Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39094.[MT7]-TPYTDVNIVTIR.2y9_1.heavy 768.431 / 1030.59 2388.0 34.64799880981445 45 17 10 10 8 3.8674595334650825 25.85676698998429 0.0 4 0.9761428293672475 7.97417348938481 2388.0 7.170495773494398 0.0 - - - - - - - 198.91666666666666 4 12 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 3 1 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39094.[MT7]-TPYTDVNIVTIR.2y6_1.heavy 768.431 / 715.446 1910.0 34.64799880981445 45 17 10 10 8 3.8674595334650825 25.85676698998429 0.0 4 0.9761428293672475 7.97417348938481 1910.0 3.179776536312849 1.0 - - - - - - - 665.0 4 7 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 5 1 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39094.[MT7]-TPYTDVNIVTIR.2b5_1.heavy 768.431 / 722.348 1910.0 34.64799880981445 45 17 10 10 8 3.8674595334650825 25.85676698998429 0.0 4 0.9761428293672475 7.97417348938481 1910.0 6.277085427135679 0.0 - - - - - - - 298.5 3 8 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 7 1 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39094.[MT7]-TPYTDVNIVTIR.2y7_1.heavy 768.431 / 814.515 3224.0 34.64799880981445 45 17 10 10 8 3.8674595334650825 25.85676698998429 0.0 4 0.9761428293672475 7.97417348938481 3224.0 28.70346128401109 0.0 - - - - - - - 212.11111111111111 6 9 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 9 2 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543046.[MT7]-WNPTQNVR.2y4_1.heavy 579.81 / 516.289 3063.0 25.818300247192383 50 20 10 10 10 50.83551636204867 1.9671286367547385 0.0 3 0.9992661634371355 45.55500876915356 3063.0 2.5906390362412273 2.0 - - - - - - - 272.0 6 9 UBE2R2;CDC34 ubiquitin-conjugating enzyme E2R 2;cell division cycle 34 homolog (S. cerevisiae) 11 2 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543046.[MT7]-WNPTQNVR.2y5_1.heavy 579.81 / 617.337 4901.0 25.818300247192383 50 20 10 10 10 50.83551636204867 1.9671286367547385 0.0 3 0.9992661634371355 45.55500876915356 4901.0 18.407033340796897 0.0 - - - - - - - 204.0 9 12 UBE2R2;CDC34 ubiquitin-conjugating enzyme E2R 2;cell division cycle 34 homolog (S. cerevisiae) 13 2 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543046.[MT7]-WNPTQNVR.2y6_1.heavy 579.81 / 714.389 73718.0 25.818300247192383 50 20 10 10 10 50.83551636204867 1.9671286367547385 0.0 3 0.9992661634371355 45.55500876915356 73718.0 172.88845079670364 0.0 - - - - - - - 216.75 147 8 UBE2R2;CDC34 ubiquitin-conjugating enzyme E2R 2;cell division cycle 34 homolog (S. cerevisiae) 15 2 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543046.[MT7]-WNPTQNVR.2y7_1.heavy 579.81 / 828.432 63508.0 25.818300247192383 50 20 10 10 10 50.83551636204867 1.9671286367547385 0.0 3 0.9992661634371355 45.55500876915356 63508.0 170.2893765299185 0.0 - - - - - - - 265.2 127 10 UBE2R2;CDC34 ubiquitin-conjugating enzyme E2R 2;cell division cycle 34 homolog (S. cerevisiae) 17 3 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22079.[MT7]-SLQEEPVEGFR.2y9_1.heavy 717.871 / 1090.52 3224.0 29.445600509643555 46 16 10 10 10 2.3627269279576018 36.71565862661002 0.0 3 0.9605004275424279 6.1890810320742915 3224.0 52.01747899159664 0.0 - - - - - - - 238.66666666666666 6 6 UBE2R2 ubiquitin-conjugating enzyme E2R 2 19 3 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22079.[MT7]-SLQEEPVEGFR.2y6_1.heavy 717.871 / 704.373 5971.0 29.445600509643555 46 16 10 10 10 2.3627269279576018 36.71565862661002 0.0 3 0.9605004275424279 6.1890810320742915 5971.0 38.82943491269489 0.0 - - - - - - - 204.57142857142858 11 7 UBE2R2 ubiquitin-conjugating enzyme E2R 2 21 3 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22079.[MT7]-SLQEEPVEGFR.2b5_1.heavy 717.871 / 731.369 4657.0 29.445600509643555 46 16 10 10 10 2.3627269279576018 36.71565862661002 0.0 3 0.9605004275424279 6.1890810320742915 4657.0 56.252256847508875 0.0 - - - - - - - 225.44444444444446 9 9 UBE2R2 ubiquitin-conjugating enzyme E2R 2 23 3 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22079.[MT7]-SLQEEPVEGFR.2y7_1.heavy 717.871 / 833.415 2627.0 29.445600509643555 46 16 10 10 10 2.3627269279576018 36.71565862661002 0.0 3 0.9605004275424279 6.1890810320742915 2627.0 32.296924158784854 0.0 - - - - - - - 208.875 5 8 UBE2R2 ubiquitin-conjugating enzyme E2R 2 25 4 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544698.[MT7]-LSDFIDPQEGWK[MT7].3y3_1.heavy 574.97 / 534.316 36923.0 39.4379997253418 48 18 10 10 10 2.9103138989794197 27.517069752568034 0.0 3 0.9811549067000406 8.975917008810349 36923.0 85.40426390131265 0.0 - - - - - - - 772.625 73 8 IRAK4 interleukin-1 receptor-associated kinase 4 27 4 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544698.[MT7]-LSDFIDPQEGWK[MT7].3b6_1.heavy 574.97 / 835.432 31071.0 39.4379997253418 48 18 10 10 10 2.9103138989794197 27.517069752568034 0.0 3 0.9811549067000406 8.975917008810349 31071.0 141.7802912621359 0.0 - - - - - - - 269.72727272727275 62 11 IRAK4 interleukin-1 receptor-associated kinase 4 29 4 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544698.[MT7]-LSDFIDPQEGWK[MT7].3b4_1.heavy 574.97 / 607.321 25714.0 39.4379997253418 48 18 10 10 10 2.9103138989794197 27.517069752568034 0.0 3 0.9811549067000406 8.975917008810349 25714.0 68.63369150779897 0.0 - - - - - - - 255.4 51 10 IRAK4 interleukin-1 receptor-associated kinase 4 31 4 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544698.[MT7]-LSDFIDPQEGWK[MT7].3y4_1.heavy 574.97 / 663.358 17143.0 39.4379997253418 48 18 10 10 10 2.9103138989794197 27.517069752568034 0.0 3 0.9811549067000406 8.975917008810349 17143.0 52.873134255173085 0.0 - - - - - - - 270.85714285714283 34 7 IRAK4 interleukin-1 receptor-associated kinase 4 33 5 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22075.[MT7]-C[CAM]REVAESC[CAM]K[MT7].3y3_1.heavy 476.239 / 538.278 7260.0 14.9975004196167 47 17 10 10 10 1.863730760681494 41.172498000828 0.0 3 0.979186453864834 8.539514326490531 7260.0 30.504201680672267 0.0 - - - - - - - 202.0 14 22 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 35 5 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22075.[MT7]-C[CAM]REVAESC[CAM]K[MT7].3b5_1.heavy 476.239 / 760.389 1270.0 14.9975004196167 47 17 10 10 10 1.863730760681494 41.172498000828 0.0 3 0.979186453864834 8.539514326490531 1270.0 11.697209449817663 0.0 - - - - - - - 126.5625 2 16 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 37 5 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22075.[MT7]-C[CAM]REVAESC[CAM]K[MT7].3y4_1.heavy 476.239 / 667.32 3491.0 14.9975004196167 47 17 10 10 10 1.863730760681494 41.172498000828 0.0 3 0.979186453864834 8.539514326490531 3491.0 97.38655808080809 0.0 - - - - - - - 127.57142857142857 6 14 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 39 5 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22075.[MT7]-C[CAM]REVAESC[CAM]K[MT7].3y5_1.heavy 476.239 / 738.357 1508.0 14.9975004196167 47 17 10 10 10 1.863730760681494 41.172498000828 0.0 3 0.979186453864834 8.539514326490531 1508.0 8.892703497579296 0.0 - - - - - - - 105.94444444444444 3 18 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 41 6 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22077.[MT7]-LLPSDSPSTPK[MT7].2y5_1.heavy 715.411 / 673.4 1320.0 27.215200424194336 38 13 10 5 10 0.9789919150309745 68.05306401206886 0.041599273681640625 3 0.9086582148402694 4.051959144035154 1320.0 7.4 0.0 - - - - - - - 206.25 2 8 WEE2 WEE1 homolog 2 (S. pombe) 43 6 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22077.[MT7]-LLPSDSPSTPK[MT7].2y9_1.heavy 715.411 / 1059.54 2530.0 27.215200424194336 38 13 10 5 10 0.9789919150309745 68.05306401206886 0.041599273681640625 3 0.9086582148402694 4.051959144035154 2530.0 45.08 0.0 - - - - - - - 264.0 5 5 WEE2 WEE1 homolog 2 (S. pombe) 45 6 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22077.[MT7]-LLPSDSPSTPK[MT7].2y6_1.heavy 715.411 / 760.432 1870.0 27.215200424194336 38 13 10 5 10 0.9789919150309745 68.05306401206886 0.041599273681640625 3 0.9086582148402694 4.051959144035154 1870.0 11.39 0.0 - - - - - - - 260.0 3 11 WEE2 WEE1 homolog 2 (S. pombe) 47 6 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22077.[MT7]-LLPSDSPSTPK[MT7].2b5_1.heavy 715.411 / 670.389 2090.0 27.215200424194336 38 13 10 5 10 0.9789919150309745 68.05306401206886 0.041599273681640625 3 0.9086582148402694 4.051959144035154 2090.0 6.083454545454545 0.0 - - - - - - - 253.84615384615384 4 13 WEE2 WEE1 homolog 2 (S. pombe) 49 7 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39363.[MT7]-RK[MT7]PSVPDSASPADDSFVDPGER.3b8_1.heavy 873.108 / 1155.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCK1 NCK adaptor protein 1 51 7 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39363.[MT7]-RK[MT7]PSVPDSASPADDSFVDPGER.3b7_1.heavy 873.108 / 1068.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCK1 NCK adaptor protein 1 53 7 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39363.[MT7]-RK[MT7]PSVPDSASPADDSFVDPGER.3b7_2.heavy 873.108 / 534.824 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCK1 NCK adaptor protein 1 55 7 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39363.[MT7]-RK[MT7]PSVPDSASPADDSFVDPGER.3y9_1.heavy 873.108 / 1021.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCK1 NCK adaptor protein 1 57 8 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21757.[MT7]-ISDFGLAR.2y5_1.heavy 511.791 / 563.33 43963.0 32.72010040283203 48 18 10 10 10 5.70949774783753 13.584114046009955 0.0 3 0.9892957280528727 11.917787561713412 43963.0 104.00969929104943 0.0 - - - - - - - 569.0 87 7 IRAK4 interleukin-1 receptor-associated kinase 4 59 8 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21757.[MT7]-ISDFGLAR.2y6_1.heavy 511.791 / 678.357 8500.0 32.72010040283203 48 18 10 10 10 5.70949774783753 13.584114046009955 0.0 3 0.9892957280528727 11.917787561713412 8500.0 18.95955869557651 2.0 - - - - - - - 206.88888888888889 94 9 IRAK4 interleukin-1 receptor-associated kinase 4 61 8 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21757.[MT7]-ISDFGLAR.2b5_1.heavy 511.791 / 664.342 12352.0 32.72010040283203 48 18 10 10 10 5.70949774783753 13.584114046009955 0.0 3 0.9892957280528727 11.917787561713412 12352.0 23.726387910053713 0.0 - - - - - - - 721.0 24 7 IRAK4 interleukin-1 receptor-associated kinase 4 63 8 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21757.[MT7]-ISDFGLAR.2y7_1.heavy 511.791 / 765.389 55518.0 32.72010040283203 48 18 10 10 10 5.70949774783753 13.584114046009955 0.0 3 0.9892957280528727 11.917787561713412 55518.0 98.41284818067754 0.0 - - - - - - - 365.0 111 4 IRAK4 interleukin-1 receptor-associated kinase 4 65 9 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22484.[MT7]-ENTEGEYSGIEHVIVDGVVQSIK[MT7].4b12_2.heavy 698.365 / 745.829 1926.0 42.19985008239746 34 7 10 7 10 0.4155563155070305 113.12989633072701 0.025501251220703125 3 0.7002996707648724 2.195440365984219 1926.0 17.82925714285714 0.0 - - - - - - - 111.5 3 28 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 67 9 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22484.[MT7]-ENTEGEYSGIEHVIVDGVVQSIK[MT7].4b13_2.heavy 698.365 / 795.364 3036.0 42.19985008239746 34 7 10 7 10 0.4155563155070305 113.12989633072701 0.025501251220703125 3 0.7002996707648724 2.195440365984219 3036.0 53.666112347052284 0.0 - - - - - - - 186.57142857142858 6 28 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 69 9 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22484.[MT7]-ENTEGEYSGIEHVIVDGVVQSIK[MT7].4b9_1.heavy 698.365 / 1111.47 321.0 42.19985008239746 34 7 10 7 10 0.4155563155070305 113.12989633072701 0.025501251220703125 3 0.7002996707648724 2.195440365984219 321.0 0.5487179487179487 1.0 - - - - - - - 0.0 0 0 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 71 9 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22484.[MT7]-ENTEGEYSGIEHVIVDGVVQSIK[MT7].4b6_1.heavy 698.365 / 804.349 876.0 42.19985008239746 34 7 10 7 10 0.4155563155070305 113.12989633072701 0.025501251220703125 3 0.7002996707648724 2.195440365984219 876.0 2.114192495921697 0.0 - - - - - - - 0.0 1 0 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 73 10 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21883.[MT7]-FAQTVMTSR.2y8_1.heavy 592.814 / 893.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 75 10 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21883.[MT7]-FAQTVMTSR.2b4_1.heavy 592.814 / 592.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 77 10 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21883.[MT7]-FAQTVMTSR.2y6_1.heavy 592.814 / 694.355 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 79 10 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21883.[MT7]-FAQTVMTSR.2b5_1.heavy 592.814 / 691.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 81 11 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22488.[MT7]-IVVQGEPGDEFFIILEGSAAVLQRR.3b6_1.heavy 963.198 / 770.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 83 11 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22488.[MT7]-IVVQGEPGDEFFIILEGSAAVLQRR.3b4_1.heavy 963.198 / 584.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 85 11 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22488.[MT7]-IVVQGEPGDEFFIILEGSAAVLQRR.3y19_2.heavy 963.198 / 1059.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 87 11 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22488.[MT7]-IVVQGEPGDEFFIILEGSAAVLQRR.3y10_1.heavy 963.198 / 1086.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 89 12 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21987.[MT7]-SLLVTELGSSR.2y8_1.heavy 653.378 / 848.447 10530.0 34.951499938964844 45 15 10 10 10 2.697503584496336 37.07131311140463 0.0 3 0.9556294597793962 5.837084271051593 10530.0 30.18531435153764 1.0 - - - - - - - 184.2 22 15 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 91 12 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21987.[MT7]-SLLVTELGSSR.2y9_1.heavy 653.378 / 961.531 5318.0 34.951499938964844 45 15 10 10 10 2.697503584496336 37.07131311140463 0.0 3 0.9556294597793962 5.837084271051593 5318.0 25.784033516392864 0.0 - - - - - - - 230.33333333333334 10 6 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 93 12 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21987.[MT7]-SLLVTELGSSR.2y10_1.heavy 653.378 / 1074.62 4148.0 34.951499938964844 45 15 10 10 10 2.697503584496336 37.07131311140463 0.0 3 0.9556294597793962 5.837084271051593 4148.0 37.36679245283019 1.0 - - - - - - - 166.85714285714286 8 7 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 95 12 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21987.[MT7]-SLLVTELGSSR.2y7_1.heavy 653.378 / 749.379 14465.0 34.951499938964844 45 15 10 10 10 2.697503584496336 37.07131311140463 0.0 3 0.9556294597793962 5.837084271051593 14465.0 62.57586206896552 0.0 - - - - - - - 222.1818181818182 28 11 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 97 13 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22487.[MT7]-QSFNIIFGEC[CAM]PYC[CAM]SK[MT7]PITLK[MT7].4y5_1.heavy 709.379 / 715.483 818.0 38.88779830932617 48 20 10 10 8 5.406087970656652 18.49766421537781 0.0 4 0.993896837570839 15.789332745462978 818.0 0.8178148902466622 9.0 - - - - - - - 268.85714285714283 2 14 FANCL Fanconi anemia, complementation group L 99 13 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22487.[MT7]-QSFNIIFGEC[CAM]PYC[CAM]SK[MT7]PITLK[MT7].4b4_1.heavy 709.379 / 621.311 2946.0 38.88779830932617 48 20 10 10 8 5.406087970656652 18.49766421537781 0.0 4 0.993896837570839 15.789332745462978 2946.0 7.499999999999999 0.0 - - - - - - - 218.5 5 12 FANCL Fanconi anemia, complementation group L 101 13 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22487.[MT7]-QSFNIIFGEC[CAM]PYC[CAM]SK[MT7]PITLK[MT7].4b5_1.heavy 709.379 / 734.395 1719.0 38.88779830932617 48 20 10 10 8 5.406087970656652 18.49766421537781 0.0 4 0.993896837570839 15.789332745462978 1719.0 1.575190995164876 0.0 - - - - - - - 268.0 3 11 FANCL Fanconi anemia, complementation group L 103 13 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22487.[MT7]-QSFNIIFGEC[CAM]PYC[CAM]SK[MT7]PITLK[MT7].4b3_1.heavy 709.379 / 507.268 737.0 38.88779830932617 48 20 10 10 8 5.406087970656652 18.49766421537781 0.0 4 0.993896837570839 15.789332745462978 737.0 2.1240213266727506 5.0 - - - - - - - 0.0 1 0 FANCL Fanconi anemia, complementation group L 105 14 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21614.[MT7]-AATVVAR.2y5_1.heavy 416.262 / 545.341 7835.0 17.622175216674805 39 18 9 6 6 2.751445113585805 28.108334119433565 0.03350067138671875 5 0.9871724669480743 10.884925452477859 7835.0 27.6820298362537 0.0 - - - - - - - 594.9 15 10 PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 107 14 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21614.[MT7]-AATVVAR.2b4_1.heavy 416.262 / 487.3 8162.0 17.622175216674805 39 18 9 6 6 2.751445113585805 28.108334119433565 0.03350067138671875 5 0.9871724669480743 10.884925452477859 8162.0 33.9828669704078 2.0 - - - - - - - 696.9285714285714 48 14 PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 109 14 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21614.[MT7]-AATVVAR.2y6_1.heavy 416.262 / 616.378 21511.0 17.622175216674805 39 18 9 6 6 2.751445113585805 28.108334119433565 0.03350067138671875 5 0.9871724669480743 10.884925452477859 21511.0 112.87026882921677 0.0 - - - - - - - 229.72727272727272 43 33 PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 111 14 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21614.[MT7]-AATVVAR.2b5_1.heavy 416.262 / 586.368 9214.0 17.622175216674805 39 18 9 6 6 2.751445113585805 28.108334119433565 0.03350067138671875 5 0.9871724669480743 10.884925452477859 9214.0 5.687033040742912 1.0 - - - - - - - 342.25 20 16 PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 113 15 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21882.[MT7]-EFLEVEK[MT7].2y4_1.heavy 591.336 / 648.369 N/A 31.020700454711914 36 18 2 10 6 2.8698505139803507 23.35136064983587 0.0 5 0.9813719608305431 9.028223733351917 3207.0 11.457224880382775 0.0 - - - - - - - 268.3636363636364 6 11 WEE2 WEE1 homolog 2 (S. pombe) 115 15 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21882.[MT7]-EFLEVEK[MT7].2b4_1.heavy 591.336 / 663.347 3335.0 31.020700454711914 36 18 2 10 6 2.8698505139803507 23.35136064983587 0.0 5 0.9813719608305431 9.028223733351917 3335.0 12.738771602812164 1.0 - - - - - - - 273.8 6 15 WEE2 WEE1 homolog 2 (S. pombe) 117 15 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21882.[MT7]-EFLEVEK[MT7].2y3_1.heavy 591.336 / 519.326 2822.0 31.020700454711914 36 18 2 10 6 2.8698505139803507 23.35136064983587 0.0 5 0.9813719608305431 9.028223733351917 2822.0 1.6570155902004458 2.0 - - - - - - - 617.9090909090909 21 11 WEE2 WEE1 homolog 2 (S. pombe) 119 15 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21882.[MT7]-EFLEVEK[MT7].2y6_1.heavy 591.336 / 908.521 2309.0 31.020700454711914 36 18 2 10 6 2.8698505139803507 23.35136064983587 0.0 5 0.9813719608305431 9.028223733351917 2309.0 11.686767396028097 0.0 - - - - - - - 219.92857142857142 4 14 WEE2 WEE1 homolog 2 (S. pombe) 121 16 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545129.[MT7]-VTYQGYSPYQLTWGRPSTR.4y10_2.heavy 601.81 / 601.326 N/A 34.780799865722656 38 12 6 10 10 1.5743610471431675 51.07117338379831 0.0 3 0.8952885057209681 3.7800768699622163 41726.0 3.1801511894662258 1.0 - - - - - - - 8268.5 124 2 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 123 16 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545129.[MT7]-VTYQGYSPYQLTWGRPSTR.4y12_2.heavy 601.81 / 731.383 18727.0 34.780799865722656 38 12 6 10 10 1.5743610471431675 51.07117338379831 0.0 3 0.8952885057209681 3.7800768699622163 18727.0 60.12347156395472 0.0 - - - - - - - 301.375 37 8 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 125 16 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545129.[MT7]-VTYQGYSPYQLTWGRPSTR.4b5_1.heavy 601.81 / 693.369 9309.0 34.780799865722656 38 12 6 10 10 1.5743610471431675 51.07117338379831 0.0 3 0.8952885057209681 3.7800768699622163 9309.0 34.815564391889076 0.0 - - - - - - - 197.5 18 10 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 127 16 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545129.[MT7]-VTYQGYSPYQLTWGRPSTR.4b3_1.heavy 601.81 / 508.289 4490.0 34.780799865722656 38 12 6 10 10 1.5743610471431675 51.07117338379831 0.0 3 0.8952885057209681 3.7800768699622163 4490.0 9.015018498150186 0.0 - - - - - - - 269.09090909090907 8 11 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 129 17 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39274.[MT7]-FDYVAQQEQELDIK[MT7].2b3_1.heavy 1007.52 / 570.268 1817.0 35.20232677459717 31 5 10 6 10 0.7525922674906944 86.91321154844556 0.039699554443359375 3 0.6963504761314809 2.1803084867663185 1817.0 22.66791405827344 0.0 - - - - - - - 136.6 3 5 NCK1 NCK adaptor protein 1 131 17 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39274.[MT7]-FDYVAQQEQELDIK[MT7].2y8_1.heavy 1007.52 / 1146.61 1135.0 35.20232677459717 31 5 10 6 10 0.7525922674906944 86.91321154844556 0.039699554443359375 3 0.6963504761314809 2.1803084867663185 1135.0 10.960526315789474 0.0 - - - - - - - 194.85714285714286 2 7 NCK1 NCK adaptor protein 1 133 17 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39274.[MT7]-FDYVAQQEQELDIK[MT7].2b4_1.heavy 1007.52 / 669.336 3293.0 35.20232677459717 31 5 10 6 10 0.7525922674906944 86.91321154844556 0.039699554443359375 3 0.6963504761314809 2.1803084867663185 3293.0 15.95726872246696 0.0 - - - - - - - 198.875 6 8 NCK1 NCK adaptor protein 1 135 17 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39274.[MT7]-FDYVAQQEQELDIK[MT7].2b5_1.heavy 1007.52 / 740.374 1476.0 35.20232677459717 31 5 10 6 10 0.7525922674906944 86.91321154844556 0.039699554443359375 3 0.6963504761314809 2.1803084867663185 1476.0 15.873701497144621 0.0 - - - - - - - 250.1 2 10 NCK1 NCK adaptor protein 1 137 18 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543980.[MT7]-QC[CAM]PLLLPQNR.3b4_1.heavy 461.595 / 643.335 60785.0 30.416150093078613 44 18 10 6 10 5.898512371243184 16.953427187425525 0.03949928283691406 3 0.9857114936760656 10.3121797802684 60785.0 98.90131592771962 0.0 - - - - - - - 225.0 121 5 FANCL Fanconi anemia, complementation group L 139 18 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543980.[MT7]-QC[CAM]PLLLPQNR.3b5_1.heavy 461.595 / 756.419 31393.0 30.416150093078613 44 18 10 6 10 5.898512371243184 16.953427187425525 0.03949928283691406 3 0.9857114936760656 10.3121797802684 31393.0 73.51122493150685 0.0 - - - - - - - 229.16666666666666 62 6 FANCL Fanconi anemia, complementation group L 141 18 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543980.[MT7]-QC[CAM]PLLLPQNR.3y4_1.heavy 461.595 / 514.273 163218.0 30.416150093078613 44 18 10 6 10 5.898512371243184 16.953427187425525 0.03949928283691406 3 0.9857114936760656 10.3121797802684 163218.0 179.07334084695793 0.0 - - - - - - - 375.0 326 2 FANCL Fanconi anemia, complementation group L 143 18 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543980.[MT7]-QC[CAM]PLLLPQNR.3y5_1.heavy 461.595 / 627.357 22263.0 30.416150093078613 44 18 10 6 10 5.898512371243184 16.953427187425525 0.03949928283691406 3 0.9857114936760656 10.3121797802684 22263.0 18.78317051509769 1.0 - - - - - - - 250.0 44 7 FANCL Fanconi anemia, complementation group L 145 19 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544686.[MT7]-ATNVAHWTTPSLK[MT7].3y6_1.heavy 571.989 / 790.479 7735.0 29.976699829101562 44 14 10 10 10 2.9323599978390757 28.183019326416204 0.0 3 0.9458870655443224 5.281213085803921 7735.0 28.81844345517026 0.0 - - - - - - - 336.9 15 10 IL15RA interleukin 15 receptor, alpha 147 19 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544686.[MT7]-ATNVAHWTTPSLK[MT7].3b4_1.heavy 571.989 / 530.305 5864.0 29.976699829101562 44 14 10 10 10 2.9323599978390757 28.183019326416204 0.0 3 0.9458870655443224 5.281213085803921 5864.0 26.5401611398041 0.0 - - - - - - - 305.1111111111111 11 9 IL15RA interleukin 15 receptor, alpha 149 19 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544686.[MT7]-ATNVAHWTTPSLK[MT7].3b5_1.heavy 571.989 / 601.343 16468.0 29.976699829101562 44 14 10 10 10 2.9323599978390757 28.183019326416204 0.0 3 0.9458870655443224 5.281213085803921 16468.0 42.47820560747663 0.0 - - - - - - - 288.0 32 13 IL15RA interleukin 15 receptor, alpha 151 19 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544686.[MT7]-ATNVAHWTTPSLK[MT7].3y4_1.heavy 571.989 / 588.384 20834.0 29.976699829101562 44 14 10 10 10 2.9323599978390757 28.183019326416204 0.0 3 0.9458870655443224 5.281213085803921 20834.0 34.61720366331835 0.0 - - - - - - - 305.0 41 9 IL15RA interleukin 15 receptor, alpha 153 20 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21769.[MT7]-VPYLAVAR.2y5_1.heavy 516.82 / 529.346 1592.0 32.57749938964844 44 20 10 10 4 5.334945406435068 18.744334268046856 0.0 9 0.9982628353367665 29.605948979805227 1592.0 2.811388894243402 13.0 - - - - - - - 235.88888888888889 5 9 LIG1 ligase I, DNA, ATP-dependent 155 20 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21769.[MT7]-VPYLAVAR.2b4_1.heavy 516.82 / 617.378 N/A 32.57749938964844 44 20 10 10 4 5.334945406435068 18.744334268046856 0.0 9 0.9982628353367665 29.605948979805227 663.0 0.017757685389314243 31.0 - - - - - - - 682.2857142857143 3 7 LIG1 ligase I, DNA, ATP-dependent 157 20 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21769.[MT7]-VPYLAVAR.2y6_1.heavy 516.82 / 692.409 3051.0 32.57749938964844 44 20 10 10 4 5.334945406435068 18.744334268046856 0.0 9 0.9982628353367665 29.605948979805227 3051.0 23.863207390335134 1.0 - - - - - - - 248.75 6 8 LIG1 ligase I, DNA, ATP-dependent 159 20 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21769.[MT7]-VPYLAVAR.2y7_1.heavy 516.82 / 789.462 32501.0 32.57749938964844 44 20 10 10 4 5.334945406435068 18.744334268046856 0.0 9 0.9982628353367665 29.605948979805227 32501.0 115.14173366834169 0.0 - - - - - - - 265.375 65 8 LIG1 ligase I, DNA, ATP-dependent 161 21 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21877.[MT7]-APIQWEER.2y4_1.heavy 586.813 / 619.284 5299.0 29.127199172973633 50 20 10 10 10 20.614434633635334 4.8509698071872425 0.0 3 0.9993312053545595 47.71904775395674 5299.0 38.47534782608696 0.0 - - - - - - - 191.73333333333332 10 15 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 163 21 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21877.[MT7]-APIQWEER.2y5_1.heavy 586.813 / 747.342 9330.0 29.127199172973633 50 20 10 10 10 20.614434633635334 4.8509698071872425 0.0 3 0.9993312053545595 47.71904775395674 9330.0 46.639934189232925 0.0 - - - - - - - 264.9 18 10 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 165 21 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21877.[MT7]-APIQWEER.2y6_1.heavy 586.813 / 860.426 4377.0 29.127199172973633 50 20 10 10 10 20.614434633635334 4.8509698071872425 0.0 3 0.9993312053545595 47.71904775395674 4377.0 26.624032349335092 0.0 - - - - - - - 230.22222222222223 8 9 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 167 21 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21877.[MT7]-APIQWEER.2y7_1.heavy 586.813 / 957.479 62431.0 29.127199172973633 50 20 10 10 10 20.614434633635334 4.8509698071872425 0.0 3 0.9993312053545595 47.71904775395674 62431.0 510.3055652173913 0.0 - - - - - - - 156.8181818181818 124 11 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 169 22 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39169.[MT7]-LVYADTC[CAM]FSTIK[MT7].2y4_1.heavy 853.457 / 592.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - FANCL Fanconi anemia, complementation group L 171 22 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39169.[MT7]-LVYADTC[CAM]FSTIK[MT7].2b3_1.heavy 853.457 / 520.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - FANCL Fanconi anemia, complementation group L 173 22 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39169.[MT7]-LVYADTC[CAM]FSTIK[MT7].2b5_1.heavy 853.457 / 706.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - FANCL Fanconi anemia, complementation group L 175 22 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39169.[MT7]-LVYADTC[CAM]FSTIK[MT7].2y7_1.heavy 853.457 / 1000.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - FANCL Fanconi anemia, complementation group L 177 23 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21767.[MT7]-LTPAPLK[MT7].2y4_1.heavy 514.341 / 572.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 179 23 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21767.[MT7]-LTPAPLK[MT7].2y5_1.heavy 514.341 / 669.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 181 23 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21767.[MT7]-LTPAPLK[MT7].2b4_1.heavy 514.341 / 527.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 183 23 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21767.[MT7]-LTPAPLK[MT7].2y3_1.heavy 514.341 / 501.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 185 24 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21978.[MT7]-RSGSQAHEQR.2b8_1.heavy 650.335 / 997.493 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 187 24 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21978.[MT7]-RSGSQAHEQR.2y9_1.heavy 650.335 / 999.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 189 24 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21978.[MT7]-RSGSQAHEQR.2b6_1.heavy 650.335 / 731.392 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 191 24 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21978.[MT7]-RSGSQAHEQR.2b5_1.heavy 650.335 / 660.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 193 25 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1287500.0 29.527799606323242 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1287500.0 2805.3170040913215 0.0 - - - - - - - 1168.5714285714287 2575 7 195 25 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 354155.0 29.527799606323242 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 354155.0 290.9815673411068 0.0 - - - - - - - 743.5454545454545 708 11 197 25 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 298771.0 29.527799606323242 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 298771.0 458.99212306438466 0.0 - - - - - - - 417.14285714285717 597 7 199 26 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21979.[MT7]-DYNVTANSK[MT7].2b3_1.heavy 650.343 / 537.242 1379.0 19.775150775909424 40 14 10 6 10 2.0367689026113274 38.69605572687899 0.031000137329101562 3 0.938183017915573 4.937935847859281 1379.0 18.259377735338585 1.0 - - - - - - - 125.125 2 24 LDHA lactate dehydrogenase A 201 26 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21979.[MT7]-DYNVTANSK[MT7].2y4_1.heavy 650.343 / 563.327 1061.0 19.775150775909424 40 14 10 6 10 2.0367689026113274 38.69605572687899 0.031000137329101562 3 0.938183017915573 4.937935847859281 1061.0 17.550344140313577 0.0 - - - - - - - 128.64 2 25 LDHA lactate dehydrogenase A 203 26 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21979.[MT7]-DYNVTANSK[MT7].2y5_1.heavy 650.343 / 664.375 1980.0 19.775150775909424 40 14 10 6 10 2.0367689026113274 38.69605572687899 0.031000137329101562 3 0.938183017915573 4.937935847859281 1980.0 14.727313735809336 0.0 - - - - - - - 113.83333333333333 3 18 LDHA lactate dehydrogenase A 205 26 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21979.