9079.0 54.034186851211075 0.0 - - - - - - - 159.6 18 25 CAMK2A calcium/calmodulin-dependent protein kinase II alpha 1657 213 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23279.[MT7]-FTEEYQLFEELGK[MT7].3b3_1.heavy 640.999 / 522.268 6766.0 42.24674987792969 47 20 10 7 10 19.866861459312563 5.0335076934421945 0.02809906005859375 3 0.9989818325394049 38.67371633878241 6766.0 46.365834289510246 0.0 - - - - - - - 211.0 13 20 CAMK2A calcium/calmodulin-dependent protein kinase II alpha 1659 214 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23276.[MT7]-YLIGAAPIAYGLPVSLR.2b3_1.heavy 959.568 / 534.341 13151.0 44.88100051879883 41 11 10 10 10 1.0876310705347132 61.06546820889365 0.0 3 0.8516214073871611 3.163402015560747 13151.0 50.873949647733156 0.0 - - - - - - - 224.85714285714286 26 14 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1661 214 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23276.[MT7]-YLIGAAPIAYGLPVSLR.2y5_1.heavy 959.568 / 571.356 5248.0 44.88100051879883 41 11 10 10 10 1.0876310705347132 61.06546820889365 0.0 3 0.8516214073871611 3.163402015560747 5248.0 44.65307801728855 0.0 - - - - - - - 165.8125 10 16 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1663 214 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23276.[MT7]-YLIGAAPIAYGLPVSLR.2b5_1.heavy 959.568 / 662.399 15929.0 44.88100051879883 41 11 10 10 10 1.0876310705347132 61.06546820889365 0.0 3 0.8516214073871611 3.163402015560747 15929.0 130.7757942797166 0.0 - - - - - - - 202.64285714285714 31 14 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1665 214 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23276.[MT7]-YLIGAAPIAYGLPVSLR.2y11_1.heavy 959.568 / 1185.7 14448.0 44.88100051879883 41 11 10 10 10 1.0876310705347132 61.06546820889365 0.0 3 0.8516214073871611 3.163402015560747 14448.0 189.06276282135795 0.0 - - - - - - - 132.07142857142858 28 14 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1667 215 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544616.[MT7]-AGAYDFPSPEWDTVTPEAK[MT7].3b6_1.heavy 790.39 / 769.364 7200.0 37.10939884185791 40 13 10 7 10 1.6388467965034583 48.543748681866084 0.027599334716796875 3 0.9201314666841831 4.337512055919995 7200.0 0.11259686014691056 1.0 - - - - - - - 723.125 14 8 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1669 215 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544616.[MT7]-AGAYDFPSPEWDTVTPEAK[MT7].3b5_1.heavy 790.39 / 622.295 7522.0 37.10939884185791 40 13 10 7 10 1.6388467965034583 48.543748681866084 0.027599334716796875 3 0.9201314666841831 4.337512055919995 7522.0 -0.5690790950488614 1.0 - - - - - - - 657.2222222222222 15 9 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1671 215 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544616.[MT7]-AGAYDFPSPEWDTVTPEAK[MT7].3y4_1.heavy 790.39 / 588.347 12858.0 37.10939884185791 40 13 10 7 10 1.6388467965034583 48.543748681866084 0.027599334716796875 3 0.9201314666841831 4.337512055919995 12858.0 9.210161470645907 1.0 - - - - - - - 692.8888888888889 25 9 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1673 215 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544616.[MT7]-AGAYDFPSPEWDTVTPEAK[MT7].3b8_1.heavy 790.39 / 953.448 3729.0 37.10939884185791 40 13 10 7 10 1.6388467965034583 48.543748681866084 0.027599334716796875 3 0.9201314666841831 4.337512055919995 3729.0 27.91919689119171 0.0 - - - - - - - 196.04761904761904 7 21 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1675 216 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23274.[MT7]-YLIGAAPIAYGLPVSLR.3y7_1.heavy 640.048 / 741.462 65215.0 44.88100051879883 46 16 10 10 10 4.449570713175508 22.47407816306697 0.0 3 0.9622279594983222 6.329954152917294 65215.0 209.48667578655767 0.0 - - - - - - - 222.83333333333334 130 12 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1677 216 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23274.[MT7]-YLIGAAPIAYGLPVSLR.3b6_1.heavy 640.048 / 733.437 121967.0 44.88100051879883 46 16 10 10 10 4.449570713175508 22.47407816306697 0.0 3 0.9622279594983222 6.329954152917294 121967.0 560.8686842006094 0.0 - - - - - - - 265.8181818181818 243 11 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1679 216 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23274.[MT7]-YLIGAAPIAYGLPVSLR.3b5_1.heavy 640.048 / 662.399 63348.0 44.88100051879883 46 16 10 10 10 4.449570713175508 22.47407816306697 0.0 3 0.9622279594983222 6.329954152917294 63348.0 441.23338393144763 0.0 - - - - - - - 233.33333333333334 126 12 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1681 216 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23274.[MT7]-YLIGAAPIAYGLPVSLR.3y5_1.heavy 640.048 / 571.356 112072.0 44.88100051879883 46 16 10 10 10 4.449570713175508 22.47407816306697 0.0 3 0.9622279594983222 6.329954152917294 112072.0 341.8191090884779 0.0 - - - - - - - 304.9 224 10 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1683 217 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542636.[MT7]-TLVPTIPR.2b3_1.heavy 520.833 / 458.31 22351.0 32.389400482177734 44 14 10 10 10 2.2707553813055448 44.03820896925769 0.0 3 0.9499886615598996 5.49542560019968 22351.0 42.27044907815592 0.0 - - - - - - - 812.0 44 7 ULK1 unc-51-like kinase 1 (C. elegans) 1685 217 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542636.[MT7]-TLVPTIPR.2y5_1.heavy 520.833 / 583.356 29384.0 32.389400482177734 44 14 10 10 10 2.2707553813055448 44.03820896925769 0.0 3 0.9499886615598996 5.49542560019968 29384.0 41.97430957410633 0.0 - - - - - - - 782.5 58 8 ULK1 unc-51-like kinase 1 (C. elegans) 1687 217 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542636.[MT7]-TLVPTIPR.2y6_1.heavy 520.833 / 682.425 5106.0 32.389400482177734 44 14 10 10 10 2.2707553813055448 44.03820896925769 0.0 3 0.9499886615598996 5.49542560019968 5106.0 6.896158665552078 1.0 - - - - - - - 426.57142857142856 11 7 ULK1 unc-51-like kinase 1 (C. elegans) 1689 217 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB542636.[MT7]-TLVPTIPR.2y7_1.heavy 520.833 / 795.509 8574.0 32.389400482177734 44 14 10 10 10 2.2707553813055448 44.03820896925769 0.0 3 0.9499886615598996 5.49542560019968 8574.0 16.499856545040746 0.0 - - - - - - - 417.5 17 6 ULK1 unc-51-like kinase 1 (C. elegans) 1691 218 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543365.[MT7]-FLDGQAVLR.2b3_1.heavy 581.839 / 520.289 16781.0 34.247100830078125 41 11 10 10 10 0.7799986157742915 65.72765757115782 0.0 3 0.8658190308908646 3.330708718745246 16781.0 34.72311289757725 0.0 - - - - - - - 742.7857142857143 33 14 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1693 218 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543365.[MT7]-FLDGQAVLR.2y6_1.heavy 581.839 / 643.389 16169.0 34.247100830078125 41 11 10 10 10 0.7799986157742915 65.72765757115782 0.0 3 0.8658190308908646 3.330708718745246 16169.0 5.357293963411 1.0 - - - - - - - 690.4 33 10 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1695 218 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543365.[MT7]-FLDGQAVLR.2b5_1.heavy 581.839 / 705.369 2360.0 34.247100830078125 41 11 10 10 10 0.7799986157742915 65.72765757115782 0.0 3 0.8658190308908646 3.330708718745246 2360.0 3.6678517997247875 0.0 - - - - - - - 661.4285714285714 4 7 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1697 218 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543365.[MT7]-FLDGQAVLR.2y7_1.heavy 581.839 / 758.416 6992.0 34.247100830078125 41 11 10 10 10 0.7799986157742915 65.72765757115782 0.0 3 0.8658190308908646 3.330708718745246 6992.0 12.044266513950284 0.0 - - - - - - - 254.27272727272728 13 11 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1699 219 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543766.[MT7]-NITAQLPTK[MT7].3y3_1.heavy 425.262 / 489.315 62821.0 27.29129981994629 50 20 10 10 10 11.374323352283488 8.791731771888143 0.0 3 0.9969997418826373 22.52549883229761 62821.0 249.27597037633032 0.0 - - - - - - - 292.6666666666667 125 12 ACVR1 activin A receptor, type I 1701 219 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543766.[MT7]-NITAQLPTK[MT7].3b4_1.heavy 425.262 / 544.321 16906.0 27.29129981994629 50 20 10 10 10 11.374323352283488 8.791731771888143 0.0 3 0.9969997418826373 22.52549883229761 16906.0 20.210565775726803 0.0 - - - - - - - 359.3333333333333 33 9 ACVR1 activin A receptor, type I 1703 219 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543766.[MT7]-NITAQLPTK[MT7].3b5_1.heavy 425.262 / 672.38 24759.0 27.29129981994629 50 20 10 10 10 11.374323352283488 8.791731771888143 0.0 3 0.9969997418826373 22.52549883229761 24759.0 79.80914913247969 0.0 - - - - - - - 241.69230769230768 49 13 ACVR1 activin A receptor, type I 1705 219 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543766.[MT7]-NITAQLPTK[MT7].3y4_1.heavy 425.262 / 602.399 3972.0 27.29129981994629 50 20 10 10 10 11.374323352283488 8.791731771888143 0.0 3 0.9969997418826373 22.52549883229761 3972.0 3.8637946137273897 1.0 - - - - - - - 254.16666666666666 8 12 ACVR1 activin A receptor, type I 1707 220 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38163.[MT7]-C[CAM]VVVGDGAVGK[MT7].2y8_1.heavy 674.878 / 846.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510206;RHOQ;RHOG;RHOJ;RAC1;RAC2;RAC3;CDC42 rho-related GTP-binding protein RhoQ-like;ras homolog gene family, member Q;ras homolog gene family, member G (rho G);ras homolog gene family, member J;ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3);cell division cycle 42 (GTP binding protein, 25kDa) 1709 220 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38163.[MT7]-C[CAM]VVVGDGAVGK[MT7].2y5_1.heavy 674.878 / 575.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510206;RHOQ;RHOG;RHOJ;RAC1;RAC2;RAC3;CDC42 rho-related GTP-binding protein RhoQ-like;ras homolog gene family, member Q;ras homolog gene family, member G (rho G);ras homolog gene family, member J;ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3);cell division cycle 42 (GTP binding protein, 25kDa) 1711 220 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38163.[MT7]-C[CAM]VVVGDGAVGK[MT7].2y9_1.heavy 674.878 / 945.549 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510206;RHOQ;RHOG;RHOJ;RAC1;RAC2;RAC3;CDC42 rho-related GTP-binding protein RhoQ-like;ras homolog gene family, member Q;ras homolog gene family, member G (rho G);ras homolog gene family, member J;ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3);cell division cycle 42 (GTP binding protein, 25kDa) 1713 220 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38163.[MT7]-C[CAM]VVVGDGAVGK[MT7].2y7_1.heavy 674.878 / 747.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510206;RHOQ;RHOG;RHOJ;RAC1;RAC2;RAC3;CDC42 rho-related GTP-binding protein RhoQ-like;ras homolog gene family, member Q;ras homolog gene family, member G (rho G);ras homolog gene family, member J;ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3);cell division cycle 42 (GTP binding protein, 25kDa) 1715 221 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22563.[MT7]-GAFSVVR.2y5_1.heavy 440.262 / 607.356 7017.0 27.79789924621582 43 13 10 10 10 1.2223460459279998 54.53992908861879 0.0 3 0.918482037161267 4.292797163814945 7017.0 27.72574174872305 0.0 - - - - - - - 263.92857142857144 14 14 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1717 221 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22563.[MT7]-GAFSVVR.2b4_1.heavy 440.262 / 507.268 12834.0 27.79789924621582 43 13 10 10 10 1.2223460459279998 54.53992908861879 0.0 3 0.918482037161267 4.292797163814945 12834.0 21.996098240866033 0.0 - - - - - - - 292.3333333333333 25 12 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1719 221 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22563.[MT7]-GAFSVVR.2y6_1.heavy 440.262 / 678.393 14127.0 27.79789924621582 43 13 10 10 10 1.2223460459279998 54.53992908861879 0.0 3 0.918482037161267 4.292797163814945 14127.0 31.875 0.0 - - - - - - - 193.0909090909091 28 11 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1721 221 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22563.[MT7]-GAFSVVR.2b5_1.heavy 440.262 / 606.337 15696.0 27.79789924621582 43 13 10 10 10 1.2223460459279998 54.53992908861879 0.0 3 0.918482037161267 4.292797163814945 15696.0 23.86677211456768 0.0 - - - - - - - 312.53846153846155 31 13 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1723 222 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22565.[MT7]-FDALK[MT7].2b3_1.heavy 441.27 / 478.242 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4E2 eukaryotic translation initiation factor 4E family member 2 1725 222 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22565.[MT7]-FDALK[MT7].2y4_1.heavy 441.27 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4E2 eukaryotic translation initiation factor 4E family member 2 1727 222 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22565.[MT7]-FDALK[MT7].2b4_1.heavy 441.27 / 591.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4E2 eukaryotic translation initiation factor 4E family member 2 1729 222 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22565.[MT7]-FDALK[MT7].2y3_1.heavy 441.27 / 475.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4E2 eukaryotic translation initiation factor 4E family member 2 1731 223 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23407.[MT7]-GAIQLGITHTVGSLSTK[MT7]PER.4y9_1.heavy 589.091 / 1118.63 2792.0 32.09444999694824 44 18 10 6 10 13.676917872217345 7.311588834143352 0.036502838134765625 3 0.9828080747959238 9.398876570144168 2792.0 42.10302245250432 0.0 - - - - - - - 151.28571428571428 5 7 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1733 223 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23407.[MT7]-GAIQLGITHTVGSLSTK[MT7]PER.4b4_1.heavy 589.091 / 514.311 11844.0 32.09444999694824 44 18 10 6 10 13.676917872217345 7.311588834143352 0.036502838134765625 3 0.9828080747959238 9.398876570144168 11844.0 29.82422774457376 0.0 - - - - - - - 323.2142857142857 23 14 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1735 223 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23407.[MT7]-GAIQLGITHTVGSLSTK[MT7]PER.4b5_1.heavy 589.091 / 627.395 3466.0 32.09444999694824 44 18 10 6 10 13.676917872217345 7.311588834143352 0.036502838134765625 3 0.9828080747959238 9.398876570144168 3466.0 16.197638857915674 0.0 - - - - - - - 246.0 6 18 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1737 223 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23407.[MT7]-GAIQLGITHTVGSLSTK[MT7]PER.4b6_1.heavy 589.091 / 684.416 7992.0 32.09444999694824 44 18 10 6 10 13.676917872217345 7.311588834143352 0.036502838134765625 3 0.9828080747959238 9.398876570144168 7992.0 19.934145854145854 0.0 - - - - - - - 260.5882352941176 15 17 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1739 224 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23409.[MT7]-AVAWC[CAM]PWQSNVLATGGGTSDR.3b5_1.heavy 793.054 / 732.362 17126.0 38.51812553405762 46 20 10 6 10 9.34030988530793 10.7062828993819 0.03749847412109375 3 0.99745613325858 24.463752960018063 17126.0 38.44045819521179 0.0 - - - - - - - 679.0 34 8 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1741 224 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23409.[MT7]-AVAWC[CAM]PWQSNVLATGGGTSDR.3y8_1.heavy 793.054 / 750.338 9586.0 38.51812553405762 46 20 10 6 10 9.34030988530793 10.7062828993819 0.03749847412109375 3 0.99745613325858 24.463752960018063 9586.0 25.183913493146978 0.0 - - - - - - - 754.2 19 10 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1743 224 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23409.[MT7]-AVAWC[CAM]PWQSNVLATGGGTSDR.3y10_1.heavy 793.054 / 934.459 11503.0 38.51812553405762 46 20 10 6 10 9.34030988530793 10.7062828993819 0.03749847412109375 3 0.99745613325858 24.463752960018063 11503.0 32.586104279952316 0.0 - - - - - - - 215.0 23 11 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1745 224 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23409.[MT7]-AVAWC[CAM]PWQSNVLATGGGTSDR.3y9_1.heavy 793.054 / 821.375 9586.0 38.51812553405762 46 20 10 6 10 9.34030988530793 10.7062828993819 0.03749847412109375 3 0.99745613325858 24.463752960018063 9586.0 29.555691909913588 0.0 - - - - - - - 623.0 19 8 CDC20 cell division cycle 20 homolog (S. cerevisiae) 1747 225 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544141.[MT7]-TILSRYEGK[MT7].3y7_1.heavy 452.269 / 996.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1749 225 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544141.[MT7]-TILSRYEGK[MT7].3y3_1.heavy 452.269 / 477.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1751 225 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544141.[MT7]-TILSRYEGK[MT7].3y4_1.heavy 452.269 / 640.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1753 225 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544141.[MT7]-TILSRYEGK[MT7].3y8_2.heavy 452.269 / 555.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence 1755 226 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541564.[MT7]-LISLK[MT7].2b3_1.heavy 431.304 / 458.31 N/A 32.389400482177734 50 20 10 10 10 9.685719760046148 10.324477940452363 0.0 3 0.9900085047078414 12.336298154342167 373.0 0.4655376241405652 29.0 - - - - - - - 580.6666666666666 30 9 PDPR;PTPN5;DZIP3 pyruvate dehydrogenase phosphatase regulatory subunit;protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched);DAZ interacting protein 3, zinc finger 1757 226 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541564.[MT7]-LISLK[MT7].2y4_1.heavy 431.304 / 604.415 55810.0 32.389400482177734 50 20 10 10 10 9.685719760046148 10.324477940452363 0.0 3 0.9900085047078414 12.336298154342167 55810.0 118.31474517116084 0.0 - - - - - - - 373.42857142857144 111 7 PDPR;PTPN5;DZIP3 pyruvate dehydrogenase phosphatase regulatory subunit;protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched);DAZ interacting protein 3, zinc finger 1759 226 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541564.[MT7]-LISLK[MT7].2y3_2.heavy 431.304 / 246.169 7466.0 32.389400482177734 50 20 10 10 10 9.685719760046148 10.324477940452363 0.0 3 0.9900085047078414 12.336298154342167 7466.0 12.394787913558998 0.0 - - - - - - - 692.1666666666666 14 12 PDPR;PTPN5;DZIP3 pyruvate dehydrogenase phosphatase regulatory subunit;protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched);DAZ interacting protein 3, zinc finger 1761 226 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541564.[MT7]-LISLK[MT7].2y3_1.heavy 431.304 / 491.331 56836.0 32.389400482177734 50 20 10 10 10 9.685719760046148 10.324477940452363 0.0 3 0.9900085047078414 12.336298154342167 56836.0 227.14101428571428 0.0 - - - - - - - 338.375 113 8 PDPR;PTPN5;DZIP3 pyruvate dehydrogenase phosphatase regulatory subunit;protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched);DAZ interacting protein 3, zinc finger 1763 227 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22707.[MT7]-GAFSVVRR.2b4_1.heavy 518.313 / 507.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1765 227 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22707.[MT7]-GAFSVVRR.2b6_1.heavy 518.313 / 705.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1767 227 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22707.[MT7]-GAFSVVRR.2b7_1.heavy 518.313 / 861.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1769 227 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22707.[MT7]-GAFSVVRR.2b5_1.heavy 518.313 / 606.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 1771 228 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22903.[MT7]-EAFSLFDK[MT7].3y3_1.heavy 415.564 / 553.31 46642.0 37.41680145263672 48 18 10 10 10 3.7760902594565025 21.084797175053403 0.0 3 0.9895777347865301 12.078232697559608 46642.0 564.6634983766234 0.0 - - - - - - - 239.46666666666667 93 15 CALM1;CALM2;CALM3;CALML3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 1773 228 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22903.[MT7]-EAFSLFDK[MT7].3b4_1.heavy 415.564 / 579.289 37403.0 37.41680145263672 48 18 10 10 10 3.7760902594565025 21.084797175053403 0.0 3 0.9895777347865301 12.078232697559608 37403.0 389.6145833333333 0.0 - - - - - - - 128.05555555555554 74 18 CALM1;CALM2;CALM3;CALML3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 1775 228 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22903.[MT7]-EAFSLFDK[MT7].3b5_1.heavy 415.564 / 692.374 5646.0 37.41680145263672 48 18 10 10 10 3.7760902594565025 21.084797175053403 0.0 3 0.9895777347865301 12.078232697559608 5646.0 163.2046875 0.0 - - - - - - - 80.0 11 4 CALM1;CALM2;CALM3;CALML3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 1777 228 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22903.[MT7]-EAFSLFDK[MT7].3b3_1.heavy 415.564 / 492.258 28036.0 37.41680145263672 48 18 10 10 10 3.7760902594565025 21.084797175053403 0.0 3 0.9895777347865301 12.078232697559608 28036.0 233.98781597995546 0.0 - - - - - - - 196.3125 56 16 CALM1;CALM2;CALM3;CALML3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 1779 229 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22902.[MT7]-EAFSLFDK[MT7].2y5_1.heavy 622.842 / 753.426 6287.0 37.43255043029785 42 16 10 6 10 3.8946748638388504 25.67608426790044 0.031497955322265625 3 0.9698678419426503 7.09170493137095 6287.0 15.461477618145203 0.0 - - - - - - - 275.85 12 20 CALM1;CALM2;CALM3;CALML3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 1781 229 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22902.[MT7]-EAFSLFDK[MT7].2y3_1.heavy 622.842 / 553.31 6929.0 37.43255043029785 42 16 10 6 10 3.8946748638388504 25.67608426790044 0.031497955322265625 3 0.9698678419426503 7.09170493137095 6929.0 13.805286637106395 0.0 - - - - - - - 623.1428571428571 13 7 CALM1;CALM2;CALM3;CALML3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 1783 229 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22902.[MT7]-EAFSLFDK[MT7].2b7_1.heavy 622.842 / 954.469 6159.0 37.43255043029785 42 16 10 6 10 3.8946748638388504 25.67608426790044 0.031497955322265625 3 0.9698678419426503 7.09170493137095 6159.0 58.655001460280374 0.0 - - - - - - - 169.58823529411765 12 17 CALM1;CALM2;CALM3;CALML3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 1785 229 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22902.[MT7]-EAFSLFDK[MT7].2y7_1.heavy 622.842 / 971.532 5197.0 37.43255043029785 42 16 10 6 10 3.8946748638388504 25.67608426790044 0.031497955322265625 3 0.9698678419426503 7.09170493137095 5197.0 15.266946971116154 0.0 - - - - - - - 181.66666666666666 10 18 CALM1;CALM2;CALM3;CALML3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 1787 230 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543276.[MT7]-SVLGC[CAM]WK[MT7].2y4_1.heavy 569.32 / 694.346 5374.0 32.679500579833984 39 14 10 5 10 3.5460305692338534 28.200546511815816 0.040802001953125 3 0.9411364638465064 5.061572746081512 5374.0 13.754880952380953 0.0 - - - - - - - 258.46153846153845 10 13 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1789 230 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543276.[MT7]-SVLGC[CAM]WK[MT7].2y5_1.heavy 569.32 / 807.43 3359.0 32.679500579833984 39 14 10 5 10 3.5460305692338534 28.200546511815816 0.040802001953125 3 0.9411364638465064 5.061572746081512 3359.0 22.0434375 0.0 - - - - - - - 219.42857142857142 6 14 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1791 230 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543276.[MT7]-SVLGC[CAM]WK[MT7].2y3_1.heavy 569.32 / 637.325 1439.0 32.679500579833984 39 14 10 5 10 3.5460305692338534 28.200546511815816 0.040802001953125 3 0.9411364638465064 5.061572746081512 1439.0 1.760681216931217 2.0 - - - - - - - 768.0 4 7 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1793 230 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543276.[MT7]-SVLGC[CAM]WK[MT7].2y6_1.heavy 569.32 / 906.499 2111.0 32.679500579833984 39 14 10 5 10 3.5460305692338534 28.200546511815816 0.040802001953125 3 0.9411364638465064 5.061572746081512 2111.0 10.293219246031745 0.0 - - - - - - - 184.6153846153846 4 13 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1795 231 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22657.[MT7]-TTSSALK[MT7].2y4_1.heavy 498.302 / 562.368 N/A 17.932199478149414 47 17 10 10 10 2.56168701680721 39.036775118857506 0.0 3 0.9708664905836665 7.212833618694808 2065.0 1.7046254691970262 3.0 - - - - - - - 780.875 7 8 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1797 231 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22657.