[MT7]-DYNVTANSK[MT7].2b4_1.heavy 650.343 / 636.311 1096.0 19.775150775909424 40 14 10 6 10 2.0367689026113274 38.69605572687899 0.031000137329101562 3 0.938183017915573 4.937935847859281 1096.0 16.06503246428928 0.0 - - - - - - - 159.08333333333334 2 24 LDHA lactate dehydrogenase A 207 27 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21973.[MT7]-VSILESLDK[MT7].2y4_1.heavy 646.389 / 606.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 209 27 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21973.[MT7]-VSILESLDK[MT7].2y8_1.heavy 646.389 / 1048.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 211 27 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21973.[MT7]-VSILESLDK[MT7].2y5_1.heavy 646.389 / 735.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 213 27 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21973.[MT7]-VSILESLDK[MT7].2y6_1.heavy 646.389 / 848.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 215 28 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21871.[MT7]-SAITVFPQR.2y4_1.heavy 581.839 / 547.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS2;NOS3 nitric oxide synthase 2, inducible;nitric oxide synthase 3 (endothelial cell) 217 28 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21871.[MT7]-SAITVFPQR.2y8_1.heavy 581.839 / 931.536 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS2;NOS3 nitric oxide synthase 2, inducible;nitric oxide synthase 3 (endothelial cell) 219 28 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21871.[MT7]-SAITVFPQR.2y6_1.heavy 581.839 / 747.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS2;NOS3 nitric oxide synthase 2, inducible;nitric oxide synthase 3 (endothelial cell) 221 28 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21871.[MT7]-SAITVFPQR.2b5_1.heavy 581.839 / 616.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS2;NOS3 nitric oxide synthase 2, inducible;nitric oxide synthase 3 (endothelial cell) 223 29 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38798.[MT7]-LVEAEVHR.2y5_1.heavy 548.815 / 611.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 225 29 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38798.[MT7]-LVEAEVHR.2y6_1.heavy 548.815 / 740.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 227 29 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38798.[MT7]-LVEAEVHR.2b5_1.heavy 548.815 / 686.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 229 29 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38798.[MT7]-LVEAEVHR.2y7_1.heavy 548.815 / 839.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 231 30 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 479793.0 15.275099754333496 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 479793.0 6256.457312490879 0.0 - - - - - - - 712.0 959 8 233 30 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 882355.0 15.275099754333496 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 882355.0 7500.740744036133 0.0 - - - - - - - 743.8333333333334 1764 6 235 30 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 341115.0 15.275099754333496 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 341115.0 1720.0086310344147 0.0 - - - - - - - 384.7142857142857 682 7 237 31 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38895.[MT7]-YQPDPWK[MT7].2y4_1.heavy 611.329 / 689.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 239 31 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38895.[MT7]-YQPDPWK[MT7].2y5_1.heavy 611.329 / 786.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 241 31 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38895.[MT7]-YQPDPWK[MT7].2b4_1.heavy 611.329 / 648.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 243 31 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38895.[MT7]-YQPDPWK[MT7].2y3_1.heavy 611.329 / 574.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 245 32 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543063.[MT7]-LQEELNK[MT7].2y4_1.heavy 581.34 / 647.385 694.0 24.93869972229004 33 13 9 5 6 1.880076807829051 42.601023727870796 0.042999267578125 5 0.9112317335769837 4.11118735973829 694.0 0.6395161290322581 19.0 - - - - - - - 277.53333333333336 2 15 ORC3;HMMR origin recognition complex, subunit 3;hyaluronan-mediated motility receptor (RHAMM) 247 32 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543063.[MT7]-LQEELNK[MT7].2b3_1.heavy 581.34 / 515.295 2082.0 24.93869972229004 33 13 9 5 6 1.880076807829051 42.601023727870796 0.042999267578125 5 0.9112317335769837 4.11118735973829 2082.0 5.770749727622999 1.0 - - - - - - - 835.7142857142857 4 7 ORC3;HMMR origin recognition complex, subunit 3;hyaluronan-mediated motility receptor (RHAMM) 249 32 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543063.[MT7]-LQEELNK[MT7].2b4_1.heavy 581.34 / 644.337 1091.0 24.93869972229004 33 13 9 5 6 1.880076807829051 42.601023727870796 0.042999267578125 5 0.9112317335769837 4.11118735973829 1091.0 2.753662570287255 3.0 - - - - - - - 266.3125 5 16 ORC3;HMMR origin recognition complex, subunit 3;hyaluronan-mediated motility receptor (RHAMM) 251 32 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543063.[MT7]-LQEELNK[MT7].2y6_1.heavy 581.34 / 904.486 892.0 24.93869972229004 33 13 9 5 6 1.880076807829051 42.601023727870796 0.042999267578125 5 0.9112317335769837 4.11118735973829 892.0 1.148110831234257 2.0 - - - - - - - 0.0 1 0 ORC3;HMMR origin recognition complex, subunit 3;hyaluronan-mediated motility receptor (RHAMM) 253 33 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38897.[MT7]-HNIQALLK[MT7].2y4_1.heavy 612.887 / 588.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 255 33 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38897.[MT7]-HNIQALLK[MT7].2y5_1.heavy 612.887 / 716.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 257 33 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38897.[MT7]-HNIQALLK[MT7].2y3_1.heavy 612.887 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 259 33 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38897.[MT7]-HNIQALLK[MT7].2y7_1.heavy 612.887 / 943.606 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 261 34 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39077.[MT7]-LVVVDENDVVK[MT7].2y8_1.heavy 758.945 / 1061.56 2099.0 32.10880088806152 40 15 10 5 10 110.85619083460905 0.9020696024924233 0.04560089111328125 3 0.9555445735246287 5.831466807294298 2099.0 11.57674913783082 0.0 - - - - - - - 262.25 4 4 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 263 34 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39077.[MT7]-LVVVDENDVVK[MT7].2y9_1.heavy 758.945 / 1160.63 1312.0 32.10880088806152 40 15 10 5 10 110.85619083460905 0.9020696024924233 0.04560089111328125 3 0.9555445735246287 5.831466807294298 1312.0 6.46010152284264 0.0 - - - - - - - 218.66666666666666 2 6 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 265 34 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39077.[MT7]-LVVVDENDVVK[MT7].2y6_1.heavy 758.945 / 847.464 1443.0 32.10880088806152 40 15 10 5 10 110.85619083460905 0.9020696024924233 0.04560089111328125 3 0.9555445735246287 5.831466807294298 1443.0 6.699087994801013 0.0 - - - - - - - 262.3333333333333 2 6 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 267 34 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39077.[MT7]-LVVVDENDVVK[MT7].2y7_1.heavy 758.945 / 962.491 1705.0 32.10880088806152 40 15 10 5 10 110.85619083460905 0.9020696024924233 0.04560089111328125 3 0.9555445735246287 5.831466807294298 1705.0 12.364503816793892 0.0 - - - - - - - 209.6 3 10 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 269 35 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21733.[MT7]-DIFSPK[MT7].2y4_1.heavy 497.794 / 622.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 271 35 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21733.[MT7]-DIFSPK[MT7].2y5_1.heavy 497.794 / 735.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 273 35 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21733.[MT7]-DIFSPK[MT7].2y3_1.heavy 497.794 / 475.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 275 36 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22363.[MT7]-K[MT7]IEFGVVYSC[CAM]VEGK[MT7].3y6_1.heavy 683.047 / 823.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 277 36 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22363.[MT7]-K[MT7]IEFGVVYSC[CAM]VEGK[MT7].3b6_1.heavy 683.047 / 962.591 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 279 36 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22363.[MT7]-K[MT7]IEFGVVYSC[CAM]VEGK[MT7].3b3_1.heavy 683.047 / 659.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 281 36 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22363.[MT7]-K[MT7]IEFGVVYSC[CAM]VEGK[MT7].3y4_1.heavy 683.047 / 576.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 283 37 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22201.[MT7]-TWVLEPEK[MT7]PPR.3y6_1.heavy 547.319 / 867.517 9640.0 30.732749938964844 34 8 10 6 10 0.9937595215070734 64.56022970425738 0.03749847412109375 3 0.787825449815567 2.630385461904142 9640.0 30.73982784410013 0.0 - - - - - - - 349.25 19 8 FANCL Fanconi anemia, complementation group L 285 37 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22201.[MT7]-TWVLEPEK[MT7]PPR.3y4_1.heavy 547.319 / 641.422 3298.0 30.732749938964844 34 8 10 6 10 0.9937595215070734 64.56022970425738 0.03749847412109375 3 0.787825449815567 2.630385461904142 3298.0 0.799704433497537 1.0 - - - - - - - 300.1818181818182 6 11 FANCL Fanconi anemia, complementation group L 287 37 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22201.[MT7]-TWVLEPEK[MT7]PPR.3b3_1.heavy 547.319 / 531.305 13826.0 30.732749938964844 34 8 10 6 10 0.9937595215070734 64.56022970425738 0.03749847412109375 3 0.787825449815567 2.630385461904142 13826.0 14.319126195101513 1.0 - - - - - - - 254.0 27 2 FANCL Fanconi anemia, complementation group L 289 37 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22201.[MT7]-TWVLEPEK[MT7]PPR.3y8_1.heavy 547.319 / 1109.64 254.0 30.732749938964844 34 8 10 6 10 0.9937595215070734 64.56022970425738 0.03749847412109375 3 0.787825449815567 2.630385461904142 254.0 3.94 0.0 - - - - - - - 0.0 0 0 FANCL Fanconi anemia, complementation group L 291 38 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21867.[MT7]-IWNSQLVR.2y5_1.heavy 580.339 / 602.362 3015.0 32.91469955444336 46 16 10 10 10 1.1574232029664935 51.013551532542486 0.0 3 0.967450192166014 6.821863808911423 3015.0 7.284332061068703 0.0 - - - - - - - 628.8 6 10 NOS3 nitric oxide synthase 3 (endothelial cell) 293 38 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21867.[MT7]-IWNSQLVR.2b4_1.heavy 580.339 / 645.348 917.0 32.91469955444336 46 16 10 10 10 1.1574232029664935 51.013551532542486 0.0 3 0.967450192166014 6.821863808911423 917.0 0.44350877192982463 19.0 - - - - - - - 748.5714285714286 9 7 NOS3 nitric oxide synthase 3 (endothelial cell) 295 38 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21867.[MT7]-IWNSQLVR.2y6_1.heavy 580.339 / 716.405 1835.0 32.91469955444336 46 16 10 10 10 1.1574232029664935 51.013551532542486 0.0 3 0.967450192166014 6.821863808911423 1835.0 2.329611168078184 4.0 - - - - - - - 212.875 6 8 NOS3 nitric oxide synthase 3 (endothelial cell) 297 38 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21867.[MT7]-IWNSQLVR.2y7_1.heavy 580.339 / 902.484 7864.0 32.91469955444336 46 16 10 10 10 1.1574232029664935 51.013551532542486 0.0 3 0.967450192166014 6.821863808911423 7864.0 33.467022900763354 0.0 - - - - - - - 283.8333333333333 15 6 NOS3 nitric oxide synthase 3 (endothelial cell) 299 39 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21732.[MT7]-TMAALAK[MT7].2y4_1.heavy 497.304 / 546.373 1940.0 25.431400299072266 37 17 6 10 4 3.252529536382025 24.559674867427084 0.0 8 0.979323280809438 8.567821039179686 1940.0 3.993335723807884 4.0 - - - - - - - 672.5 3 12 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 301 39 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21732.[MT7]-TMAALAK[MT7].2y5_1.heavy 497.304 / 617.41 2042.0 25.431400299072266 37 17 6 10 4 3.252529536382025 24.559674867427084 0.0 8 0.979323280809438 8.567821039179686 2042.0 1.3335510204081633 6.0 - - - - - - - 715.0 8 11 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 303 39 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21732.[MT7]-TMAALAK[MT7].2b4_1.heavy 497.304 / 519.272 2859.0 25.431400299072266 37 17 6 10 4 3.252529536382025 24.559674867427084 0.0 8 0.979323280809438 8.567821039179686 2859.0 5.047461956976647 2.0 - - - - - - - 650.0909090909091 6 11 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 305 39 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21732.[MT7]-TMAALAK[MT7].2y6_1.heavy 497.304 / 748.451 2144.0 25.431400299072266 37 17 6 10 4 3.252529536382025 24.559674867427084 0.0 8 0.979323280809438 8.567821039179686 2144.0 22.2259841121271 1.0 - - - - - - - 182.14285714285714 4 14 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 307 40 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38908.[MT7]-WMIPSEAK[MT7].2b3_1.heavy 625.346 / 575.313 1727.0 33.26755142211914 39 16 10 3 10 2.018101805018572 39.63774721266162 0.0522003173828125 3 0.9670572773273394 6.7808341331529105 1727.0 2.7083908849153278 2.0 - - - - - - - 265.6666666666667 3 6 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 309 40 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38908.[MT7]-WMIPSEAK[MT7].2y4_1.heavy 625.346 / 578.327 664.0 33.26755142211914 39 16 10 3 10 2.018101805018572 39.63774721266162 0.0522003173828125 3 0.9670572773273394 6.7808341331529105 664.0 2.745864661654135 12.0 - - - - - - - 251.22222222222223 2 9 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 311 40 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38908.[MT7]-WMIPSEAK[MT7].2y5_1.heavy 625.346 / 675.379 4915.0 33.26755142211914 39 16 10 3 10 2.018101805018572 39.63774721266162 0.0522003173828125 3 0.9670572773273394 6.7808341331529105 4915.0 17.679190207156307 0.0 - - - - - - - 265.625 9 8 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 313 40 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38908.[MT7]-WMIPSEAK[MT7].2y7_1.heavy 625.346 / 919.504 1063.0 33.26755142211914 39 16 10 3 10 2.018101805018572 39.63774721266162 0.0522003173828125 3 0.9670572773273394 6.7808341331529105 1063.0 4.379044137826609 1.0 - - - - - - - 225.8 2 10 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 315 41 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39344.[MT7]-GNFPDVPQELSESFSSLLK[MT7].3y6_1.heavy 794.753 / 838.516 494.0 48.58995056152344 34 8 10 6 10 0.9681308279770301 64.39931774156521 0.0337982177734375 3 0.7852471145432794 2.6139375594113985 494.0 13.357973045822103 1.0 - - - - - - - 0.0 1 0 WEE2 WEE1 homolog 2 (S. pombe) 317 41 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39344.[MT7]-GNFPDVPQELSESFSSLLK[MT7].3b6_1.heavy 794.753 / 774.39 3602.0 48.58995056152344 34 8 10 6 10 0.9681308279770301 64.39931774156521 0.0337982177734375 3 0.7852471145432794 2.6139375594113985 3602.0 52.615149228130356 0.0 - - - - - - - 158.9 7 20 WEE2 WEE1 homolog 2 (S. pombe) 319 41 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39344.[MT7]-GNFPDVPQELSESFSSLLK[MT7].3b5_1.heavy 794.753 / 675.322 2154.0 48.58995056152344 34 8 10 6 10 0.9681308279770301 64.39931774156521 0.0337982177734375 3 0.7852471145432794 2.6139375594113985 2154.0 16.659181746656177 0.0 - - - - - - - 142.23809523809524 4 21 WEE2 WEE1 homolog 2 (S. pombe) 321 41 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39344.[MT7]-GNFPDVPQELSESFSSLLK[MT7].3y5_1.heavy 794.753 / 691.447 1024.0 48.58995056152344 34 8 10 6 10 0.9681308279770301 64.39931774156521 0.0337982177734375 3 0.7852471145432794 2.6139375594113985 1024.0 18.562786647314947 0.0 - - - - - - - 119.63636363636364 2 22 WEE2 WEE1 homolog 2 (S. pombe) 323 42 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543680.[MT7]-MSDGLFLQK[MT7].3y3_1.heavy 442.916 / 532.357 14687.0 34.64799880981445 41 11 10 10 10 0.6989730142954096 75.20384470815523 0.0 3 0.869933956369607 3.384205352568088 14687.0 33.6009250876965 0.0 - - - - - - - 305.22222222222223 29 9 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 325 42 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543680.[MT7]-MSDGLFLQK[MT7].3b4_1.heavy 442.916 / 535.23 11821.0 34.64799880981445 41 11 10 10 10 0.6989730142954096 75.20384470815523 0.0 3 0.869933956369607 3.384205352568088 11821.0 23.291736226050624 0.0 - - - - - - - 268.625 23 8 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 327 42 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543680.[MT7]-MSDGLFLQK[MT7].3b5_1.heavy 442.916 / 648.314 12060.0 34.64799880981445 41 11 10 10 10 0.6989730142954096 75.20384470815523 0.0 3 0.869933956369607 3.384205352568088 12060.0 26.04126438872288 0.0 - - - - - - - 293.0 24 11 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 329 42 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543680.[MT7]-MSDGLFLQK[MT7].3b3_1.heavy 442.916 / 478.209 5493.0 34.64799880981445 41 11 10 10 10 0.6989730142954096 75.20384470815523 0.0 3 0.869933956369607 3.384205352568088 5493.0 26.084078212290507 1.0 - - - - - - - 282.27272727272725 14 11 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 331 43 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543683.[MT7]-NVTAIQGPGGK[MT7].3b4_1.heavy 443.929 / 530.305 152959.0 22.691299438476562 50 20 10 10 10 14.876722072758504 6.721910882714877 0.0 3 0.9990255356608829 39.53157531549491 152959.0 353.2967215772536 0.0 - - - - - - - 348.8888888888889 305 9 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 333 43 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543683.[MT7]-NVTAIQGPGGK[MT7].3b5_1.heavy 443.929 / 643.39 39809.0 22.691299438476562 50 20 10 10 10 14.876722072758504 6.721910882714877 0.0 3 0.9990255356608829 39.53157531549491 39809.0 53.9746787140027 0.0 - - - - - - - 719.6666666666666 79 9 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 335 43 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543683.[MT7]-NVTAIQGPGGK[MT7].3y4_1.heavy 443.929 / 502.311 91708.0 22.691299438476562 50 20 10 10 10 14.876722072758504 6.721910882714877 0.0 3 0.9990255356608829 39.53157531549491 91708.0 377.1033618156944 0.0 - - - - - - - 734.6666666666666 183 9 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 337 43 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543683.[MT7]-NVTAIQGPGGK[MT7].3y5_1.heavy 443.929 / 559.332 98655.0 22.691299438476562 50 20 10 10 10 14.876722072758504 6.721910882714877 0.0 3 0.9990255356608829 39.53157531549491 98655.0 269.68071514423076 0.0 - - - - - - - 761.6 197 10 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 339 44 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21632.[MT7]-ISFAK[MT7].2b3_1.heavy 427.273 / 492.294 1999.0 27.81813367207845 40 20 10 6 4 2.62204578469532 38.13815936536743 0.036098480224609375 7 0.9911662520049442 13.12108182576489 1999.0 3.5994870191528285 5.0 - - - - - - - 790.1111111111111 6 9 SMAD6;THAP4;SNRPA SMAD family member 6;THAP domain containing 4;small nuclear ribonucleoprotein polypeptide A 341 44 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21632.[MT7]-ISFAK[MT7].2y4_1.heavy 427.273 / 596.352 13107.0 27.81813367207845 40 20 10 6 4 2.62204578469532 38.13815936536743 0.036098480224609375 7 0.9911662520049442 13.12108182576489 13107.0 35.50304504504504 0.0 - - - - - - - 277.5 26 10 SMAD6;THAP4;SNRPA SMAD family member 6;THAP domain containing 4;small nuclear ribonucleoprotein polypeptide A 343 44 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21632.[MT7]-ISFAK[MT7].2y3_1.heavy 427.273 / 509.32 2666.0 27.81813367207845 40 20 10 6 4 2.62204578469532 38.13815936536743 0.036098480224609375 7 0.9911662520049442 13.12108182576489 2666.0 2.401801801801802 2.0 - - - - - - - 281.7692307692308 8 13 SMAD6;THAP4;SNRPA SMAD family member 6;THAP domain containing 4;small nuclear ribonucleoprotein polypeptide A 345 45 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22460.[MT7]-TALHLAVDLQNPDLVSLLLK[MT7].4y5_1.heavy 616.121 / 717.499 N/A N/A - - - - - - - - - 0.0 - - - - - - - NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 347 45 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22460.[MT7]-TALHLAVDLQNPDLVSLLLK[MT7].4b4_1.heavy 616.121 / 567.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 349 45 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22460.[MT7]-TALHLAVDLQNPDLVSLLLK[MT7].4b5_1.heavy 616.121 / 680.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 351 45 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22460.[MT7]-TALHLAVDLQNPDLVSLLLK[MT7].4y3_1.heavy 616.121 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 353 46 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39067.[MT7]-QAGEVVC[CAM]EAIK[MT7].2b4_1.heavy 746.408 / 530.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 355 46 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39067.[MT7]-QAGEVVC[CAM]EAIK[MT7].2b6_1.heavy 746.408 / 728.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 357 46 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39067.[MT7]-QAGEVVC[CAM]EAIK[MT7].2y6_1.heavy 746.408 / 863.478 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 359 46 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39067.[MT7]-QAGEVVC[CAM]EAIK[MT7].2b5_1.heavy 746.408 / 629.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 361 47 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 669784.0 17.936500549316406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 669784.0 4724.8739451476795 0.0 - - - - - - - 366.0 1339 1 363 47 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 448772.0 17.936500549316406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 448772.0 2008.5913043085943 0.0 - - - - - - - 829.125 897 8 365 47 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 359186.0 17.936500549316406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 359186.0 4851.221413809888 0.0 - - - - - - - 1308.5714285714287 718 7 367 48 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544078.[MT7]-VQQLLQEMTAS.2b3_1.heavy 696.37 / 500.295 1085.0 43.047550201416016 37 10 10 7 10 1.5482169526516947 52.989496944847566 0.029296875 3 0.8208441282927119 2.871037342140569 1085.0 3.598301839673687 0.0 - - - - - - - 197.52941176470588 2 34 IRAK4 interleukin-1 receptor-associated kinase 4 369 48 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544078.[MT7]-VQQLLQEMTAS.2b4_1.heavy 696.37 / 613.379 2111.0 43.047550201416016 37 10 10 7 10 1.5482169526516947 52.989496944847566 0.029296875 3 0.8208441282927119 2.871037342140569 2111.0 16.248629406307977 0.0 - - - - - - - 171.3846153846154 4 26 IRAK4 interleukin-1 receptor-associated kinase 4 371 48 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544078.[MT7]-VQQLLQEMTAS.2b7_1.heavy 696.37 / 983.564 1583.0 43.047550201416016 37 10 10 7 10 1.5482169526516947 52.989496944847566 0.029296875 3 0.8208441282927119 2.871037342140569 1583.0 13.518399709038007 0.0 - - - - - - - 109.08 3 25 IRAK4 interleukin-1 receptor-associated kinase 4 373 48 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544078.[MT7]-VQQLLQEMTAS.2b5_1.heavy 696.37 / 726.463 2639.0 43.047550201416016 37 10 10 7 10 1.5482169526516947 52.989496944847566 0.029296875 3 0.8208441282927119 2.871037342140569 2639.0 36.050169245647965 0.0 - - - - - - - 126.75 5 28 IRAK4 interleukin-1 receptor-associated kinase 4 375 49 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21856.[MT7]-SNVTAVHK[MT7].2y4_1.heavy 572.34 / 598.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 377 49 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21856.[MT7]-SNVTAVHK[MT7].2y5_1.heavy 572.34 / 699.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 379 49 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21856.[MT7]-SNVTAVHK[MT7].2y3_1.heavy 572.34 / 527.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 381 49 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21856.[MT7]-SNVTAVHK[MT7].2b5_1.heavy 572.34 / 617.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 383 50 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21742.[MT7]-VIVMEK[MT7].2b3_1.heavy 503.814 / 456.33 4224.0 28.09040069580078 42 14 10 10 8 1.8073723740575742 38.043542217935894 0.0 4 0.9410353809100277 5.0571888197026045 4224.0 6.116265466816648 0.0 - - - - - - - 704.0 8 9 PLEKHG3;NCK1 pleckstrin homology domain containing, family G (with RhoGef domain) member 3;NCK adaptor protein 1 385 50 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21742.[MT7]-VIVMEK[MT7].2y4_1.heavy 503.814 / 650.366 5558.0 28.09040069580078 42 14 10 10 8 1.8073723740575742 38.043542217935894 0.0 4 0.9410353809100277 5.0571888197026045 5558.0 7.249535232383808 1.0 - - - - - - - 237.85714285714286 11 7 PLEKHG3;NCK1 pleckstrin homology domain containing, family G (with RhoGef domain) member 3;NCK adaptor protein 1 387 50 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21742.[MT7]-VIVMEK[MT7].2y5_1.heavy 503.814 / 763.45 6447.0 28.09040069580078 42 14 10 10 8 1.8073723740575742 38.043542217935894 0.0 4 0.9410353809100277 5.0571888197026045 6447.0 20.10281153057393 1.0 - - - - - - - 292.90909090909093 13 11 PLEKHG3;NCK1 pleckstrin homology domain containing, family G (with RhoGef domain) member 3;NCK adaptor protein 1 389 50 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21742.[MT7]-VIVMEK[MT7].2y3_1.heavy 503.814 / 551.298 6891.0 28.09040069580078 42 14 10 10 8 1.8073723740575742 38.043542217935894 0.0 4 0.9410353809100277 5.0571888197026045 6891.0 13.433058892376083 0.0 - - - - - - - 259.22222222222223 13 9 PLEKHG3;NCK1 pleckstrin homology domain containing, family G (with RhoGef domain) member 3;NCK adaptor protein 1 391 51 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22214.[MT7]-NRVIGSGC[CAM]NLDSAR.3b9_2.heavy 554.954 / 551.781 25069.0 21.663999557495117 42 12 10 10 10 1.3954325561109262 49.544226487622225 0.0 3 0.8833083057240697 3.5770566081678417 25069.0 49.65509631490787 0.0 - - - - - - - 225.1764705882353 50 17 LDHAL6A;LDHA lactate dehydrogenase A-like 6A;lactate dehydrogenase A 393 51 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22214.[MT7]-NRVIGSGC[CAM]NLDSAR.3b9_1.heavy 554.954 / 1102.55 249.0 21.663999557495117 42 12 10 10 10 1.3954325561109262 49.544226487622225 0.0 3 0.8833083057240697 3.5770566081678417 249.0 5.483030303030303 0.0 - - - - - - - 0.0 0 0 LDHAL6A;LDHA lactate dehydrogenase A-like 6A;lactate dehydrogenase A 395 51 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22214.[MT7]-NRVIGSGC[CAM]NLDSAR.3y6_1.heavy 554.954 / 675.342 18652.0 21.663999557495117 42 12 10 10 10 1.3954325561109262 49.544226487622225 0.0 3 0.8833083057240697 3.5770566081678417 18652.0 86.4655826201023 0.0 - - - - - - - 233.43478260869566 37 23 LDHAL6A;LDHA lactate dehydrogenase A-like 6A;lactate dehydrogenase A 397 51 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22214.[MT7]-NRVIGSGC[CAM]NLDSAR.3y5_1.heavy 554.954 / 561.299 16364.0 21.663999557495117 42 12 10 10 10 1.3954325561109262 49.544226487622225 0.0 3 0.8833083057240697 3.5770566081678417 16364.0 44.34372751320049 0.0 - - - - - - - 739.0 32 7 LDHAL6A;LDHA lactate dehydrogenase A-like 6A;lactate dehydrogenase A 399 52 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21641.[MT7]-SESVRR.2y4_1.heavy 439.252 / 517.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 401 52 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21641.[MT7]-SESVRR.2b3_1.heavy 439.252 / 448.216 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 403 52 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21641.[MT7]-SESVRR.2b4_1.heavy 439.252 / 547.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 405 52 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21641.[MT7]-SESVRR.2b5_1.heavy 439.252 / 703.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 407 53 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22213.[MT7]-FLANEILQEDYR.3y6_1.heavy 552.29 / 823.394 44939.0 39.16339874267578 45 15 10 10 10 1.9432605484415415 41.12793792219904 0.0 3 0.958533349062274 6.039494917434306 44939.0 225.1534644339689 0.0 - - - - - - - 198.55555555555554 89 9 WEE2 WEE1 homolog 2 (S. pombe) 409 53 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22213.[MT7]-FLANEILQEDYR.3b5_1.heavy 552.29 / 719.385 78081.0 39.16339874267578 45 15 10 10 10 1.9432605484415415 41.12793792219904 0.0 3 0.958533349062274 6.039494917434306 78081.0 124.24586605243398 0.0 - - - - - - - 354.85714285714283 156 7 WEE2 WEE1 homolog 2 (S. pombe) 411 53 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22213.[MT7]-FLANEILQEDYR.3y4_1.heavy 552.29 / 582.252 22120.0 39.16339874267578 45 15 10 10 10 1.9432605484415415 41.12793792219904 0.0 3 0.958533349062274 6.039494917434306 22120.0 71.60421441529135 0.0 - - - - - - - 698.5 44 8 WEE2 WEE1 homolog 2 (S. pombe) 413 53 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22213.[MT7]-FLANEILQEDYR.3y5_1.heavy 552.29 / 710.31 49906.0 39.16339874267578 45 15 10 10 10 1.9432605484415415 41.12793792219904 0.0 3 0.958533349062274 6.039494917434306 49906.0 150.95112485484714 0.0 - - - - - - - 252.25 99 12 WEE2 WEE1 homolog 2 (S. pombe) 415 54 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38916.[MT7]-GDVGLVAENSR.2y8_1.heavy 630.837 / 845.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIG1 ligase I, DNA, ATP-dependent 417 54 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38916.[MT7]-GDVGLVAENSR.2y9_1.heavy 630.837 / 944.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIG1 ligase I, DNA, ATP-dependent 419 54 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38916.[MT7]-GDVGLVAENSR.2y6_1.heavy 630.837 / 675.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIG1 ligase I, DNA, ATP-dependent 421 54 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38916.[MT7]-GDVGLVAENSR.2b5_1.heavy 630.837 / 586.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIG1 ligase I, DNA, ATP-dependent 423 55 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21991.[MT7]-GGVPGGC[CAM]VLVPR.2b3_1.heavy 656.37 / 358.221 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 425 55 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21991.[MT7]-GGVPGGC[CAM]VLVPR.2y8_1.heavy 656.37 / 857.466 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 427 55 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21991.[MT7]-GGVPGGC[CAM]VLVPR.2y9_1.heavy 656.37 / 954.519 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 429 55 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21991.[MT7]-GGVPGGC[CAM]VLVPR.2y7_1.heavy 656.37 / 800.445 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 431 56 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22095.[MT7]-IVLPEDLQLK[MT7].2y4_1.heavy 728.455 / 645.442 3165.0 38.774200439453125 45 20 10 5 10 8.039936068992773 12.437909846779142 0.04540252685546875 3 0.9938995047536886 15.792787494429922 3165.0 23.145057485029938 0.0 - - - - - - - 184.42857142857142 6 14 FANCL Fanconi anemia, complementation group L 433 56 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22095.[MT7]-IVLPEDLQLK[MT7].2y8_1.heavy 728.455 / 1099.65 3582.0 38.774200439453125 45 20 10 5 10 8.039936068992773 12.437909846779142 0.04540252685546875 3 0.9938995047536886 15.792787494429922 3582.0 31.48728143712575 0.0 - - - - - - - 150.0 7 10 FANCL Fanconi anemia, complementation group L 435 56 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22095.