[MT7]-TTSSALK[MT7].2y5_1.heavy 498.302 / 649.4 3224.0 17.932199478149414 47 17 10 10 10 2.56168701680721 39.036775118857506 0.0 3 0.9708664905836665 7.212833618694808 3224.0 12.952734367671614 0.0 - - - - - - - 220.96153846153845 6 26 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1799 231 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22657.[MT7]-TTSSALK[MT7].2y6_1.heavy 498.302 / 750.448 5894.0 17.932199478149414 47 17 10 10 10 2.56168701680721 39.036775118857506 0.0 3 0.9708664905836665 7.212833618694808 5894.0 24.87804003089412 0.0 - - - - - - - 207.05555555555554 11 18 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1801 231 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22657.[MT7]-TTSSALK[MT7].2b5_1.heavy 498.302 / 592.306 3073.0 17.932199478149414 47 17 10 10 10 2.56168701680721 39.036775118857506 0.0 3 0.9708664905836665 7.212833618694808 3073.0 13.185306166920897 0.0 - - - - - - - 274.65 6 20 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1803 232 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22849.[MT7]-FVDAYFK[MT7].2y4_1.heavy 589.328 / 672.384 11736.0 35.29702663421631 44 18 10 6 10 5.5496832692858105 18.019046339714627 0.033100128173828125 3 0.9862831320750728 10.525366038017733 11736.0 26.72606809588389 0.0 - - - - - - - 666.6363636363636 23 11 ACSS1 acyl-CoA synthetase short-chain family member 1 1805 232 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22849.[MT7]-FVDAYFK[MT7].2b3_1.heavy 589.328 / 506.273 14052.0 35.29702663421631 44 18 10 6 10 5.5496832692858105 18.019046339714627 0.033100128173828125 3 0.9862831320750728 10.525366038017733 14052.0 48.71125945302413 0.0 - - - - - - - 741.3 28 10 ACSS1 acyl-CoA synthetase short-chain family member 1 1807 232 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22849.[MT7]-FVDAYFK[MT7].2y3_1.heavy 589.328 / 601.347 5096.0 35.29702663421631 44 18 10 6 10 5.5496832692858105 18.019046339714627 0.033100128173828125 3 0.9862831320750728 10.525366038017733 5096.0 7.137042029534268 0.0 - - - - - - - 287.44444444444446 10 18 ACSS1 acyl-CoA synthetase short-chain family member 1 1809 232 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22849.[MT7]-FVDAYFK[MT7].2y6_1.heavy 589.328 / 886.479 5868.0 35.29702663421631 44 18 10 6 10 5.5496832692858105 18.019046339714627 0.033100128173828125 3 0.9862831320750728 10.525366038017733 5868.0 16.220578565113755 0.0 - - - - - - - 197.16666666666666 11 18 ACSS1 acyl-CoA synthetase short-chain family member 1 1811 233 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22653.[MT7]-SELVQK[MT7].2y4_1.heavy 496.305 / 631.426 4998.0 20.706199645996094 48 18 10 10 10 4.279361587783699 23.367971588442114 0.0 3 0.9880444597135523 11.275716009770635 4998.0 17.784507844129557 0.0 - - - - - - - 252.64 9 25 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 1813 233 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22653.[MT7]-SELVQK[MT7].2y5_1.heavy 496.305 / 760.469 4175.0 20.706199645996094 48 18 10 10 10 4.279361587783699 23.367971588442114 0.0 3 0.9880444597135523 11.275716009770635 4175.0 12.143913312146893 0.0 - - - - - - - 170.35 8 20 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 1815 233 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22653.[MT7]-SELVQK[MT7].2b4_1.heavy 496.305 / 573.336 4889.0 20.706199645996094 48 18 10 10 10 4.279361587783699 23.367971588442114 0.0 3 0.9880444597135523 11.275716009770635 4889.0 20.85698615291993 0.0 - - - - - - - 284.17391304347825 9 23 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 1817 233 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22653.[MT7]-SELVQK[MT7].2y3_1.heavy 496.305 / 518.342 7360.0 20.706199645996094 48 18 10 10 10 4.279361587783699 23.367971588442114 0.0 3 0.9880444597135523 11.275716009770635 7360.0 41.483636363636364 0.0 - - - - - - - 265.2173913043478 14 23 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 1819 234 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544443.[MT7]-YLSEVASGDNK[MT7].3b4_1.heavy 490.927 / 637.331 66386.0 27.87700080871582 47 17 10 10 10 3.730831584021635 26.803675734996702 0.0 3 0.9763288052211676 8.005562434677508 66386.0 73.75556498194946 0.0 - - - - - - - 1253.142857142857 132 7 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 1821 234 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544443.[MT7]-YLSEVASGDNK[MT7].3b5_1.heavy 490.927 / 736.4 26868.0 27.87700080871582 47 17 10 10 10 3.730831584021635 26.803675734996702 0.0 3 0.9763288052211676 8.005562434677508 26868.0 59.47154822241379 0.0 - - - - - - - 769.3333333333334 53 9 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 1823 234 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544443.[MT7]-YLSEVASGDNK[MT7].3y4_1.heavy 490.927 / 577.306 35824.0 27.87700080871582 47 17 10 10 10 3.730831584021635 26.803675734996702 0.0 3 0.9763288052211676 8.005562434677508 35824.0 28.35527797833935 0.0 - - - - - - - 1226.5714285714287 71 7 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 1825 234 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544443.[MT7]-YLSEVASGDNK[MT7].3y5_1.heavy 490.927 / 664.338 33055.0 27.87700080871582 47 17 10 10 10 3.730831584021635 26.803675734996702 0.0 3 0.9763288052211676 8.005562434677508 33055.0 57.85601929138895 0.0 - - - - - - - 784.75 66 8 YWHAB tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide 1827 235 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38310.[MT7]-TPFLLVGTQIDLR.3y7_1.heavy 539.655 / 802.442 23319.0 43.96329879760742 36 18 0 10 8 9.63696211002752 10.37671403687966 0.0 4 0.9891462395078885 11.83528330283532 23319.0 277.88474999999994 0.0 - - - - - - - 138.46153846153845 46 13 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 1829 235 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38310.[MT7]-TPFLLVGTQIDLR.3y6_1.heavy 539.655 / 745.42 5335.0 43.96329879760742 36 18 0 10 8 9.63696211002752 10.37671403687966 0.0 4 0.9891462395078885 11.83528330283532 5335.0 59.4319 1.0 - - - - - - - 156.66666666666666 10 18 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 1831 235 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38310.[MT7]-TPFLLVGTQIDLR.3b4_1.heavy 539.655 / 603.362 34889.0 43.96329879760742 36 18 0 10 8 9.63696211002752 10.37671403687966 0.0 4 0.9891462395078885 11.83528330283532 34889.0 177.96158968253968 0.0 - - - - - - - 222.85714285714286 69 14 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 1833 235 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38310.[MT7]-TPFLLVGTQIDLR.3y5_1.heavy 539.655 / 644.373 6654.0 43.96329879760742 36 18 0 10 8 9.63696211002752 10.37671403687966 0.0 4 0.9891462395078885 11.83528330283532 6654.0 31.722095443128815 3.0 - - - - - - - 228.75 1212 16 CDC42 cell division cycle 42 (GTP binding protein, 25kDa) 1835 236 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544873.[MT7]-YLIGAAPIAYGLPVSLR.4y5_1.heavy 480.288 / 571.356 21437.0 44.881025314331055 34 11 10 3 10 0.8153241080658338 74.47093205708727 0.07250213623046875 3 0.8511092062099826 3.157813479425532 21437.0 341.88878405650854 0.0 - - - - - - - 217.0 42 10 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1837 236 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544873.[MT7]-YLIGAAPIAYGLPVSLR.4b5_1.heavy 480.288 / 662.399 10099.0 44.881025314331055 34 11 10 3 10 0.8153241080658338 74.47093205708727 0.07250213623046875 3 0.8511092062099826 3.157813479425532 10099.0 94.47451612903225 0.0 - - - - - - - 221.42857142857142 20 7 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1839 236 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544873.[MT7]-YLIGAAPIAYGLPVSLR.4b3_1.heavy 480.288 / 534.341 2664.0 44.881025314331055 34 11 10 3 10 0.8153241080658338 74.47093205708727 0.07250213623046875 3 0.8511092062099826 3.157813479425532 2664.0 38.670967741935485 1.0 - - - - - - - 119.57142857142857 5 14 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1841 236 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544873.[MT7]-YLIGAAPIAYGLPVSLR.4b6_1.heavy 480.288 / 733.437 4957.0 44.881025314331055 34 11 10 3 10 0.8153241080658338 74.47093205708727 0.07250213623046875 3 0.8511092062099826 3.157813479425532 4957.0 53.96733870967742 0.0 - - - - - - - 196.33333333333334 9 6 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1843 237 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37894.[MT7]-FLISYDR.2b3_1.heavy 529.294 / 518.346 24393.0 34.58300018310547 40 14 10 6 10 2.2675528855677967 39.092211574480146 0.03600311279296875 3 0.934368017802652 4.79071350004073 24393.0 26.222141215106735 0.0 - - - - - - - 1230.0 48 9 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 1845 237 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37894.[MT7]-FLISYDR.2y4_1.heavy 529.294 / 540.241 38435.0 34.58300018310547 40 14 10 6 10 2.2675528855677967 39.092211574480146 0.03600311279296875 3 0.934368017802652 4.79071350004073 38435.0 62.19420194003527 0.0 - - - - - - - 1220.0 76 9 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 1847 237 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37894.[MT7]-FLISYDR.2y5_1.heavy 529.294 / 653.325 40685.0 34.58300018310547 40 14 10 6 10 2.2675528855677967 39.092211574480146 0.03600311279296875 3 0.934368017802652 4.79071350004073 40685.0 65.75353535353536 0.0 - - - - - - - 1170.0 81 7 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 1849 237 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37894.[MT7]-FLISYDR.2y6_1.heavy 529.294 / 766.409 61478.0 34.58300018310547 40 14 10 6 10 2.2675528855677967 39.092211574480146 0.03600311279296875 3 0.934368017802652 4.79071350004073 61478.0 215.7318909090909 0.0 - - - - - - - 280.0 122 9 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 1851 238 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 201016.0 42.195098876953125 22 -3 10 7 8 null 0.0 0.0281982421875 4 0.0 0.0 201016.0 405.0440026851534 0.0 - - - - - - - 291.94444444444446 402 18 1853 238 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 379703.0 42.195098876953125 22 -3 10 7 8 null 0.0 0.0281982421875 4 0.0 0.0 379703.0 420.0801574227411 0.0 - - - - - - - 621.0 759 8 1855 238 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 247386.0 42.195098876953125 22 -3 10 7 8 null 0.0 0.0281982421875 4 0.0 0.0 247386.0 326.5364113796563 1.0 - - - - - - - 279.3333333333333 495 18 1857 239 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22910.[MT7]-DYLEEYK[MT7].2y4_1.heavy 624.324 / 712.363 2155.0 30.12459945678711 44 20 10 6 8 7.425282260948836 13.467501501716857 0.03639984130859375 4 0.9928162891918646 14.55216529407141 2155.0 8.579185521533379 0.0 - - - - - - - 239.58333333333334 4 12 SOCS2 suppressor of cytokine signaling 2 1859 239 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22910.[MT7]-DYLEEYK[MT7].2y5_1.heavy 624.324 / 825.447 1437.0 30.12459945678711 44 20 10 6 8 7.425282260948836 13.467501501716857 0.03639984130859375 4 0.9928162891918646 14.55216529407141 1437.0 3.8026462395543175 1.0 - - - - - - - 211.71428571428572 2 14 SOCS2 suppressor of cytokine signaling 2 1861 239 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22910.[MT7]-DYLEEYK[MT7].2b4_1.heavy 624.324 / 665.326 898.0 30.12459945678711 44 20 10 6 8 7.425282260948836 13.467501501716857 0.03639984130859375 4 0.9928162891918646 14.55216529407141 898.0 2.001114206128134 5.0 - - - - - - - 0.0 1 0 SOCS2 suppressor of cytokine signaling 2 1863 239 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22910.[MT7]-DYLEEYK[MT7].2y3_1.heavy 624.324 / 583.321 1706.0 30.12459945678711 44 20 10 6 8 7.425282260948836 13.467501501716857 0.03639984130859375 4 0.9928162891918646 14.55216529407141 1706.0 2.3488199078789354 2.0 - - - - - - - 693.9090909090909 4 11 SOCS2 suppressor of cytokine signaling 2 1865 240 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544778.[MT7]-LLVPANEGDPTETLR.3y6_1.heavy 590.324 / 716.394 65220.0 33.818599700927734 50 20 10 10 10 18.87967902518291 5.296700217552093 0.0 3 0.9997938607841488 85.95568372482028 65220.0 167.88946909592227 0.0 - - - - - - - 688.8571428571429 130 7 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1867 240 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544778.