[MT7]-IVLPEDLQLK[MT7].2y9_1.heavy 728.455 / 1198.72 3415.0 38.774200439453125 45 20 10 5 10 8.039936068992773 12.437909846779142 0.04540252685546875 3 0.9938995047536886 15.792787494429922 3415.0 16.76477975986278 0.0 - - - - - - - 166.58333333333334 6 12 FANCL Fanconi anemia, complementation group L 437 56 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22095.[MT7]-IVLPEDLQLK[MT7].2y7_1.heavy 728.455 / 986.564 16742.0 38.774200439453125 45 20 10 5 10 8.039936068992773 12.437909846779142 0.04540252685546875 3 0.9938995047536886 15.792787494429922 16742.0 283.8566784503283 0.0 - - - - - - - 166.57142857142858 33 7 FANCL Fanconi anemia, complementation group L 439 57 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22094.[MT7]-RVLIAAHGNSLR.3b6_1.heavy 484.296 / 768.521 11415.0 22.156149864196777 39 15 10 6 8 1.2999532355999106 50.42834994062588 0.031398773193359375 4 0.9504777689867903 5.522726059113646 11415.0 62.67058823529412 0.0 - - - - - - - 210.1764705882353 22 17 PGAM1;PGAM2 phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 441 57 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22094.[MT7]-RVLIAAHGNSLR.3b4_1.heavy 484.296 / 626.447 2870.0 22.156149864196777 39 15 10 6 8 1.2999532355999106 50.42834994062588 0.031398773193359375 4 0.9504777689867903 5.522726059113646 2870.0 1.3483505377136509 0.0 - - - - - - - 263.77272727272725 5 22 PGAM1;PGAM2 phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 443 57 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22094.[MT7]-RVLIAAHGNSLR.3b5_1.heavy 484.296 / 697.484 4081.0 22.156149864196777 39 15 10 6 8 1.2999532355999106 50.42834994062588 0.031398773193359375 4 0.9504777689867903 5.522726059113646 4081.0 19.1296875 1.0 - - - - - - - 191.47826086956522 10 23 PGAM1;PGAM2 phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 445 57 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22094.[MT7]-RVLIAAHGNSLR.3y5_1.heavy 484.296 / 546.299 32651.0 22.156149864196777 39 15 10 6 8 1.2999532355999106 50.42834994062588 0.031398773193359375 4 0.9504777689867903 5.522726059113646 32651.0 40.743792103106586 0.0 - - - - - - - 713.0 65 11 PGAM1;PGAM2 phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 447 58 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22210.[MT7]-SSPVDLVTATDQK[MT7].2y8_1.heavy 824.953 / 1019.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 449 58 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22210.[MT7]-SSPVDLVTATDQK[MT7].2y5_1.heavy 824.953 / 706.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 451 58 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22210.[MT7]-SSPVDLVTATDQK[MT7].2y6_1.heavy 824.953 / 807.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 453 58 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22210.[MT7]-SSPVDLVTATDQK[MT7].2b5_1.heavy 824.953 / 630.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 455 59 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22093.[MT7]-RFEALLQTGK[MT7].3b4_1.heavy 484.292 / 648.359 37059.0 30.595399856567383 47 17 10 10 10 4.24771976164495 23.54204269852174 0.0 3 0.9755866596889646 7.882450235805478 37059.0 73.93733711240858 0.0 - - - - - - - 664.6 74 10 IRAK4 interleukin-1 receptor-associated kinase 4 457 59 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22093.[MT7]-RFEALLQTGK[MT7].3b5_1.heavy 484.292 / 761.443 66323.0 30.595399856567383 47 17 10 10 10 4.24771976164495 23.54204269852174 0.0 3 0.9755866596889646 7.882450235805478 66323.0 251.89882935727314 0.0 - - - - - - - 223.83333333333334 132 12 IRAK4 interleukin-1 receptor-associated kinase 4 459 59 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22093.[MT7]-RFEALLQTGK[MT7].3b7_1.heavy 484.292 / 1002.59 N/A 30.595399856567383 47 17 10 10 10 4.24771976164495 23.54204269852174 0.0 3 0.9755866596889646 7.882450235805478 0.0 0.0 1.0 - - - - - - - 0.0 0 0 IRAK4 interleukin-1 receptor-associated kinase 4 461 59 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22093.[MT7]-RFEALLQTGK[MT7].3y5_1.heavy 484.292 / 690.427 8945.0 30.595399856567383 47 17 10 10 10 4.24771976164495 23.54204269852174 0.0 3 0.9755866596889646 7.882450235805478 8945.0 36.71240903253425 0.0 - - - - - - - 204.73333333333332 17 15 IRAK4 interleukin-1 receptor-associated kinase 4 463 60 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21994.[MT7]-DVLEIDFPAR.2y8_1.heavy 659.86 / 960.515 4197.0 38.26075077056885 41 15 10 6 10 2.2108829008295676 37.555370263683784 0.039798736572265625 3 0.9506594141890696 5.532967859037551 4197.0 14.265800029540031 0.0 - - - - - - - 304.4 8 10 FANCL Fanconi anemia, complementation group L 465 60 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21994.[MT7]-DVLEIDFPAR.2y9_1.heavy 659.86 / 1059.58 2962.0 38.26075077056885 41 15 10 6 10 2.2108829008295676 37.555370263683784 0.039798736572265625 3 0.9506594141890696 5.532967859037551 2962.0 33.28111026422765 1.0 - - - - - - - 205.75 5 8 FANCL Fanconi anemia, complementation group L 467 60 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21994.[MT7]-DVLEIDFPAR.2b4_1.heavy 659.86 / 601.331 7406.0 38.26075077056885 41 15 10 6 10 2.2108829008295676 37.555370263683784 0.039798736572265625 3 0.9506594141890696 5.532967859037551 7406.0 23.30069917257683 0.0 - - - - - - - 291.72727272727275 14 11 FANCL Fanconi anemia, complementation group L 469 60 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21994.[MT7]-DVLEIDFPAR.2b6_1.heavy 659.86 / 829.442 8641.0 38.26075077056885 41 15 10 6 10 2.2108829008295676 37.555370263683784 0.039798736572265625 3 0.9506594141890696 5.532967859037551 8641.0 105.0090655453576 1.0 - - - - - - - 210.44444444444446 17 9 FANCL Fanconi anemia, complementation group L 471 61 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541700.[MT7]-QQEGESR.2b3_1.heavy 489.242 / 530.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA;LDHB lactate dehydrogenase A;lactate dehydrogenase B 473 61 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541700.[MT7]-QQEGESR.2y5_1.heavy 489.242 / 577.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA;LDHB lactate dehydrogenase A;lactate dehydrogenase B 475 61 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541700.[MT7]-QQEGESR.2y6_1.heavy 489.242 / 705.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA;LDHB lactate dehydrogenase A;lactate dehydrogenase B 477 61 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541700.[MT7]-QQEGESR.2b5_1.heavy 489.242 / 716.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA;LDHB lactate dehydrogenase A;lactate dehydrogenase B 479 62 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21998.[MT7]-QQFDQEIK[MT7].2y4_1.heavy 662.361 / 661.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 481 62 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21998.[MT7]-QQFDQEIK[MT7].2b6_1.heavy 662.361 / 920.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 483 62 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21998.[MT7]-QQFDQEIK[MT7].2y6_1.heavy 662.361 / 923.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 485 62 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21998.[MT7]-QQFDQEIK[MT7].2b7_1.heavy 662.361 / 1033.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 487 63 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540309.[MT7]-AILEK[MT7].2b3_1.heavy 431.286 / 442.315 3258.0 24.32159996032715 48 18 10 10 10 5.3421618859404285 18.719013413498626 0.0 3 0.9820899450299339 9.20796341224512 3258.0 15.417596296281012 1.0 - - - - - - - 797.2 6 10 PRPF6;FANCL;CHD7;CHD8;LOC653889;CHD9;CHD6 PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae);Fanconi anemia, complementation group L;chromodomain helicase DNA binding protein 7;chromodomain helicase DNA binding protein 8;pre-mRNA-processing factor 6-like;chromodomain helicase DNA binding protein 9;chromodomain helicase DNA binding protein 6 489 63 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540309.[MT7]-AILEK[MT7].2y4_1.heavy 431.286 / 646.426 10547.0 24.32159996032715 48 18 10 10 10 5.3421618859404285 18.719013413498626 0.0 3 0.9820899450299339 9.20796341224512 10547.0 43.66396501457726 0.0 - - - - - - - 151.69230769230768 21 13 PRPF6;FANCL;CHD7;CHD8;LOC653889;CHD9;CHD6 PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae);Fanconi anemia, complementation group L;chromodomain helicase DNA binding protein 7;chromodomain helicase DNA binding protein 8;pre-mRNA-processing factor 6-like;chromodomain helicase DNA binding protein 9;chromodomain helicase DNA binding protein 6 491 63 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540309.[MT7]-AILEK[MT7].2b4_1.heavy 431.286 / 571.357 3258.0 24.32159996032715 48 18 10 10 10 5.3421618859404285 18.719013413498626 0.0 3 0.9820899450299339 9.20796341224512 3258.0 9.902686115581131 1.0 - - - - - - - 306.2142857142857 6 14 PRPF6;FANCL;CHD7;CHD8;LOC653889;CHD9;CHD6 PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae);Fanconi anemia, complementation group L;chromodomain helicase DNA binding protein 7;chromodomain helicase DNA binding protein 8;pre-mRNA-processing factor 6-like;chromodomain helicase DNA binding protein 9;chromodomain helicase DNA binding protein 6 493 63 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540309.[MT7]-AILEK[MT7].2y3_1.heavy 431.286 / 533.341 10547.0 24.32159996032715 48 18 10 10 10 5.3421618859404285 18.719013413498626 0.0 3 0.9820899450299339 9.20796341224512 10547.0 16.67681760556757 2.0 - - - - - - - 634.4 21 10 PRPF6;FANCL;CHD7;CHD8;LOC653889;CHD9;CHD6 PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae);Fanconi anemia, complementation group L;chromodomain helicase DNA binding protein 7;chromodomain helicase DNA binding protein 8;pre-mRNA-processing factor 6-like;chromodomain helicase DNA binding protein 9;chromodomain helicase DNA binding protein 6 495 64 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21643.[MT7]-AETAAK[MT7].2y4_1.heavy 439.763 / 534.337 3096.0 13.609299659729004 47 17 10 10 10 3.4968578339545635 28.597101955074606 0.0 3 0.9780190512754753 8.308840281774277 3096.0 42.87504818383989 0.0 - - - - - - - 115.8 6 25 LOC100290936;PGAM4;PGAM1;PGAM2 phosphoglycerate mutase 1-like;phosphoglycerate mutase family member 4;phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 497 64 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21643.[MT7]-AETAAK[MT7].2y5_1.heavy 439.763 / 663.379 2329.0 13.609299659729004 47 17 10 10 10 3.4968578339545635 28.597101955074606 0.0 3 0.9780190512754753 8.308840281774277 2329.0 41.1240350877193 0.0 - - - - - - - 107.76 4 25 LOC100290936;PGAM4;PGAM1;PGAM2 phosphoglycerate mutase 1-like;phosphoglycerate mutase family member 4;phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 499 64 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21643.[MT7]-AETAAK[MT7].2b4_1.heavy 439.763 / 517.274 880.0 13.609299659729004 47 17 10 10 10 3.4968578339545635 28.597101955074606 0.0 3 0.9780190512754753 8.308840281774277 880.0 3.6654241500056477 1.0 - - - - - - - 137.89285714285714 3 28 LOC100290936;PGAM4;PGAM1;PGAM2 phosphoglycerate mutase 1-like;phosphoglycerate mutase family member 4;phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 501 64 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21643.[MT7]-AETAAK[MT7].2b5_1.heavy 439.763 / 588.311 1420.0 13.609299659729004 47 17 10 10 10 3.4968578339545635 28.597101955074606 0.0 3 0.9780190512754753 8.308840281774277 1420.0 17.438596491228072 0.0 - - - - - - - 153.82758620689654 2 29 LOC100290936;PGAM4;PGAM1;PGAM2 phosphoglycerate mutase 1-like;phosphoglycerate mutase family member 4;phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 503 65 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22215.[MT7]-DFINQYYSSIK[MT7].2b3_1.heavy 833.44 / 520.289 2165.0 35.55329895019531 46 20 10 6 10 6.862551167684289 14.571840348659165 0.03459930419921875 3 0.9929774131935575 14.718356836660574 2165.0 10.589204853267368 0.0 - - - - - - - 198.35 4 20 NOS3 nitric oxide synthase 3 (endothelial cell) 505 65 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22215.[MT7]-DFINQYYSSIK[MT7].2y8_1.heavy 833.44 / 1146.59 1443.0 35.55329895019531 46 20 10 6 10 6.862551167684289 14.571840348659165 0.03459930419921875 3 0.9929774131935575 14.718356836660574 1443.0 0.0 1.0 - - - - - - - 152.3846153846154 2 13 NOS3 nitric oxide synthase 3 (endothelial cell) 507 65 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22215.[MT7]-DFINQYYSSIK[MT7].2y5_1.heavy 833.44 / 741.426 2435.0 35.55329895019531 46 20 10 6 10 6.862551167684289 14.571840348659165 0.03459930419921875 3 0.9929774131935575 14.718356836660574 2435.0 8.230282351929539 0.0 - - - - - - - 240.44444444444446 4 18 NOS3 nitric oxide synthase 3 (endothelial cell) 509 65 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22215.[MT7]-DFINQYYSSIK[MT7].2b4_1.heavy 833.44 / 634.332 1533.0 35.55329895019531 46 20 10 6 10 6.862551167684289 14.571840348659165 0.03459930419921875 3 0.9929774131935575 14.718356836660574 1533.0 9.368333333333334 0.0 - - - - - - - 193.1904761904762 3 21 NOS3 nitric oxide synthase 3 (endothelial cell) 511 66 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22217.[MT7]-SANILLDEAFTAK[MT7].3b4_1.heavy 560.985 / 530.305 130963.0 39.4379997253418 46 16 10 10 10 2.8064702004439126 35.63194791242841 0.0 3 0.9651682564048792 6.593348497539747 130963.0 114.76483044164976 0.0 - - - - - - - 238.0 261 3 IRAK4 interleukin-1 receptor-associated kinase 4 513 66 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22217.[MT7]-SANILLDEAFTAK[MT7].3b5_1.heavy 560.985 / 643.39 100510.0 39.4379997253418 46 16 10 10 10 2.8064702004439126 35.63194791242841 0.0 3 0.9651682564048792 6.593348497539747 100510.0 110.48387223716139 0.0 - - - - - - - 178.5 201 6 IRAK4 interleukin-1 receptor-associated kinase 4 515 66 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22217.[MT7]-SANILLDEAFTAK[MT7].3y4_1.heavy 560.985 / 610.368 89501.0 39.4379997253418 46 16 10 10 10 2.8064702004439126 35.63194791242841 0.0 3 0.9651682564048792 6.593348497539747 89501.0 265.85833592534993 0.0 - - - - - - - 243.0 179 10 IRAK4 interleukin-1 receptor-associated kinase 4 517 66 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22217.[MT7]-SANILLDEAFTAK[MT7].3b7_1.heavy 560.985 / 871.5 29023.0 39.4379997253418 46 16 10 10 10 2.8064702004439126 35.63194791242841 0.0 3 0.9651682564048792 6.593348497539747 29023.0 72.41760093815648 0.0 - - - - - - - 182.55555555555554 58 9 IRAK4 interleukin-1 receptor-associated kinase 4 519 67 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22393.[MT7]-TVYEGFISAQGRDFHLR.4y4_1.heavy 535.782 / 572.33 6476.0 34.824798583984375 43 13 10 10 10 2.208529157732156 45.27900374323593 0.0 3 0.9041141893411627 3.953232040657487 6476.0 20.864635932539336 0.0 - - - - - - - 668.7142857142857 12 7 FANCL Fanconi anemia, complementation group L 521 67 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22393.[MT7]-TVYEGFISAQGRDFHLR.4y10_2.heavy 535.782 / 593.807 47026.0 34.824798583984375 43 13 10 10 10 2.208529157732156 45.27900374323593 0.0 3 0.9041141893411627 3.953232040657487 47026.0 33.300972116511296 0.0 - - - - - - - 365.3333333333333 94 6 FANCL Fanconi anemia, complementation group L 523 67 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22393.[MT7]-TVYEGFISAQGRDFHLR.4b5_1.heavy 535.782 / 694.353 19030.0 34.824798583984375 43 13 10 10 10 2.208529157732156 45.27900374323593 0.0 3 0.9041141893411627 3.953232040657487 19030.0 30.8176950747991 0.0 - - - - - - - 307.3333333333333 38 12 FANCL Fanconi anemia, complementation group L 525 67 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22393.[MT7]-TVYEGFISAQGRDFHLR.4b3_1.heavy 535.782 / 508.289 9465.0 34.824798583984375 43 13 10 10 10 2.208529157732156 45.27900374323593 0.0 3 0.9041141893411627 3.953232040657487 9465.0 7.917180908416491 0.0 - - - - - - - 1807.5714285714287 18 7 FANCL Fanconi anemia, complementation group L 527 68 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21849.[MT7]-LTGSASTAK[MT7].2y4_1.heavy 562.332 / 550.332 819.0 18.423800468444824 32 15 2 7 8 3.6574480256573265 27.341468504402798 0.026798248291015625 4 0.9546687023871867 5.774426960888296 819.0 -0.04982981800225733 4.0 - - - - - - - 0.0 1 0 LIG1 ligase I, DNA, ATP-dependent 529 68 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21849.[MT7]-LTGSASTAK[MT7].2y8_1.heavy 562.332 / 866.47 2149.0 18.423800468444824 32 15 2 7 8 3.6574480256573265 27.341468504402798 0.026798248291015625 4 0.9546687023871867 5.774426960888296 2149.0 38.555588235294124 1.0 - - - - - - - 96.96153846153847 9 26 LIG1 ligase I, DNA, ATP-dependent 531 68 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21849.[MT7]-LTGSASTAK[MT7].2y6_1.heavy 562.332 / 708.401 205.0 18.423800468444824 32 15 2 7 8 3.6574480256573265 27.341468504402798 0.026798248291015625 4 0.9546687023871867 5.774426960888296 205.0 0.564155486756106 17.0 - - - - - - - 97.33333333333333 3 21 LIG1 ligase I, DNA, ATP-dependent 533 68 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21849.[MT7]-LTGSASTAK[MT7].2y7_1.heavy 562.332 / 765.422 750.0 18.423800468444824 32 15 2 7 8 3.6574480256573265 27.341468504402798 0.026798248291015625 4 0.9546687023871867 5.774426960888296 750.0 4.6117131062951495 0.0 - - - - - - - 0.0 1 0 LIG1 ligase I, DNA, ATP-dependent 535 69 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543529.[MT7]-VSILESLDK[MT7].3b4_1.heavy 431.262 / 557.378 15220.0 37.11412525177002 47 20 10 7 10 6.798270674274231 14.709623195560066 0.027301788330078125 3 0.9958389107351378 19.125295042063012 15220.0 59.76209475301157 0.0 - - - - - - - 174.0 30 14 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 537 69 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543529.[MT7]-VSILESLDK[MT7].3b5_1.heavy 431.262 / 686.42 7568.0 37.11412525177002 47 20 10 7 10 6.798270674274231 14.709623195560066 0.027301788330078125 3 0.9958389107351378 19.125295042063012 7568.0 52.46541569376636 0.0 - - - - - - - 136.5 15 8 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 539 69 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543529.[MT7]-VSILESLDK[MT7].3y4_1.heavy 431.262 / 606.358 13538.0 37.11412525177002 47 20 10 7 10 6.798270674274231 14.709623195560066 0.027301788330078125 3 0.9958389107351378 19.125295042063012 13538.0 114.106 0.0 - - - - - - - 221.45454545454547 27 11 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 541 69 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543529.[MT7]-VSILESLDK[MT7].3b3_1.heavy 431.262 / 444.294 33804.0 37.11412525177002 47 20 10 7 10 6.798270674274231 14.709623195560066 0.027301788330078125 3 0.9958389107351378 19.125295042063012 33804.0 100.51819978455941 0.0 - - - - - - - 224.0 67 18 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 543 70 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543144.[MT7]-FC[CAM]VFGLGSR.2b3_1.heavy 593.812 / 551.277 3224.0 38.320448875427246 43 17 10 6 10 2.815642083578091 35.515877740014794 0.039798736572265625 3 0.9740174480095867 7.6397054697140945 3224.0 7.999031770045385 0.0 - - - - - - - 754.375 6 8 NOS3 nitric oxide synthase 3 (endothelial cell) 545 70 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543144.[MT7]-FC[CAM]VFGLGSR.2y8_1.heavy 593.812 / 895.445 5126.0 38.320448875427246 43 17 10 6 10 2.815642083578091 35.515877740014794 0.039798736572265625 3 0.9740174480095867 7.6397054697140945 5126.0 23.354871377306235 0.0 - - - - - - - 234.33333333333334 10 12 NOS3 nitric oxide synthase 3 (endothelial cell) 547 70 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543144.[MT7]-FC[CAM]VFGLGSR.2y6_1.heavy 593.812 / 636.346 3059.0 38.320448875427246 43 17 10 6 10 2.815642083578091 35.515877740014794 0.039798736572265625 3 0.9740174480095867 7.6397054697140945 3059.0 11.049280798145157 1.0 - - - - - - - 279.0 8 16 NOS3 nitric oxide synthase 3 (endothelial cell) 549 70 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543144.[MT7]-FC[CAM]VFGLGSR.2y7_1.heavy 593.812 / 735.415 3472.0 38.320448875427246 43 17 10 6 10 2.815642083578091 35.515877740014794 0.039798736572265625 3 0.9740174480095867 7.6397054697140945 3472.0 13.96832835026533 0.0 - - - - - - - 305.38461538461536 6 13 NOS3 nitric oxide synthase 3 (endothelial cell) 551 71 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 2168090.0 36.83290100097656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2168090.0 394.6932248665293 0.0 - - - - - - - 117.6 4336 5 553 71 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 930111.0 36.83290100097656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 930111.0 434.0089543258122 0.0 - - - - - - - 154.0 1860 6 555 71 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1381000.0 36.83290100097656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1381000.0 293.4219160979928 0.0 - - - - - - - 280.3333333333333 2762 3 557 72 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39120.[MT7]-RSENEEFVEVGR.2b6_1.heavy 797.901 / 889.413 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 559 72 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39120.[MT7]-RSENEEFVEVGR.2y6_1.heavy 797.901 / 706.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 561 72 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39120.[MT7]-RSENEEFVEVGR.2b7_1.heavy 797.901 / 1036.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 563 72 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39120.[MT7]-RSENEEFVEVGR.2b5_1.heavy 797.901 / 760.371 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 565 73 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540230.[MT7]-LVEALR.2b3_1.heavy 422.772 / 486.304 3446.0 29.507100105285645 30 5 10 5 10 0.7038264272521443 70.86095039659371 0.04139900207519531 3 0.6601022333827019 2.0537115459531226 3446.0 7.601117640648715 0.0 - - - - - - - 832.75 6 8 PPM1B protein phosphatase, Mg2+/Mn2+ dependent, 1B 567 73 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540230.[MT7]-LVEALR.2y5_1.heavy 422.772 / 587.351 12291.0 29.507100105285645 30 5 10 5 10 0.7038264272521443 70.86095039659371 0.04139900207519531 3 0.6601022333827019 2.0537115459531226 12291.0 33.8988767238284 0.0 - - - - - - - 264.3 24 10 PPM1B protein phosphatase, Mg2+/Mn2+ dependent, 1B 569 73 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540230.[MT7]-LVEALR.2b4_1.heavy 422.772 / 557.341 39054.0 29.507100105285645 30 5 10 5 10 0.7038264272521443 70.86095039659371 0.04139900207519531 3 0.6601022333827019 2.0537115459531226 39054.0 61.53611313869766 0.0 - - - - - - - 210.66666666666666 78 6 PPM1B protein phosphatase, Mg2+/Mn2+ dependent, 1B 571 73 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540230.[MT7]-LVEALR.2b5_1.heavy 422.772 / 670.426 6203.0 29.507100105285645 30 5 10 5 10 0.7038264272521443 70.86095039659371 0.04139900207519531 3 0.6601022333827019 2.0537115459531226 6203.0 28.767536231884062 0.0 - - - - - - - 253.0 12 10 PPM1B protein phosphatase, Mg2+/Mn2+ dependent, 1B 573 74 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543736.[MT7]-HYGGLTGLNK[MT7].3y3_1.heavy 449.926 / 518.342 10375.0 25.046100616455078 50 20 10 10 10 7.071403736657747 14.141463806062406 0.0 3 0.9944974133130297 16.629514753194886 10375.0 18.806889949163363 0.0 - - - - - - - 780.0 20 11 LOC100290936;PGAM4;PGAM1;PGAM2 phosphoglycerate mutase 1-like;phosphoglycerate mutase family member 4;phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 575 74 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543736.[MT7]-HYGGLTGLNK[MT7].3b4_1.heavy 449.926 / 559.274 36611.0 25.046100616455078 50 20 10 10 10 7.071403736657747 14.141463806062406 0.0 3 0.9944974133130297 16.629514753194886 36611.0 100.44421919770774 0.0 - - - - - - - 345.53846153846155 73 13 LOC100290936;PGAM4;PGAM1;PGAM2 phosphoglycerate mutase 1-like;phosphoglycerate mutase family member 4;phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 577 74 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543736.[MT7]-HYGGLTGLNK[MT7].3b5_1.heavy 449.926 / 672.359 16260.0 25.046100616455078 50 20 10 10 10 7.071403736657747 14.141463806062406 0.0 3 0.9944974133130297 16.629514753194886 16260.0 37.11878630769893 0.0 - - - - - - - 236.0909090909091 32 11 LOC100290936;PGAM4;PGAM1;PGAM2 phosphoglycerate mutase 1-like;phosphoglycerate mutase family member 4;phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 579 74 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543736.[MT7]-HYGGLTGLNK[MT7].3y4_1.heavy 449.926 / 575.363 24939.0 25.046100616455078 50 20 10 10 10 7.071403736657747 14.141463806062406 0.0 3 0.9944974133130297 16.629514753194886 24939.0 99.36093615803034 0.0 - - - - - - - 293.4117647058824 49 17 LOC100290936;PGAM4;PGAM1;PGAM2 phosphoglycerate mutase 1-like;phosphoglycerate mutase family member 4;phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 581 75 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544086.[MT7]-EYFERLEK[MT7].3y3_1.heavy 467.925 / 533.341 8338.0 28.424033482869465 38 14 10 6 8 3.161984108432807 31.62571239156657 0.03890037536621094 4 0.9387329493725359 4.96028030783899 8338.0 13.394987516413604 0.0 - - - - - - - 321.44444444444446 16 9 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 583 75 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544086.[MT7]-EYFERLEK[MT7].3y7_2.heavy 467.925 / 564.812 41358.0 28.424033482869465 38 14 10 6 8 3.161984108432807 31.62571239156657 0.03890037536621094 4 0.9387329493725359 4.96028030783899 41358.0 12.782102873081932 0.0 - - - - - - - 259.6666666666667 82 3 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 585 75 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544086.[MT7]-EYFERLEK[MT7].3b3_1.heavy 467.925 / 584.284 6337.0 28.424033482869465 38 14 10 6 8 3.161984108432807 31.62571239156657 0.03890037536621094 4 0.9387329493725359 4.96028030783899 6337.0 8.501601698333172 1.0 - - - - - - - 250.25 32 8 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 587 75 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544086.[MT7]-EYFERLEK[MT7].3b7_2.heavy 467.925 / 556.281 N/A 28.424033482869465 38 14 10 6 8 3.161984108432807 31.62571239156657 0.03890037536621094 4 0.9387329493725359 4.96028030783899 20234.0 34.436776487350805 0.0 - - - - - - - 305.75 40 4 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 589 76 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543661.[MT7]-QQFDQEIK[MT7].3y3_1.heavy 441.91 / 533.341 12452.0 24.783899307250977 47 17 10 10 10 5.871576349938769 17.03120151048412 0.0 3 0.9751572629747725 7.813748650294772 12452.0 21.894854756398626 0.0 - - - - - - - 281.75 24 12 IRAK4 interleukin-1 receptor-associated kinase 4 591 76 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543661.[MT7]-QQFDQEIK[MT7].3b4_1.heavy 441.91 / 663.322 17278.0 24.783899307250977 47 17 10 10 10 5.871576349938769 17.03120151048412 0.0 3 0.9751572629747725 7.813748650294772 17278.0 104.26379310344826 0.0 - - - - - - - 223.07692307692307 34 13 IRAK4 interleukin-1 receptor-associated kinase 4 593 76 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543661.[MT7]-QQFDQEIK[MT7].3b5_1.heavy 441.91 / 791.38 4440.0 24.783899307250977 47 17 10 10 10 5.871576349938769 17.03120151048412 0.0 3 0.9751572629747725 7.813748650294772 4440.0 64.19157096308957 0.0 - - - - - - - 133.125 8 8 IRAK4 interleukin-1 receptor-associated kinase 4 595 76 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543661.[MT7]-QQFDQEIK[MT7].3b3_1.heavy 441.91 / 548.295 10425.0 24.783899307250977 47 17 10 10 10 5.871576349938769 17.03120151048412 0.0 3 0.9751572629747725 7.813748650294772 10425.0 41.708931248661386 0.0 - - - - - - - 298.54545454545456 20 11 IRAK4 interleukin-1 receptor-associated kinase 4 597 77 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543521.[MT7]-LLGAFHNPK[MT7].3y3_1.heavy 428.927 / 502.311 23752.0 30.23390007019043 48 18 10 10 10 3.8068980642582657 26.268105505337182 0.0 3 0.9834110577458407 9.568653185299556 23752.0 32.134839981868105 0.0 - - - - - - - 365.3333333333333 47 9 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 599 77 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543521.[MT7]-LLGAFHNPK[MT7].3b4_1.heavy 428.927 / 499.336 60902.0 30.23390007019043 48 18 10 10 10 3.8068980642582657 26.268105505337182 0.0 3 0.9834110577458407 9.568653185299556 60902.0 76.66918445539135 0.0 - - - - - - - 752.8181818181819 121 11 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 601 77 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543521.[MT7]-LLGAFHNPK[MT7].3b5_1.heavy 428.927 / 646.404 40074.0 30.23390007019043 48 18 10 10 10 3.8068980642582657 26.268105505337182 0.0 3 0.9834110577458407 9.568653185299556 40074.0 201.2687545864611 0.0 - - - - - - - 265.8181818181818 80 11 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 603 77 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543521.[MT7]-LLGAFHNPK[MT7].3b3_1.heavy 428.927 / 428.299 N/A 30.23390007019043 48 18 10 10 10 3.8068980642582657 26.268105505337182 0.0 3 0.9834110577458407 9.568653185299556 21438.0 2.9887301235891095 1.0 - - - - - - - 3045.0 46 1 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 605 78 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21839.[MT7]-TANTLPSK[MT7].2y4_1.heavy 560.334 / 588.384 2608.0 20.010700225830078 36 15 8 3 10 3.3582577481703972 29.777345129176197 0.05990028381347656 3 0.9542240295030909 5.746095245294305 2608.0 16.184498764075805 0.0 - - - - - - - 160.03571428571428 5 28 IRAK4 interleukin-1 receptor-associated kinase 4 607 78 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21839.[MT7]-TANTLPSK[MT7].2y5_1.heavy 560.334 / 689.431 1506.0 20.010700225830078 36 15 8 3 10 3.3582577481703972 29.777345129176197 0.05990028381347656 3 0.9542240295030909 5.746095245294305 1506.0 10.301997969886653 0.0 - - - - - - - 198.2 3 30 IRAK4 interleukin-1 receptor-associated kinase 4 609 78 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21839.[MT7]-TANTLPSK[MT7].2b4_1.heavy 560.334 / 532.285 N/A 20.010700225830078 36 15 8 3 10 3.3582577481703972 29.777345129176197 0.05990028381347656 3 0.9542240295030909 5.746095245294305 3894.0 1.562882014427856 5.0 - - - - - - - 1695.5384615384614 13 13 IRAK4 interleukin-1 receptor-associated kinase 4 611 78 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21839.[MT7]-TANTLPSK[MT7].2b5_1.heavy 560.334 / 645.369 5364.0 20.010700225830078 36 15 8 3 10 3.3582577481703972 29.777345129176197 0.05990028381347656 3 0.9542240295030909 5.746095245294305 5364.0 25.554788411277322 0.0 - - - - - - - 231.72413793103448 10 29 IRAK4 interleukin-1 receptor-associated kinase 4 613 79 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542593.[MT7]-C[CAM]LNVGLIR.2b3_1.heavy 544.822 / 532.267 N/A 32.91469955444336 37 15 10 10 2 2.1695866770006234 36.56163709001942 0.0 14 0.953732887615871 5.715277503937446 1962.0 3.1595541401273883 10.0 - - - - - - - 719.5 5 8 IRAK4 interleukin-1 receptor-associated kinase 4 615 79 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542593.[MT7]-C[CAM]LNVGLIR.2y6_1.heavy 544.822 / 671.42 1831.0 32.91469955444336 37 15 10 10 2 2.1695866770006234 36.56163709001942 0.0 14 0.953732887615871 5.715277503937446 1831.0 1.7103657993640853 8.0 - - - - - - - 668.5555555555555 5 9 IRAK4 interleukin-1 receptor-associated kinase 4 617 79 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542593.