[MT7]-LLVPANEGDPTETLR.3y4_1.heavy 590.324 / 518.293 10432.0 33.818599700927734 50 20 10 10 10 18.87967902518291 5.296700217552093 0.0 3 0.9997938607841488 85.95568372482028 10432.0 19.719149092800418 0.0 - - - - - - - 818.2222222222222 20 9 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1869 240 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544778.[MT7]-LLVPANEGDPTETLR.3y8_1.heavy 590.324 / 888.442 10169.0 33.818599700927734 50 20 10 10 10 18.87967902518291 5.296700217552093 0.0 3 0.9997938607841488 85.95568372482028 10169.0 67.66444866920152 0.0 - - - - - - - 168.16666666666666 20 12 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1871 240 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544778.[MT7]-LLVPANEGDPTETLR.3y5_1.heavy 590.324 / 619.341 15954.0 33.818599700927734 50 20 10 10 10 18.87967902518291 5.296700217552093 0.0 3 0.9997938607841488 85.95568372482028 15954.0 36.64741237466451 0.0 - - - - - - - 663.8571428571429 31 7 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 1873 241 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38413.[MT7]-EGIEYILLNFSFK[MT7].2y4_1.heavy 931.021 / 672.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1875 241 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38413.[MT7]-EGIEYILLNFSFK[MT7].2b4_1.heavy 931.021 / 573.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1877 241 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38413.[MT7]-EGIEYILLNFSFK[MT7].2b5_1.heavy 931.021 / 736.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1879 241 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38413.[MT7]-EGIEYILLNFSFK[MT7].2y7_1.heavy 931.021 / 1012.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 1881 242 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22648.[MT7]-INQFYGAPTAVR.3y7_1.heavy 494.272 / 671.383 43492.0 31.321399688720703 47 17 10 10 10 3.52632365527031 22.276977521488583 0.0 3 0.9717269806153912 7.322302963748424 43492.0 48.503136704354574 0.0 - - - - - - - 309.42857142857144 86 7 ACSS1 acyl-CoA synthetase short-chain family member 1 1883 242 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22648.[MT7]-INQFYGAPTAVR.3b4_1.heavy 494.272 / 647.363 41986.0 31.321399688720703 47 17 10 10 10 3.52632365527031 22.276977521488583 0.0 3 0.9717269806153912 7.322302963748424 41986.0 51.3679185876428 0.0 - - - - - - - 706.0 83 8 ACSS1 acyl-CoA synthetase short-chain family member 1 1885 242 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22648.[MT7]-INQFYGAPTAVR.3b3_1.heavy 494.272 / 500.295 70980.0 31.321399688720703 47 17 10 10 10 3.52632365527031 22.276977521488583 0.0 3 0.9717269806153912 7.322302963748424 70980.0 97.16901931689051 0.0 - - - - - - - 784.3333333333334 141 9 ACSS1 acyl-CoA synthetase short-chain family member 1 1887 242 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22648.[MT7]-INQFYGAPTAVR.3y5_1.heavy 494.272 / 543.325 86230.0 31.321399688720703 47 17 10 10 10 3.52632365527031 22.276977521488583 0.0 3 0.9717269806153912 7.322302963748424 86230.0 57.58986341749481 0.0 - - - - - - - 376.5 172 2 ACSS1 acyl-CoA synthetase short-chain family member 1 1889 243 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB545012.[MT7]-AADTDGDGQVNYEEFVR.3y7_1.heavy 677.312 / 956.447 7200.0 32.41144943237305 43 18 10 5 10 28.08474461104531 3.5606519263369587 0.044097900390625 3 0.9886573310863698 11.576929293756143 7200.0 34.832142857142856 0.0 - - - - - - - 278.4 14 10 CALML3 calmodulin-like 3 1891 243 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB545012.[MT7]-AADTDGDGQVNYEEFVR.3y6_1.heavy 677.312 / 842.404 3456.0 32.41144943237305 43 18 10 5 10 28.08474461104531 3.5606519263369587 0.044097900390625 3 0.9886573310863698 11.576929293756143 3456.0 20.674285714285716 0.0 - - - - - - - 218.1818181818182 6 11 CALML3 calmodulin-like 3 1893 243 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB545012.[MT7]-AADTDGDGQVNYEEFVR.3b5_1.heavy 677.312 / 618.285 2976.0 32.41144943237305 43 18 10 5 10 28.08474461104531 3.5606519263369587 0.044097900390625 3 0.9886573310863698 11.576929293756143 2976.0 16.43 0.0 - - - - - - - 295.38461538461536 5 13 CALML3 calmodulin-like 3 1895 243 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB545012.[MT7]-AADTDGDGQVNYEEFVR.3b7_1.heavy 677.312 / 790.333 4320.0 32.41144943237305 43 18 10 5 10 28.08474461104531 3.5606519263369587 0.044097900390625 3 0.9886573310863698 11.576929293756143 4320.0 15.9 0.0 - - - - - - - 226.9090909090909 8 11 CALML3 calmodulin-like 3 1897 244 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22918.[MT7]-VYIGEEEK[MT7].2y5_1.heavy 627.845 / 735.364 8460.0 26.114299774169922 48 18 10 10 10 4.155723669441003 24.063197641206795 0.0 3 0.9836502693880007 9.638591420179807 8460.0 57.53850931677019 0.0 - - - - - - - 276.0 16 9 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 1899 244 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22918.[MT7]-VYIGEEEK[MT7].2y3_1.heavy 627.845 / 549.3 1747.0 26.114299774169922 48 18 10 10 10 4.155723669441003 24.063197641206795 0.0 3 0.9836502693880007 9.638591420179807 1747.0 0.8850931677018634 2.0 - - - - - - - 222.33333333333334 3 12 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 1901 244 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22918.[MT7]-VYIGEEEK[MT7].2y6_1.heavy 627.845 / 848.448 4138.0 26.114299774169922 48 18 10 10 10 4.155723669441003 24.063197641206795 0.0 3 0.9836502693880007 9.638591420179807 4138.0 36.70975724637681 0.0 - - - - - - - 176.33333333333334 8 12 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 1903 244 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22918.[MT7]-VYIGEEEK[MT7].2y7_1.heavy 627.845 / 1011.51 7724.0 26.114299774169922 48 18 10 10 10 4.155723669441003 24.063197641206795 0.0 3 0.9836502693880007 9.638591420179807 7724.0 157.8382608695652 0.0 - - - - - - - 126.5 15 8 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 1905 245 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB545150.[MT7]-QSSAPASPAASAAGLAGQAAK[MT7].4y5_1.heavy 525.788 / 618.369 11537.0 27.23264980316162 44 18 10 6 10 4.1468428303900575 20.19295178648472 0.03909873962402344 3 0.9892761079477439 11.906860815970546 11537.0 39.316470189701896 0.0 - - - - - - - 276.85714285714283 23 7 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1907 245 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB545150.[MT7]-QSSAPASPAASAAGLAGQAAK[MT7].4b7_1.heavy 525.788 / 773.391 8861.0 27.23264980316162 44 18 10 6 10 4.1468428303900575 20.19295178648472 0.03909873962402344 3 0.9892761079477439 11.906860815970546 8861.0 60.24234373692578 0.0 - - - - - - - 266.44444444444446 17 9 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1909 245 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB545150.[MT7]-QSSAPASPAASAAGLAGQAAK[MT7].4b4_1.heavy 525.788 / 518.269 17260.0 27.23264980316162 44 18 10 6 10 4.1468428303900575 20.19295178648472 0.03909873962402344 3 0.9892761079477439 11.906860815970546 17260.0 34.72198977135981 0.0 - - - - - - - 1186.857142857143 34 7 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1911 245 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB545150.[MT7]-QSSAPASPAASAAGLAGQAAK[MT7].4b6_1.heavy 525.788 / 686.359 7661.0 27.23264980316162 44 18 10 6 10 4.1468428303900575 20.19295178648472 0.03909873962402344 3 0.9892761079477439 11.906860815970546 7661.0 10.539235790931865 1.0 - - - - - - - 295.4 21 5 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 1913 246 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38084.[MT7]-RITAAEALK[MT7].2y8_1.heavy 630.898 / 960.585 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A calcium/calmodulin-dependent protein kinase II alpha 1915 246 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38084.[MT7]-RITAAEALK[MT7].2b4_1.heavy 630.898 / 586.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A calcium/calmodulin-dependent protein kinase II alpha 1917 246 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38084.[MT7]-RITAAEALK[MT7].2b6_1.heavy 630.898 / 786.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A calcium/calmodulin-dependent protein kinase II alpha 1919 246 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38084.[MT7]-RITAAEALK[MT7].2b7_1.heavy 630.898 / 857.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A calcium/calmodulin-dependent protein kinase II alpha 1921 247 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38180.[MT7]-DVEFLVQLK[MT7].2y4_1.heavy 689.913 / 631.426 1155.0 39.580501556396484 46 16 10 10 10 2.3787581425290854 35.31682708371861 0.0 3 0.9653700846275921 6.612646739025232 1155.0 8.832849007009345 1.0 - - - - - - - 196.0 2 17 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 1923 247 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38180.[MT7]-DVEFLVQLK[MT7].2b4_1.heavy 689.913 / 635.316 2823.0 39.580501556396484 46 16 10 10 10 2.3787581425290854 35.31682708371861 0.0 3 0.9653700846275921 6.612646739025232 2823.0 16.314211260648392 1.0 - - - - - - - 266.63157894736844 5 19 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 1925 247 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38180.[MT7]-DVEFLVQLK[MT7].2y6_1.heavy 689.913 / 891.578 1026.0 39.580501556396484 46 16 10 10 10 2.3787581425290854 35.31682708371861 0.0 3 0.9653700846275921 6.612646739025232 1026.0 11.19515625 0.0 - - - - - - - 162.6153846153846 2 13 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 1927 247 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38180.[MT7]-DVEFLVQLK[MT7].2b5_1.heavy 689.913 / 748.4 1411.0 39.580501556396484 46 16 10 10 10 2.3787581425290854 35.31682708371861 0.0 3 0.9653700846275921 6.612646739025232 1411.0 4.398636490215438 0.0 - - - - - - - 179.45 2 20 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 1929 248 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22858.[MT7]-RTC[CAM]GQGITR.2y8_1.heavy 596.82 / 892.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNA1 cyclin A1 1931 248 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22858.[MT7]-RTC[CAM]GQGITR.2b4_1.heavy 596.82 / 619.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNA1 cyclin A1 1933 248 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22858.[MT7]-RTC[CAM]GQGITR.2b6_1.heavy 596.82 / 804.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNA1 cyclin A1 1935 248 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22858.[MT7]-RTC[CAM]GQGITR.2b5_1.heavy 596.82 / 747.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNA1 cyclin A1 1937 249 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22641.[MT7]-RIHSYR.2y4_1.heavy 488.284 / 562.273 1033.0 14.563874959945679 43 17 10 6 10 2.996503762041481 33.372225747472854 0.03670024871826172 3 0.9714464722220131 7.286075113622891 1033.0 10.276343092282787 1.0 - - - - - - - 168.55 2 20 VHL von Hippel-Lindau tumor suppressor 1939 249 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22641.[MT7]-RIHSYR.2y5_1.heavy 488.284 / 675.357 2664.0 14.563874959945679 43 17 10 6 10 2.996503762041481 33.372225747472854 0.03670024871826172 3 0.9714464722220131 7.286075113622891 2664.0 13.728588957055214 0.0 - - - - - - - 121.07692307692308 5 13 VHL von Hippel-Lindau tumor suppressor 1941 249 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22641.[MT7]-RIHSYR.2b4_1.heavy 488.284 / 638.385 326.0 14.563874959945679 43 17 10 6 10 2.996503762041481 33.372225747472854 0.03670024871826172 3 0.9714464722220131 7.286075113622891 326.0 0.8 10.0 - - - - - - - 0.0 0 0 VHL von Hippel-Lindau tumor suppressor 1943 249 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22641.[MT7]-RIHSYR.2b5_1.heavy 488.284 / 801.449 2229.0 14.563874959945679 43 17 10 6 10 2.996503762041481 33.372225747472854 0.03670024871826172 3 0.9714464722220131 7.286075113622891 2229.0 11.299078341013825 0.0 - - - - - - - 140.10526315789474 4 19 VHL von Hippel-Lindau tumor suppressor 1945 250 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38599.[MT7]-IMLSGAGALTPQDIQALAYGLC[CAM]PTQPER.4b8_1.heavy 779.656 / 845.