[MT7]-C[CAM]LNVGLIR.2b5_1.heavy 544.822 / 688.357 2485.0 32.91469955444336 37 15 10 10 2 2.1695866770006234 36.56163709001942 0.0 14 0.953732887615871 5.715277503937446 2485.0 5.572142620619801 1.0 - - - - - - - 714.4615384615385 4 13 IRAK4 interleukin-1 receptor-associated kinase 4 619 79 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542593.[MT7]-C[CAM]LNVGLIR.2y7_1.heavy 544.822 / 784.504 3532.0 32.91469955444336 37 15 10 10 2 2.1695866770006234 36.56163709001942 0.0 14 0.953732887615871 5.715277503937446 3532.0 9.017989442723856 0.0 - - - - - - - 229.125 7 8 IRAK4 interleukin-1 receptor-associated kinase 4 621 80 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21729.[MT7]-LQVFDAR.2y4_1.heavy 496.786 / 508.251 3797.0 31.83180046081543 45 15 10 10 10 3.67031151885661 27.245643724310465 0.0 3 0.9558244566400085 5.850049560841539 3797.0 13.61510487552265 3.0 - - - - - - - 285.8181818181818 10 11 NOS1;NOS3 nitric oxide synthase 1 (neuronal);nitric oxide synthase 3 (endothelial cell) 623 80 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21729.[MT7]-LQVFDAR.2y5_1.heavy 496.786 / 607.32 5891.0 31.83180046081543 45 15 10 10 10 3.67031151885661 27.245643724310465 0.0 3 0.9558244566400085 5.850049560841539 5891.0 19.186972010178117 0.0 - - - - - - - 767.1428571428571 11 7 NOS1;NOS3 nitric oxide synthase 1 (neuronal);nitric oxide synthase 3 (endothelial cell) 625 80 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21729.[MT7]-LQVFDAR.2y6_1.heavy 496.786 / 735.378 15449.0 31.83180046081543 45 15 10 10 10 3.67031151885661 27.245643724310465 0.0 3 0.9558244566400085 5.850049560841539 15449.0 26.647993646030976 1.0 - - - - - - - 622.125 30 8 NOS1;NOS3 nitric oxide synthase 1 (neuronal);nitric oxide synthase 3 (endothelial cell) 627 80 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21729.[MT7]-LQVFDAR.2b5_1.heavy 496.786 / 747.416 48310.0 31.83180046081543 45 15 10 10 10 3.67031151885661 27.245643724310465 0.0 3 0.9558244566400085 5.850049560841539 48310.0 127.73054528751723 0.0 - - - - - - - 229.25 96 8 NOS1;NOS3 nitric oxide synthase 1 (neuronal);nitric oxide synthase 3 (endothelial cell) 629 81 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21939.[MT7]-EASSQTPEK[MT7].2y4_1.heavy 632.835 / 618.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 631 81 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21939.[MT7]-EASSQTPEK[MT7].2y8_1.heavy 632.835 / 991.518 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 633 81 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21939.[MT7]-EASSQTPEK[MT7].2y3_1.heavy 632.835 / 517.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 635 81 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21939.[MT7]-EASSQTPEK[MT7].2b5_1.heavy 632.835 / 647.312 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 637 82 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544096.[MT7]-IEAAC[CAM]FATIK[MT7].3y3_1.heavy 471.267 / 505.347 35092.0 33.43339920043945 47 17 10 10 10 3.0015579287113536 26.392569461204644 0.0 3 0.9750933313277763 7.803671893526447 35092.0 93.66409443562172 0.0 - - - - - - - 348.42857142857144 70 7 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 639 82 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544096.[MT7]-IEAAC[CAM]FATIK[MT7].3b4_1.heavy 471.267 / 529.31 32168.0 33.43339920043945 47 17 10 10 10 3.0015579287113536 26.392569461204644 0.0 3 0.9750933313277763 7.803671893526447 32168.0 43.40183001581795 0.0 - - - - - - - 292.6 64 10 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 641 82 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544096.[MT7]-IEAAC[CAM]FATIK[MT7].3b5_1.heavy 471.267 / 689.341 21689.0 33.43339920043945 47 17 10 10 10 3.0015579287113536 26.392569461204644 0.0 3 0.9750933313277763 7.803671893526447 21689.0 86.17703285420944 0.0 - - - - - - - 292.6 43 10 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 643 82 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544096.[MT7]-IEAAC[CAM]FATIK[MT7].3y4_1.heavy 471.267 / 576.384 14134.0 33.43339920043945 47 17 10 10 10 3.0015579287113536 26.392569461204644 0.0 3 0.9750933313277763 7.803671893526447 14134.0 13.819764096668909 0.0 - - - - - - - 365.3333333333333 28 3 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 645 83 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21936.[MT7]-AMEAVAAQGK[MT7].2y8_1.heavy 632.352 / 917.517 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGAM1;PGAM2 phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 647 83 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21936.[MT7]-AMEAVAAQGK[MT7].2y5_1.heavy 632.352 / 618.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGAM1;PGAM2 phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 649 83 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21936.[MT7]-AMEAVAAQGK[MT7].2y9_1.heavy 632.352 / 1048.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGAM1;PGAM2 phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 651 83 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21936.[MT7]-AMEAVAAQGK[MT7].2b5_1.heavy 632.352 / 646.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGAM1;PGAM2 phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 653 84 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544094.[MT7]-FDVINLAAEK[MT7].3y3_1.heavy 469.941 / 491.295 215348.0 36.86539840698242 44 14 10 10 10 1.5930577896405056 44.021953794353266 0.0 3 0.9426022699510433 5.126435604171428 215348.0 141.17531789401954 0.0 - - - - - - - 757.0 430 9 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 655 84 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544094.[MT7]-FDVINLAAEK[MT7].3b4_1.heavy 469.941 / 619.357 68222.0 36.86539840698242 44 14 10 10 10 1.5930577896405056 44.021953794353266 0.0 3 0.9426022699510433 5.126435604171428 68222.0 118.37861154303482 0.0 - - - - - - - 680.6363636363636 136 11 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 657 84 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544094.[MT7]-FDVINLAAEK[MT7].3b5_1.heavy 469.941 / 733.4 126349.0 36.86539840698242 44 14 10 10 10 1.5930577896405056 44.021953794353266 0.0 3 0.9426022699510433 5.126435604171428 126349.0 237.93629849532766 0.0 - - - - - - - 218.46666666666667 252 15 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 659 84 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544094.[MT7]-FDVINLAAEK[MT7].3b3_1.heavy 469.941 / 506.273 131228.0 36.86539840698242 44 14 10 10 10 1.5930577896405056 44.021953794353266 0.0 3 0.9426022699510433 5.126435604171428 131228.0 159.37746298386057 0.0 - - - - - - - 278.2307692307692 262 13 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 661 85 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21935.[MT7]-EEQTPQNK[MT7].2b3_1.heavy 631.335 / 531.253 828.0 14.024074792861938 43 17 10 6 10 1.6905089465353402 35.68240452337394 0.03209972381591797 3 0.9797936135440795 8.667303903273565 828.0 24.096774193548384 0.0 - - - - - - - 0.0 1 0 LDHA lactate dehydrogenase A 663 85 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21935.[MT7]-EEQTPQNK[MT7].2y4_1.heavy 631.335 / 630.369 2514.0 14.024074792861938 43 17 10 6 10 1.6905089465353402 35.68240452337394 0.03209972381591797 3 0.9797936135440795 8.667303903273565 2514.0 16.0582586512866 0.0 - - - - - - - 193.2173913043478 5 23 LDHA lactate dehydrogenase A 665 85 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21935.[MT7]-EEQTPQNK[MT7].2y5_1.heavy 631.335 / 731.417 950.0 14.024074792861938 43 17 10 6 10 1.6905089465353402 35.68240452337394 0.03209972381591797 3 0.9797936135440795 8.667303903273565 950.0 58.89999999999999 0.0 - - - - - - - 0.0 1 0 LDHA lactate dehydrogenase A 667 85 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21935.[MT7]-EEQTPQNK[MT7].2y7_1.heavy 631.335 / 988.518 644.0 14.024074792861938 43 17 10 6 10 1.6905089465353402 35.68240452337394 0.03209972381591797 3 0.9797936135440795 8.667303903273565 644.0 14.041311475409834 0.0 - - - - - - - 0.0 1 0 LDHA lactate dehydrogenase A 669 86 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22398.[MT7]-NVTNNFDERPISVGGNK[MT7].3y10_2.heavy 717.046 / 600.844 5078.0 26.705900192260742 32 11 10 5 6 2.06134602933011 48.51199098896448 0.043201446533203125 5 0.8545857922296252 3.196318350651424 5078.0 11.75462962962963 0.0 - - - - - - - 284.72727272727275 10 11 IRAK4 interleukin-1 receptor-associated kinase 4 671 86 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22398.[MT7]-NVTNNFDERPISVGGNK[MT7].3y6_1.heavy 717.046 / 705.401 648.0 26.705900192260742 32 11 10 5 6 2.06134602933011 48.51199098896448 0.043201446533203125 5 0.8545857922296252 3.196318350651424 648.0 1.784 7.0 - - - - - - - 0.0 1 0 IRAK4 interleukin-1 receptor-associated kinase 4 673 86 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22398.[MT7]-NVTNNFDERPISVGGNK[MT7].3y4_1.heavy 717.046 / 519.301 648.0 26.705900192260742 32 11 10 5 6 2.06134602933011 48.51199098896448 0.043201446533203125 5 0.8545857922296252 3.196318350651424 648.0 1.56 6.0 - - - - - - - 192.85714285714286 2 14 IRAK4 interleukin-1 receptor-associated kinase 4 675 86 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22398.[MT7]-NVTNNFDERPISVGGNK[MT7].3y8_1.heavy 717.046 / 915.538 1080.0 26.705900192260742 32 11 10 5 6 2.06134602933011 48.51199098896448 0.043201446533203125 5 0.8545857922296252 3.196318350651424 1080.0 6.1000000000000005 0.0 - - - - - - - 228.0 2 9 IRAK4 interleukin-1 receptor-associated kinase 4 677 87 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 572328.0 33.95140075683594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 572328.0 1135.8209068878095 0.0 - - - - - - - 270.0 1144 11 679 87 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 144823.0 33.95140075683594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 144823.0 133.11991753867773 0.0 - - - - - - - 218.0 289 12 681 87 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 222165.0 33.95140075683594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 222165.0 143.0508535020006 0.0 - - - - - - - 802.0 444 8 683 88 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542883.[MT7]-LEPQEVPR.2b4_1.heavy 556.315 / 612.347 2706.0 25.046100616455078 50 20 10 10 10 8.794551964810964 11.370675891179348 0.0 3 0.9972488551326717 23.523721137536395 2706.0 5.265157465617394 0.0 - - - - - - - 300.5833333333333 5 12 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 685 88 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542883.[MT7]-LEPQEVPR.2y6_1.heavy 556.315 / 725.394 61831.0 25.046100616455078 50 20 10 10 10 8.794551964810964 11.370675891179348 0.0 3 0.9972488551326717 23.523721137536395 61831.0 394.4037209302325 0.0 - - - - - - - 211.44444444444446 123 9 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 687 88 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542883.[MT7]-LEPQEVPR.2b5_1.heavy 556.315 / 741.39 11023.0 25.046100616455078 50 20 10 10 10 8.794551964810964 11.370675891179348 0.0 3 0.9972488551326717 23.523721137536395 11023.0 62.13574667405766 0.0 - - - - - - - 200.25 22 8 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 689 88 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542883.[MT7]-LEPQEVPR.2y7_1.heavy 556.315 / 854.437 20944.0 25.046100616455078 50 20 10 10 10 8.794551964810964 11.370675891179348 0.0 3 0.9972488551326717 23.523721137536395 20944.0 27.68973232628721 1.0 - - - - - - - 200.14285714285714 44 7 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 691 89 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22396.[MT7]-LTVADALEPVQFEDGQK[MT7].2b4_1.heavy 1074.57 / 529.347 1146.0 38.79690170288086 44 14 10 10 10 1.452019864756285 46.47979511773025 0.0 3 0.9346270477003011 4.8003015111978256 1146.0 4.260836211884763 1.0 - - - - - - - 150.33333333333334 2 6 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 693 89 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22396.[MT7]-LTVADALEPVQFEDGQK[MT7].2y9_1.heavy 1074.57 / 1191.61 3274.0 38.79690170288086 44 14 10 10 10 1.452019864756285 46.47979511773025 0.0 3 0.9346270477003011 4.8003015111978256 3274.0 58.29317073170732 0.0 - - - - - - - 163.83333333333334 6 6 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 695 89 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22396.[MT7]-LTVADALEPVQFEDGQK[MT7].2b6_1.heavy 1074.57 / 715.411 1964.0 38.79690170288086 44 14 10 10 10 1.452019864756285 46.47979511773025 0.0 3 0.9346270477003011 4.8003015111978256 1964.0 26.386051164176564 0.0 - - - - - - - 163.85714285714286 3 7 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 697 89 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22396.[MT7]-LTVADALEPVQFEDGQK[MT7].2b5_1.heavy 1074.57 / 644.374 2537.0 38.79690170288086 44 14 10 10 10 1.452019864756285 46.47979511773025 0.0 3 0.9346270477003011 4.8003015111978256 2537.0 33.73261404973463 0.0 - - - - - - - 174.0 5 8 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 699 90 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22397.[MT7]-LTVADALEPVQFEDGQK[MT7].4y4_1.heavy 537.791 / 591.322 17588.0 38.79690170288086 42 12 10 10 10 1.3040391943050818 66.87997325154043 0.0 3 0.8972963110934833 3.8175113845585606 17588.0 33.77153004765213 0.0 - - - - - - - 222.75 35 4 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 701 90 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22397.[MT7]-LTVADALEPVQFEDGQK[MT7].4b4_1.heavy 537.791 / 529.347 7052.0 38.79690170288086 42 12 10 10 10 1.3040391943050818 66.87997325154043 0.0 3 0.8972963110934833 3.8175113845585606 7052.0 8.363274029748961 0.0 - - - - - - - 903.5714285714286 14 7 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 703 90 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22397.[MT7]-LTVADALEPVQFEDGQK[MT7].4b5_1.heavy 537.791 / 644.374 22533.0 38.79690170288086 42 12 10 10 10 1.3040391943050818 66.87997325154043 0.0 3 0.8972963110934833 3.8175113845585606 22533.0 51.29912510197421 0.0 - - - - - - - 351.0 45 6 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 705 90 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22397.[MT7]-LTVADALEPVQFEDGQK[MT7].4b6_1.heavy 537.791 / 715.411 26666.0 38.79690170288086 42 12 10 10 10 1.3040391943050818 66.87997325154043 0.0 3 0.8972963110934833 3.8175113845585606 26666.0 43.94683900544305 0.0 - - - - - - - 243.0 53 3 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 707 91 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21827.[MT7]-LITEGASK[MT7].2y4_1.heavy 553.837 / 506.306 15496.0 24.280899047851562 50 20 10 10 10 6.799356592323295 14.707273937199204 0.0 3 0.9950473034873499 17.529200336584456 15496.0 61.54125714285714 0.0 - - - - - - - 259.22222222222223 30 9 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 709 91 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21827.[MT7]-LITEGASK[MT7].2y5_1.heavy 553.837 / 635.348 7842.0 24.280899047851562 50 20 10 10 10 6.799356592323295 14.707273937199204 0.0 3 0.9950473034873499 17.529200336584456 7842.0 22.30703771089161 0.0 - - - - - - - 186.63636363636363 15 11 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 711 91 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21827.[MT7]-LITEGASK[MT7].2y6_1.heavy 553.837 / 736.396 18297.0 24.280899047851562 50 20 10 10 10 6.799356592323295 14.707273937199204 0.0 3 0.9950473034873499 17.529200336584456 18297.0 98.77805322728665 0.0 - - - - - - - 261.3 36 10 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 713 91 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21827.[MT7]-LITEGASK[MT7].2y7_1.heavy 553.837 / 849.48 11296.0 24.280899047851562 50 20 10 10 10 6.799356592323295 14.707273937199204 0.0 3 0.9950473034873499 17.529200336584456 11296.0 16.413069883069983 1.0 - - - - - - - 212.1818181818182 23 11 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 715 92 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39100.[MT7]-ETVYC[CAM]IGQRK[MT7].3y7_1.heavy 514.616 / 1068.57 N/A 23.665800094604492 38 8 10 10 10 0.9129866799108172 71.82427808885393 0.0 3 0.7593098464112702 2.463260057081803 0.0 0.0 5.0 - - - - - - - 0.0 0 0 NCK1 NCK adaptor protein 1 717 92 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39100.[MT7]-ETVYC[CAM]IGQRK[MT7].3y6_1.heavy 514.616 / 905.511 2190.0 23.665800094604492 38 8 10 10 10 0.9129866799108172 71.82427808885393 0.0 3 0.7593098464112702 2.463260057081803 2190.0 26.535766423357664 0.0 - - - - - - - 152.6153846153846 4 13 NCK1 NCK adaptor protein 1 719 92 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39100.[MT7]-ETVYC[CAM]IGQRK[MT7].3y4_1.heavy 514.616 / 632.396 2669.0 23.665800094604492 38 8 10 10 10 0.9129866799108172 71.82427808885393 0.0 3 0.7593098464112702 2.463260057081803 2669.0 7.072862254054911 0.0 - - - - - - - 646.2222222222222 5 9 NCK1 NCK adaptor protein 1 721 92 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39100.[MT7]-ETVYC[CAM]IGQRK[MT7].3y9_2.heavy 514.616 / 634.849 12523.0 23.665800094604492 38 8 10 10 10 0.9129866799108172 71.82427808885393 0.0 3 0.7593098464112702 2.463260057081803 12523.0 28.258996471564963 0.0 - - - - - - - 289.94117647058823 25 17 NCK1 NCK adaptor protein 1 723 93 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543716.[MT7]-VSALPVVDEK[MT7].3b6_1.heavy 448.937 / 711.452 8573.0 30.50512456893921 44 20 10 6 8 8.363748921101063 11.956360830931699 0.03949928283691406 4 0.9938743060437508 15.760238174500104 8573.0 55.668686197916664 0.0 - - - - - - - 181.33333333333334 17 12 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 725 93 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543716.[MT7]-VSALPVVDEK[MT7].3y3_1.heavy 448.937 / 535.284 25848.0 30.50512456893921 44 20 10 6 8 8.363748921101063 11.956360830931699 0.03949928283691406 4 0.9938743060437508 15.760238174500104 25848.0 38.7046875 0.0 - - - - - - - 256.0 51 6 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 727 93 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543716.[MT7]-VSALPVVDEK[MT7].3b4_1.heavy 448.937 / 515.331 48881.0 30.50512456893921 44 20 10 6 8 8.363748921101063 11.956360830931699 0.03949928283691406 4 0.9938743060437508 15.760238174500104 48881.0 119.65661458333332 1.0 - - - - - - - 749.7142857142857 101 7 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 729 93 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543716.[MT7]-VSALPVVDEK[MT7].3y4_1.heavy 448.937 / 634.353 16251.0 30.50512456893921 44 20 10 6 8 8.363748921101063 11.956360830931699 0.03949928283691406 4 0.9938743060437508 15.760238174500104 16251.0 35.125859375 0.0 - - - - - - - 224.0 32 8 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 731 94 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543712.[MT7]-HQAEMALNER.3y6_1.heavy 448.227 / 733.366 2630.0 20.458799362182617 45 20 10 7 8 7.319076170440779 13.662926532157908 0.026599884033203125 4 0.9925579513114922 14.297049186803191 2630.0 7.011089425691889 1.0 - - - - - - - 199.71428571428572 8 28 NCK1 NCK adaptor protein 1 733 94 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543712.[MT7]-HQAEMALNER.3b4_1.heavy 448.227 / 610.307 4055.0 20.458799362182617 45 20 10 7 8 7.319076170440779 13.662926532157908 0.026599884033203125 4 0.9925579513114922 14.297049186803191 4055.0 21.478538812785388 0.0 - - - - - - - 187.3548387096774 8 31 NCK1 NCK adaptor protein 1 735 94 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543712.[MT7]-HQAEMALNER.3b5_1.heavy 448.227 / 741.347 1206.0 20.458799362182617 45 20 10 7 8 7.319076170440779 13.662926532157908 0.026599884033203125 4 0.9925579513114922 14.297049186803191 1206.0 3.121663821459799 0.0 - - - - - - - 136.3846153846154 2 26 NCK1 NCK adaptor protein 1 737 94 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543712.[MT7]-HQAEMALNER.3y5_1.heavy 448.227 / 602.326 5955.0 20.458799362182617 45 20 10 7 8 7.319076170440779 13.662926532157908 0.026599884033203125 4 0.9925579513114922 14.297049186803191 5955.0 28.823287671232876 0.0 - - - - - - - 195.74193548387098 11 31 NCK1 NCK adaptor protein 1 739 95 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21965.[MT7]-TIEDYIDK[MT7].2y4_1.heavy 642.85 / 682.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 741 95 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21965.[MT7]-TIEDYIDK[MT7].2y5_1.heavy 642.85 / 797.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 743 95 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21965.[MT7]-TIEDYIDK[MT7].2b4_1.heavy 642.85 / 603.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 745 95 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21965.[MT7]-TIEDYIDK[MT7].2y3_1.heavy 642.85 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 747 96 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22196.[MT7]-SRLLLLEQELK[MT7].3y3_1.heavy 544.01 / 533.341 8511.0 36.417701721191406 33 15 2 10 6 1.6042823753591051 42.75990455456777 0.0 6 0.9532529343637242 5.685630999835758 8511.0 6.375719515395101 1.0 - - - - - - - 738.9230769230769 47 13 SMAD6 SMAD family member 6 749 96 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22196.[MT7]-SRLLLLEQELK[MT7].3b4_1.heavy 544.01 / 614.411 5056.0 36.417701721191406 33 15 2 10 6 1.6042823753591051 42.75990455456777 0.0 6 0.9532529343637242 5.685630999835758 5056.0 9.894203645804765 1.0 - - - - - - - 779.625 13 8 SMAD6 SMAD family member 6 751 96 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22196.[MT7]-SRLLLLEQELK[MT7].3b5_1.heavy 544.01 / 727.495 6657.0 36.417701721191406 33 15 2 10 6 1.6042823753591051 42.75990455456777 0.0 6 0.9532529343637242 5.685630999835758 6657.0 36.837154150197634 1.0 - - - - - - - 716.25 54 8 SMAD6 SMAD family member 6 753 96 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22196.[MT7]-SRLLLLEQELK[MT7].3y4_1.heavy 544.01 / 661.4 4635.0 36.417701721191406 33 15 2 10 6 1.6042823753591051 42.75990455456777 0.0 6 0.9532529343637242 5.685630999835758 4635.0 5.013729083864934 0.0 - - - - - - - 750.0 9 10 SMAD6 SMAD family member 6 755 97 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541994.[MT7]-NVNIFK[MT7].2y4_1.heavy 511.815 / 665.41 13415.0 29.93239974975586 45 15 10 10 10 3.5214009729511218 22.32654833056993 0.0 3 0.9599502993318659 6.146141066541749 13415.0 29.90549208434934 0.0 - - - - - - - 733.1428571428571 26 7 LDHA lactate dehydrogenase A 757 97 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541994.[MT7]-NVNIFK[MT7].2y5_1.heavy 511.815 / 764.479 6766.0 29.93239974975586 45 15 10 10 10 3.5214009729511218 22.32654833056993 0.0 3 0.9599502993318659 6.146141066541749 6766.0 8.542276749549538 1.0 - - - - - - - 320.875 17 8 LDHA lactate dehydrogenase A 759 97 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541994.[MT7]-NVNIFK[MT7].2b4_1.heavy 511.815 / 585.348 7699.0 29.93239974975586 45 15 10 10 10 3.5214009729511218 22.32654833056993 0.0 3 0.9599502993318659 6.146141066541749 7699.0 29.87913795638324 0.0 - - - - - - - 626.875 15 8 LDHA lactate dehydrogenase A 761 97 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541994.[MT7]-NVNIFK[MT7].2y3_1.heavy 511.815 / 551.367 4783.0 29.93239974975586 45 15 10 10 10 3.5214009729511218 22.32654833056993 0.0 3 0.9599502993318659 6.146141066541749 4783.0 8.02229281342892 0.0 - - - - - - - 350.1111111111111 9 9 LDHA lactate dehydrogenase A 763 98 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21966.[MT7]-LLGAFHNPK[MT7].2y5_1.heavy 642.887 / 786.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 765 98 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21966.[MT7]-LLGAFHNPK[MT7].2y3_1.heavy 642.887 / 502.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 767 98 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21966.[MT7]-LLGAFHNPK[MT7].2b7_1.heavy 642.887 / 897.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 769 98 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21966.[MT7]-LLGAFHNPK[MT7].2b5_1.heavy 642.887 / 646.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 771 99 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21826.[MT7]-ALMLELK[MT7].2y4_1.heavy 553.348 / 646.426 1767.0 36.889774322509766 23 13 0 6 4 1.5470955006547646 53.21382780065186 0.032501220703125 9 0.9201684350578583 4.338530016863199 1767.0 0.0 8.0 - - - - - - - 639.4 31 10 UBE2R2 ubiquitin-conjugating enzyme E2R 2 773 99 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21826.[MT7]-ALMLELK[MT7].2y5_1.heavy 553.348 / 777.466 1599.0 36.889774322509766 23 13 0 6 4 1.5470955006547646 53.21382780065186 0.032501220703125 9 0.9201684350578583 4.338530016863199 1599.0 4.081586855210748 3.0 - - - - - - - 248.33333333333334 3 21 UBE2R2 ubiquitin-conjugating enzyme E2R 2 775 99 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21826.[MT7]-ALMLELK[MT7].2y3_1.heavy 553.348 / 533.341 3113.0 36.889774322509766 23 13 0 6 4 1.5470955006547646 53.21382780065186 0.032501220703125 9 0.9201684350578583 4.338530016863199 3113.0 3.7010568031704096 0.0 - - - - - - - 757.0 6 14 UBE2R2 ubiquitin-conjugating enzyme E2R 2 777 99 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21826.[MT7]-ALMLELK[MT7].2y6_1.heavy 553.348 / 890.55 1178.0 36.889774322509766 23 13 0 6 4 1.5470955006547646 53.21382780065186 0.032501220703125 9 0.9201684350578583 4.338530016863199 1178.0 4.207142857142857 1.0 - - - - - - - 280.42857142857144 2 21 UBE2R2 ubiquitin-conjugating enzyme E2R 2 779 100 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540975.[MT7]-VAWLLR.2y4_1.heavy 451.291 / 587.366 23262.0 38.93320083618164 48 18 10 10 10 2.478184330647085 30.463003205746883 0.0 3 0.988098633800307 11.301401204403444 23262.0 21.140654610827642 1.0 - - - - - - - 193.72727272727272 55 11 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 781 100 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540975.[MT7]-VAWLLR.2b3_1.heavy 451.291 / 501.294 33255.0 38.93320083618164 48 18 10 10 10 2.478184330647085 30.463003205746883 0.0 3 0.988098633800307 11.301401204403444 33255.0 18.5007414410828 0.0 - - - - - - - 344.2 66 5 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 783 100 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540975.[MT7]-VAWLLR.2y5_1.heavy 451.291 / 658.404 130646.0 38.93320083618164 48 18 10 10 10 2.478184330647085 30.463003205746883 0.0 3 0.988098633800307 11.301401204403444 130646.0 385.145635900321 0.0 - - - - - - - 177.66666666666666 261 6 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 785 100 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540975.[MT7]-VAWLLR.2b4_1.heavy 451.291 / 614.378 48818.0 38.93320083618164 48 18 10 10 10 2.478184330647085 30.463003205746883 0.0 3 0.988098633800307 11.301401204403444 48818.0 31.424248611017987 0.0 - - - - - - - 215.125 97 8 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 787 101 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543127.[MT7]-AAPLWDSK[MT7].2y4_1.heavy 588.337 / 679.353 2362.0 30.10610008239746 43 15 10 10 8 3.1328663604737272 31.919650726780056 0.0 4 0.9545027411947054 5.763804529733683 2362.0 2.514341811325395 0.0 - - - - - - - 236.0 4 14 PRKAG3;PRKAG1 protein kinase, AMP-activated, gamma 3 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 789 101 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543127.[MT7]-AAPLWDSK[MT7].2y5_1.heavy 588.337 / 792.437 827.0 30.10610008239746 43 15 10 10 8 3.1328663604737272 31.919650726780056 0.0 4 0.9545027411947054 5.763804529733683 827.0 2.733305084745763 4.0 - - - - - - - 0.0 1 0 PRKAG3;PRKAG1 protein kinase, AMP-activated, gamma 3 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 791 101 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543127.[MT7]-AAPLWDSK[MT7].2y6_1.heavy 588.337 / 889.49 5432.0 30.10610008239746 43 15 10 10 8 3.1328663604737272 31.919650726780056 0.0 4 0.9545027411947054 5.763804529733683 5432.0 18.77817702448211 0.0 - - - - - - - 275.3333333333333 10 6 PRKAG3;PRKAG1 protein kinase, AMP-activated, gamma 3 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 793 101 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543127.[MT7]-AAPLWDSK[MT7].2y7_1.heavy 588.337 / 960.527 1771.0 30.10610008239746 43 15 10 10 8 3.1328663604737272 31.919650726780056 0.0 4 0.9545027411947054 5.763804529733683 1771.0 9.455338983050847 1.0 - - - - - - - 255.66666666666666 6 12 PRKAG3;PRKAG1 protein kinase, AMP-activated, gamma 3 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 795 102 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543540.[MT7]-DYNVTANSK[MT7].3y3_1.heavy 433.898 / 492.29 30975.0 19.775150775909424 42 16 10 6 10 3.3815582004518037 29.572165869166227 0.031000137329101562 3 0.9616689747920628 6.283332658350614 30975.0 117.47979336956973 0.0 - - - - - - - 280.4 61 15 LDHA lactate dehydrogenase A 797 102 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543540.[MT7]-DYNVTANSK[MT7].3b4_1.heavy 433.898 / 636.311 15852.0 19.775150775909424 42 16 10 6 10 3.3815582004518037 29.572165869166227 0.031000137329101562 3 0.9616689747920628 6.283332658350614 15852.0 85.9082247795193 0.0 - - - - - - - 234.75 31 24 LDHA lactate dehydrogenase A 799 102 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543540.[MT7]-DYNVTANSK[MT7].3y4_1.heavy 433.898 / 563.327 24474.0 19.775150775909424 42 16 10 6 10 3.3815582004518037 29.572165869166227 0.031000137329101562 3 0.9616689747920628 6.283332658350614 24474.0 58.98904520547946 0.0 - - - - - - - 314.42857142857144 48 21 LDHA lactate dehydrogenase A 801 102 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543540.[MT7]-DYNVTANSK[MT7].3b3_1.heavy 433.898 / 537.242 49991.0 19.775150775909424 42 16 10 6 10 3.3815582004518037 29.572165869166227 0.031000137329101562 3 0.9616689747920628 6.283332658350614 49991.0 328.7405991164371 0.0 - - - - - - - 271.5625 99 16 LDHA lactate dehydrogenase A 803 103 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21823.[MT7]-ESPDQILR.2y4_1.heavy 551.305 / 529.346 N/A 27.32270050048828 46 16 10 10 10 1.8682492048266512 42.64986648932696 0.0 3 0.9629144167369132 6.388640068638676 5520.0 3.5572995401015466 2.0 - - - - - - - 828.0 11 2 WEE2 WEE1 homolog 2 (S. pombe) 805 103 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21823.[MT7]-ESPDQILR.2b4_1.heavy 551.305 / 573.264 2318.0 27.32270050048828 46 16 10 10 10 1.8682492048266512 42.64986648932696 0.0 3 0.9629144167369132 6.388640068638676 2318.0 6.168564496032527 2.0 - - - - - - - 294.44444444444446 4 9 WEE2 WEE1 homolog 2 (S. pombe) 807 103 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21823.[MT7]-ESPDQILR.2y6_1.heavy 551.305 / 741.425 3202.0 27.32270050048828 46 16 10 10 10 1.8682492048266512 42.64986648932696 0.0 3 0.9629144167369132 6.388640068638676 3202.0 9.692844669828927 0.0 - - - - - - - 266.75 6 12 WEE2 WEE1 homolog 2 (S. pombe) 809 103 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21823.[MT7]-ESPDQILR.2y7_1.heavy 551.305 / 828.457 3974.0 27.32270050048828 46 16 10 10 10 1.8682492048266512 42.64986648932696 0.0 3 0.9629144167369132 6.388640068638676 3974.0 17.168640483383683 0.0 - - - - - - - 231.8 7 10 WEE2 WEE1 homolog 2 (S. pombe) 811 104 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 262713.0 22.288799285888672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 262713.0 167.65573893066454 0.0 - - - - - - - 609.0 525 9 813 104 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 373143.0 22.288799285888672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 373143.0 1931.404941183604 0.0 - - - - - - - 137.52941176470588 746 17 815 104 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 1372070.0 22.288799285888672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1372070.0 1131.0606275766127 0.0 - - - - - - - 216.8 2744 15 817 105 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543850.