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1947 250 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38599.[MT7]-IMLSGAGALTPQDIQALAYGLC[CAM]PTQPER.4b7_1.heavy 779.656 / 774.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1949 250 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38599.[MT7]-IMLSGAGALTPQDIQALAYGLC[CAM]PTQPER.4y9_1.heavy 779.656 / 1057.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1951 250 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38599.[MT7]-IMLSGAGALTPQDIQALAYGLC[CAM]PTQPER.4b6_1.heavy 779.656 / 717.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 1953 251 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38320.[MT7]-FYGLYC[CAM]VQAGGK[MT7].2b3_1.heavy 825.931 / 512.263 1399.0 34.826948165893555 39 13 10 6 10 1.3022845658802131 50.61794888452814 0.033100128173828125 3 0.9053254890000723 3.9788574164349253 1399.0 7.594571428571428 0.0 - - - - - - - 231.07142857142858 2 14 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1955 251 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38320.[MT7]-FYGLYC[CAM]VQAGGK[MT7].2y8_1.heavy 825.931 / 1026.52 1836.0 34.826948165893555 39 13 10 6 10 1.3022845658802131 50.61794888452814 0.033100128173828125 3 0.9053254890000723 3.9788574164349253 1836.0 13.999249727371865 0.0 - - - - - - - 151.26666666666668 3 15 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1957 251 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38320.[MT7]-FYGLYC[CAM]VQAGGK[MT7].2y5_1.heavy 825.931 / 604.354 1224.0 34.826948165893555 39 13 10 6 10 1.3022845658802131 50.61794888452814 0.033100128173828125 3 0.9053254890000723 3.9788574164349253 1224.0 4.436833151581244 1.0 - - - - - - - 228.53846153846155 2 13 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1959 251 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38320.[MT7]-FYGLYC[CAM]VQAGGK[MT7].2y7_1.heavy 825.931 / 863.453 787.0 34.826948165893555 39 13 10 6 10 1.3022845658802131 50.61794888452814 0.033100128173828125 3 0.9053254890000723 3.9788574164349253 787.0 5.531485714285715 0.0 - - - - - - - 0.0 1 0 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 1961 252 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38573.[MT7]-AVVPGPAEHPLQYNYTFWYSR.3b5_1.heavy 880.444 / 568.357 2356.0 38.35462474822998 36 10 10 6 10 1.7930066627292305 55.77224116266511 0.036098480224609375 3 0.8379394270078696 3.023263737835911 2356.0 9.83995144981948 0.0 - - - - - - - 239.8235294117647 4 17 EIF4E2 eukaryotic translation initiation factor 4E family member 2 1963 252 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38573.[MT7]-AVVPGPAEHPLQYNYTFWYSR.3b3_1.heavy 880.444 / 414.283 19481.0 38.35462474822998 36 10 10 6 10 1.7930066627292305 55.77224116266511 0.036098480224609375 3 0.8379394270078696 3.023263737835911 19481.0 51.93235910494175 0.0 - - - - - - - 636.375 38 8 EIF4E2 eukaryotic translation initiation factor 4E family member 2 1965 252 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38573.[MT7]-AVVPGPAEHPLQYNYTFWYSR.3y8_1.heavy 880.444 / 1136.52 1082.0 38.35462474822998 36 10 10 6 10 1.7930066627292305 55.77224116266511 0.036098480224609375 3 0.8379394270078696 3.023263737835911 1082.0 2.630314465408805 1.0 - - - - - - - 179.8235294117647 2 17 EIF4E2 eukaryotic translation initiation factor 4E family member 2 1967 252 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38573.[MT7]-AVVPGPAEHPLQYNYTFWYSR.3b8_1.heavy 880.444 / 865.49 1719.0 38.35462474822998 36 10 10 6 10 1.7930066627292305 55.77224116266511 0.036098480224609375 3 0.8379394270078696 3.023263737835911 1719.0 6.3 1.0 - - - - - - - 208.3181818181818 3 22 EIF4E2 eukaryotic translation initiation factor 4E family member 2 1969 253 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22829.[MT7]-LSALLTGIC[CAM]A.2b4_1.heavy 581.835 / 529.347 3612.0 44.74720001220703 32 7 10 5 10 0.4849053031796361 103.11291642334791 0.04019927978515625 3 0.7200148651265463 2.27560838655825 3612.0 8.555705732797506 0.0 - - - - - - - 249.21052631578948 7 19 ULK1 unc-51-like kinase 1 (C. elegans) 1971 253 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22829.[MT7]-LSALLTGIC[CAM]A.2b6_1.heavy 581.835 / 743.478 1744.0 44.74720001220703 32 7 10 5 10 0.4849053031796361 103.11291642334791 0.04019927978515625 3 0.7200148651265463 2.27560838655825 1744.0 18.302691189710607 0.0 - - - - - - - 182.5 3 14 ULK1 unc-51-like kinase 1 (C. elegans) 1973 253 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22829.[MT7]-LSALLTGIC[CAM]A.2b7_1.heavy 581.835 / 800.5 4795.0 44.74720001220703 32 7 10 5 10 0.4849053031796361 103.11291642334791 0.04019927978515625 3 0.7200148651265463 2.27560838655825 4795.0 26.05601862200595 0.0 - - - - - - - 196.3846153846154 9 13 ULK1 unc-51-like kinase 1 (C. elegans) 1975 253 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22829.[MT7]-LSALLTGIC[CAM]A.2b5_1.heavy 581.835 / 642.431 3737.0 44.74720001220703 32 7 10 5 10 0.4849053031796361 103.11291642334791 0.04019927978515625 3 0.7200148651265463 2.27560838655825 3737.0 32.542550093421816 0.0 - - - - - - - 174.9047619047619 7 21 ULK1 unc-51-like kinase 1 (C. elegans) 1977 254 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22925.[MT7]-DTDNEEEIR.2y8_1.heavy 632.792 / 1005.45 N/A N/A - - - - - - - - - 0.0 - - - - - - - CALML3 calmodulin-like 3 1979 254 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22925.[MT7]-DTDNEEEIR.2b6_1.heavy 632.792 / 848.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - CALML3 calmodulin-like 3 1981 254 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22925.[MT7]-DTDNEEEIR.2y6_1.heavy 632.792 / 789.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - CALML3 calmodulin-like 3 1983 254 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22925.[MT7]-DTDNEEEIR.2b5_1.heavy 632.792 / 719.296 N/A N/A - - - - - - - - - 0.0 - - - - - - - CALML3 calmodulin-like 3 1985 255 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541685.[MT7]-NILVK[MT7].2b3_1.heavy 437.802 / 485.32 6352.0 26.114299774169922 48 20 10 10 8 9.492259103858988 10.534899954358174 0.0 4 0.9943527690472581 16.41496658825114 6352.0 19.56774376602826 1.0 - - - - - - - 741.2857142857143 12 7 ACVR1C;BMPR1B;TGFBR1;ACVR1;ACVR1B activin A receptor, type IC;bone morphogenetic protein receptor, type IB;transforming growth factor, beta receptor 1;activin A receptor, type I;activin A receptor, type IB 1987 255 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541685.[MT7]-NILVK[MT7].2y4_1.heavy 437.802 / 616.451 6799.0 26.114299774169922 48 20 10 10 8 9.492259103858988 10.534899954358174 0.0 4 0.9943527690472581 16.41496658825114 6799.0 9.18075732974598 0.0 - - - - - - - 617.4 13 10 ACVR1C;BMPR1B;TGFBR1;ACVR1;ACVR1B activin A receptor, type IC;bone morphogenetic protein receptor, type IB;transforming growth factor, beta receptor 1;activin A receptor, type I;activin A receptor, type IB 1989 255 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541685.[MT7]-NILVK[MT7].2b4_1.heavy 437.802 / 584.389 3579.0 26.114299774169922 48 20 10 10 8 9.492259103858988 10.534899954358174 0.0 4 0.9943527690472581 16.41496658825114 3579.0 3.2158937456689425 6.0 - - - - - - - 715.7777777777778 10 9 ACVR1C;BMPR1B;TGFBR1;ACVR1;ACVR1B activin A receptor, type IC;bone morphogenetic protein receptor, type IB;transforming growth factor, beta receptor 1;activin A receptor, type I;activin A receptor, type IB 1991 255 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB541685.[MT7]-NILVK[MT7].2y3_1.heavy 437.802 / 503.367 13419.0 26.114299774169922 48 20 10 10 8 9.492259103858988 10.534899954358174 0.0 4 0.9943527690472581 16.41496658825114 13419.0 37.183374301675975 1.0 - - - - - - - 754.1428571428571 29 7 ACVR1C;BMPR1B;TGFBR1;ACVR1;ACVR1B activin A receptor, type IC;bone morphogenetic protein receptor, type IB;transforming growth factor, beta receptor 1;activin A receptor, type I;activin A receptor, type IB 1993 256 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22531.[MT7]-VLVSK[MT7].2b3_1.heavy 417.289 / 456.33 3576.0 23.520450592041016 42 18 10 6 8 3.4808208652677557 28.72885559777512 0.034900665283203125 4 0.9822992081383636 9.262395473215939 3576.0 17.834625719769676 1.0 - - - - - - - 178.4 25 5 UTRN;CALML3 utrophin;calmodulin-like 3 1995 256 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22531.[MT7]-VLVSK[MT7].2y4_1.heavy 417.289 / 590.399 15421.0 23.520450592041016 42 18 10 6 8 3.4808208652677557 28.72885559777512 0.034900665283203125 4 0.9822992081383636 9.262395473215939 15421.0 51.79283683336942 0.0 - - - - - - - 893.8 30 5 UTRN;CALML3 utrophin;calmodulin-like 3 1997 256 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22531.[MT7]-VLVSK[MT7].2b4_1.heavy 417.289 / 543.362 1043.0 23.520450592041016 42 18 10 6 8 3.4808208652677557 28.72885559777512 0.034900665283203125 4 0.9822992081383636 9.262395473215939 1043.0 1.0553132088640726 20.0 - - - - - - - 198.33333333333334 13 3 UTRN;CALML3 utrophin;calmodulin-like 3 1999 256 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22531.[MT7]-VLVSK[MT7].2y3_1.heavy 417.289 / 477.315 7673.0 23.520450592041016 42 18 10 6 8 3.4808208652677557 28.72885559777512 0.034900665283203125 4 0.9822992081383636 9.262395473215939 7673.0 11.193203022711574 0.0 - - - - - - - 260.5 15 4 UTRN;CALML3 utrophin;calmodulin-like 3 2001 257 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38050.[MT7]-APLGQDPPQR.2y8_1.heavy 611.837 / 910.474 486.0 20.42442560195923 33 8 10 7 8 1.130988786464233 50.63045954173333 0.028699874877929688 4 0.7891266871355792 2.638799103830574 486.0 3.6621917808219178 0.0 - - - - - - - 0.0 0 0 CCNA1 cyclin A1 2003 257 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38050.[MT7]-APLGQDPPQR.2y9_1.heavy 611.837 / 1007.53 4665.0 20.42442560195923 33 8 10 7 8 1.130988786464233 50.63045954173333 0.028699874877929688 4 0.7891266871355792 2.638799103830574 4665.0 101.57435474189674 0.0 - - - - - - - 167.33333333333334 9 9 CCNA1 cyclin A1 2005 257 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38050.[MT7]-APLGQDPPQR.2b6_1.heavy 611.837 / 726.39 20359.0 20.42442560195923 33 8 10 7 8 1.130988786464233 50.63045954173333 0.028699874877929688 4 0.7891266871355792 2.638799103830574 20359.0 241.6611967958126 0.0 - - - - - - - 180.57142857142858 40 14 CCNA1 cyclin A1 2007 257 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38050.[MT7]-APLGQDPPQR.2y7_1.heavy 611.837 / 797.39 1166.0 20.42442560195923 33 8 10 7 8 1.130988786464233 50.63045954173333 0.028699874877929688 4 0.7891266871355792 2.638799103830574 1166.0 0.0680146412306594 2.0 - - - - - - - 123.38461538461539 2 13 CCNA1 cyclin A1 2009 258 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544780.[MT7]-ALYSTAMESIQGEAR.3y7_1.heavy 590.965 / 760.395 4825.0 35.125051498413086 38 12 10 6 10 1.21454206182401 54.89037289210559 0.033100128173828125 3 0.899251769467701 3.855033664734002 4825.0 20.461954277976254 0.0 - - - - - - - 218.61904761904762 9 21 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 2011 258 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544780.[MT7]-ALYSTAMESIQGEAR.3b6_1.heavy 590.965 / 751.411 5603.0 35.125051498413086 38 12 10 6 10 1.21454206182401 54.89037289210559 0.033100128173828125 3 0.899251769467701 3.855033664734002 5603.0 22.207612041008833 0.0 - - - - - - - 260.6 11 20 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 2013 258 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544780.[MT7]-ALYSTAMESIQGEAR.3y8_1.heavy 590.965 / 889.437 2257.0 35.125051498413086 38 12 10 6 10 1.21454206182401 54.89037289210559 0.033100128173828125 3 0.899251769467701 3.855033664734002 2257.0 4.254510164425337 3.0 - - - - - - - 267.5 10 16 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 2015 258 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544780.[MT7]-ALYSTAMESIQGEAR.3y5_1.heavy 590.965 / 560.279 8405.0 35.125051498413086 38 12 10 6 10 1.21454206182401 54.89037289210559 0.033100128173828125 3 0.899251769467701 3.855033664734002 8405.0 11.923109837908402 0.0 - - - - - - - 1134.0 16 7 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha 2017 259 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544782.[MT7]-DLK[MT7]PENLLLASK[MT7].4y4_1.heavy 444.027 / 562.368 55675.0 33.68539810180664 48 18 10 10 10 8.12497649570452 12.307727911935205 0.0 3 0.9823564972900735 9.277465548897931 55675.0 237.93689807383626 0.0 - - - - - - - 280.6923076923077 111 13 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 2019 259 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544782.[MT7]-DLK[MT7]PENLLLASK[MT7].4y3_1.heavy 444.027 / 449.284 81022.0 33.68539810180664 48 18 10 10 10 8.12497649570452 12.307727911935205 0.0 3 0.9823564972900735 9.277465548897931 81022.0 168.01239097153362 0.0 - - - - - - - 632.4444444444445 162 9 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 2021 259 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544782.[MT7]-DLK[MT7]PENLLLASK[MT7].4b3_1.heavy 444.027 / 645.417 5870.0 33.68539810180664 48 18 10 10 10 8.12497649570452 12.307727911935205 0.0 3 0.9823564972900735 9.277465548897931 5870.0 42.87078651685393 0.0 - - - - - - - 178.0 11 11 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 2023 259 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544782.[MT7]-DLK[MT7]PENLLLASK[MT7].4b6_2.heavy 444.027 / 493.281 134651.0 33.68539810180664 48 18 10 10 10 8.12497649570452 12.307727911935205 0.0 3 0.9823564972900735 9.277465548897931 134651.0 274.9619007708392 0.0 - - - - - - - 733.5 269 8 CAMK2A;CAMK2B;CAMK2D;CAMK2G calcium/calmodulin-dependent protein kinase II alpha;calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II delta;calcium/calmodulin-dependent protein kinase II gamma 2025 260 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22928.[MT7]-ANFSSEAGWR.2y8_1.heavy 634.811 / 939.432 2065.0 28.837499618530273 47 17 10 10 10 3.31997256635567 30.120730819703695 0.0 3 0.9783263617590928 8.367754480094991 2065.0 15.323306484923584 0.0 - - - - - - - 303.0 4 8 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 2027 260 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22928.[MT7]-ANFSSEAGWR.2b4_1.heavy 634.811 / 564.29 1616.0 28.837499618530273 47 17 10 10 10 3.31997256635567 30.120730819703695 0.0 3 0.9783263617590928 8.367754480094991 1616.0 2.495266678499111 3.0 - - - - - - - 232.16666666666666 9 12 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 2029 260 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22928.[MT7]-ANFSSEAGWR.2y9_1.heavy 634.811 / 1053.47 4579.0 28.837499618530273 47 17 10 10 10 3.31997256635567 30.120730819703695 0.0 3 0.9783263617590928 8.367754480094991 4579.0 41.97416666666666 0.0 - - - - - - - 179.75 9 8 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 2031 260 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22928.[MT7]-ANFSSEAGWR.2y7_1.heavy 634.811 / 792.364 3681.0 28.837499618530273 47 17 10 10 10 3.31997256635567 30.120730819703695 0.0 3 0.9783263617590928 8.367754480094991 3681.0 41.35613382899628 0.0 - - - - - - - 196.0909090909091 7 11 ESPL1 extra spindle pole bodies homolog 1 (S. cerevisiae) 2033 261 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22821.[MT7]-EAEFLQK[MT7].2y4_1.heavy 576.829 / 679.426 3371.0 28.05389976501465 46 20 10 6 10 13.659706293187229 7.320801622936427 0.03989982604980469 3 0.998492828326422 31.785309654629526 3371.0 16.081025181714836 0.0 - - - - - - - 230.1764705882353 6 17 PIP5K1C;PIP5K1A;PIP5K1B phosphatidylinositol-4-phosphate 5-kinase, type I, gamma;phosphatidylinositol-4-phosphate 5-kinase, type I, alpha;phosphatidylinositol-4-phosphate 5-kinase, type I, beta 2035 261 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22821.[MT7]-EAEFLQK[MT7].2b4_1.heavy 576.829 / 621.3 3462.0 28.05389976501465 46 20 10 6 10 13.659706293187229 7.320801622936427 0.03989982604980469 3 0.998492828326422 31.785309654629526 3462.0 9.699904128793017 0.0 - - - - - - - 257.8333333333333 6 12 PIP5K1C;PIP5K1A;PIP5K1B phosphatidylinositol-4-phosphate 5-kinase, type I, gamma;phosphatidylinositol-4-phosphate 5-kinase, type I, alpha;phosphatidylinositol-4-phosphate 5-kinase, type I, beta 2037 261 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22821.[MT7]-EAEFLQK[MT7].2y3_1.heavy 576.829 / 532.357 N/A 28.05389976501465 46 20 10 6 10 13.659706293187229 7.320801622936427 0.03989982604980469 3 0.998492828326422 31.785309654629526 3279.0 5.565047919655667 0.0 - - - - - - - 690.0 6 7 PIP5K1C;PIP5K1A;PIP5K1B phosphatidylinositol-4-phosphate 5-kinase, type I, gamma;phosphatidylinositol-4-phosphate 5-kinase, type I, alpha;phosphatidylinositol-4-phosphate 5-kinase, type I, beta 2039 261 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22821.[MT7]-EAEFLQK[MT7].2y6_1.heavy 576.829 / 879.506 4555.0 28.05389976501465 46 20 10 6 10 13.659706293187229 7.320801622936427 0.03989982604980469 3 0.998492828326422 31.785309654629526 4555.0 22.27445054945055 0.0 - - - - - - - 208.0 9 14 PIP5K1C;PIP5K1A;PIP5K1B phosphatidylinositol-4-phosphate 5-kinase, type I, gamma;phosphatidylinositol-4-phosphate 5-kinase, type I, alpha;phosphatidylinositol-4-phosphate 5-kinase, type I, beta 2041 262 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38196.[MT7]-GQNAPAASGARK[MT7].3y6_1.heavy 472.603 / 733.444 899.0 13.81404972076416 43 18 10 5 10 5.107016886350124 19.580902555320876 0.041500091552734375 3 0.9884335307350338 11.464166124747242 899.0 35.30447916666667 0.0 - - - - - - - 0.0 1 0 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 2043 262 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38196.[MT7]-GQNAPAASGARK[MT7].3b4_1.heavy 472.603 / 515.269 2504.0 13.81404972076416 43 18 10 5 10 5.107016886350124 19.580902555320876 0.041500091552734375 3 0.9884335307350338 11.464166124747242 2504.0 11.057865397306823 0.0 - - - - - - - 158.3125 5 16 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 2045 262 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38196.[MT7]-GQNAPAASGARK[MT7].3y8_1.heavy 472.603 / 901.534 2728.0 13.81404972076416 43 18 10 5 10 5.107016886350124 19.580902555320876 0.041500091552734375 3 0.9884335307350338 11.464166124747242 2728.0 20.452910602910602 0.0 - - - - - - - 187.71428571428572 5 7 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 2047 262 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38196.[MT7]-GQNAPAASGARK[MT7].3y5_1.heavy 472.603 / 662.407 802.0 13.81404972076416 43 18 10 5 10 5.107016886350124 19.580902555320876 0.041500091552734375 3 0.9884335307350338 11.464166124747242 802.0 3.125498540856031 0.0 - - - - - - - 0.0 1 0 TNFRSF10B tumor necrosis factor receptor superfamily, member 10b 2049 263 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22535.[MT7]-WAPDGR.2y4_1.heavy 423.223 / 444.22 7231.0 23.074499130249023 32 8 4 10 10 0.6244720983734697 85.0137327669105 0.0 3 0.7764423833619144 2.5599008907420435 7231.0 9.603429878969266 0.0 - - - - - - - 663.7272727272727 63 11 CDC20 cell division cycle 20 homolog (S. cerevisiae) 2051 263 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22535.[MT7]-WAPDGR.2y5_1.heavy 423.223 / 515.257 11176.0 23.074499130249023 32 8 4 10 10 0.6244720983734697 85.0137327669105 0.0 3 0.7764423833619144 2.5599008907420435 11176.0 14.484836438923397 0.0 - - - - - - - 721.125 22 8 CDC20 cell division cycle 20 homolog (S. cerevisiae) 2053 263 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22535.[MT7]-WAPDGR.2b4_1.heavy 423.223 / 614.305 17896.0 23.074499130249023 32 8 4 10 10 0.6244720983734697 85.0137327669105 0.0 3 0.7764423833619144 2.5599008907420435 17896.0 36.98808294197962 0.0 - - - - - - - 324.44444444444446 35 9 CDC20 cell division cycle 20 homolog (S. cerevisiae) 2055 264 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22534.[MT7]-GSTYK[MT7].2b3_1.heavy 422.244 / 390.211 N/A 14.905699729919434 44 14 10 10 10 1.3270140880521129 50.2381001580208 0.0 3 0.9409754592001496 5.054595339275424 2674.0 4.895194508009154 3.0 - - - - - - - 612.4444444444445 5 9 PIP5K1C;PIP5K1A;PIP5K1B phosphatidylinositol-4-phosphate 5-kinase, type I, gamma;phosphatidylinositol-4-phosphate 5-kinase, type I, alpha;phosphatidylinositol-4-phosphate 5-kinase, type I, beta 2057 264 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22534.[MT7]-GSTYK[MT7].2y4_1.heavy 422.244 / 642.358 1473.0 14.905699729919434 44 14 10 10 10 1.3270140880521129 50.2381001580208 0.0 3 0.9409754592001496 5.054595339275424 1473.0 16.20003356455583 0.0 - - - - - - - 125.29411764705883 2 17 PIP5K1C;PIP5K1A;PIP5K1B phosphatidylinositol-4-phosphate 5-kinase, type I, gamma;phosphatidylinositol-4-phosphate 5-kinase, type I, alpha;phosphatidylinositol-4-phosphate 5-kinase, type I, beta 2059 264 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22534.[MT7]-GSTYK[MT7].2b4_1.heavy 422.244 / 553.274 1583.0 14.905699729919434 44 14 10 10 10 1.3270140880521129 50.2381001580208 0.0 3 0.9409754592001496 5.054595339275424 1583.0 8.69605057059745 0.0 - - - - - - - 229.15 3 20 PIP5K1C;PIP5K1A;PIP5K1B phosphatidylinositol-4-phosphate 5-kinase, type I, gamma;phosphatidylinositol-4-phosphate 5-kinase, type I, alpha;phosphatidylinositol-4-phosphate 5-kinase, type I, beta 2061 264 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22534.[MT7]-GSTYK[MT7].2y3_1.heavy 422.244 / 555.326 1528.0 14.905699729919434 44 14 10 10 10 1.3270140880521129 50.2381001580208 0.0 3 0.9409754592001496 5.054595339275424 1528.0 12.888664851967604 0.0 - - - - - - - 138.4 3 15 PIP5K1C;PIP5K1A;PIP5K1B phosphatidylinositol-4-phosphate 5-kinase, type I, gamma;phosphatidylinositol-4-phosphate 5-kinase, type I, alpha;phosphatidylinositol-4-phosphate 5-kinase, type I, beta 2063 265 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23309.[MT7]-ETSAPLRQLLLALLQR.3y15_2.heavy 656.069 / 847.028 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 2065 265 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23309.[MT7]-ETSAPLRQLLLALLQR.3y6_1.heavy 656.069 / 713.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 2067 265 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23309.[MT7]-ETSAPLRQLLLALLQR.3y5_1.heavy 656.069 / 600.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 2069 265 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23309.[MT7]-ETSAPLRQLLLALLQR.3y9_1.heavy 656.069 / 1067.69 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 2071 266 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37876.[MT7]-TC[CAM]GQGITR.2b4_1.heavy 518.77 / 591.268 1957.0 16.25480079650879 46 16 10 10 10 4.1093425628580125 24.334792845902548 0.0 3 0.9663997172633488 6.713783123744598 1957.0 11.511764705882353 0.0 - - - - - - - 213.57142857142858 3 14 CCNA1 cyclin A1 2073 266 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37876.[MT7]-TC[CAM]GQGITR.2y6_1.heavy 518.77 / 631.352 2283.0 16.25480079650879 46 16 10 10 10 4.1093425628580125 24.334792845902548 0.0 3 0.9663997172633488 6.713783123744598 2283.0 40.109587155963304 0.0 - - - - - - - 182.1 4 20 CCNA1 cyclin A1 2075 266 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37876.[MT7]-TC[CAM]GQGITR.2b5_1.heavy 518.77 / 648.289 2066.0 16.25480079650879 46 16 10 10 10 4.1093425628580125 24.334792845902548 0.0 3 0.9663997172633488 6.713783123744598 2066.0 17.744785276073618 0.0 - - - - - - - 173.9 4 20 CCNA1 cyclin A1 2077 266 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37876.[MT7]-TC[CAM]GQGITR.2y7_1.heavy 518.77 / 791.383 8697.0 16.25480079650879 46 16 10 10 10 4.1093425628580125 24.334792845902548 0.0 3 0.9663997172633488 6.713783123744598 8697.0 125.95401981201104 0.0 - - - - - - - 112.26666666666667 17 15 CCNA1 cyclin A1 2079 267 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23307.[MT7]-VDPDSPLHSDLQILK[MT7].4b7_1.heavy 492.028 / 868.453 12522.0 35.050498962402344 38 12 10 6 10 1.637091403737809 47.862554442946546 0.033203125 3 0.8884853369134473 3.660794823089368 12522.0 99.4136419638291 0.0 - - - - - - - 190.0 25 14 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 2081 267 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23307.[MT7]-VDPDSPLHSDLQILK[MT7].4b4_1.heavy 492.028 / 571.284 23557.0 35.050498962402344 38 12 10 6 10 1.637091403737809 47.862554442946546 0.033203125 3 0.8884853369134473 3.660794823089368 23557.0 47.06015945403281 0.0 - - - - - - - 694.375 47 8 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 2083 267 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23307.