[MT7]-SHYFEGVLK[MT7].3b6_1.heavy 456.59 / 865.396 2645.0 29.2052001953125 44 14 10 10 10 2.0814133044421785 37.73960366454135 0.0 3 0.9309564116785434 4.6694924394363735 2645.0 32.89 1.0 - - - - - - - 184.0 8 5 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 819 105 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543850.[MT7]-SHYFEGVLK[MT7].3y4_1.heavy 456.59 / 560.389 23686.0 29.2052001953125 44 14 10 10 10 2.0814133044421785 37.73960366454135 0.0 3 0.9309564116785434 4.6694924394363735 23686.0 61.926875362318846 0.0 - - - - - - - 345.0 47 10 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 821 105 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543850.[MT7]-SHYFEGVLK[MT7].3b3_1.heavy 456.59 / 532.264 11843.0 29.2052001953125 44 14 10 10 10 2.0814133044421785 37.73960366454135 0.0 3 0.9309564116785434 4.6694924394363735 11843.0 4.631492983666897 0.0 - - - - - - - 333.5 23 10 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 823 105 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543850.[MT7]-SHYFEGVLK[MT7].3y5_1.heavy 456.59 / 689.431 8049.0 29.2052001953125 44 14 10 10 10 2.0814133044421785 37.73960366454135 0.0 3 0.9309564116785434 4.6694924394363735 8049.0 35.441051383399206 0.0 - - - - - - - 215.625 16 16 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 825 106 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543637.[MT7]-ATILYGSETGR.2y8_1.heavy 656.355 / 882.432 3193.0 27.664674758911133 39 15 10 6 8 10.177977615478103 9.825134597262776 0.03910064697265625 4 0.9576334299806819 5.974552330870661 3193.0 10.300728046641213 0.0 - - - - - - - 293.3333333333333 6 9 NOS3 nitric oxide synthase 3 (endothelial cell) 827 106 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543637.[MT7]-ATILYGSETGR.2y6_1.heavy 656.355 / 606.284 1982.0 27.664674758911133 39 15 10 6 8 10.177977615478103 9.825134597262776 0.03910064697265625 4 0.9576334299806819 5.974552330870661 1982.0 7.936728530984587 1.0 - - - - - - - 201.66666666666666 4 12 NOS3 nitric oxide synthase 3 (endothelial cell) 829 106 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543637.[MT7]-ATILYGSETGR.2y10_1.heavy 656.355 / 1096.56 771.0 27.664674758911133 39 15 10 6 8 10.177977615478103 9.825134597262776 0.03910064697265625 4 0.9576334299806819 5.974552330870661 771.0 13.906036363636362 0.0 - - - - - - - 0.0 1 0 NOS3 nitric oxide synthase 3 (endothelial cell) 831 106 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543637.[MT7]-ATILYGSETGR.2y7_1.heavy 656.355 / 769.347 2202.0 27.664674758911133 39 15 10 6 8 10.177977615478103 9.825134597262776 0.03910064697265625 4 0.9576334299806819 5.974552330870661 2202.0 4.704272727272727 1.0 - - - - - - - 270.0 5 11 NOS3 nitric oxide synthase 3 (endothelial cell) 833 107 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21609.[MT7]-ATILVR.2y4_1.heavy 408.775 / 500.355 2203.0 26.6023006439209 41 17 8 10 6 2.2922353426676603 29.696443994257102 0.0 5 0.9729884201491177 7.492123327528326 2203.0 7.48866066958268 6.0 - - - - - - - 315.0 15 12 NOS3 nitric oxide synthase 3 (endothelial cell) 835 107 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21609.[MT7]-ATILVR.2b3_1.heavy 408.775 / 430.278 5035.0 26.6023006439209 41 17 8 10 6 2.2922353426676603 29.696443994257102 0.0 5 0.9729884201491177 7.492123327528326 5035.0 25.834835214739847 1.0 - - - - - - - 694.625 25 8 NOS3 nitric oxide synthase 3 (endothelial cell) 837 107 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21609.[MT7]-ATILVR.2y5_1.heavy 408.775 / 601.403 6818.0 26.6023006439209 41 17 8 10 6 2.2922353426676603 29.696443994257102 0.0 5 0.9729884201491177 7.492123327528326 6818.0 10.598374567376244 1.0 - - - - - - - 217.0 20 15 NOS3 nitric oxide synthase 3 (endothelial cell) 839 107 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21609.[MT7]-ATILVR.2b4_1.heavy 408.775 / 543.362 5454.0 26.6023006439209 41 17 8 10 6 2.2922353426676603 29.696443994257102 0.0 5 0.9729884201491177 7.492123327528326 5454.0 18.539223256870315 1.0 - - - - - - - 258.46153846153845 26 13 NOS3 nitric oxide synthase 3 (endothelial cell) 841 108 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21603.[MT7]-ASIVK[MT7].2b3_1.heavy 403.273 / 416.263 4059.0 19.910874843597412 44 18 10 6 10 3.0056938762072387 33.27018788958837 0.030900955200195312 3 0.9821575133870369 9.225434210262792 4059.0 14.384448319594167 0.0 - - - - - - - 774.75 8 8 NCK1 NCK adaptor protein 1 843 108 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21603.[MT7]-ASIVK[MT7].2y4_1.heavy 403.273 / 590.399 10775.0 19.910874843597412 44 18 10 6 10 3.0056938762072387 33.27018788958837 0.030900955200195312 3 0.9821575133870369 9.225434210262792 10775.0 66.08673071350556 0.0 - - - - - - - 174.45454545454547 21 22 NCK1 NCK adaptor protein 1 845 108 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21603.[MT7]-ASIVK[MT7].2b4_1.heavy 403.273 / 515.331 3100.0 19.910874843597412 44 18 10 6 10 3.0056938762072387 33.27018788958837 0.030900955200195312 3 0.9821575133870369 9.225434210262792 3100.0 9.114119922630561 0.0 - - - - - - - 599.625 6 8 NCK1 NCK adaptor protein 1 847 108 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21603.[MT7]-ASIVK[MT7].2y3_1.heavy 403.273 / 503.367 1956.0 19.910874843597412 44 18 10 6 10 3.0056938762072387 33.27018788958837 0.030900955200195312 3 0.9821575133870369 9.225434210262792 1956.0 6.2305217031831335 2.0 - - - - - - - 261.11538461538464 10 26 NCK1 NCK adaptor protein 1 849 109 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544508.[MT7]-ESLTEAEVATEK[MT7].3y3_1.heavy 532.285 / 521.305 21928.0 26.098899841308594 47 17 10 10 10 4.051343464481174 19.734418250726748 0.0 3 0.9762626043091605 7.994346846389104 21928.0 30.05606484893147 0.0 - - - - - - - 1327.4285714285713 43 7 LIG1 ligase I, DNA, ATP-dependent 851 109 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544508.[MT7]-ESLTEAEVATEK[MT7].3b5_1.heavy 532.285 / 704.358 11277.0 26.098899841308594 47 17 10 10 10 4.051343464481174 19.734418250726748 0.0 3 0.9762626043091605 7.994346846389104 11277.0 17.285345860004128 1.0 - - - - - - - 699.7 22 10 LIG1 ligase I, DNA, ATP-dependent 853 109 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544508.[MT7]-ESLTEAEVATEK[MT7].3y4_1.heavy 532.285 / 592.342 20570.0 26.098899841308594 47 17 10 10 10 4.051343464481174 19.734418250726748 0.0 3 0.9762626043091605 7.994346846389104 20570.0 22.40077314953551 0.0 - - - - - - - 678.875 41 8 LIG1 ligase I, DNA, ATP-dependent 855 109 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544508.[MT7]-ESLTEAEVATEK[MT7].3b7_1.heavy 532.285 / 904.438 16393.0 26.098899841308594 47 17 10 10 10 4.051343464481174 19.734418250726748 0.0 3 0.9762626043091605 7.994346846389104 16393.0 155.61996168582377 0.0 - - - - - - - 151.63636363636363 32 11 LIG1 ligase I, DNA, ATP-dependent 857 110 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544503.[MT7]-LQVSQQEDITK[MT7].3b4_1.heavy 526.298 / 572.352 26563.0 25.6962251663208 46 20 10 6 10 12.672898590720486 7.890854588959095 0.037899017333984375 3 0.9965096796533567 20.88350186714378 26563.0 36.14529901095384 0.0 - - - - - - - 163.28571428571428 53 7 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 859 110 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544503.[MT7]-LQVSQQEDITK[MT7].3b5_1.heavy 526.298 / 700.411 16498.0 25.6962251663208 46 20 10 6 10 12.672898590720486 7.890854588959095 0.037899017333984375 3 0.9965096796533567 20.88350186714378 16498.0 36.16561366854702 0.0 - - - - - - - 238.8 32 10 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 861 110 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544503.[MT7]-LQVSQQEDITK[MT7].3y4_1.heavy 526.298 / 620.374 70247.0 25.6962251663208 46 20 10 6 10 12.672898590720486 7.890854588959095 0.037899017333984375 3 0.9965096796533567 20.88350186714378 70247.0 59.71610990073948 0.0 - - - - - - - 726.4285714285714 140 7 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 863 110 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544503.[MT7]-LQVSQQEDITK[MT7].3y5_1.heavy 526.298 / 749.416 25629.0 25.6962251663208 46 20 10 6 10 12.672898590720486 7.890854588959095 0.037899017333984375 3 0.9965096796533567 20.88350186714378 25629.0 38.742675944795835 0.0 - - - - - - - 166.2 51 10 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 865 111 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21958.[MT7]-VTLTSEEEAR.2y8_1.heavy 639.837 / 934.448 4022.0 24.15880012512207 45 15 10 10 10 3.5084821348686632 28.502354053954274 0.0 3 0.9528853439124472 5.663231280698091 4022.0 62.64012009848075 0.0 - - - - - - - 114.0 8 4 LDHA lactate dehydrogenase A 867 111 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21958.[MT7]-VTLTSEEEAR.2y9_1.heavy 639.837 / 1035.5 16728.0 24.15880012512207 45 15 10 10 10 3.5084821348686632 28.502354053954274 0.0 3 0.9528853439124472 5.663231280698091 16728.0 226.50627095532207 0.0 - - - - - - - 182.57142857142858 33 7 LDHA lactate dehydrogenase A 869 111 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21958.[MT7]-VTLTSEEEAR.2y6_1.heavy 639.837 / 720.316 7130.0 24.15880012512207 45 15 10 10 10 3.5084821348686632 28.502354053954274 0.0 3 0.9528853439124472 5.663231280698091 7130.0 40.58277244485617 0.0 - - - - - - - 232.63636363636363 14 11 LDHA lactate dehydrogenase A 871 111 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21958.[MT7]-VTLTSEEEAR.2y7_1.heavy 639.837 / 821.364 14442.0 24.15880012512207 45 15 10 10 10 3.5084821348686632 28.502354053954274 0.0 3 0.9528853439124472 5.663231280698091 14442.0 218.61162313096742 0.0 - - - - - - - 152.16666666666666 28 6 LDHA lactate dehydrogenase A 873 112 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 587438.0 31.35770034790039 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 587438.0 2149.2938812638345 0.0 - - - - - - - 694.375 1174 8 875 112 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 543160.0 31.35770034790039 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 543160.0 541.0605252894153 0.0 - - - - - - - 301.6666666666667 1086 3 877 112 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 934080.0 31.35770034790039 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 934080.0 1382.1080820700893 0.0 - - - - - - - 723.8 1868 5 879 113 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540967.[MT7]-VIAANNR.2y4_1.heavy 451.27 / 474.242 3206.0 17.720699787139893 46 20 10 6 10 9.550642389034758 10.47049988122386 0.03199958801269531 3 0.99649350217845 20.83524429670397 3206.0 8.676279459356557 0.0 - - - - - - - 624.4166666666666 6 12 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 881 113 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540967.[MT7]-VIAANNR.2y5_1.heavy 451.27 / 545.279 7339.0 17.720699787139893 46 20 10 6 10 9.550642389034758 10.47049988122386 0.03199958801269531 3 0.99649350217845 20.83524429670397 7339.0 25.96640872852347 0.0 - - - - - - - 203.94444444444446 14 18 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 883 113 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540967.[MT7]-VIAANNR.2y6_1.heavy 451.27 / 658.363 12554.0 17.720699787139893 46 20 10 6 10 9.550642389034758 10.47049988122386 0.03199958801269531 3 0.99649350217845 20.83524429670397 12554.0 93.05864950693633 0.0 - - - - - - - 160.4 25 20 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 885 113 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540967.[MT7]-VIAANNR.2b5_1.heavy 451.27 / 613.379 773.0 17.720699787139893 46 20 10 6 10 9.550642389034758 10.47049988122386 0.03199958801269531 3 0.99649350217845 20.83524429670397 773.0 3.448332718339127 5.0 - - - - - - - 643.7777777777778 3 9 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 887 114 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39105.[MT7]-QVVESAYEVIK[MT7].2y8_1.heavy 776.945 / 1082.58 2250.0 32.49209976196289 46 16 10 10 10 3.137206428099198 25.469111099939227 0.0 3 0.9633482237811555 6.426572040587631 2250.0 17.384752534799794 0.0 - - - - - - - 207.85714285714286 4 7 LDHA lactate dehydrogenase A 889 114 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39105.[MT7]-QVVESAYEVIK[MT7].2y9_1.heavy 776.945 / 1181.65 1588.0 32.49209976196289 46 16 10 10 10 3.137206428099198 25.469111099939227 0.0 3 0.9633482237811555 6.426572040587631 1588.0 24.060606060606062 0.0 - - - - - - - 264.5 3 2 LDHA lactate dehydrogenase A 891 114 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39105.[MT7]-QVVESAYEVIK[MT7].2b4_1.heavy 776.945 / 600.347 2382.0 32.49209976196289 46 16 10 10 10 3.137206428099198 25.469111099939227 0.0 3 0.9633482237811555 6.426572040587631 2382.0 3.412844971757358 1.0 - - - - - - - 211.8 5 5 LDHA lactate dehydrogenase A 893 114 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39105.[MT7]-QVVESAYEVIK[MT7].2y3_1.heavy 776.945 / 503.367 926.0 32.49209976196289 46 16 10 10 10 3.137206428099198 25.469111099939227 0.0 3 0.9633482237811555 6.426572040587631 926.0 11.224242424242426 1.0 - - - - - - - 0.0 1 0 LDHA lactate dehydrogenase A 895 115 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540209.[MT7]-RSGLVR.2b3_1.heavy 416.268 / 445.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 897 115 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540209.[MT7]-RSGLVR.2y5_1.heavy 416.268 / 531.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 899 115 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540209.[MT7]-RSGLVR.2b4_1.heavy 416.268 / 558.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 901 115 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540209.[MT7]-RSGLVR.2b5_1.heavy 416.268 / 657.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 903 116 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39109.[MT7]-LGGQPAPPQLLLGR.2y8_1.heavy 780.971 / 893.557 1034.0 36.250265757242836 44 18 10 6 10 3.4649877478254263 28.860130908906815 0.03530120849609375 2 0.9825627818399889 9.3323424760504 1034.0 0.9777777777777779 3.0 - - - - - - - 250.66666666666666 2 12 SMAD6 SMAD family member 6 905 116 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39109.[MT7]-LGGQPAPPQLLLGR.2y10_1.heavy 780.971 / 1061.65 2443.0 36.250265757242836 44 18 10 6 10 3.4649877478254263 28.860130908906815 0.03530120849609375 2 0.9825627818399889 9.3323424760504 2443.0 16.737148936170215 0.0 - - - - - - - 242.83333333333334 4 12 SMAD6 SMAD family member 6 907 116 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39109.[MT7]-LGGQPAPPQLLLGR.2b4_1.heavy 780.971 / 500.295 3477.0 36.250265757242836 44 18 10 6 10 3.4649877478254263 28.860130908906815 0.03530120849609375 2 0.9825627818399889 9.3323424760504 3477.0 -1.1984634717770717 2.0 - - - - - - - 241.71428571428572 7 14 SMAD6 SMAD family member 6 909 116 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39109.[MT7]-LGGQPAPPQLLLGR.2y9_1.heavy 780.971 / 964.594 N/A 36.250265757242836 44 18 10 6 10 3.4649877478254263 28.860130908906815 0.03530120849609375 2 0.9825627818399889 9.3323424760504 188.0 0.08000000000000002 18.0 - - - - - - - 0.0 1 0 SMAD6 SMAD family member 6 911 117 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21810.[MT7]-MLISSIK[MT7].2b3_1.heavy 540.34 / 502.318 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 913 117 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21810.[MT7]-MLISSIK[MT7].2y4_1.heavy 540.34 / 578.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 915 117 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21810.[MT7]-MLISSIK[MT7].2y5_1.heavy 540.34 / 691.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 917 117 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21810.[MT7]-MLISSIK[MT7].2y6_1.heavy 540.34 / 804.531 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 919 118 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21691.[MT7]-DQLIYNLLK[MT7].3y3_1.heavy 469.953 / 517.383 62218.0 41.32149887084961 48 18 10 10 10 5.01284079332273 19.9487683975927 0.0 3 0.9805062949415082 8.824846066255265 62218.0 386.36272636307945 0.0 - - - - - - - 253.8125 124 16 LDHA lactate dehydrogenase A 921 118 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21691.[MT7]-DQLIYNLLK[MT7].3b4_1.heavy 469.953 / 614.363 162061.0 41.32149887084961 48 18 10 10 10 5.01284079332273 19.9487683975927 0.0 3 0.9805062949415082 8.824846066255265 162061.0 1658.4812996753099 0.0 - - - - - - - 232.92307692307693 324 13 LDHA lactate dehydrogenase A 923 118 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21691.[MT7]-DQLIYNLLK[MT7].3b5_1.heavy 469.953 / 777.426 44679.0 41.32149887084961 48 18 10 10 10 5.01284079332273 19.9487683975927 0.0 3 0.9805062949415082 8.824846066255265 44679.0 613.7002990808068 0.0 - - - - - - - 125.6 89 15 LDHA lactate dehydrogenase A 925 118 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21691.[MT7]-DQLIYNLLK[MT7].3b3_1.heavy 469.953 / 501.279 198395.0 41.32149887084961 48 18 10 10 10 5.01284079332273 19.9487683975927 0.0 3 0.9805062949415082 8.824846066255265 198395.0 555.326862302483 0.0 - - - - - - - 298.4166666666667 396 12 LDHA lactate dehydrogenase A 927 119 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22279.[MT7]-FSTMEELVEHYK[MT7].3y3_1.heavy 600.974 / 591.337 2704.0 38.88779830932617 43 13 10 10 10 0.9737292386502064 59.89791917721139 0.0 3 0.9045821914798075 3.963075225336236 2704.0 9.471007079705974 0.0 - - - - - - - 273.5 5 16 NCK1 NCK adaptor protein 1 929 119 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22279.[MT7]-FSTMEELVEHYK[MT7].3b6_1.heavy 600.974 / 869.383 2465.0 38.88779830932617 43 13 10 10 10 0.9737292386502064 59.89791917721139 0.0 3 0.9045821914798075 3.963075225336236 2465.0 37.95751179245283 0.0 - - - - - - - 109.625 4 8 NCK1 NCK adaptor protein 1 931 119 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22279.[MT7]-FSTMEELVEHYK[MT7].3b5_1.heavy 600.974 / 740.341 1511.0 38.88779830932617 43 13 10 10 10 0.9737292386502064 59.89791917721139 0.0 3 0.9045821914798075 3.963075225336236 1511.0 11.969664359533516 0.0 - - - - - - - 194.125 3 16 NCK1 NCK adaptor protein 1 933 119 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22279.[MT7]-FSTMEELVEHYK[MT7].3b7_1.heavy 600.974 / 982.467 875.0 38.88779830932617 43 13 10 10 10 0.9737292386502064 59.89791917721139 0.0 3 0.9045821914798075 3.963075225336236 875.0 10.180817610062892 0.0 - - - - - - - 0.0 1 0 NCK1 NCK adaptor protein 1 935 120 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22278.[MT7]-RNIQQYNSFVSLSV.2b8_1.heavy 899.982 / 1148.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 937 120 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22278.[MT7]-RNIQQYNSFVSLSV.2b8_2.heavy 899.982 / 574.8 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 939 120 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22278.[MT7]-RNIQQYNSFVSLSV.2b4_1.heavy 899.982 / 656.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 941 120 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22278.[MT7]-RNIQQYNSFVSLSV.2b7_2.heavy 899.982 / 531.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 943 121 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21911.[MT7]-LLC[CAM]SWQLR.2y5_1.heavy 610.341 / 689.373 5204.0 37.8110990524292 42 16 10 6 10 2.37605917143607 42.08649397378469 0.033199310302734375 3 0.9618287304300454 6.296552553439472 5204.0 15.120581113801451 0.0 - - - - - - - 275.42857142857144 10 21 FANCL Fanconi anemia, complementation group L 945 121 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21911.[MT7]-LLC[CAM]SWQLR.2b4_1.heavy 610.341 / 618.34 1735.0 37.8110990524292 42 16 10 6 10 2.37605917143607 42.08649397378469 0.033199310302734375 3 0.9618287304300454 6.296552553439472 1735.0 3.0338998580803587 0.0 - - - - - - - 755.1428571428571 3 7 FANCL Fanconi anemia, complementation group L 947 121 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21911.[MT7]-LLC[CAM]SWQLR.2y6_1.heavy 610.341 / 849.404 7682.0 37.8110990524292 42 16 10 6 10 2.37605917143607 42.08649397378469 0.033199310302734375 3 0.9618287304300454 6.296552553439472 7682.0 54.006787878787875 0.0 - - - - - - - 201.4375 15 16 FANCL Fanconi anemia, complementation group L 949 121 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21911.[MT7]-LLC[CAM]SWQLR.2y7_1.heavy 610.341 / 962.488 10573.0 37.8110990524292 42 16 10 6 10 2.37605917143607 42.08649397378469 0.033199310302734375 3 0.9618287304300454 6.296552553439472 10573.0 41.09246282898186 0.0 - - - - - - - 240.83333333333334 21 12 FANCL Fanconi anemia, complementation group L 951 122 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541490.[MT7]-IFDAAK[MT7].2b3_1.heavy 476.789 / 520.289 29352.0 27.65489959716797 47 17 10 10 10 2.253475629785217 34.64415438582873 0.0 3 0.9778530443889336 8.277525983317371 29352.0 55.33988517072379 0.0 - - - - - - - 216.0 58 5 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 953 122 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541490.[MT7]-IFDAAK[MT7].2y4_1.heavy 476.789 / 548.316 16511.0 27.65489959716797 47 17 10 10 10 2.253475629785217 34.64415438582873 0.0 3 0.9778530443889336 8.277525983317371 16511.0 15.71400186751689 0.0 - - - - - - - 724.5714285714286 33 7 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 955 122 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541490.[MT7]-IFDAAK[MT7].2y5_1.heavy 476.789 / 695.385 47374.0 27.65489959716797 47 17 10 10 10 2.253475629785217 34.64415438582873 0.0 3 0.9778530443889336 8.277525983317371 47374.0 51.88658113638541 0.0 - - - - - - - 288.0 94 3 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 957 122 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541490.[MT7]-IFDAAK[MT7].2b4_1.heavy 476.789 / 591.326 5719.0 27.65489959716797 47 17 10 10 10 2.253475629785217 34.64415438582873 0.0 3 0.9778530443889336 8.277525983317371 5719.0 13.685065431195643 1.0 - - - - - - - 240.0 11 9 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 959 123 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543239.[MT7]-FIIPNVVK[MT7].2y4_1.heavy 609.397 / 603.395 2757.0 37.461050033569336 41 14 10 7 10 2.8513708276347587 35.070850494374675 0.024700164794921875 3 0.9450067501228983 5.238380355834858 2757.0 1.9900257724198978 1.0 - - - - - - - 1241.142857142857 5 7 LDHA lactate dehydrogenase A 961 123 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543239.[MT7]-FIIPNVVK[MT7].2b3_1.heavy 609.397 / 518.346 28234.0 37.461050033569336 41 14 10 7 10 2.8513708276347587 35.070850494374675 0.024700164794921875 3 0.9450067501228983 5.238380355834858 28234.0 51.8889707940441 0.0 - - - - - - - 295.6923076923077 56 13 LDHA lactate dehydrogenase A 963 123 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543239.[MT7]-FIIPNVVK[MT7].2y5_1.heavy 609.397 / 700.447 42351.0 37.461050033569336 41 14 10 7 10 2.8513708276347587 35.070850494374675 0.024700164794921875 3 0.9450067501228983 5.238380355834858 42351.0 110.20963993453356 0.0 - - - - - - - 736.7272727272727 84 11 LDHA lactate dehydrogenase A 965 123 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543239.[MT7]-FIIPNVVK[MT7].2y6_1.heavy 609.397 / 813.531 6014.0 37.461050033569336 41 14 10 7 10 2.8513708276347587 35.070850494374675 0.024700164794921875 3 0.9450067501228983 5.238380355834858 6014.0 34.81157684630738 0.0 - - - - - - - 196.6 12 20 LDHA lactate dehydrogenase A 967 124 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39006.[MT7]-VIGSGC[CAM]NLDSAR.2y10_1.heavy 696.855 / 1036.45 1629.0 24.9601993560791 42 12 10 10 10 2.532120187072049 26.32839744615556 0.0 2 0.8962667170014339 3.7981801990046047 1629.0 8.948856088560888 0.0 - - - - - - - 225.83333333333334 3 6 LDHAL6A;LDHA;LDHB;LDHC lactate dehydrogenase A-like 6A;lactate dehydrogenase A;lactate dehydrogenase B;lactate dehydrogenase C 969 124 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39006.[MT7]-VIGSGC[CAM]NLDSAR.2y11_1.heavy 696.855 / 1149.53 2895.0 24.9601993560791 42 12 10 10 10 2.532120187072049 26.32839744615556 0.0 2 0.8962667170014339 3.7981801990046047 2895.0 16.237638376383764 0.0 - - - - - - - 210.83333333333334 5 6 LDHAL6A;LDHA;LDHB;LDHC lactate dehydrogenase A-like 6A;lactate dehydrogenase A;lactate dehydrogenase B;lactate dehydrogenase C 971 124 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39006.[MT7]-VIGSGC[CAM]NLDSAR.2y5_1.heavy 696.855 / 561.299 N/A 24.9601993560791 42 12 10 10 10 2.532120187072049 26.32839744615556 0.0 2 0.8962667170014339 3.7981801990046047 90.0 0.3999999999999999 19.0 - - - - - - - 0.0 0 0 LDHAL6A;LDHA;LDHB;LDHC lactate dehydrogenase A-like 6A;lactate dehydrogenase A;lactate dehydrogenase B;lactate dehydrogenase C 973 124 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39006.[MT7]-VIGSGC[CAM]NLDSAR.2y9_1.heavy 696.855 / 979.426 N/A 24.9601993560791 42 12 10 10 10 2.532120187072049 26.32839744615556 0.0 2 0.8962667170014339 3.7981801990046047 362.0 0.7999999999999999 4.0 - - - - - - - 0.0 0 0 LDHAL6A;LDHA;LDHB;LDHC lactate dehydrogenase A-like 6A;lactate dehydrogenase A;lactate dehydrogenase B;lactate dehydrogenase C 975 125 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22276.[MT7]-IRGDLEEAGPEEGK[MT7].2y5_1.heavy 894.473 / 703.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 977 125 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22276.[MT7]-IRGDLEEAGPEEGK[MT7].2b4_1.heavy 894.473 / 586.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 979 125 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22276.[MT7]-IRGDLEEAGPEEGK[MT7].2y6_1.heavy 894.473 / 760.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 981 125 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22276.[MT7]-IRGDLEEAGPEEGK[MT7].2y10_1.heavy 894.473 / 1202.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 983 126 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21695.[MT7]-IEEVSAR.2b3_1.heavy 474.268 / 516.279 3269.0 21.46762466430664 40 17 10 7 6 3.7801872111215666 26.453716288387312 0.028900146484375 5 0.9756199599781884 7.88785373911449 3269.0 6.761879670782225 0.0 - - - - - - - 671.5 6 12 LIG1 ligase I, DNA, ATP-dependent 985 126 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21695.[MT7]-IEEVSAR.2y5_1.heavy 474.268 / 561.299 3223.0 21.46762466430664 40 17 10 7 6 3.7801872111215666 26.453716288387312 0.028900146484375 5 0.9756199599781884 7.88785373911449 3223.0 3.77416830351613 3.0 - - - - - - - 221.63636363636363 7 22 LIG1 ligase I, DNA, ATP-dependent 987 126 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21695.[MT7]-IEEVSAR.2b4_1.heavy 474.268 / 615.347 1611.0 21.46762466430664 40 17 10 7 6 3.7801872111215666 26.453716288387312 0.028900146484375 5 0.9756199599781884 7.88785373911449 1611.0 6.5665760869565215 2.0 - - - - - - - 265.38461538461536 3 26 LIG1 ligase I, DNA, ATP-dependent 989 126 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21695.[MT7]-IEEVSAR.2y6_1.heavy 474.268 / 690.342 12339.0 21.46762466430664 40 17 10 7 6 3.7801872111215666 26.453716288387312 0.028900146484375 5 0.9756199599781884 7.88785373911449 12339.0 21.387495051737755 0.0 - - - - - - - 753.6363636363636 24 11 LIG1 ligase I, DNA, ATP-dependent 991 127 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21804.[MT7]-ALTMEVIR.2y5_1.heavy 538.816 / 647.354 6113.0 32.84210014343262 45 20 10 5 10 7.018951238989786 14.247142713359649 0.048397064208984375 3 0.991371017143343 13.276077475028323 6113.0 4.338203249971366 0.0 - - - - - - - 342.0 12 7 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 993 127 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21804.[MT7]-ALTMEVIR.2y6_1.heavy 538.816 / 748.402 14751.0 32.84210014343262 45 20 10 5 10 7.018951238989786 14.247142713359649 0.048397064208984375 3 0.991371017143343 13.276077475028323 14751.0 90.76116541353383 0.0 - - - - - - - 232.75 29 12 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 995 127 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21804.[MT7]-ALTMEVIR.2b5_1.heavy 538.816 / 690.361 9701.0 32.84210014343262 45 20 10 5 10 7.018951238989786 14.247142713359649 0.048397064208984375 3 0.991371017143343 13.276077475028323 9701.0 34.05323937195561 0.0 - - - - - - - 266.0 19 9 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 997 127 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21804.[MT7]-ALTMEVIR.2y7_1.heavy 538.816 / 861.486 13422.0 32.84210014343262 45 20 10 5 10 7.018951238989786 14.247142713359649 0.048397064208984375 3 0.991371017143343 13.276077475028323 13422.0 46.42195488721804 0.0 - - - - - - - 239.4 26 5 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 999 128 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544105.[MT7]-LLPSDSPSTPK[MT7].3y3_1.heavy 477.276 / 489.315 10106.0 27.236000061035156 50 20 10 10 10 7.372982087589628 13.56303308647966 0.0 3 0.9955720108045837 18.53952952770391 10106.0 11.780899484600077 0.0 - - - - - - - 769.0 20 7 WEE2 WEE1 homolog 2 (S. pombe) 1001 128 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544105.[MT7]-LLPSDSPSTPK[MT7].3b6_1.heavy 477.276 / 757.421 12742.0 27.236000061035156 50 20 10 10 10 7.372982087589628 13.56303308647966 0.0 3 0.9955720108045837 18.53952952770391 12742.0 48.51623580062923 0.0 - - - - - - - 219.9 25 10 WEE2 WEE1 homolog 2 (S. pombe) 1003 128 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544105.[MT7]-LLPSDSPSTPK[MT7].3b5_1.heavy 477.276 / 670.389 22189.0 27.236000061035156 50 20 10 10 10 7.372982087589628 13.56303308647966 0.0 3 0.9955720108045837 18.53952952770391 22189.0 55.54786647124526 0.0 - - - - - - - 706.1428571428571 44 7 WEE2 WEE1 homolog 2 (S. pombe) 1005 128 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544105.[MT7]-LLPSDSPSTPK[MT7].3y4_1.heavy 477.276 / 576.347 11204.0 27.236000061035156 50 20 10 10 10 7.372982087589628 13.56303308647966 0.0 3 0.9955720108045837 18.53952952770391 11204.0 55.16693251846193 0.0 - - - - - - - 206.25 22 8 WEE2 WEE1 homolog 2 (S. pombe) 1007 129 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21696.[MT7]-LWGIDRDSYR.3b3_1.heavy 475.585 / 501.294 6284.0 31.704599380493164 39 11 10 10 8 1.8697286226773624 53.48369746664345 0.0 4 0.8749991249302922 3.4536196911794446 6284.0 10.106218746599088 1.0 - - - - - - - 687.625 13 8 PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 1009 129 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21696.[MT7]-LWGIDRDSYR.3y4_1.heavy 475.585 / 540.241 6415.0 31.704599380493164 39 11 10 10 8 1.8697286226773624 53.48369746664345 0.0 4 0.8749991249302922 3.4536196911794446 6415.0 12.242366412213741 0.0 - - - - - - - 622.25 12 8 PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 1011 129 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21696.[MT7]-LWGIDRDSYR.3y9_2.heavy 475.585 / 584.281 23697.0 31.704599380493164 39 11 10 10 8 1.8697286226773624 53.48369746664345 0.0 4 0.8749991249302922 3.4536196911794446 23697.0 14.33813442156714 0.0 - - - - - - - 318.14285714285717 47 7 PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 1013 129 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21696.[MT7]-LWGIDRDSYR.3b8_2.heavy 475.585 / 544.286 2095.0 31.704599380493164 39 11 10 10 8 1.8697286226773624 53.48369746664345 0.0 4 0.8749991249302922 3.4536196911794446 2095.0 1.4002227880330997 3.0 - - - - - - - 280.7142857142857 6 7 PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 1015 130 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22274.[MT7]-AFWDVMDEIDEK[MT7].2y5_1.heavy 893.434 / 777.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - FANCL Fanconi anemia, complementation group L 1017 130 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22274.[MT7]-AFWDVMDEIDEK[MT7].2b4_1.heavy 893.434 / 664.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - FANCL Fanconi anemia, complementation group L 1019 130 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22274.[MT7]-AFWDVMDEIDEK[MT7].2y3_1.heavy 893.434 / 535.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - FANCL Fanconi anemia, complementation group L 1021 130 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22274.[MT7]-AFWDVMDEIDEK[MT7].2y7_1.heavy 893.434 / 1023.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - FANCL Fanconi anemia, complementation group L 1023 131 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39207.[MT7]-TEELQQQLNLEK[MT7].2b3_1.heavy 880.985 / 504.242 1240.0 30.3164005279541 42 12 10 10 10 1.0357697563894936 64.36436887195339 0.0 3 0.8865416678012088 3.6286893686813304 1240.0 4.365 0.0 - - - - - - - 330.6666666666667 2 6 WEE2 WEE1 homolog 2 (S. pombe) 1025 131 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39207.[MT7]-TEELQQQLNLEK[MT7].2y4_1.heavy 880.985 / 647.385 1364.0 30.3164005279541 42 12 10 10 10 1.0357697563894936 64.36436887195339 0.0 3 0.8865416678012088 3.6286893686813304 1364.0 18.700000000000003 0.0 - - - - - - - 265.7142857142857 2 7 WEE2 WEE1 homolog 2 (S. pombe) 1027 131 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39207.[MT7]-TEELQQQLNLEK[MT7].2y8_1.heavy 880.985 / 1144.64 372.0 30.3164005279541 42 12 10 10 10 1.0357697563894936 64.36436887195339 0.0 3 0.8865416678012088 3.6286893686813304 372.0 5.85 0.0 - - - - - - - 0.0 0 0 WEE2 WEE1 homolog 2 (S. pombe) 1029 131 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39207.[MT7]-TEELQQQLNLEK[MT7].2b4_1.heavy 880.985 / 617.326 1860.0 30.3164005279541 42 12 10 10 10 1.0357697563894936 64.36436887195339 0.0 3 0.8865416678012088 3.6286893686813304 1860.0 9.649999999999999 0.0 - - - - - - - 268.6666666666667 3 6 WEE2 WEE1 homolog 2 (S. pombe) 1031 132 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22412.[MT7]-LLIVSNPVDILTYVAWK[MT7].3b9_1.heavy 744.78 / 1095.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA lactate dehydrogenase A 1033 132 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22412.[MT7]-LLIVSNPVDILTYVAWK[MT7].3b6_1.heavy 744.78 / 784.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA lactate dehydrogenase A 1035 132 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22412.[MT7]-LLIVSNPVDILTYVAWK[MT7].3b4_1.heavy 744.78 / 583.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA lactate dehydrogenase A 1037 132 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22412.[MT7]-LLIVSNPVDILTYVAWK[MT7].3y5_1.heavy 744.78 / 810.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA lactate dehydrogenase A 1039 133 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 328611.0 26.016700744628906 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 328611.0 634.1742791806945 0.0 - - - - - - - 104.0 657 1 1041 133 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 374814.0 26.016700744628906 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 374814.0 1200.365009661494 0.0 - - - - - - - 104.0 749 1 1043 133 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 486532.0 26.016700744628906 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 486532.0 1448.866199461645 0.0 - - - - - - - 207.5 973 2 1045 134 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22176.[MT7]-NVLFSHLDDNER.3y6_1.heavy 534.938 / 761.342 23292.0 31.897000312805176 42 17 10 5 10 3.8457195736044696 26.00293601394165 0.04400062561035156 3 0.9788112096003427 8.463294296320573 23292.0 77.42999777347131 0.0 - - - - - - - 733.0 46 7 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1047 134 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22176.[MT7]-NVLFSHLDDNER.3b4_1.heavy 534.938 / 618.373 9343.0 31.897000312805176 42 17 10 5 10 3.8457195736044696 26.00293601394165 0.04400062561035156 3 0.9788112096003427 8.463294296320573 9343.0 14.757946397913823 0.0 - - - - - - - 733.1428571428571 18 7 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1049 134 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22176.[MT7]-NVLFSHLDDNER.3b5_1.heavy 534.938 / 705.405 10264.0 31.897000312805176 42 17 10 5 10 3.8457195736044696 26.00293601394165 0.04400062561035156 3 0.9788112096003427 8.463294296320573 10264.0 12.828419042142446 0.0 - - - - - - - 605.2 20 10 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1051 134 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22176.[MT7]-NVLFSHLDDNER.3y4_1.heavy 534.938 / 533.231 13291.0 31.897000312805176 42 17 10 5 10 3.8457195736044696 26.00293601394165 0.04400062561035156 3 0.9788112096003427 8.463294296320573 13291.0 13.069718569891426 1.0 - - - - - - - 289.6 26 5 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1053 135 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38972.[MT7]-MSDGLFLQK[MT7].2y4_1.heavy 663.87 / 679.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1055 135 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38972.[MT7]-MSDGLFLQK[MT7].2b4_1.heavy 663.87 / 535.23 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1057 135 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38972.[MT7]-MSDGLFLQK[MT7].2y6_1.heavy 663.87 / 849.531 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1059 135 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38972.[MT7]-MSDGLFLQK[MT7].2b5_1.heavy 663.87 / 648.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1061 136 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543376.[MT7]-EASSQTPEK[MT7].3y3_1.heavy 422.226 / 517.31 10947.0 14.883600234985352 50 20 10 10 10 16.101017576307704 6.21078758072706 0.0 3 0.9981775434175314 28.904655358968192 10947.0 20.71541901066925 0.0 - - - - - - - 853.0 21 7 WEE2 WEE1 homolog 2 (S. pombe) 1063 136 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543376.[MT7]-EASSQTPEK[MT7].3b4_1.heavy 422.226 / 519.253 2452.0 14.883600234985352 50 20 10 10 10 16.101017576307704 6.21078758072706 0.0 3 0.9981775434175314 28.904655358968192 2452.0 17.382723004694835 0.0 - - - - - - - 179.25 4 24 WEE2 WEE1 homolog 2 (S. pombe) 1065 136 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543376.[MT7]-EASSQTPEK[MT7].3b5_1.heavy 422.226 / 647.312 3092.0 14.883600234985352 50 20 10 10 10 16.101017576307704 6.21078758072706 0.0 3 0.9981775434175314 28.904655358968192 3092.0 9.577128514056225 0.0 - - - - - - - 182.63636363636363 6 22 WEE2 WEE1 homolog 2 (S. pombe) 1067 136 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543376.[MT7]-EASSQTPEK[MT7].3b3_1.heavy 422.226 / 432.221 2488.0 14.883600234985352 50 20 10 10 10 16.101017576307704 6.21078758072706 0.0 3 0.9981775434175314 28.904655358968192 2488.0 9.656217660292464 0.0 - - - - - - - 216.30434782608697 4 23 WEE2 WEE1 homolog 2 (S. pombe) 1069 137 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39310.[MT7]-NVTNNFDERPISVGGNK[MT7].4y4_1.heavy 538.036 / 519.301 32288.0 26.727500915527344 48 18 10 10 10 2.854208248333381 26.608659828372534 0.0 3 0.9880103072061128 11.259612994226645 32288.0 36.170491292473486 0.0 - - - - - - - 105.0 64 1 IRAK4 interleukin-1 receptor-associated kinase 4 1071 137 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39310.[MT7]-NVTNNFDERPISVGGNK[MT7].4y8_1.heavy 538.036 / 915.538 1262.0 26.727500915527344 48 18 10 10 10 2.854208248333381 26.608659828372534 0.0 3 0.9880103072061128 11.259612994226645 1262.0 2.262869198312236 1.0 - - - - - - - 248.72727272727272 3 11 IRAK4 interleukin-1 receptor-associated kinase 4 1073 137 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39310.[MT7]-NVTNNFDERPISVGGNK[MT7].4b4_1.heavy 538.036 / 573.311 8309.0 26.727500915527344 48 18 10 10 10 2.854208248333381 26.608659828372534 0.0 3 0.9880103072061128 11.259612994226645 8309.0 14.03843717001056 1.0 - - - - - - - 706.2142857142857 16 14 IRAK4 interleukin-1 receptor-associated kinase 4 1075 137 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39310.[MT7]-NVTNNFDERPISVGGNK[MT7].4b5_1.heavy 538.036 / 687.354 11884.0 26.727500915527344 48 18 10 10 10 2.854208248333381 26.608659828372534 0.0 3 0.9880103072061128 11.259612994226645 11884.0 23.72348490496556 0.0 - - - - - - - 757.3 23 10 IRAK4 interleukin-1 receptor-associated kinase 4 1077 138 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38981.[MT7]-VSALPVVDEK[MT7].2y4_1.heavy 672.902 / 634.353 375.0 30.485349655151367 34 13 10 3 8 1.5946184706504516 62.71092542858203 0.07909965515136719 4 0.9124290508153403 4.139624002988533 375.0 -0.20000000000000007 20.0 - - - - - - - 230.76923076923077 2 13 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1079 138 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38981.[MT7]-VSALPVVDEK[MT7].2b4_1.heavy 672.902 / 515.331 3627.0 30.485349655151367 34 13 10 3 8 1.5946184706504516 62.71092542858203 0.07909965515136719 4 0.9124290508153403 4.139624002988533 3627.0 21.084960000000002 0.0 - - - - - - - 236.11111111111111 7 9 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1081 138 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38981.[MT7]-VSALPVVDEK[MT7].2y3_1.heavy 672.902 / 535.284 750.0 30.485349655151367 34 13 10 3 8 1.5946184706504516 62.71092542858203 0.07909965515136719 4 0.9124290508153403 4.139624002988533 750.0 5.64 3.0 - - - - - - - 222.22222222222223 2 9 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1083 138 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38981.[MT7]-VSALPVVDEK[MT7].2y6_1.heavy 672.902 / 830.474 4503.0 30.485349655151367 34 13 10 3 8 1.5946184706504516 62.71092542858203 0.07909965515136719 4 0.9124290508153403 4.139624002988533 4503.0 47.19144 0.0 - - - - - - - 208.33333333333334 9 6 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1085 139 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540276.[MT7]-AEDASGR.2b3_1.heavy 425.213 / 460.216 N/A N/A - - - - - - - - - 0.0 - - - - - - - FANCL Fanconi anemia, complementation group L 1087 139 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540276.[MT7]-AEDASGR.2y5_1.heavy 425.213 / 505.237 N/A N/A - - - - - - - - - 0.0 - - - - - - - FANCL Fanconi anemia, complementation group L 1089 139 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540276.[MT7]-AEDASGR.2b4_1.heavy 425.213 / 531.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - FANCL Fanconi anemia, complementation group L 1091 139 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540276.[MT7]-AEDASGR.2y6_1.heavy 425.213 / 634.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - FANCL Fanconi anemia, complementation group L 1093 140 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38838.[MT7]-TYVQDILR.2b3_1.heavy 576.331 / 508.289 1921.0 34.722100575764976 25 12 4 5 4 0.9480824515208225 61.0439469940126 0.044101715087890625 10 0.8825728223220114 3.565608493426399 1921.0 3.1561945911555354 0.0 - - - - - - - 338.1818181818182 3 11 NOS3 nitric oxide synthase 3 (endothelial cell) 1095 140 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38838.[MT7]-TYVQDILR.2b4_1.heavy 576.331 / 636.347 N/A 34.722100575764976 25 12 4 5 4 0.9480824515208225 61.0439469940126 0.044101715087890625 10 0.8825728223220114 3.565608493426399 600.0 0.47619047619047605 27.0 - - - - - - - 291.42857142857144 9 7 NOS3 nitric oxide synthase 3 (endothelial cell) 1097 140 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38838.[MT7]-TYVQDILR.2y6_1.heavy 576.331 / 743.441 1321.0 34.722100575764976 25 12 4 5 4 0.9480824515208225 61.0439469940126 0.044101715087890625 10 0.8825728223220114 3.565608493426399 1321.0 0.9571683521713266 8.0 - - - - - - - 260.0 3 12 NOS3 nitric oxide synthase 3 (endothelial cell) 1099 140 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38838.[MT7]-TYVQDILR.2b5_1.heavy 576.331 / 751.374 3122.0 34.722100575764976 25 12 4 5 4 0.9480824515208225 61.0439469940126 0.044101715087890625 10 0.8825728223220114 3.565608493426399 3122.0 8.890266666666665 1.0 - - - - - - - 280.0 10 9 NOS3 nitric oxide synthase 3 (endothelial cell) 1101 141 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22182.[MT7]-LYDLNMPAYVK[MT7].2b3_1.heavy 807.944 / 536.284 2002.0 37.16769886016846 42 15 10 7 10 2.0149351303279026 39.56151082044432 0.026401519775390625 3 0.9501621488949067 5.505063252153425 2002.0 6.241247002398081 0.0 - - - - - - - 176.47058823529412 4 17 NCK1 NCK adaptor protein 1 1103 141 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22182.[MT7]-LYDLNMPAYVK[MT7].2y5_1.heavy 807.944 / 721.437 2503.0 37.16769886016846 42 15 10 7 10 2.0149351303279026 39.56151082044432 0.026401519775390625 3 0.9501621488949067 5.505063252153425 2503.0 5.571746575342465 0.0 - - - - - - - 584.1111111111111 5 9 NCK1 NCK adaptor protein 1 1105 141 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22182.[MT7]-LYDLNMPAYVK[MT7].2y6_1.heavy 807.944 / 852.477 751.0 37.16769886016846 42 15 10 7 10 2.0149351303279026 39.56151082044432 0.026401519775390625 3 0.9501621488949067 5.505063252153425 751.0 3.8998035928143713 0.0 - - - - - - - 0.0 1 0 NCK1 NCK adaptor protein 1 1107 141 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22182.[MT7]-LYDLNMPAYVK[MT7].2b5_1.heavy 807.944 / 763.411 1669.0 37.16769886016846 42 15 10 7 10 2.0149351303279026 39.56151082044432 0.026401519775390625 3 0.9501621488949067 5.505063252153425 1669.0 1.1999205426078299 1.0 - - - - - - - 283.5 3 20 NCK1 NCK adaptor protein 1 1109 142 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544387.[MT7]-TPYTDVNIVTIR.3y6_1.heavy 512.623 / 715.446 32387.0 34.67034912109375 45 20 10 5 10 7.37166126190992 13.56546325815452 0.04470062255859375 3 0.9938717096906178 15.75689585911108 32387.0 78.08757037065314 0.0 - - - - - - - 718.0 64 7 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1111 142 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544387.[MT7]-TPYTDVNIVTIR.3b5_1.heavy 512.623 / 722.348 58856.0 34.67034912109375 45 20 10 5 10 7.37166126190992 13.56546325815452 0.04470062255859375 3 0.9938717096906178 15.75689585911108 58856.0 158.72885405001864 0.0 - - - - - - - 279.1666666666667 117 6 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1113 142 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544387.[MT7]-TPYTDVNIVTIR.3b3_1.heavy 512.623 / 506.273 18092.0 34.67034912109375 45 20 10 5 10 7.37166126190992 13.56546325815452 0.04470062255859375 3 0.9938717096906178 15.75689585911108 18092.0 15.998308834972061 0.0 - - - - - - - 1787.142857142857 36 7 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1115 142 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544387.[MT7]-TPYTDVNIVTIR.3y5_1.heavy 512.623 / 601.403 27473.0 34.67034912109375 45 20 10 5 10 7.37166126190992 13.56546325815452 0.04470062255859375 3 0.9938717096906178 15.75689585911108 27473.0 87.74958208955223 0.0 - - - - - - - 212.1 54 10 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1117 143 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544107.[MT7]-SLQEEPVEGFR.3y6_1.heavy 478.916 / 704.373 52601.0 29.445600509643555 50 20 10 10 10 5.946957550517721 16.815320968836303 0.0 3 0.9921143959755949 13.88861963567215 52601.0 195.1027818579661 0.0 - - - - - - - 314.0 105 6 UBE2R2 ubiquitin-conjugating enzyme E2R 2 1119 143 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544107.[MT7]-SLQEEPVEGFR.3b5_1.heavy 478.916 / 731.369 26595.0 29.445600509643555 50 20 10 10 10 5.946957550517721 16.815320968836303 0.0 3 0.9921143959755949 13.88861963567215 26595.0 90.18079247938508 0.0 - - - - - - - 310.27272727272725 53 11 UBE2R2 ubiquitin-conjugating enzyme E2R 2 1121 143 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544107.[MT7]-SLQEEPVEGFR.3y4_1.heavy 478.916 / 508.251 53425.0 29.445600509643555 50 20 10 10 10 5.946957550517721 16.815320968836303 0.0 3 0.9921143959755949 13.88861963567215 53425.0 80.92194744976817 0.0 - - - - - - - 294.25 106 8 UBE2R2 ubiquitin-conjugating enzyme E2R 2 1123 143 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544107.[MT7]-SLQEEPVEGFR.3y5_1.heavy 478.916 / 607.32 23888.0 29.445600509643555 50 20 10 10 10 5.946957550517721 16.815320968836303 0.0 3 0.9921143959755949 13.88861963567215 23888.0 63.269689070102004 0.0 - - - - - - - 753.0 47 10 UBE2R2 ubiquitin-conjugating enzyme E2R 2 1125 144 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39011.[MT7]-SADTLWGIQK[MT7].2y4_1.heavy 703.898 / 589.379 2475.0 33.83715057373047 35 14 10 5 6 1.5158950908982005 54.38705390036078 0.045501708984375 5 0.9354616334342102 4.831583896815988 2475.0 8.54539641943734 0.0 - - - - - - - 223.42857142857142 4 7 LDHA lactate dehydrogenase A 1127 144 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39011.[MT7]-SADTLWGIQK[MT7].2y5_1.heavy 703.898 / 775.458 3517.0 33.83715057373047 35 14 10 5 6 1.5158950908982005 54.38705390036078 0.045501708984375 5 0.9354616334342102 4.831583896815988 3517.0 21.772963273265326 0.0 - - - - - - - 260.6666666666667 7 6 LDHA lactate dehydrogenase A 1129 144 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39011.[MT7]-SADTLWGIQK[MT7].2b4_1.heavy 703.898 / 519.253 1042.0 33.83715057373047 35 14 10 5 6 1.5158950908982005 54.38705390036078 0.045501708984375 5 0.9354616334342102 4.831583896815988 1042.0 0.3198772064466615 5.0 - - - - - - - 247.7 2 10 LDHA lactate dehydrogenase A 1131 144 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39011.[MT7]-SADTLWGIQK[MT7].2b7_1.heavy 703.898 / 875.438 1042.0 33.83715057373047 35 14 10 5 6 1.5158950908982005 54.38705390036078 0.045501708984375 5 0.9354616334342102 4.831583896815988 1042.0 4.4917135549872125 0.0 - - - - - - - 223.28571428571428 2 7 LDHA lactate dehydrogenase A 1133 145 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39212.[MT7]-DASDPLAGAALEPAGGGR.2y6_1.heavy 884.951 / 514.273 3461.0 31.0398006439209 34 8 10 6 10 0.6991331522439513 80.94406324202643 0.03820037841796875 3 0.7820449121362071 2.5939118538407033 3461.0 21.474985288149348 0.0 - - - - - - - 227.66666666666666 6 9 SMAD6 SMAD family member 6 1135 145 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39212.[MT7]-DASDPLAGAALEPAGGGR.2y14_1.heavy 884.951 / 1236.67 3076.0 31.0398006439209 34 8 10 6 10 0.6991331522439513 80.94406324202643 0.03820037841796875 3 0.7820449121362071 2.5939118538407033 3076.0 27.91125 0.0 - - - - - - - 192.0 6 4 SMAD6 SMAD family member 6 1137 145 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39212.[MT7]-DASDPLAGAALEPAGGGR.2y12_1.heavy 884.951 / 1026.53 769.0 31.0398006439209 34 8 10 6 10 0.6991331522439513 80.94406324202643 0.03820037841796875 3 0.7820449121362071 2.5939118538407033 769.0 4.20546875 0.0 - - - - - - - 0.0 1 0 SMAD6 SMAD family member 6 1139 145 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39212.[MT7]-DASDPLAGAALEPAGGGR.2b4_1.heavy 884.951 / 533.232 11280.0 31.0398006439209 34 8 10 6 10 0.6991331522439513 80.94406324202643 0.03820037841796875 3 0.7820449121362071 2.5939118538407033 11280.0 41.5578947368421 0.0 - - - - - - - 160.0 22 8 SMAD6 SMAD family member 6 1141 146 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544389.[MT7]-LVVFDTSLQVK[MT7].3y3_1.heavy 512.979 / 518.342 91642.0 39.486000061035156 42 12 10 10 10 1.041561074694869 58.24990790010668 0.0 3 0.8846545350154763 3.598292161575206 91642.0 123.81960331325557 0.0 - - - - - - - 695.125 183 8 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1143 146 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544389.[MT7]-LVVFDTSLQVK[MT7].3b4_1.heavy 512.979 / 603.399 29097.0 39.486000061035156 42 12 10 10 10 1.041561074694869 58.24990790010668 0.0 3 0.8846545350154763 3.598292161575206 29097.0 96.19409892551118 0.0 - - - - - - - 288.0 58 7 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1145 146 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544389.[MT7]-LVVFDTSLQVK[MT7].3y4_1.heavy 512.979 / 631.426 29822.0 39.486000061035156 42 12 10 10 10 1.041561074694869 58.24990790010668 0.0 3 0.8846545350154763 3.598292161575206 29822.0 113.41808156386921 0.0 - - - - - - - 313.44444444444446 59 9 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1147 146 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544389.[MT7]-LVVFDTSLQVK[MT7].3b7_1.heavy 512.979 / 906.505 9753.0 39.486000061035156 42 12 10 10 10 1.041561074694869 58.24990790010668 0.0 3 0.8846545350154763 3.598292161575206 9753.0 62.97018259746119 0.0 - - - - - - - 208.41666666666666 19 12 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1149 147 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38662.[MT7]-LWGIDR.2b3_1.heavy 452.262 / 501.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 1151 147 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38662.[MT7]-LWGIDR.2y4_1.heavy 452.262 / 460.251 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 1153 147 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38662.[MT7]-LWGIDR.2y5_1.heavy 452.262 / 646.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 1155 147 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38662.[MT7]-LWGIDR.2b5_1.heavy 452.262 / 729.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 1157 148 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22407.[MT7]-GIVSLSDILQALVLTGGEK[MT7].3y6_1.heavy 734.438 / 748.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1159 148 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22407.[MT7]-GIVSLSDILQALVLTGGEK[MT7].3y4_1.heavy 734.438 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1161 148 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22407.[MT7]-GIVSLSDILQALVLTGGEK[MT7].3b8_1.heavy 734.438 / 929.542 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1163 148 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22407.[MT7]-GIVSLSDILQALVLTGGEK[MT7].3b7_1.heavy 734.438 / 816.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1165 149 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38661.[MT7]-LAVAIK[MT7].2y4_1.heavy 451.817 / 574.404 6368.0 29.283899307250977 50 20 10 10 10 26.306085346490892 3.801401792887421 0.0 3 0.9993178041817898 47.247969658833526 6368.0 12.636402737047899 0.0 - - - - - - - 682.2857142857143 12 7 IRAK4 interleukin-1 receptor-associated kinase 4 1167 149 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38661.[MT7]-LAVAIK[MT7].2y5_1.heavy 451.817 / 645.442 15921.0 29.283899307250977 50 20 10 10 10 26.306085346490892 3.801401792887421 0.0 3 0.9993178041817898 47.247969658833526 15921.0 42.69419873002987 1.0 - - - - - - - 268.72727272727275 31 11 IRAK4 interleukin-1 receptor-associated kinase 4 1169 149 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38661.[MT7]-LAVAIK[MT7].2y3_1.heavy 451.817 / 475.336 20924.0 29.283899307250977 50 20 10 10 10 26.306085346490892 3.801401792887421 0.0 3 0.9993178041817898 47.247969658833526 20924.0 44.549207130471515 0.0 - - - - - - - 674.2142857142857 41 14 IRAK4 interleukin-1 receptor-associated kinase 4 1171 149 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38661.[MT7]-LAVAIK[MT7].2b5_1.heavy 451.817 / 612.42 1706.0 29.283899307250977 50 20 10 10 10 26.306085346490892 3.801401792887421 0.0 3 0.9993178041817898 47.247969658833526 1706.0 5.201643053358004 3.0 - - - - - - - 318.3 15 10 IRAK4 interleukin-1 receptor-associated kinase 4 1173 150 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22409.[MT7]-NIHLWDPENSVLQNLK[MT7].4b4_1.heavy 552.806 / 622.379 12899.0 39.58209991455078 38 8 10 10 10 0.6720715167406948 87.37970696520443 0.0 3 0.7851649643367079 2.6134183049636888 12899.0 34.73666320526134 0.0 - - - - - - - 291.90909090909093 25 11 FANCL Fanconi anemia, complementation group L 1175 150 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22409.[MT7]-NIHLWDPENSVLQNLK[MT7].4y3_1.heavy 552.806 / 518.342 37815.0 39.58209991455078 38 8 10 10 10 0.6720715167406948 87.37970696520443 0.0 3 0.7851649643367079 2.6134183049636888 37815.0 62.39841809506751 0.0 - - - - - - - 713.0 75 9 FANCL Fanconi anemia, complementation group L 1177 150 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22409.[MT7]-NIHLWDPENSVLQNLK[MT7].4b6_1.heavy 552.806 / 923.486 16170.0 39.58209991455078 38 8 10 10 10 0.6720715167406948 87.37970696520443 0.0 3 0.7851649643367079 2.6134183049636888 16170.0 65.50833333333333 0.0 - - - - - - - 257.6363636363636 32 11 FANCL Fanconi anemia, complementation group L 1179 150 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22409.[MT7]-NIHLWDPENSVLQNLK[MT7].4b3_1.heavy 552.806 / 509.295 14723.0 39.58209991455078 38 8 10 10 10 0.6720715167406948 87.37970696520443 0.0 3 0.7851649643367079 2.6134183049636888 14723.0 48.835863034316674 0.0 - - - - - - - 314.8333333333333 29 12 FANCL Fanconi anemia, complementation group L 1181 151 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21924.[MT7]-EIQVIPLQR.2y4_1.heavy 620.381 / 513.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1183 151 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21924.[MT7]-EIQVIPLQR.2b3_1.heavy 620.381 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1185 151 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21924.[MT7]-EIQVIPLQR.2y8_1.heavy 620.381 / 966.609 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1187 151 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21924.[MT7]-EIQVIPLQR.2y6_1.heavy 620.381 / 725.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1189 152 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22263.[MT7]-TETAGNSSGVYGFGK[MT7].3b6_1.heavy 588.3 / 718.349 3665.0 27.57379913330078 44 14 10 10 10 2.6567159670520146 37.64045582598109 0.0 3 0.9478418667031954 5.380162208287147 3665.0 9.704503693612605 0.0 - - - - - - - 214.07142857142858 7 14 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1191 152 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22263.[MT7]-TETAGNSSGVYGFGK[MT7].3b5_1.heavy 588.3 / 604.306 3776.0 27.57379913330078 44 14 10 10 10 2.6567159670520146 37.64045582598109 0.0 3 0.9478418667031954 5.380162208287147 3776.0 17.009009009009006 0.0 - - - - - - - 244.2 7 15 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1193 152 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22263.[MT7]-TETAGNSSGVYGFGK[MT7].3y4_1.heavy 588.3 / 552.326 31761.0 27.57379913330078 44 14 10 10 10 2.6567159670520146 37.64045582598109 0.0 3 0.9478418667031954 5.380162208287147 31761.0 53.27712375223014 0.0 - - - - - - - 288.6 63 5 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1195 152 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22263.[MT7]-TETAGNSSGVYGFGK[MT7].3y5_1.heavy 588.3 / 715.39 20211.0 27.57379913330078 44 14 10 10 10 2.6567159670520146 37.64045582598109 0.0 3 0.9478418667031954 5.380162208287147 20211.0 43.52065643384792 0.0 - - - - - - - 777.0 40 8 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1197 153 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22262.[MT7]-ERSLDTLLEAVESR.3y7_1.heavy 587.987 / 803.426 10053.0 39.768798828125 42 12 10 10 10 4.057290458609383 24.646990650571887 0.0 3 0.8996698235050647 3.8631966193385145 10053.0 50.52110274763334 0.0 - - - - - - - 208.05882352941177 20 17 SMAD6 SMAD family member 6 1199 153 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22262.[MT7]-ERSLDTLLEAVESR.3y6_1.heavy 587.987 / 690.342 24920.0 39.768798828125 42 12 10 10 10 4.057290458609383 24.646990650571887 0.0 3 0.8996698235050647 3.8631966193385145 24920.0 128.68272932305516 0.0 - - - - - - - 291.64285714285717 49 14 SMAD6 SMAD family member 6 1201 153 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22262.[MT7]-ERSLDTLLEAVESR.3b5_1.heavy 587.987 / 745.396 5423.0 39.768798828125 42 12 10 10 10 4.057290458609383 24.646990650571887 0.0 3 0.8996698235050647 3.8631966193385145 5423.0 23.9324882629108 0.0 - - - - - - - 217.125 10 16 SMAD6 SMAD family member 6 1203 153 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22262.[MT7]-ERSLDTLLEAVESR.3y5_1.heavy 587.987 / 561.299 20898.0 39.768798828125 42 12 10 10 10 4.057290458609383 24.646990650571887 0.0 3 0.8996698235050647 3.8631966193385145 20898.0 72.67932106695258 0.0 - - - - - - - 277.09090909090907 41 11 SMAD6 SMAD family member 6 1205 154 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22405.[MT7]-LGPSDYFGEIALLMNRPR.3b9_1.heavy 731.725 / 1110.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1207 154 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22405.[MT7]-LGPSDYFGEIALLMNRPR.3b6_1.heavy 731.725 / 777.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1209 154 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22405.[MT7]-LGPSDYFGEIALLMNRPR.3y8_1.heavy 731.725 / 970.562 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1211 154 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22405.[MT7]-LGPSDYFGEIALLMNRPR.3y13_2.heavy 731.725 / 790.424 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1213 155 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22264.[MT7]-VSILESLDK[MT7]WER.3y7_1.heavy 588.336 / 1077.58 2585.0 40.39440155029297 45 15 10 10 10 2.2423022089302407 44.597021579757566 0.0 3 0.9584079811717467 6.03032185895573 2585.0 73.59336734693878 0.0 - - - - - - - 132.42857142857142 5 7 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1215 155 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22264.[MT7]-VSILESLDK[MT7]WER.3b4_1.heavy 588.336 / 557.378 5951.0 40.39440155029297 45 15 10 10 10 2.2423022089302407 44.597021579757566 0.0 3 0.9584079811717467 6.03032185895573 5951.0 25.451240133018292 0.0 - - - - - - - 759.5714285714286 11 7 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1217 155 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22264.[MT7]-VSILESLDK[MT7]WER.3y8_1.heavy 588.336 / 1206.62 N/A 40.39440155029297 45 15 10 10 10 2.2423022089302407 44.597021579757566 0.0 3 0.9584079811717467 6.03032185895573 0.0 0.0 3.0 - - - - - - - 0.0 0 0 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1219 155 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22264.[MT7]-VSILESLDK[MT7]WER.3y9_2.heavy 588.336 / 660.357 6438.0 40.39440155029297 45 15 10 10 10 2.2423022089302407 44.597021579757566 0.0 3 0.9584079811717467 6.03032185895573 6438.0 28.86747079467333 0.0 - - - - - - - 233.57894736842104 12 19 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1221 156 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22404.[MT7]-TLGLPALLLLLLLRPPATR.3y18_2.heavy 729.148 / 970.643 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL15RA interleukin 15 receptor, alpha 1223 156 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22404.[MT7]-TLGLPALLLLLLLRPPATR.3y15_2.heavy 729.148 / 829.048 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL15RA interleukin 15 receptor, alpha 1225 156 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22404.[MT7]-TLGLPALLLLLLLRPPATR.3b4_1.heavy 729.148 / 529.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL15RA interleukin 15 receptor, alpha 1227 156 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22404.