[MT7]-VDPDSPLHSDLQILK[MT7].4y3_1.heavy 492.028 / 517.383 48444.0 35.050498962402344 38 12 10 6 10 1.637091403737809 47.862554442946546 0.033203125 3 0.8884853369134473 3.660794823089368 48444.0 47.80657894736842 0.0 - - - - - - - 1281.375 96 8 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 2085 267 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23307.[MT7]-VDPDSPLHSDLQILK[MT7].4b10_2.heavy 492.028 / 604.289 80688.0 35.050498962402344 38 12 10 6 10 1.637091403737809 47.862554442946546 0.033203125 3 0.8884853369134473 3.660794823089368 80688.0 69.53127129750982 0.0 - - - - - - - 704.4285714285714 161 7 UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 2087 268 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37872.[MT7]-SQTLLGK[MT7].2y5_1.heavy 517.826 / 675.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 2089 268 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37872.[MT7]-SQTLLGK[MT7].2y6_1.heavy 517.826 / 803.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 2091 268 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37872.[MT7]-SQTLLGK[MT7].2y6_2.heavy 517.826 / 402.259 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 2093 268 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB37872.[MT7]-SQTLLGK[MT7].2b5_1.heavy 517.826 / 687.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK1 unc-51-like kinase 1 (C. elegans) 2095 269 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23306.[MT7]-DSAQEDYLFSVSFRR.3b6_1.heavy 655.326 / 790.333 4047.0 36.50204944610596 41 14 10 7 10 1.2475795787681627 51.94148039123819 0.028598785400390625 3 0.9481918688751118 5.398465622479581 4047.0 11.974649987272263 0.0 - - - - - - - 216.26315789473685 8 19 SOCS4;SOCS5 suppressor of cytokine signaling 4;suppressor of cytokine signaling 5 2097 269 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23306.[MT7]-DSAQEDYLFSVSFRR.3b4_1.heavy 655.326 / 546.264 1991.0 36.50204944610596 41 14 10 7 10 1.2475795787681627 51.94148039123819 0.028598785400390625 3 0.9481918688751118 5.398465622479581 1991.0 3.660336005029074 1.0 - - - - - - - 259.3076923076923 3 26 SOCS4;SOCS5 suppressor of cytokine signaling 4;suppressor of cytokine signaling 5 2099 269 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23306.[MT7]-DSAQEDYLFSVSFRR.3b5_1.heavy 655.326 / 675.307 964.0 36.50204944610596 41 14 10 7 10 1.2475795787681627 51.94148039123819 0.028598785400390625 3 0.9481918688751118 5.398465622479581 964.0 1.7563839327648005 3.0 - - - - - - - 0.0 1 0 SOCS4;SOCS5 suppressor of cytokine signaling 4;suppressor of cytokine signaling 5 2101 269 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB23306.[MT7]-DSAQEDYLFSVSFRR.3b7_1.heavy 655.326 / 953.397 2184.0 36.50204944610596 41 14 10 7 10 1.2475795787681627 51.94148039123819 0.028598785400390625 3 0.9481918688751118 5.398465622479581 2184.0 15.010747663551403 0.0 - - - - - - - 162.35294117647058 4 17 SOCS4;SOCS5 suppressor of cytokine signaling 4;suppressor of cytokine signaling 5 2103 270 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22935.[MT7]-EAPEGTFLIR.2y8_1.heavy 638.854 / 932.52 10793.0 34.01585006713867 35 20 2 5 8 6.873392494252252 14.548856344755979 0.04270172119140625 4 0.9903688989982999 12.565368306488836 10793.0 39.609988695029585 0.0 - - - - - - - 245.25 21 12 SOCS2 suppressor of cytokine signaling 2 2105 270 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22935.[MT7]-EAPEGTFLIR.2y9_1.heavy 638.854 / 1003.56 7582.0 34.01585006713867 35 20 2 5 8 6.873392494252252 14.548856344755979 0.04270172119140625 4 0.9903688989982999 12.565368306488836 7582.0 84.47280898876406 1.0 - - - - - - - 223.0 44 8 SOCS2 suppressor of cytokine signaling 2 2107 270 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22935.[MT7]-EAPEGTFLIR.2y6_1.heavy 638.854 / 706.425 3568.0 34.01585006713867 35 20 2 5 8 6.873392494252252 14.548856344755979 0.04270172119140625 4 0.9903688989982999 12.565368306488836 3568.0 15.595518207282913 0.0 - - - - - - - 286.64285714285717 7 14 SOCS2 suppressor of cytokine signaling 2 2109 270 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22935.[MT7]-EAPEGTFLIR.2y7_1.heavy 638.854 / 835.467 1338.0 34.01585006713867 35 20 2 5 8 6.873392494252252 14.548856344755979 0.04270172119140625 4 0.9903688989982999 12.565368306488836 1338.0 2.2462665782493363 2.0 - - - - - - - 282.5 2 12 SOCS2 suppressor of cytokine signaling 2 2111 271 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38436.[MT7]-FTEEYQLFEELGK[MT7].2b3_1.heavy 960.995 / 522.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A calcium/calmodulin-dependent protein kinase II alpha 2113 271 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38436.[MT7]-FTEEYQLFEELGK[MT7].2y5_1.heavy 960.995 / 719.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A calcium/calmodulin-dependent protein kinase II alpha 2115 271 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38436.[MT7]-FTEEYQLFEELGK[MT7].2b4_1.heavy 960.995 / 651.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A calcium/calmodulin-dependent protein kinase II alpha 2117 271 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB38436.[MT7]-FTEEYQLFEELGK[MT7].2y7_1.heavy 960.995 / 979.558 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAMK2A calcium/calmodulin-dependent protein kinase II alpha 2119 272 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22933.[MT7]-GPDAC[CAM]QILTR.2y8_1.heavy 637.836 / 976.488 640.0 27.75862455368042 37 16 10 3 8 2.452263339298289 40.77865472172937 0.07909965515136719 4 0.965024746638398 6.579728034559146 640.0 3.3823940010370546 2.0 - - - - - - - 0.0 1 0 CCNA1 cyclin A1 2121 272 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22933.[MT7]-GPDAC[CAM]QILTR.2y9_1.heavy 637.836 / 1073.54 732.0 27.75862455368042 37 16 10 3 8 2.452263339298289 40.77865472172937 0.07909965515136719 4 0.965024746638398 6.579728034559146 732.0 0.29105367793240555 1.0 - - - - - - - 172.33333333333334 2 9 CCNA1 cyclin A1 2123 272 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22933.[MT7]-GPDAC[CAM]QILTR.2b6_1.heavy 637.836 / 773.337 457.0 27.75862455368042 37 16 10 3 8 2.452263339298289 40.77865472172937 0.07909965515136719 4 0.965024746638398 6.579728034559146 457.0 1.9297971732446848 8.0 - - - - - - - 203.0 2 18 CCNA1 cyclin A1 2125 272 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22933.[MT7]-GPDAC[CAM]QILTR.2y7_1.heavy 637.836 / 861.461 2195.0 27.75862455368042 37 16 10 3 8 2.452263339298289 40.77865472172937 0.07909965515136719 4 0.965024746638398 6.579728034559146 2195.0 10.420124673055275 1.0 - - - - - - - 228.5 5 8 CCNA1 cyclin A1 2127 273 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22623.[MT7]-ELGTVMR.2b3_1.heavy 475.267 / 444.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNNC2;CALM1;CALM2;CALM3;CALML3 troponin C type 2 (fast);calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 2129 273 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22623.[MT7]-ELGTVMR.2y5_1.heavy 475.267 / 563.297 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNNC2;CALM1;CALM2;CALM3;CALML3 troponin C type 2 (fast);calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 2131 273 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22623.[MT7]-ELGTVMR.2b4_1.heavy 475.267 / 545.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNNC2;CALM1;CALM2;CALM3;CALML3 troponin C type 2 (fast);calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 2133 273 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22623.[MT7]-ELGTVMR.2y6_1.heavy 475.267 / 676.381 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNNC2;CALM1;CALM2;CALM3;CALML3 troponin C type 2 (fast);calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 2135 274 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22736.[MT7]-QLSTGSSSR.2b8_1.heavy 533.784 / 892.449 327.0 15.52002501487732 46 20 10 6 10 8.757775806930018 11.418424289974414 0.03229999542236328 3 0.9953745547904623 18.139196968969912 327.0 0.0 3.0 - - - - - - - 0.0 0 0 CCKAR cholecystokinin A receptor 2137 274 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22736.[MT7]-QLSTGSSSR.2y6_1.heavy 533.784 / 594.284 818.0 15.52002501487732 46 20 10 6 10 8.757775806930018 11.418424289974414 0.03229999542236328 3 0.9953745547904623 18.139196968969912 818.0 6.482315954352204 0.0 - - - - - - - 0.0 1 0 CCKAR cholecystokinin A receptor 2139 274 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22736.[MT7]-QLSTGSSSR.2y8_1.heavy 533.784 / 794.4 3818.0 15.52002501487732 46 20 10 6 10 8.757775806930018 11.418424289974414 0.03229999542236328 3 0.9953745547904623 18.139196968969912 3818.0 29.64666517686119 0.0 - - - - - - - 155.21052631578948 7 19 CCKAR cholecystokinin A receptor 2141 274 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22736.[MT7]-QLSTGSSSR.2y7_1.heavy 533.784 / 681.316 2400.0 15.52002501487732 46 20 10 6 10 8.757775806930018 11.418424289974414 0.03229999542236328 3 0.9953745547904623 18.139196968969912 2400.0 12.835086149026626 0.0 - - - - - - - 213.1818181818182 4 11 CCKAR cholecystokinin A receptor 2143 275 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544792.[MT7]-FGIDDQDYLVSLTR.3y7_1.heavy 595.976 / 851.498 1562.0 40.422698974609375 46 16 10 10 10 2.6734749479880904 29.43823177221404 0.0 3 0.962882059353816 6.385837371638882 1562.0 10.142857142857142 0.0 - - - - - - - 207.64705882352942 3 17 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 2145 275 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544792.[MT7]-FGIDDQDYLVSLTR.3b4_1.heavy 595.976 / 577.31 5786.0 40.422698974609375 46 16 10 10 10 2.6734749479880904 29.43823177221404 0.0 3 0.962882059353816 6.385837371638882 5786.0 33.54937285577055 0.0 - - - - - - - 224.94444444444446 11 18 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 2147 275 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544792.[MT7]-FGIDDQDYLVSLTR.3y5_1.heavy 595.976 / 575.351 14987.0 40.422698974609375 46 16 10 10 10 2.6734749479880904 29.43823177221404 0.0 3 0.962882059353816 6.385837371638882 14987.0 64.84274034034631 0.0 - - - - - - - 343.375 29 16 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 2149 275 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544792.[MT7]-FGIDDQDYLVSLTR.3b7_1.heavy 595.976 / 935.423 8622.0 40.422698974609375 46 16 10 10 10 2.6734749479880904 29.43823177221404 0.0 3 0.962882059353816 6.385837371638882 8622.0 153.8950264392642 0.0 - - - - - - - 152.0 17 16 PIP4K2C phosphatidylinositol-5-phosphate 4-kinase, type II, gamma 2151 276 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22832.[MT7]-ELLETTC[CAM]R.2y4_1.heavy 583.304 / 537.245 2772.0 26.306925773620605 40 14 10 6 10 1.1277499991759465 58.03494280411931 0.038700103759765625 3 0.9451597440738669 5.245750570540836 2772.0 7.505415162454874 0.0 - - - - - - - 277.0769230769231 5 13 ACSS1 acyl-CoA synthetase short-chain family member 1 2153 276 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22832.[MT7]-ELLETTC[CAM]R.2y5_1.heavy 583.304 / 666.288 4435.0 26.306925773620605 40 14 10 6 10 1.1277499991759465 58.03494280411931 0.038700103759765625 3 0.9451597440738669 5.245750570540836 4435.0 18.4726036686506 0.0 - - - - - - - 263.0 8 13 ACSS1 acyl-CoA synthetase short-chain family member 1 2155 276 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22832.[MT7]-ELLETTC[CAM]R.2y6_1.heavy 583.304 / 779.372 3049.0 26.306925773620605 40 14 10 6 10 1.1277499991759465 58.03494280411931 0.038700103759765625 3 0.9451597440738669 5.245750570540836 3049.0 17.71716216216216 0.0 - - - - - - - 149.0 6 13 ACSS1 acyl-CoA synthetase short-chain family member 1 2157 276 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22832.[MT7]-ELLETTC[CAM]R.2y7_1.heavy 583.304 / 892.456 6006.0 26.306925773620605 40 14 10 6 10 1.1277499991759465 58.03494280411931 0.038700103759765625 3 0.9451597440738669 5.245750570540836 6006.0 74.6691891891892 0.0 - - - - - - - 184.77777777777777 12 9 ACSS1 acyl-CoA synthetase short-chain family member 1 2159 277 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22527.[MT7]-NFSVGR.2b3_1.heavy 412.231 / 493.253 2346.0 22.455699920654297 44 14 10 10 10 10.598282039074588 9.435491491103186 0.0 3 0.9463019503821563 5.3017628338741005 2346.0 5.689925373134328 0.0 - - - - - - - 221.9375 4 16 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 2161 277 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22527.