[MT7]-TLGLPALLLLLLLRPPATR.3y5_1.heavy 729.148 / 541.309 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL15RA interleukin 15 receptor, alpha 1229 157 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 126372.0 35.86676788330078 23 -3 10 6 10 null 0.0 0.034698486328125 3 0.0 0.0 126372.0 128.67964253018127 0.0 - - - - - - - 222.46153846153845 252 13 1231 157 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 253708.0 35.86676788330078 23 -3 10 6 10 null 0.0 0.034698486328125 3 0.0 0.0 253708.0 149.88796978570934 0.0 - - - - - - - 243.44444444444446 507 9 1233 157 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 257651.0 35.86676788330078 23 -3 10 6 10 null 0.0 0.034698486328125 3 0.0 0.0 257651.0 112.00598127351898 0.0 - - - - - - - 233.77777777777777 515 9 1235 158 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22166.[MT7]-VPTTLAEYC[CAM]IK[MT7].3y6_1.heavy 528.297 / 927.473 2038.0 33.859901428222656 50 20 10 10 10 4.135366719155636 18.85285640763444 0.0 3 0.9941649313670722 16.148343575853698 2038.0 23.182250000000003 0.0 - - - - - - - 188.57142857142858 4 7 UBE2R2 ubiquitin-conjugating enzyme E2R 2 1237 158 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22166.[MT7]-VPTTLAEYC[CAM]IK[MT7].3y3_1.heavy 528.297 / 564.33 24098.0 33.859901428222656 50 20 10 10 10 4.135366719155636 18.85285640763444 0.0 3 0.9941649313670722 16.148343575853698 24098.0 49.25138686131387 0.0 - - - - - - - 779.0 48 8 UBE2R2 ubiquitin-conjugating enzyme E2R 2 1239 158 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22166.[MT7]-VPTTLAEYC[CAM]IK[MT7].3b4_1.heavy 528.297 / 543.326 11509.0 33.859901428222656 50 20 10 10 10 4.135366719155636 18.85285640763444 0.0 3 0.9941649313670722 16.148343575853698 11509.0 24.806180012657883 0.0 - - - - - - - 734.0 23 8 UBE2R2 ubiquitin-conjugating enzyme E2R 2 1241 158 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22166.[MT7]-VPTTLAEYC[CAM]IK[MT7].3b5_1.heavy 528.297 / 656.41 10550.0 33.859901428222656 50 20 10 10 10 4.135366719155636 18.85285640763444 0.0 3 0.9941649313670722 16.148343575853698 10550.0 21.71796212717829 0.0 - - - - - - - 291.42857142857144 21 7 UBE2R2 ubiquitin-conjugating enzyme E2R 2 1243 159 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22165.[MT7]-LQVSQQEDITK[MT7].2b8_1.heavy 788.943 / 1072.54 1139.0 25.6962251663208 46 20 10 6 10 10.41735752488903 9.599363347286598 0.037899017333984375 3 0.9941664068176062 16.150387581404534 1139.0 16.125780843552583 0.0 - - - - - - - 129.75 2 4 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1245 159 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22165.[MT7]-LQVSQQEDITK[MT7].2y4_1.heavy 788.943 / 620.374 1035.0 25.6962251663208 46 20 10 6 10 10.41735752488903 9.599363347286598 0.037899017333984375 3 0.9941664068176062 16.150387581404534 1035.0 11.73028846153846 1.0 - - - - - - - 194.375 4 8 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1247 159 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22165.[MT7]-LQVSQQEDITK[MT7].2y8_1.heavy 788.943 / 1092.57 3002.0 25.6962251663208 46 20 10 6 10 10.41735752488903 9.599363347286598 0.037899017333984375 3 0.9941664068176062 16.150387581404534 3002.0 37.55284442245858 0.0 - - - - - - - 222.0 6 7 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1249 159 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22165.[MT7]-LQVSQQEDITK[MT7].2y9_1.heavy 788.943 / 1191.63 1760.0 25.6962251663208 46 20 10 6 10 10.41735752488903 9.599363347286598 0.037899017333984375 3 0.9941664068176062 16.150387581404534 1760.0 15.247120029728725 0.0 - - - - - - - 192.57142857142858 3 7 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1251 160 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22167.[MT7]-AVDTRLEELGGER.3y7_1.heavy 530.285 / 789.374 2336.0 28.036449432373047 40 14 10 6 10 3.09661193584177 32.29335870037471 0.035900115966796875 3 0.9386026799768876 4.954960259652015 2336.0 5.545899280575538 0.0 - - - - - - - 205.15384615384616 4 13 NOS3 nitric oxide synthase 3 (endothelial cell) 1253 160 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22167.[MT7]-AVDTRLEELGGER.3y10_2.heavy 530.285 / 580.307 80965.0 28.036449432373047 40 14 10 6 10 3.09661193584177 32.29335870037471 0.035900115966796875 3 0.9386026799768876 4.954960259652015 80965.0 139.55391068510687 0.0 - - - - - - - 651.4285714285714 161 7 NOS3 nitric oxide synthase 3 (endothelial cell) 1255 160 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22167.[MT7]-AVDTRLEELGGER.3y6_1.heavy 530.285 / 660.331 4893.0 28.036449432373047 40 14 10 6 10 3.09661193584177 32.29335870037471 0.035900115966796875 3 0.9386026799768876 4.954960259652015 4893.0 7.823910422411172 0.0 - - - - - - - 753.8888888888889 9 9 NOS3 nitric oxide synthase 3 (endothelial cell) 1257 160 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22167.[MT7]-AVDTRLEELGGER.3y8_1.heavy 530.285 / 902.458 3559.0 28.036449432373047 40 14 10 6 10 3.09661193584177 32.29335870037471 0.035900115966796875 3 0.9386026799768876 4.954960259652015 3559.0 20.507751290616458 0.0 - - - - - - - 265.0 7 13 NOS3 nitric oxide synthase 3 (endothelial cell) 1259 161 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541512.[MT7]-DLGGNAK[MT7].2y4_1.heavy 481.779 / 533.316 1426.0 16.486000061035156 48 20 10 10 8 17.143794034891027 5.833014547216336 0.0 4 0.9954859086687153 18.361734063488147 1426.0 8.656098964326812 1.0 - - - - - - - 183.0 8 21 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1261 161 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541512.[MT7]-DLGGNAK[MT7].2y5_1.heavy 481.779 / 590.338 4277.0 16.486000061035156 48 20 10 10 8 17.143794034891027 5.833014547216336 0.0 4 0.9954859086687153 18.361734063488147 4277.0 20.558345531388518 0.0 - - - - - - - 217.8181818181818 8 22 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1263 161 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541512.[MT7]-DLGGNAK[MT7].2y6_1.heavy 481.779 / 703.422 4158.0 16.486000061035156 48 20 10 10 8 17.143794034891027 5.833014547216336 0.0 4 0.9954859086687153 18.361734063488147 4158.0 28.31957232395232 0.0 - - - - - - - 193.41176470588235 8 17 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1265 161 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541512.[MT7]-DLGGNAK[MT7].2b5_1.heavy 481.779 / 601.306 1228.0 16.486000061035156 48 20 10 10 8 17.143794034891027 5.833014547216336 0.0 4 0.9954859086687153 18.361734063488147 1228.0 7.901736492430907 2.0 - - - - - - - 223.1818181818182 2 22 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1267 162 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544631.[MT7]-SSPVDLVTATDQK[MT7].3y6_1.heavy 550.305 / 807.433 42150.0 30.376649856567383 44 18 10 6 10 3.846272102789849 25.999200609719253 0.039501190185546875 3 0.9843141919716689 9.8410082080824 42150.0 86.98494764397904 0.0 - - - - - - - 318.3333333333333 84 6 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1269 162 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544631.[MT7]-SSPVDLVTATDQK[MT7].3b6_1.heavy 550.305 / 743.406 73858.0 30.376649856567383 44 18 10 6 10 3.846272102789849 25.999200609719253 0.039501190185546875 3 0.9843141919716689 9.8410082080824 73858.0 207.42770052692362 0.0 - - - - - - - 672.8571428571429 147 7 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1271 162 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544631.[MT7]-SSPVDLVTATDQK[MT7].3b5_1.heavy 550.305 / 630.321 138676.0 30.376649856567383 44 18 10 6 10 3.846272102789849 25.999200609719253 0.039501190185546875 3 0.9843141919716689 9.8410082080824 138676.0 323.74920820276344 0.0 - - - - - - - 382.0 277 2 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1273 162 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544631.[MT7]-SSPVDLVTATDQK[MT7].3y4_1.heavy 550.305 / 635.348 47499.0 30.376649856567383 44 18 10 6 10 3.846272102789849 25.999200609719253 0.039501190185546875 3 0.9843141919716689 9.8410082080824 47499.0 119.70709830181036 0.0 - - - - - - - 280.2 94 5 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1275 163 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22170.[MT7]-FHSFSFYELK[MT7].3y3_1.heavy 531.617 / 533.341 29924.0 37.1072998046875 50 20 10 10 10 7.655914462472865 13.06179692709105 0.0 3 0.9925989461085253 14.336639642950379 29924.0 29.745526838966203 0.0 - - - - - - - 679.0 59 10 IRAK4 interleukin-1 receptor-associated kinase 4 1277 163 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22170.[MT7]-FHSFSFYELK[MT7].3b5_1.heavy 531.617 / 750.369 5951.0 37.1072998046875 50 20 10 10 10 7.655914462472865 13.06179692709105 0.0 3 0.9925989461085253 14.336639642950379 5951.0 32.9451210085033 0.0 - - - - - - - 207.52380952380952 11 21 IRAK4 interleukin-1 receptor-associated kinase 4 1279 163 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22170.[MT7]-FHSFSFYELK[MT7].3b3_1.heavy 531.617 / 516.269 9556.0 37.1072998046875 50 20 10 10 10 7.655914462472865 13.06179692709105 0.0 3 0.9925989461085253 14.336639642950379 9556.0 9.754428718065512 0.0 - - - - - - - 1210.6666666666667 19 9 IRAK4 interleukin-1 receptor-associated kinase 4 1281 163 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22170.[MT7]-FHSFSFYELK[MT7].3y4_1.heavy 531.617 / 696.405 18441.0 37.1072998046875 50 20 10 10 10 7.655914462472865 13.06179692709105 0.0 3 0.9925989461085253 14.336639642950379 18441.0 29.488411526502592 0.0 - - - - - - - 265.3333333333333 36 12 IRAK4 interleukin-1 receptor-associated kinase 4 1283 164 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22172.[MT7]-RSENEEFVEVGR.3y6_1.heavy 532.27 / 706.388 30838.0 24.9601993560791 42 12 10 10 10 1.1427874677163008 50.88213324832023 0.0 3 0.8846940630118119 3.5989212547826894 30838.0 158.03031273408237 0.0 - - - - - - - 222.22222222222223 61 9 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1285 164 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22172.[MT7]-RSENEEFVEVGR.3b6_1.heavy 532.27 / 889.413 17322.0 24.9601993560791 42 12 10 10 10 1.1427874677163008 50.88213324832023 0.0 3 0.8846940630118119 3.5989212547826894 17322.0 78.00086227544911 0.0 - - - - - - - 260.0 34 10 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1287 164 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22172.[MT7]-RSENEEFVEVGR.3b4_1.heavy 532.27 / 631.328 6708.0 24.9601993560791 42 12 10 10 10 1.1427874677163008 50.88213324832023 0.0 3 0.8846940630118119 3.5989212547826894 6708.0 8.802184742175664 0.0 - - - - - - - 300.0 13 8 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1289 164 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22172.[MT7]-RSENEEFVEVGR.3y5_1.heavy 532.27 / 559.32 40851.0 24.9601993560791 42 12 10 10 10 1.1427874677163008 50.88213324832023 0.0 3 0.8846940630118119 3.5989212547826894 40851.0 50.67111060915161 0.0 - - - - - - - 260.0 81 5 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1291 165 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543383.[MT7]-AQSYAQQLGR.2y8_1.heavy 633.34 / 922.474 2151.0 23.765649795532227 45 20 10 5 10 5.653863795588316 17.687019640980658 0.040699005126953125 3 0.9906754817776787 12.770594784758035 2151.0 29.857984665936474 0.0 - - - - - - - 196.375 4 8 NOS3 nitric oxide synthase 3 (endothelial cell) 1293 165 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543383.[MT7]-AQSYAQQLGR.2y9_1.heavy 633.34 / 1050.53 1903.0 23.765649795532227 45 20 10 5 10 5.653863795588316 17.687019640980658 0.040699005126953125 3 0.9906754817776787 12.770594784758035 1903.0 25.228799114232018 0.0 - - - - - - - 165.33333333333334 3 3 NOS3 nitric oxide synthase 3 (endothelial cell) 1295 165 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543383.[MT7]-AQSYAQQLGR.2y6_1.heavy 633.34 / 672.379 827.0 23.765649795532227 45 20 10 5 10 5.653863795588316 17.687019640980658 0.040699005126953125 3 0.9906754817776787 12.770594784758035 827.0 7.312184220753983 6.0 - - - - - - - 223.2 4 10 NOS3 nitric oxide synthase 3 (endothelial cell) 1297 165 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543383.[MT7]-AQSYAQQLGR.2y7_1.heavy 633.34 / 835.442 1406.0 23.765649795532227 45 20 10 5 10 5.653863795588316 17.687019640980658 0.040699005126953125 3 0.9906754817776787 12.770594784758035 1406.0 24.525691128148964 0.0 - - - - - - - 147.0 2 9 NOS3 nitric oxide synthase 3 (endothelial cell) 1299 166 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543224.[MT7]-TVTYSLLK[MT7].2y4_1.heavy 606.876 / 604.415 2260.0 32.72010040283203 44 18 10 10 6 3.1291174054468445 26.837894284814425 0.0 5 0.9813430505715156 9.021204203220101 2260.0 5.947368421052632 0.0 - - - - - - - 218.5 4 14 SMAD6 SMAD family member 6 1301 166 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543224.[MT7]-TVTYSLLK[MT7].2y5_1.heavy 606.876 / 767.478 1595.0 32.72010040283203 44 18 10 10 6 3.1291174054468445 26.837894284814425 0.0 5 0.9813430505715156 9.021204203220101 1595.0 7.105545112781954 2.0 - - - - - - - 221.66666666666666 3 9 SMAD6 SMAD family member 6 1303 166 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543224.[MT7]-TVTYSLLK[MT7].2y3_1.heavy 606.876 / 517.383 1595.0 32.72010040283203 44 18 10 10 6 3.1291174054468445 26.837894284814425 0.0 5 0.9813430505715156 9.021204203220101 1595.0 4.47719298245614 3.0 - - - - - - - 279.3 4 10 SMAD6 SMAD family member 6 1305 166 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543224.[MT7]-TVTYSLLK[MT7].2y6_1.heavy 606.876 / 868.526 N/A 32.72010040283203 44 18 10 10 6 3.1291174054468445 26.837894284814425 0.0 5 0.9813430505715156 9.021204203220101 1728.0 2.129262981942947 1.0 - - - - - - - 228.0 4 7 SMAD6 SMAD family member 6 1307 167 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21928.[MT7]-GEVQDSEAK[MT7].2y4_1.heavy 625.827 / 578.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 1309 167 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21928.[MT7]-GEVQDSEAK[MT7].2y5_1.heavy 625.827 / 693.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 1311 167 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21928.[MT7]-GEVQDSEAK[MT7].2b4_1.heavy 625.827 / 558.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 1313 167 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21928.[MT7]-GEVQDSEAK[MT7].2b5_1.heavy 625.827 / 673.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 1315 168 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22297.[MT7]-ELQEIRLEPQEVPR.3y10_2.heavy 627.35 / 618.857 4368.0 31.83180046081543 40 10 10 10 10 4.168215259107324 19.18750859043809 0.0 3 0.826687573395113 2.9205573503825835 4368.0 6.601511335012594 1.0 - - - - - - - 648.4 8 10 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1317 168 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22297.[MT7]-ELQEIRLEPQEVPR.3y6_1.heavy 627.35 / 725.394 2647.0 31.83180046081543 40 10 10 10 10 4.168215259107324 19.18750859043809 0.0 3 0.826687573395113 2.9205573503825835 2647.0 6.285681657762892 1.0 - - - - - - - 297.75 5 8 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1319 168 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22297.[MT7]-ELQEIRLEPQEVPR.3b4_1.heavy 627.35 / 644.337 3176.0 31.83180046081543 40 10 10 10 10 4.168215259107324 19.18750859043809 0.0 3 0.826687573395113 2.9205573503825835 3176.0 8.016044866047206 0.0 - - - - - - - 340.42857142857144 6 7 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1321 168 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22297.[MT7]-ELQEIRLEPQEVPR.3y13_2.heavy 627.35 / 803.949 3176.0 31.83180046081543 40 10 10 10 10 4.168215259107324 19.18750859043809 0.0 3 0.826687573395113 2.9205573503825835 3176.0 25.636545454545455 0.0 - - - - - - - 226.85714285714286 6 7 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1323 169 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544747.[MT7]-DASDPLAGAALEPAGGGR.3b6_1.heavy 590.303 / 743.369 5686.0 31.04935073852539 39 15 10 6 8 3.400843272299276 29.40447177161181 0.03820037841796875 4 0.9549081036665632 5.789852881592328 5686.0 10.935152184585172 0.0 - - - - - - - 236.75 11 12 SMAD6 SMAD family member 6 1325 169 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544747.[MT7]-DASDPLAGAALEPAGGGR.3y6_1.heavy 590.303 / 514.273 29724.0 31.04935073852539 39 15 10 6 8 3.400843272299276 29.40447177161181 0.03820037841796875 4 0.9549081036665632 5.789852881592328 29724.0 44.11749861840288 0.0 - - - - - - - 738.4285714285714 59 7 SMAD6 SMAD family member 6 1327 169 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544747.[MT7]-DASDPLAGAALEPAGGGR.3b4_1.heavy 590.303 / 533.232 15379.0 31.04935073852539 39 15 10 6 8 3.400843272299276 29.40447177161181 0.03820037841796875 4 0.9549081036665632 5.789852881592328 15379.0 17.751461484561837 0.0 - - - - - - - 1163.142857142857 30 7 SMAD6 SMAD family member 6 1329 169 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544747.[MT7]-DASDPLAGAALEPAGGGR.3y8_1.heavy 590.303 / 756.4 6979.0 31.04935073852539 39 15 10 6 8 3.400843272299276 29.40447177161181 0.03820037841796875 4 0.9549081036665632 5.789852881592328 6979.0 7.403138121546961 1.0 - - - - - - - 232.5 14 10 SMAD6 SMAD family member 6 1331 170 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543752.[MT7]-LFC[CAM]IPVHGIR.3y3_1.heavy 452.596 / 345.224 23463.0 36.48929977416992 50 20 10 10 10 5.27633694754903 18.952542453993978 0.0 3 0.991021899149006 13.015014777095042 23463.0 42.52384453922461 0.0 - - - - - - - 671.0769230769231 46 13 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1333 170 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543752.[MT7]-LFC[CAM]IPVHGIR.3b3_1.heavy 452.596 / 565.292 30155.0 36.48929977416992 50 20 10 10 10 5.27633694754903 18.952542453993978 0.0 3 0.991021899149006 13.015014777095042 30155.0 176.48890994042927 0.0 - - - - - - - 199.57142857142858 60 14 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1335 170 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543752.[MT7]-LFC[CAM]IPVHGIR.3y4_1.heavy 452.596 / 482.283 37355.0 36.48929977416992 50 20 10 10 10 5.27633694754903 18.952542453993978 0.0 3 0.991021899149006 13.015014777095042 37355.0 57.8334852608038 0.0 - - - - - - - 225.88888888888889 74 9 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1337 170 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543752.[MT7]-LFC[CAM]IPVHGIR.3y5_1.heavy 452.596 / 581.352 10249.0 36.48929977416992 50 20 10 10 10 5.27633694754903 18.952542453993978 0.0 3 0.991021899149006 13.015014777095042 10249.0 43.369369985126376 0.0 - - - - - - - 277.1818181818182 20 11 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1339 171 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22155.[MT7]-QVVESAYEVIK[MT7].3b6_1.heavy 518.299 / 758.417 50309.0 32.49209976196289 44 14 10 10 10 1.803546666979419 45.23853005927339 0.0 3 0.9371284454831961 4.89590725003789 50309.0 163.40743964710526 0.0 - - - - - - - 739.5714285714286 100 7 LDHA lactate dehydrogenase A 1341 171 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22155.[MT7]-QVVESAYEVIK[MT7].3y3_1.heavy 518.299 / 503.367 82831.0 32.49209976196289 44 14 10 10 10 1.803546666979419 45.23853005927339 0.0 3 0.9371284454831961 4.89590725003789 82831.0 56.569436114684 0.0 - - - - - - - 531.0 165 1 LDHA lactate dehydrogenase A 1343 171 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22155.[MT7]-QVVESAYEVIK[MT7].3b4_1.heavy 518.299 / 600.347 25885.0 32.49209976196289 44 14 10 10 10 1.803546666979419 45.23853005927339 0.0 3 0.9371284454831961 4.89590725003789 25885.0 41.83223950771816 2.0 - - - - - - - 265.1666666666667 51 6 LDHA lactate dehydrogenase A 1345 171 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22155.[MT7]-QVVESAYEVIK[MT7].3b5_1.heavy 518.299 / 687.379 20575.0 32.49209976196289 44 14 10 10 10 1.803546666979419 45.23853005927339 0.0 3 0.9371284454831961 4.89590725003789 20575.0 70.79390741357389 0.0 - - - - - - - 303.14285714285717 41 7 LDHA lactate dehydrogenase A 1347 172 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541966.[MT7]-SYSLYSR.2y4_1.heavy 510.268 / 538.298 4546.0 25.401625633239746 41 20 9 6 6 11.245920668188802 8.892113233811862 0.039699554443359375 5 0.998243668978468 29.443917991126078 4546.0 14.525106568229571 1.0 - - - - - - - 250.33333333333334 9 15 IL15RA interleukin 15 receptor, alpha 1349 172 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541966.[MT7]-SYSLYSR.2y5_1.heavy 510.268 / 625.33 10871.0 25.401625633239746 41 20 9 6 6 11.245920668188802 8.892113233811862 0.039699554443359375 5 0.998243668978468 29.443917991126078 10871.0 26.16470081928018 0.0 - - - - - - - 856.5555555555555 21 9 IL15RA interleukin 15 receptor, alpha 1351 172 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541966.[MT7]-SYSLYSR.2b4_1.heavy 510.268 / 595.321 9488.0 25.401625633239746 41 20 9 6 6 11.245920668188802 8.892113233811862 0.039699554443359375 5 0.998243668978468 29.443917991126078 9488.0 13.826758703141977 1.0 - - - - - - - 692.0 19 7 IL15RA interleukin 15 receptor, alpha 1353 172 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541966.[MT7]-SYSLYSR.2y6_1.heavy 510.268 / 788.394 20853.0 25.401625633239746 41 20 9 6 6 11.245920668188802 8.892113233811862 0.039699554443359375 5 0.998243668978468 29.443917991126078 20853.0 55.79440092924563 1.0 - - - - - - - 288.1666666666667 46 12 IL15RA interleukin 15 receptor, alpha 1355 173 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 323520.0 38.79690170288086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 323520.0 225.0652752197111 0.0 - - - - - - - 322.25 647 8 1357 173 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 537287.0 38.79690170288086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 537287.0 232.62441635848364 0.0 - - - - - - - 332.25 1074 8 1359 173 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 699378.0 38.79690170288086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 699378.0 233.9483181860499 0.0 - - - - - - - 249.2 1398 5 1361 174 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540253.[MT7]-TPETVR.2y4_1.heavy 423.744 / 504.278 791.0 16.494800090789795 44 20 10 6 8 5.713657822469895 17.501923130001522 0.03520011901855469 4 0.9967917069549035 21.78257281593818 791.0 1.7133574007220218 3.0 - - - - - - - 0.0 1 0 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1363 174 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540253.[MT7]-TPETVR.2y5_1.heavy 423.744 / 601.33 30574.0 16.494800090789795 44 20 10 6 8 5.713657822469895 17.501923130001522 0.03520011901855469 4 0.9967917069549035 21.78257281593818 30574.0 97.40090696454334 0.0 - - - - - - - 637.75 61 8 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1365 174 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540253.[MT7]-TPETVR.2b4_1.heavy 423.744 / 573.3 1780.0 16.494800090789795 44 20 10 6 8 5.713657822469895 17.501923130001522 0.03520011901855469 4 0.9967917069549035 21.78257281593818 1780.0 3.3797468354430378 0.0 - - - - - - - 171.42857142857142 3 21 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1367 174 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540253.[MT7]-TPETVR.2y3_1.heavy 423.744 / 375.235 2294.0 16.494800090789795 44 20 10 6 8 5.713657822469895 17.501923130001522 0.03520011901855469 4 0.9967917069549035 21.78257281593818 2294.0 4.525900735130794 1.0 - - - - - - - 300.1764705882353 6 17 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1369 175 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22018.[MT7]-LQEVEAEVAATGTYQLR.3b4_1.heavy 674.692 / 614.363 10803.0 38.13370132446289 44 14 10 10 10 1.9765641101028164 40.32924265839456 0.0 3 0.9470325208642104 5.3385322313959955 10803.0 38.10184993315508 0.0 - - - - - - - 249.21428571428572 21 14 NOS3 nitric oxide synthase 3 (endothelial cell) 1371 175 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22018.[MT7]-LQEVEAEVAATGTYQLR.3b5_1.heavy 674.692 / 743.406 14377.0 38.13370132446289 44 14 10 10 10 1.9765641101028164 40.32924265839456 0.0 3 0.9470325208642104 5.3385322313959955 14377.0 63.14504315338276 0.0 - - - - - - - 253.47368421052633 28 19 NOS3 nitric oxide synthase 3 (endothelial cell) 1373 175 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22018.[MT7]-LQEVEAEVAATGTYQLR.3b3_1.heavy 674.692 / 515.295 8975.0 38.13370132446289 44 14 10 10 10 1.9765641101028164 40.32924265839456 0.0 3 0.9470325208642104 5.3385322313959955 8975.0 43.19347414708936 0.0 - - - - - - - 254.3125 17 16 NOS3 nitric oxide synthase 3 (endothelial cell) 1375 175 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22018.[MT7]-LQEVEAEVAATGTYQLR.3b7_1.heavy 674.692 / 943.485 19446.0 38.13370132446289 44 14 10 10 10 1.9765641101028164 40.32924265839456 0.0 3 0.9470325208642104 5.3385322313959955 19446.0 231.92089078335 0.0 - - - - - - - 207.66666666666666 38 12 NOS3 nitric oxide synthase 3 (endothelial cell) 1377 176 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38710.[MT7]-EFQEK[MT7].2b3_1.heavy 484.768 / 549.279 2313.0 19.204325199127197 37 13 10 6 8 2.1297763475269833 46.95328695715691 0.03510093688964844 4 0.9297899175149904 4.630077766843068 2313.0 6.9541176470588235 1.0 - - - - - - - 649.6 5 10 SMC1B;NAT10 structural maintenance of chromosomes 1B;N-acetyltransferase 10 (GCN5-related) 1379 176 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38710.[MT7]-EFQEK[MT7].2y4_1.heavy 484.768 / 695.385 12111.0 19.204325199127197 37 13 10 6 8 2.1297763475269833 46.95328695715691 0.03510093688964844 4 0.9297899175149904 4.630077766843068 12111.0 146.9468 0.0 - - - - - - - 170.0 24 22 SMC1B;NAT10 structural maintenance of chromosomes 1B;N-acetyltransferase 10 (GCN5-related) 1381 176 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38710.[MT7]-EFQEK[MT7].2b4_1.heavy 484.768 / 678.321 3028.0 19.204325199127197 37 13 10 6 8 2.1297763475269833 46.95328695715691 0.03510093688964844 4 0.9297899175149904 4.630077766843068 3028.0 24.256385026737966 0.0 - - - - - - - 293.4736842105263 6 19 SMC1B;NAT10 structural maintenance of chromosomes 1B;N-acetyltransferase 10 (GCN5-related) 1383 176 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38710.[MT7]-EFQEK[MT7].2y3_1.heavy 484.768 / 548.316 3504.0 19.204325199127197 37 13 10 6 8 2.1297763475269833 46.95328695715691 0.03510093688964844 4 0.9297899175149904 4.630077766843068 3504.0 10.666227889757302 1.0 - - - - - - - 578.0 10 9 SMC1B;NAT10 structural maintenance of chromosomes 1B;N-acetyltransferase 10 (GCN5-related) 1385 177 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 696801.0 34.0447998046875 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 696801.0 431.3070977910734 0.0 - - - - - - - 240.0 1393 3 1387 177 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 114255.0 34.0447998046875 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 114255.0 169.6090043185165 1.0 - - - - - - - 360.0 393 3 1389 177 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 84163.0 34.0447998046875 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 84163.0 91.18148370391681 0.0 - - - - - - - 420.0 168 2 1391 178 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544362.[MT7]-RIAEFAFEYAR.2b8_1.heavy 758.905 / 1108.59 3836.0 34.7588005065918 39 14 10 5 10 3.0073990535346193 26.724474979106496 0.04399871826171875 3 0.944206829195979 5.200338913013031 3836.0 22.45658333333333 0.0 - - - - - - - 216.0 7 10 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1393 178 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544362.[MT7]-RIAEFAFEYAR.2y9_1.heavy 758.905 / 1103.52 1678.0 34.7588005065918 39 14 10 5 10 3.0073990535346193 26.724474979106496 0.04399871826171875 3 0.944206829195979 5.200338913013031 1678.0 10.986666666666668 1.0 - - - - - - - 200.0 3 9 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1395 178 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544362.[MT7]-RIAEFAFEYAR.2b6_1.heavy 758.905 / 832.48 839.0 34.7588005065918 39 14 10 5 10 3.0073990535346193 26.724474979106496 0.04399871826171875 3 0.944206829195979 5.200338913013031 839.0 1.0487499999999996 3.0 - - - - - - - 0.0 1 0 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1397 178 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544362.[MT7]-RIAEFAFEYAR.2y10_1.heavy 758.905 / 1216.6 2518.0 34.7588005065918 39 14 10 5 10 3.0073990535346193 26.724474979106496 0.04399871826171875 3 0.944206829195979 5.200338913013031 2518.0 41.12733333333334 0.0 - - - - - - - 160.0 5 3 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1399 179 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38986.[MT7]-RNVIEAVYSR.2y5_1.heavy 675.884 / 595.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPM1B protein phosphatase, Mg2+/Mn2+ dependent, 1B 1401 179 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38986.[MT7]-RNVIEAVYSR.2y9_1.heavy 675.884 / 1050.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPM1B protein phosphatase, Mg2+/Mn2+ dependent, 1B 1403 179 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38986.[MT7]-RNVIEAVYSR.2y6_1.heavy 675.884 / 724.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPM1B protein phosphatase, Mg2+/Mn2+ dependent, 1B 1405 179 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38986.[MT7]-RNVIEAVYSR.2b5_1.heavy 675.884 / 756.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPM1B protein phosphatase, Mg2+/Mn2+ dependent, 1B 1407 180 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22148.[MT7]-LVVFDTSLQVK[MT7].2y8_1.heavy 768.966 / 1081.6 4234.0 39.486000061035156 48 18 10 10 10 4.669299760428467 21.41648751007233 0.0 3 0.9888237029150325 11.66294119663423 4234.0 66.75417872417871 0.0 - - - - - - - 200.07692307692307 8 13 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1409 180 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22148.[MT7]-LVVFDTSLQVK[MT7].2y9_1.heavy 768.966 / 1180.67 2971.0 39.486000061035156 48 18 10 10 10 4.669299760428467 21.41648751007233 0.0 3 0.9888237029150325 11.66294119663423 2971.0 36.07977214883044 0.0 - - - - - - - 148.5 5 8 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1411 180 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22148.[MT7]-LVVFDTSLQVK[MT7].2y3_1.heavy 768.966 / 518.342 1783.0 39.486000061035156 48 18 10 10 10 4.669299760428467 21.41648751007233 0.0 3 0.9888237029150325 11.66294119663423 1783.0 24.991043316043314 0.0 - - - - - - - 240.07692307692307 3 13 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1413 180 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22148.[MT7]-LVVFDTSLQVK[MT7].2y7_1.heavy 768.966 / 934.533 2525.0 39.486000061035156 48 18 10 10 10 4.669299760428467 21.41648751007233 0.0 3 0.9888237029150325 11.66294119663423 2525.0 13.981029976312994 0.0 - - - - - - - 217.8 5 15 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1415 181 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541777.[MT7]-LADFGLAR.2y5_1.heavy 503.794 / 563.33 31165.0 34.69269943237305 50 20 10 10 10 9.272973131988518 10.784027795253168 0.0 3 0.9935385576170784 15.34488036447592 31165.0 47.01644792503913 0.0 - - - - - - - 443.7142857142857 62 7 CDK2;CDK3;CDK4;CDK5;CDK6;CDK9;CDK16;CDK17;CDK18;CDK12;CDK14;CDK15;CDK13;CDK1 cyclin-dependent kinase 2;cyclin-dependent kinase 3;cyclin-dependent kinase 4;cyclin-dependent kinase 5;cyclin-dependent kinase 6;cyclin-dependent kinase 9;cyclin-dependent kinase 16;cyclin-dependent kinase 17;cyclin-dependent kinase 18;cyclin-dependent kinase 12;cyclin-dependent kinase 14;cyclin-dependent kinase 15;cyclin-dependent kinase 13;cyclin-dependent kinase 1 1417 181 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541777.