[MT7]-NFSVGR.2y4_1.heavy 412.231 / 418.241 5897.0 22.455699920654297 44 14 10 10 10 10.598282039074588 9.435491491103186 0.0 3 0.9463019503821563 5.3017628338741005 5897.0 27.431318407960198 0.0 - - - - - - - 214.4 11 15 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 2163 277 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22527.[MT7]-NFSVGR.2y5_1.heavy 412.231 / 565.309 10723.0 22.455699920654297 44 14 10 10 10 10.598282039074588 9.435491491103186 0.0 3 0.9463019503821563 5.3017628338741005 10723.0 39.38244669509595 0.0 - - - - - - - 209.375 21 16 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 2165 277 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22527.[MT7]-NFSVGR.2y3_1.heavy 412.231 / 331.209 2279.0 22.455699920654297 44 14 10 10 10 10.598282039074588 9.435491491103186 0.0 3 0.9463019503821563 5.3017628338741005 2279.0 0.20349097794211463 1.0 - - - - - - - 310.6363636363636 5 11 CAMK2B;CAMK2G calcium/calmodulin-dependent protein kinase II beta;calcium/calmodulin-dependent protein kinase II gamma 2167 278 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22730.[MT7]-TSAGPTNLR.2y8_1.heavy 530.797 / 815.437 6968.0 19.247925758361816 46 20 10 6 10 10.295198496534473 9.713265852393384 0.034099578857421875 3 0.9961889571029325 19.98492065940856 6968.0 29.96763335343457 0.0 - - - - - - - 225.76190476190476 13 21 SOCS2 suppressor of cytokine signaling 2 2169 278 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22730.[MT7]-TSAGPTNLR.2y5_1.heavy 530.797 / 600.346 1452.0 19.247925758361816 46 20 10 6 10 10.295198496534473 9.713265852393384 0.034099578857421875 3 0.9961889571029325 19.98492065940856 1452.0 5.280000000000001 3.0 - - - - - - - 257.3181818181818 3 22 SOCS2 suppressor of cytokine signaling 2 2171 278 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22730.[MT7]-TSAGPTNLR.2y6_1.heavy 530.797 / 657.368 3629.0 19.247925758361816 46 20 10 6 10 10.295198496534473 9.713265852393384 0.034099578857421875 3 0.9961889571029325 19.98492065940856 3629.0 14.347209302325581 0.0 - - - - - - - 244.23809523809524 7 21 SOCS2 suppressor of cytokine signaling 2 2173 278 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22730.[MT7]-TSAGPTNLR.2y7_1.heavy 530.797 / 728.405 1500.0 19.247925758361816 46 20 10 6 10 10.295198496534473 9.713265852393384 0.034099578857421875 3 0.9961889571029325 19.98492065940856 1500.0 11.815685077815075 0.0 - - - - - - - 202.71428571428572 3 21 SOCS2 suppressor of cytokine signaling 2 2175 279 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22524.[MT7]-SLLGK[MT7].2b3_1.heavy 403.273 / 458.31 6434.0 25.645599365234375 46 18 10 10 8 2.9571235176704174 33.81664627887396 0.0 4 0.9833375881404589 9.547475525989917 6434.0 13.434153616703952 2.0 - - - - - - - 223.33333333333334 36 6 LOC100294341;LOC100506084;LOC100507695;UTP20;ARL17A;PGK1;PGK2;PLD2;LOC653877;TMEM177;TRANK1 ADP-ribosylation factor-like protein 17-like;ADP-ribosylation factor-like protein 17-like;ADP-ribosylation factor-like protein 17-like;UTP20, small subunit (SSU) processome component, homolog (yeast);ADP-ribosylation factor-like 17A;phosphoglycerate kinase 1;phosphoglycerate kinase 2;phospholipase D2;small subunit processome component 20 homolog;transmembrane protein 177;tetratricopeptide repeat and ankyrin repeat containing 1 2177 279 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22524.[MT7]-SLLGK[MT7].2y4_1.heavy 403.273 / 574.404 8490.0 25.645599365234375 46 18 10 10 8 2.9571235176704174 33.81664627887396 0.0 4 0.9833375881404589 9.547475525989917 8490.0 15.866300617968143 1.0 - - - - - - - 185.69230769230768 16 13 LOC100294341;LOC100506084;LOC100507695;UTP20;ARL17A;PGK1;PGK2;PLD2;LOC653877;TMEM177;TRANK1 ADP-ribosylation factor-like protein 17-like;ADP-ribosylation factor-like protein 17-like;ADP-ribosylation factor-like protein 17-like;UTP20, small subunit (SSU) processome component, homolog (yeast);ADP-ribosylation factor-like 17A;phosphoglycerate kinase 1;phosphoglycerate kinase 2;phospholipase D2;small subunit processome component 20 homolog;transmembrane protein 177;tetratricopeptide repeat and ankyrin repeat containing 1 2179 279 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22524.[MT7]-SLLGK[MT7].2b4_1.heavy 403.273 / 515.331 1698.0 25.645599365234375 46 18 10 10 8 2.9571235176704174 33.81664627887396 0.0 4 0.9833375881404589 9.547475525989917 1698.0 2.022360012020435 8.0 - - - - - - - 770.1538461538462 5 13 LOC100294341;LOC100506084;LOC100507695;UTP20;ARL17A;PGK1;PGK2;PLD2;LOC653877;TMEM177;TRANK1 ADP-ribosylation factor-like protein 17-like;ADP-ribosylation factor-like protein 17-like;ADP-ribosylation factor-like protein 17-like;UTP20, small subunit (SSU) processome component, homolog (yeast);ADP-ribosylation factor-like 17A;phosphoglycerate kinase 1;phosphoglycerate kinase 2;phospholipase D2;small subunit processome component 20 homolog;transmembrane protein 177;tetratricopeptide repeat and ankyrin repeat containing 1 2181 279 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22524.[MT7]-SLLGK[MT7].2y3_1.heavy 403.273 / 461.32 17337.0 25.645599365234375 46 18 10 10 8 2.9571235176704174 33.81664627887396 0.0 4 0.9833375881404589 9.547475525989917 17337.0 39.331078221154876 0.0 - - - - - - - 643.4 34 10 LOC100294341;LOC100506084;LOC100507695;UTP20;ARL17A;PGK1;PGK2;PLD2;LOC653877;TMEM177;TRANK1 ADP-ribosylation factor-like protein 17-like;ADP-ribosylation factor-like protein 17-like;ADP-ribosylation factor-like protein 17-like;UTP20, small subunit (SSU) processome component, homolog (yeast);ADP-ribosylation factor-like 17A;phosphoglycerate kinase 1;phosphoglycerate kinase 2;phospholipase D2;small subunit processome component 20 homolog;transmembrane protein 177;tetratricopeptide repeat and ankyrin repeat containing 1 2183 280 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22523.[MT7]-LLGSLR.2b3_1.heavy 401.767 / 428.299 3234.0 32.14910125732422 48 18 10 10 10 4.284123497327144 23.341997508332753 0.0 3 0.9826488146358833 9.355517759644744 3234.0 8.072143069194142 1.0 - - - - - - - 285.42857142857144 7 14 ASPHD2;ACSS1 aspartate beta-hydroxylase domain containing 2;acyl-CoA synthetase short-chain family member 1 2185 280 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22523.[MT7]-LLGSLR.2y4_1.heavy 401.767 / 432.257 17408.0 32.14910125732422 48 18 10 10 10 4.284123497327144 23.341997508332753 0.0 3 0.9826488146358833 9.355517759644744 17408.0 203.32944360902255 0.0 - - - - - - - 217.42857142857142 34 14 ASPHD2;ACSS1 aspartate beta-hydroxylase domain containing 2;acyl-CoA synthetase short-chain family member 1 2187 280 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22523.[MT7]-LLGSLR.2y5_1.heavy 401.767 / 545.341 38812.0 32.14910125732422 48 18 10 10 10 4.284123497327144 23.341997508332753 0.0 3 0.9826488146358833 9.355517759644744 38812.0 134.55881469925976 0.0 - - - - - - - 249.625 77 8 ASPHD2;ACSS1 aspartate beta-hydroxylase domain containing 2;acyl-CoA synthetase short-chain family member 1 2189 280 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22523.[MT7]-LLGSLR.2b4_1.heavy 401.767 / 515.331 11891.0 32.14910125732422 48 18 10 10 10 4.284123497327144 23.341997508332753 0.0 3 0.9826488146358833 9.355517759644744 11891.0 46.03049372206852 0.0 - - - - - - - 241.3846153846154 23 13 ASPHD2;ACSS1 aspartate beta-hydroxylase domain containing 2;acyl-CoA synthetase short-chain family member 1 2191 281 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543194.[MT7]-YIPSLPDR.2y4_1.heavy 552.812 / 500.283 3179.0 32.30630111694336 34 20 0 10 4 8.083625982305517 12.370686152339669 0.0 10 0.995917118526456 19.307725170753198 3179.0 0.16634277052996266 9.0 - - - - - - - 385.0 547 1 CDC20 cell division cycle 20 homolog (S. cerevisiae) 2193 281 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543194.[MT7]-YIPSLPDR.2y5_1.heavy 552.812 / 587.315 3083.0 32.30630111694336 34 20 0 10 4 8.083625982305517 12.370686152339669 0.0 10 0.995917118526456 19.307725170753198 3083.0 9.148872991715603 1.0 - - - - - - - 355.7692307692308 7 13 CDC20 cell division cycle 20 homolog (S. cerevisiae) 2195 281 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543194.[MT7]-YIPSLPDR.2y6_1.heavy 552.812 / 684.367 46244.0 32.30630111694336 34 20 0 10 4 8.083625982305517 12.370686152339669 0.0 10 0.995917118526456 19.307725170753198 46244.0 68.87961830645688 0.0 - - - - - - - 1156.142857142857 92 7 CDC20 cell division cycle 20 homolog (S. cerevisiae) 2197 281 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB543194.[MT7]-YIPSLPDR.2y7_1.heavy 552.812 / 797.452 8382.0 32.30630111694336 34 20 0 10 4 8.083625982305517 12.370686152339669 0.0 10 0.995917118526456 19.307725170753198 8382.0 35.593123888559575 0.0 - - - - - - - 211.86666666666667 16 15 CDC20 cell division cycle 20 homolog (S. cerevisiae) 2199 282 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22526.[MT7]-VADSK[MT7].2b3_1.heavy 404.244 / 430.242 6216.0 14.840200424194336 41 11 10 10 10 1.1976955329022987 52.94096979234868 0.0 3 0.8668665941865701 3.344093983444192 6216.0 19.605009633911365 0.0 - - - - - - - 236.25 12 16 RNASEH2A;PSMC6;ABCG2 ribonuclease H2, subunit A;proteasome (prosome, macropain) 26S subunit, ATPase, 6;ATP-binding cassette, sub-family G (WHITE), member 2 2201 282 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22526.[MT7]-VADSK[MT7].2y4_1.heavy 404.244 / 564.311 5243.0 14.840200424194336 41 11 10 10 10 1.1976955329022987 52.94096979234868 0.0 3 0.8668665941865701 3.344093983444192 5243.0 21.35797597844454 0.0 - - - - - - - 190.58823529411765 10 17 RNASEH2A;PSMC6;ABCG2 ribonuclease H2, subunit A;proteasome (prosome, macropain) 26S subunit, ATPase, 6;ATP-binding cassette, sub-family G (WHITE), member 2 2203 282 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22526.[MT7]-VADSK[MT7].2b4_1.heavy 404.244 / 517.274 N/A 14.840200424194336 41 11 10 10 10 1.1976955329022987 52.94096979234868 0.0 3 0.8668665941865701 3.344093983444192 324.0 0.17142857142857137 24.0 - - - - - - - 0.0 1 0 RNASEH2A;PSMC6;ABCG2 ribonuclease H2, subunit A;proteasome (prosome, macropain) 26S subunit, ATPase, 6;ATP-binding cassette, sub-family G (WHITE), member 2 2205 282 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB22526.[MT7]-VADSK[MT7].2y3_1.heavy 404.244 / 493.274 1676.0 14.840200424194336 41 11 10 10 10 1.1976955329022987 52.94096979234868 0.0 3 0.8668665941865701 3.344093983444192 1676.0 5.378222283113364 0.0 - - - - - - - 187.57894736842104 3 19 RNASEH2A;PSMC6;ABCG2 ribonuclease H2, subunit A;proteasome (prosome, macropain) 26S subunit, ATPase, 6;ATP-binding cassette, sub-family G (WHITE), member 2 2207 283 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544859.[MT7]-FTDDYQLFEELGK[MT7].3b6_1.heavy 631.656 / 914.401 36244.0 41.117698669433594 48 18 10 10 10 5.138495743273242 19.460948300075774 0.0 3 0.9801734939024308 8.750222736231441 36244.0 71.44556617539763 0.0 - - - - - - - 198.15384615384616 72 13 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 2209 283 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544859.[MT7]-FTDDYQLFEELGK[MT7].3b4_1.heavy 631.656 / 623.279 50137.0 41.117698669433594 48 18 10 10 10 5.138495743273242 19.460948300075774 0.0 3 0.9801734939024308 8.750222736231441 50137.0 100.45832720588236 0.0 - - - - - - - 712.7272727272727 100 11 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 2211 283 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544859.[MT7]-FTDDYQLFEELGK[MT7].3b5_1.heavy 631.656 / 786.343 20223.0 41.117698669433594 48 18 10 10 10 5.138495743273242 19.460948300075774 0.0 3 0.9801734939024308 8.750222736231441 20223.0 73.25678571428571 0.0 - - - - - - - 161.41176470588235 40 17 CAMK2G calcium/calmodulin-dependent protein kinase II gamma 2213 283 B20140227_KEGG1700_set05_05 B20140227_KEGG1700_set05_05 TB544859.[MT7]-FTDDYQLFEELGK[MT7].3b3_1.heavy 631.656 / 508.252 9467.0 41.117698669433594 48 18 10 10 10 5.138495743273242 19.460948300075774 0.0 3 0.9801734939024308 8.750222736231441 9467.0 46.65878571428571 0.0 - - - - - - - 218.10526315789474 18 19 CAMK2G calcium/calmodulin-dependent protein kinase II gamma