[MT7]-LADFGLAR.2y6_1.heavy 503.794 / 678.357 6687.0 34.69269943237305 50 20 10 10 10 9.272973131988518 10.784027795253168 0.0 3 0.9935385576170784 15.34488036447592 6687.0 18.335884446154218 0.0 - - - - - - - 318.44444444444446 13 9 CDK2;CDK3;CDK4;CDK5;CDK6;CDK9;CDK16;CDK17;CDK18;CDK12;CDK14;CDK15;CDK13;CDK1 cyclin-dependent kinase 2;cyclin-dependent kinase 3;cyclin-dependent kinase 4;cyclin-dependent kinase 5;cyclin-dependent kinase 6;cyclin-dependent kinase 9;cyclin-dependent kinase 16;cyclin-dependent kinase 17;cyclin-dependent kinase 18;cyclin-dependent kinase 12;cyclin-dependent kinase 14;cyclin-dependent kinase 15;cyclin-dependent kinase 13;cyclin-dependent kinase 1 1419 181 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541777.[MT7]-LADFGLAR.2b5_1.heavy 503.794 / 648.347 6090.0 34.69269943237305 50 20 10 10 10 9.272973131988518 10.784027795253168 0.0 3 0.9935385576170784 15.34488036447592 6090.0 6.950942590720144 0.0 - - - - - - - 298.5 12 6 CDK2;CDK3;CDK4;CDK5;CDK6;CDK9;CDK16;CDK17;CDK18;CDK12;CDK14;CDK15;CDK13;CDK1 cyclin-dependent kinase 2;cyclin-dependent kinase 3;cyclin-dependent kinase 4;cyclin-dependent kinase 5;cyclin-dependent kinase 6;cyclin-dependent kinase 9;cyclin-dependent kinase 16;cyclin-dependent kinase 17;cyclin-dependent kinase 18;cyclin-dependent kinase 12;cyclin-dependent kinase 14;cyclin-dependent kinase 15;cyclin-dependent kinase 13;cyclin-dependent kinase 1 1421 181 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541777.[MT7]-LADFGLAR.2y7_1.heavy 503.794 / 749.394 21015.0 34.69269943237305 50 20 10 10 10 9.272973131988518 10.784027795253168 0.0 3 0.9935385576170784 15.34488036447592 21015.0 30.010807380840326 0.0 - - - - - - - 322.5 42 10 CDK2;CDK3;CDK4;CDK5;CDK6;CDK9;CDK16;CDK17;CDK18;CDK12;CDK14;CDK15;CDK13;CDK1 cyclin-dependent kinase 2;cyclin-dependent kinase 3;cyclin-dependent kinase 4;cyclin-dependent kinase 5;cyclin-dependent kinase 6;cyclin-dependent kinase 9;cyclin-dependent kinase 16;cyclin-dependent kinase 17;cyclin-dependent kinase 18;cyclin-dependent kinase 12;cyclin-dependent kinase 14;cyclin-dependent kinase 15;cyclin-dependent kinase 13;cyclin-dependent kinase 1 1423 182 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38983.[MT7]-HYGGLTGLNK[MT7].2y4_1.heavy 674.385 / 575.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100290936;PGAM4;PGAM1;PGAM2 phosphoglycerate mutase 1-like;phosphoglycerate mutase family member 4;phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 1425 182 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38983.[MT7]-HYGGLTGLNK[MT7].2y8_1.heavy 674.385 / 903.538 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100290936;PGAM4;PGAM1;PGAM2 phosphoglycerate mutase 1-like;phosphoglycerate mutase family member 4;phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 1427 182 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38983.[MT7]-HYGGLTGLNK[MT7].2y9_1.heavy 674.385 / 1066.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100290936;PGAM4;PGAM1;PGAM2 phosphoglycerate mutase 1-like;phosphoglycerate mutase family member 4;phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 1429 182 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38983.[MT7]-HYGGLTGLNK[MT7].2y7_1.heavy 674.385 / 846.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100290936;PGAM4;PGAM1;PGAM2 phosphoglycerate mutase 1-like;phosphoglycerate mutase family member 4;phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 1431 183 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39319.[MT7]-NIHLWDPENSVLQNLK[MT7].3y3_1.heavy 736.739 / 518.342 3974.0 39.58209991455078 42 12 10 10 10 0.980230688077461 62.92358131078855 0.0 3 0.8889331507533552 3.6683101814824246 3974.0 33.07158373675973 0.0 - - - - - - - 229.23076923076923 7 13 FANCL Fanconi anemia, complementation group L 1433 183 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39319.[MT7]-NIHLWDPENSVLQNLK[MT7].3b6_1.heavy 736.739 / 923.486 3312.0 39.58209991455078 42 12 10 10 10 0.980230688077461 62.92358131078855 0.0 3 0.8889331507533552 3.6683101814824246 3312.0 32.50696463272445 0.0 - - - - - - - 182.2 6 10 FANCL Fanconi anemia, complementation group L 1435 183 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39319.[MT7]-NIHLWDPENSVLQNLK[MT7].3b3_1.heavy 736.739 / 509.295 3312.0 39.58209991455078 42 12 10 10 10 0.980230688077461 62.92358131078855 0.0 3 0.8889331507533552 3.6683101814824246 3312.0 12.877809385788334 0.0 - - - - - - - 222.5625 6 16 FANCL Fanconi anemia, complementation group L 1437 183 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39319.[MT7]-NIHLWDPENSVLQNLK[MT7].3y5_1.heavy 736.739 / 759.484 4471.0 39.58209991455078 42 12 10 10 10 0.980230688077461 62.92358131078855 0.0 3 0.8889331507533552 3.6683101814824246 4471.0 12.448324015436373 1.0 - - - - - - - 198.8 10 15 FANCL Fanconi anemia, complementation group L 1439 184 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22006.[MT7]-NVTAIQGPGGK[MT7].2y4_1.heavy 665.39 / 502.311 3460.0 22.67509937286377 42 16 10 6 10 1.8810968934831407 36.99811156673671 0.03240013122558594 3 0.9672819562977436 6.8042056747882 3460.0 10.41814567142599 1.0 - - - - - - - 222.11764705882354 6 17 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1441 184 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22006.[MT7]-NVTAIQGPGGK[MT7].2y5_1.heavy 665.39 / 559.332 5473.0 22.67509937286377 42 16 10 6 10 1.8810968934831407 36.99811156673671 0.03240013122558594 3 0.9672819562977436 6.8042056747882 5473.0 20.41515873015873 0.0 - - - - - - - 151.13333333333333 10 15 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1443 184 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22006.[MT7]-NVTAIQGPGGK[MT7].2b4_1.heavy 665.39 / 530.305 4529.0 22.67509937286377 42 16 10 6 10 1.8810968934831407 36.99811156673671 0.03240013122558594 3 0.9672819562977436 6.8042056747882 4529.0 22.045925925925925 1.0 - - - - - - - 204.5625 9 16 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1445 184 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22006.[MT7]-NVTAIQGPGGK[MT7].2y7_1.heavy 665.39 / 800.475 2202.0 22.67509937286377 42 16 10 6 10 1.8810968934831407 36.99811156673671 0.03240013122558594 3 0.9672819562977436 6.8042056747882 2202.0 4.77759697256386 0.0 - - - - - - - 182.0 4 9 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1447 185 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543364.[MT7]-EEQTPQNK[MT7].3y3_1.heavy 421.226 / 533.316 8161.0 14.032099723815918 50 20 10 10 10 101.38964023620683 0.9862940608826563 0.0 3 0.9996564282369976 66.57960326952848 8161.0 86.10990369453945 0.0 - - - - - - - 159.875 16 24 LDHA lactate dehydrogenase A 1449 185 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543364.[MT7]-EEQTPQNK[MT7].3b4_1.heavy 421.226 / 632.301 10518.0 14.032099723815918 50 20 10 10 10 101.38964023620683 0.9862940608826563 0.0 3 0.9996564282369976 66.57960326952848 10518.0 182.5872644628099 0.0 - - - - - - - 194.77777777777777 21 18 LDHA lactate dehydrogenase A 1451 185 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543364.[MT7]-EEQTPQNK[MT7].3y4_1.heavy 421.226 / 630.369 13450.0 14.032099723815918 50 20 10 10 10 101.38964023620683 0.9862940608826563 0.0 3 0.9996564282369976 66.57960326952848 13450.0 184.91576438267614 0.0 - - - - - - - 195.68421052631578 26 19 LDHA lactate dehydrogenase A 1453 185 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543364.[MT7]-EEQTPQNK[MT7].3b3_1.heavy 421.226 / 531.253 24996.0 14.032099723815918 50 20 10 10 10 101.38964023620683 0.9862940608826563 0.0 3 0.9996564282369976 66.57960326952848 24996.0 102.4022524163048 0.0 - - - - - - - 173.42105263157896 49 19 LDHA lactate dehydrogenase A 1455 186 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22151.[MT7]-TYNNLDVSVTK[MT7].2y4_1.heavy 771.424 / 578.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1457 186 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22151.[MT7]-TYNNLDVSVTK[MT7].2y5_1.heavy 771.424 / 677.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1459 186 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22151.[MT7]-TYNNLDVSVTK[MT7].2b4_1.heavy 771.424 / 637.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1461 186 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22151.[MT7]-TYNNLDVSVTK[MT7].2b6_1.heavy 771.424 / 865.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1463 187 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543366.[MT7]-AMEAVAAQGK[MT7].3b5_1.heavy 421.904 / 646.335 8618.0 22.41996701558431 46 20 10 6 10 8.116756469913993 12.320192230808622 0.03140068054199219 3 0.992682800170667 14.418654577217337 8618.0 36.45054384567924 0.0 - - - - - - - 173.15 17 20 PGAM1;PGAM2 phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 1465 187 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543366.[MT7]-AMEAVAAQGK[MT7].3y8_2.heavy 421.904 / 459.262 6290.0 22.41996701558431 46 20 10 6 10 8.116756469913993 12.320192230808622 0.03140068054199219 3 0.992682800170667 14.418654577217337 6290.0 15.460575407251707 0.0 - - - - - - - 263.5625 12 16 PGAM1;PGAM2 phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 1467 187 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543366.[MT7]-AMEAVAAQGK[MT7].3y5_1.heavy 421.904 / 618.369 2831.0 22.41996701558431 46 20 10 6 10 8.116756469913993 12.320192230808622 0.03140068054199219 3 0.992682800170667 14.418654577217337 2831.0 18.573756613756615 0.0 - - - - - - - 159.35294117647058 5 17 PGAM1;PGAM2 phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 1469 188 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21904.[MT7]-TVTYSLLK[MT7].3y3_1.heavy 404.92 / 517.383 11564.0 32.72010040283203 32 14 0 10 8 1.877695651927072 42.347102796292525 0.0 4 0.9383912422732391 4.946361211580251 11564.0 18.080836120401337 1.0 - - - - - - - 304.0 88 7 SMAD6 SMAD family member 6 1471 188 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21904.[MT7]-TVTYSLLK[MT7].3b4_1.heavy 404.92 / 609.336 3988.0 32.72010040283203 32 14 0 10 8 1.877695651927072 42.347102796292525 0.0 4 0.9383912422732391 4.946361211580251 3988.0 43.17834586466165 0.0 - - - - - - - 177.33333333333334 7 3 SMAD6 SMAD family member 6 1473 188 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21904.[MT7]-TVTYSLLK[MT7].3b5_1.heavy 404.92 / 696.369 7975.0 32.72010040283203 32 14 0 10 8 1.877695651927072 42.347102796292525 0.0 4 0.9383912422732391 4.946361211580251 7975.0 83.34774436090225 0.0 - - - - - - - 266.0 15 4 SMAD6 SMAD family member 6 1475 188 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21904.[MT7]-TVTYSLLK[MT7].3b3_1.heavy 404.92 / 446.273 9171.0 32.72010040283203 32 14 0 10 8 1.877695651927072 42.347102796292525 0.0 4 0.9383912422732391 4.946361211580251 9171.0 33.243120300751876 1.0 - - - - - - - 205.54545454545453 18 11 SMAD6 SMAD family member 6 1477 189 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38674.[MT7]-RLVGGK[MT7].2y4_1.heavy 459.31 / 504.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 1479 189 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38674.[MT7]-RLVGGK[MT7].2b5_2.heavy 459.31 / 314.207 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 1481 189 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38674.[MT7]-RLVGGK[MT7].2y5_1.heavy 459.31 / 617.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 1483 189 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38674.[MT7]-RLVGGK[MT7].2y3_1.heavy 459.31 / 405.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 1485 190 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22001.[MT7]-GRVVDIYSK[MT7].3b6_1.heavy 442.266 / 784.48 6554.0 24.32159996032715 46 16 10 10 10 2.173734650740676 36.69089671360494 0.0 3 0.9653572157762323 6.611411234346032 6554.0 64.16021052631578 0.0 - - - - - - - 213.75 13 8 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1487 190 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22001.[MT7]-GRVVDIYSK[MT7].3y3_1.heavy 442.266 / 541.31 31250.0 24.32159996032715 46 16 10 10 10 2.173734650740676 36.69089671360494 0.0 3 0.9653572157762323 6.611411234346032 31250.0 49.142743221690594 0.0 - - - - - - - 393.57142857142856 62 7 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1489 190 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22001.[MT7]-GRVVDIYSK[MT7].3b5_1.heavy 442.266 / 671.396 19567.0 24.32159996032715 46 16 10 10 10 2.173734650740676 36.69089671360494 0.0 3 0.9653572157762323 6.611411234346032 19567.0 60.41740350877193 0.0 - - - - - - - 171.0 39 10 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1491 190 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22001.[MT7]-GRVVDIYSK[MT7].3y4_1.heavy 442.266 / 654.394 36189.0 24.32159996032715 46 16 10 10 10 2.173734650740676 36.69089671360494 0.0 3 0.9653572157762323 6.611411234346032 36189.0 193.00799999999998 0.0 - - - - - - - 285.0 72 14 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1493 191 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544751.[MT7]-FC[CAM]GWFDAELSEK[MT7].3b6_1.heavy 592.955 / 957.404 6254.0 40.6708984375 45 15 10 10 10 2.2530559043600866 37.30194224102351 0.0 3 0.9581685523815182 6.012917511129512 6254.0 64.81137221646026 0.0 - - - - - - - 154.93333333333334 12 15 PGAM2 phosphoglycerate mutase 2 (muscle) 1495 191 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544751.[MT7]-FC[CAM]GWFDAELSEK[MT7].3y3_1.heavy 592.955 / 507.289 24572.0 40.6708984375 45 15 10 10 10 2.2530559043600866 37.30194224102351 0.0 3 0.9581685523815182 6.012917511129512 24572.0 81.03938460031267 0.0 - - - - - - - 719.2857142857143 49 7 PGAM2 phosphoglycerate mutase 2 (muscle) 1497 191 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544751.[MT7]-FC[CAM]GWFDAELSEK[MT7].3b4_1.heavy 592.955 / 695.309 8910.0 40.6708984375 45 15 10 10 10 2.2530559043600866 37.30194224102351 0.0 3 0.9581685523815182 6.012917511129512 8910.0 62.99005206345744 0.0 - - - - - - - 242.1875 17 16 PGAM2 phosphoglycerate mutase 2 (muscle) 1499 191 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544751.[MT7]-FC[CAM]GWFDAELSEK[MT7].3b3_1.heavy 592.955 / 509.23 4593.0 40.6708984375 45 15 10 10 10 2.2530559043600866 37.30194224102351 0.0 3 0.9581685523815182 6.012917511129512 4593.0 28.61909866904441 0.0 - - - - - - - 263.6470588235294 9 17 PGAM2 phosphoglycerate mutase 2 (muscle) 1501 192 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22002.[MT7]-GRVVDIYSK[MT7].2y4_1.heavy 662.895 / 654.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1503 192 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22002.[MT7]-GRVVDIYSK[MT7].2y5_1.heavy 662.895 / 769.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1505 192 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22002.[MT7]-GRVVDIYSK[MT7].2y3_1.heavy 662.895 / 541.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1507 192 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22002.[MT7]-GRVVDIYSK[MT7].2b5_1.heavy 662.895 / 671.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1509 193 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22292.[MT7]-SALVQIYELEEHK[MT7].3b6_1.heavy 616.343 / 756.474 4787.0 36.722999572753906 39 13 10 6 10 1.009780932934761 65.41156618657513 0.031402587890625 3 0.9238432450842825 4.443371642463349 4787.0 10.76441798941799 0.0 - - - - - - - 178.5 9 16 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1511 193 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22292.[MT7]-SALVQIYELEEHK[MT7].3b4_1.heavy 616.343 / 515.331 3947.0 36.722999572753906 39 13 10 6 10 1.009780932934761 65.41156618657513 0.031402587890625 3 0.9238432450842825 4.443371642463349 3947.0 4.585311709224753 0.0 - - - - - - - 663.6 7 10 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1513 193 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22292.[MT7]-SALVQIYELEEHK[MT7].3b5_1.heavy 616.343 / 643.39 8146.0 36.722999572753906 39 13 10 6 10 1.009780932934761 65.41156618657513 0.031402587890625 3 0.9238432450842825 4.443371642463349 8146.0 12.032547909621131 0.0 - - - - - - - 262.5 16 16 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1515 193 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22292.[MT7]-SALVQIYELEEHK[MT7].3y5_1.heavy 616.343 / 799.443 1764.0 36.722999572753906 39 13 10 6 10 1.009780932934761 65.41156618657513 0.031402587890625 3 0.9238432450842825 4.443371642463349 1764.0 15.189999999999998 0.0 - - - - - - - 191.33333333333334 3 18 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1517 194 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22133.[MT7]-RIAEFAFEYAR.3b4_1.heavy 506.272 / 614.374 108648.0 34.73680114746094 45 15 10 10 10 1.9200695363888187 41.61875195007895 0.0 3 0.9558179412080129 5.849614969431523 108648.0 121.76037561127768 0.0 - - - - - - - 726.7142857142857 217 7 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1519 194 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22133.[MT7]-RIAEFAFEYAR.3b5_1.heavy 506.272 / 761.443 66769.0 34.73680114746094 45 15 10 10 10 1.9200695363888187 41.61875195007895 0.0 3 0.9558179412080129 5.849614969431523 66769.0 345.27968479614066 0.0 - - - - - - - 138.85714285714286 133 7 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1521 194 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22133.[MT7]-RIAEFAFEYAR.3y4_1.heavy 506.272 / 538.262 190458.0 34.73680114746094 45 15 10 10 10 1.9200695363888187 41.61875195007895 0.0 3 0.9558179412080129 5.849614969431523 190458.0 246.37130803020665 0.0 - - - - - - - 135.0 380 4 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1523 194 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22133.[MT7]-RIAEFAFEYAR.3y5_1.heavy 506.272 / 685.33 193705.0 34.73680114746094 45 15 10 10 10 1.9200695363888187 41.61875195007895 0.0 3 0.9558179412080129 5.849614969431523 193705.0 265.6195979097959 0.0 - - - - - - - 788.5714285714286 387 7 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1525 195 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22317.[MT7]-DIEQIAEFLEQSVK[MT7].3b4_1.heavy 646.354 / 630.321 2882.0 48.75895023345947 44 18 10 6 10 4.5035373724512855 22.20476743719566 0.033802032470703125 3 0.9868354603214865 10.744394260530788 2882.0 77.82479400749064 0.0 - - - - - - - 62.04 5 25 LIG1 ligase I, DNA, ATP-dependent 1527 195 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22317.[MT7]-DIEQIAEFLEQSVK[MT7].3b5_1.heavy 646.354 / 743.406 1957.0 48.75895023345947 44 18 10 6 10 4.5035373724512855 22.20476743719566 0.033802032470703125 3 0.9868354603214865 10.744394260530788 1957.0 39.64171546130717 0.0 - - - - - - - 60.0 3 19 LIG1 ligase I, DNA, ATP-dependent 1529 195 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22317.[MT7]-DIEQIAEFLEQSVK[MT7].3b3_1.heavy 646.354 / 502.263 1085.0 48.75895023345947 44 18 10 6 10 4.5035373724512855 22.20476743719566 0.033802032470703125 3 0.9868354603214865 10.744394260530788 1085.0 13.673836276083467 0.0 - - - - - - - 59.84 2 25 LIG1 ligase I, DNA, ATP-dependent 1531 195 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22317.[MT7]-DIEQIAEFLEQSVK[MT7].3b7_1.heavy 646.354 / 943.485 1779.0 48.75895023345947 44 18 10 6 10 4.5035373724512855 22.20476743719566 0.033802032470703125 3 0.9868354603214865 10.744394260530788 1779.0 114.47962441314553 0.0 - - - - - - - 37.07692307692308 3 13 LIG1 ligase I, DNA, ATP-dependent 1533 196 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542132.[MT7]-YYYDK[MT7].2y4_1.heavy 520.271 / 732.369 10954.0 23.827600479125977 30 14 0 10 6 2.158174612219558 46.33545378293361 0.0 5 0.9496800446830123 5.478404166252579 10954.0 36.3144267362987 0.0 - - - - - - - 220.28571428571428 21 14 ELK1;ELK3;ERG;ETS1;ETS2;FLI1;FEV ELK1, member of ETS oncogene family;ELK3, ETS-domain protein (SRF accessory protein 2);v-ets erythroblastosis virus E26 oncogene homolog (avian);v-ets erythroblastosis virus E26 oncogene homolog 1 (avian);v-ets erythroblastosis virus E26 oncogene homolog 2 (avian);Friend leukemia virus integration 1;FEV (ETS oncogene family) 1535 196 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542132.[MT7]-YYYDK[MT7].2b4_1.heavy 520.271 / 749.326 5014.0 23.827600479125977 30 14 0 10 6 2.158174612219558 46.33545378293361 0.0 5 0.9496800446830123 5.478404166252579 5014.0 19.989702542856865 0.0 - - - - - - - 210.73333333333332 10 15 ELK1;ELK3;ERG;ETS1;ETS2;FLI1;FEV ELK1, member of ETS oncogene family;ELK3, ETS-domain protein (SRF accessory protein 2);v-ets erythroblastosis virus E26 oncogene homolog (avian);v-ets erythroblastosis virus E26 oncogene homolog 1 (avian);v-ets erythroblastosis virus E26 oncogene homolog 2 (avian);Friend leukemia virus integration 1;FEV (ETS oncogene family) 1537 196 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542132.[MT7]-YYYDK[MT7].2y3_1.heavy 520.271 / 569.305 5323.0 23.827600479125977 30 14 0 10 6 2.158174612219558 46.33545378293361 0.0 5 0.9496800446830123 5.478404166252579 5323.0 2.118145305873899 3.0 - - - - - - - 370.4 215 5 ELK1;ELK3;ERG;ETS1;ETS2;FLI1;FEV ELK1, member of ETS oncogene family;ELK3, ETS-domain protein (SRF accessory protein 2);v-ets erythroblastosis virus E26 oncogene homolog (avian);v-ets erythroblastosis virus E26 oncogene homolog 1 (avian);v-ets erythroblastosis virus E26 oncogene homolog 2 (avian);Friend leukemia virus integration 1;FEV (ETS oncogene family) 1539 197 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541454.[MT7]-VEEGDSR.2b3_1.heavy 468.231 / 502.263 1186.0 14.225000381469727 42 14 10 10 8 2.864713805040705 34.907500995052835 0.0 4 0.9332931151234346 4.751522141344099 1186.0 8.267420801794225 3.0 - - - - - - - 204.0 2 21 WEE2 WEE1 homolog 2 (S. pombe) 1541 197 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541454.[MT7]-VEEGDSR.2y5_1.heavy 468.231 / 563.242 1186.0 14.225000381469727 42 14 10 10 8 2.864713805040705 34.907500995052835 0.0 4 0.9332931151234346 4.751522141344099 1186.0 9.99575459023735 0.0 - - - - - - - 154.73076923076923 2 26 WEE2 WEE1 homolog 2 (S. pombe) 1543 197 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541454.[MT7]-VEEGDSR.2y6_1.heavy 468.231 / 692.285 3472.0 14.225000381469727 42 14 10 10 8 2.864713805040705 34.907500995052835 0.0 4 0.9332931151234346 4.751522141344099 3472.0 15.418181818181818 0.0 - - - - - - - 166.17391304347825 6 23 WEE2 WEE1 homolog 2 (S. pombe) 1545 197 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541454.[MT7]-VEEGDSR.2b5_1.heavy 468.231 / 674.311 15304.0 14.225000381469727 42 14 10 10 8 2.864713805040705 34.907500995052835 0.0 4 0.9332931151234346 4.751522141344099 15304.0 222.16171352785145 0.0 - - - - - - - 183.38888888888889 30 18 WEE2 WEE1 homolog 2 (S. pombe) 1547 198 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544140.[MT7]-GYVNNTTVAVK[MT7].3b4_1.heavy 485.28 / 578.305 14051.0 24.405000686645508 44 14 10 10 10 2.3662011041031086 33.20252584787919 0.0 3 0.938502987647081 4.950900325207242 14051.0 18.154190538758094 0.0 - - - - - - - 808.4285714285714 28 7 IRAK4 interleukin-1 receptor-associated kinase 4 1549 198 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544140.[MT7]-GYVNNTTVAVK[MT7].3b5_1.heavy 485.28 / 692.348 5464.0 24.405000686645508 44 14 10 10 10 2.3662011041031086 33.20252584787919 0.0 3 0.938502987647081 4.950900325207242 5464.0 23.874619817601967 0.0 - - - - - - - 253.86666666666667 10 15 IRAK4 interleukin-1 receptor-associated kinase 4 1551 198 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544140.[MT7]-GYVNNTTVAVK[MT7].3y4_1.heavy 485.28 / 560.389 16197.0 24.405000686645508 44 14 10 10 10 2.3662011041031086 33.20252584787919 0.0 3 0.938502987647081 4.950900325207242 16197.0 28.775118048355374 0.0 - - - - - - - 341.5 32 8 IRAK4 interleukin-1 receptor-associated kinase 4 1553 198 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544140.[MT7]-GYVNNTTVAVK[MT7].3y5_1.heavy 485.28 / 661.437 7611.0 24.405000686645508 44 14 10 10 10 2.3662011041031086 33.20252584787919 0.0 3 0.938502987647081 4.950900325207242 7611.0 11.048258030269004 0.0 - - - - - - - 744.0 15 8 IRAK4 interleukin-1 receptor-associated kinase 4 1555 199 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22319.[MT7]-LEPQEVPRGSEPWK[MT7].3y3_1.heavy 647.354 / 574.347 7079.0 28.975799560546875 43 13 10 10 10 2.325943901327308 42.99329830910138 0.0 3 0.9160528400165476 4.229347268168748 7079.0 18.307758620689654 0.0 - - - - - - - 258.7692307692308 14 13 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1557 199 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22319.[MT7]-LEPQEVPRGSEPWK[MT7].3y8_1.heavy 647.354 / 1100.6 1393.0 28.975799560546875 43 13 10 10 10 2.325943901327308 42.99329830910138 0.0 3 0.9160528400165476 4.229347268168748 1393.0 11.996612068965517 1.0 - - - - - - - 232.0 2 5 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1559 199 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22319.[MT7]-LEPQEVPRGSEPWK[MT7].3y12_2.heavy 647.354 / 777.413 23557.0 28.975799560546875 43 13 10 10 10 2.325943901327308 42.99329830910138 0.0 3 0.9160528400165476 4.229347268168748 23557.0 134.2342844827586 0.0 - - - - - - - 232.0 47 7 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1561 199 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22319.[MT7]-LEPQEVPRGSEPWK[MT7].3y13_2.heavy 647.354 / 841.935 4874.0 28.975799560546875 43 13 10 10 10 2.325943901327308 42.99329830910138 0.0 3 0.9160528400165476 4.229347268168748 4874.0 49.32824137931034 0.0 - - - - - - - 217.5 9 8 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1563 200 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22135.[MT7]-LVVVDENDVVK[MT7].3b6_1.heavy 506.299 / 799.468 10216.0 32.143001556396484 48 18 10 10 10 11.266448602795784 8.875911436296338 0.0 3 0.9869147933927062 10.77698722431143 10216.0 17.512226285061026 1.0 - - - - - - - 193.0 21 11 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1565 200 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22135.[MT7]-LVVVDENDVVK[MT7].3b4_1.heavy 506.299 / 555.399 35025.0 32.143001556396484 48 18 10 10 10 11.266448602795784 8.875911436296338 0.0 3 0.9869147933927062 10.77698722431143 35025.0 53.35152324120603 0.0 - - - - - - - 729.75 70 8 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1567 200 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22135.[MT7]-LVVVDENDVVK[MT7].3b5_1.heavy 506.299 / 670.426 34229.0 32.143001556396484 48 18 10 10 10 11.266448602795784 8.875911436296338 0.0 3 0.9869147933927062 10.77698722431143 34229.0 26.05378421732285 0.0 - - - - - - - 309.6666666666667 68 3 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1569 200 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22135.[MT7]-LVVVDENDVVK[MT7].3b8_1.heavy 506.299 / 1028.54 3980.0 32.143001556396484 48 18 10 10 10 11.266448602795784 8.875911436296338 0.0 3 0.9869147933927062 10.77698722431143 3980.0 57.45563909774437 0.0 - - - - - - - 133.0 7 4 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1571 201 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38937.[MT7]-SVENLQSSK[MT7].2y8_1.heavy 640.358 / 1048.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 1573 201 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38937.[MT7]-SVENLQSSK[MT7].2b4_1.heavy 640.358 / 574.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 1575 201 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38937.[MT7]-SVENLQSSK[MT7].2y6_1.heavy 640.358 / 820.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 1577 201 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38937.[MT7]-SVENLQSSK[MT7].2b5_1.heavy 640.358 / 687.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 1579 202 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544769.[MT7]-IRGDLEEAGPEEGK[MT7].3b6_1.heavy 596.651 / 828.47 2811.0 23.785999298095703 46 16 10 10 10 2.8943456530678544 34.550123581129725 0.0 3 0.9612588441229133 6.249768451443442 2811.0 20.017727272727274 0.0 - - - - - - - 196.15384615384616 5 13 WEE2 WEE1 homolog 2 (S. pombe) 1581 202 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544769.[MT7]-IRGDLEEAGPEEGK[MT7].3b4_1.heavy 596.651 / 586.343 2723.0 23.785999298095703 46 16 10 10 10 2.8943456530678544 34.550123581129725 0.0 3 0.9612588441229133 6.249768451443442 2723.0 8.110072878709005 0.0 - - - - - - - 677.7142857142857 5 7 WEE2 WEE1 homolog 2 (S. pombe) 1583 202 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544769.[MT7]-IRGDLEEAGPEEGK[MT7].3y4_1.heavy 596.651 / 606.321 5798.0 23.785999298095703 46 16 10 10 10 2.8943456530678544 34.550123581129725 0.0 3 0.9612588441229133 6.249768451443442 5798.0 21.122437366807006 1.0 - - - - - - - 214.375 12 16 WEE2 WEE1 homolog 2 (S. pombe) 1585 202 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544769.[MT7]-IRGDLEEAGPEEGK[MT7].3b7_1.heavy 596.651 / 957.512 5271.0 23.785999298095703 46 16 10 10 10 2.8943456530678544 34.550123581129725 0.0 3 0.9612588441229133 6.249768451443442 5271.0 81.4609090909091 0.0 - - - - - - - 136.88888888888889 10 9 WEE2 WEE1 homolog 2 (S. pombe) 1587 203 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22233.[MT7]-SLREC[CAM]ELYVQK[MT7].2b8_1.heavy 856.966 / 1195.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1589 203 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22233.[MT7]-SLREC[CAM]ELYVQK[MT7].2y4_1.heavy 856.966 / 681.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1591 203 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22233.[MT7]-SLREC[CAM]ELYVQK[MT7].2y3_1.heavy 856.966 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1593 203 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22233.[MT7]-SLREC[CAM]ELYVQK[MT7].2b6_1.heavy 856.966 / 919.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1595 204 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38879.[MT7]-EAITVQQK[MT7].2y5_1.heavy 602.861 / 747.448 3196.0 21.028274536132812 40 13 10 7 10 8.673328743741456 11.529598722077553 0.02590179443359375 3 0.9061169595629343 3.9958668974855898 3196.0 35.57667715285332 0.0 - - - - - - - 126.04347826086956 6 23 IRAK4 interleukin-1 receptor-associated kinase 4 1597 204 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38879.[MT7]-EAITVQQK[MT7].2b4_1.heavy 602.861 / 559.321 1655.0 21.028274536132812 40 13 10 7 10 8.673328743741456 11.529598722077553 0.02590179443359375 3 0.9061169595629343 3.9958668974855898 1655.0 9.786648621427672 1.0 - - - - - - - 224.24137931034483 3 29 IRAK4 interleukin-1 receptor-associated kinase 4 1599 204 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38879.[MT7]-EAITVQQK[MT7].2y3_1.heavy 602.861 / 547.332 1843.0 21.028274536132812 40 13 10 7 10 8.673328743741456 11.529598722077553 0.02590179443359375 3 0.9061169595629343 3.9958668974855898 1843.0 8.496099290780142 0.0 - - - - - - - 183.4848484848485 3 33 IRAK4 interleukin-1 receptor-associated kinase 4 1601 204 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38879.[MT7]-EAITVQQK[MT7].2y7_1.heavy 602.861 / 931.569 1015.0 21.028274536132812 40 13 10 7 10 8.673328743741456 11.529598722077553 0.02590179443359375 3 0.9061169595629343 3.9958668974855898 1015.0 9.347792207792207 1.0 - - - - - - - 105.6923076923077 3 26 IRAK4 interleukin-1 receptor-associated kinase 4 1603 205 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540649.[MT7]-EYFER.2b3_1.heavy 444.223 / 584.284 10767.0 24.445899963378906 48 18 10 10 10 3.9750770273884113 25.156745218016336 0.0 3 0.9810564466020609 8.952486255008989 10767.0 28.209013835529262 0.0 - - - - - - - 290.09090909090907 21 11 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1605 205 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540649.[MT7]-EYFER.2y4_1.heavy 444.223 / 614.293 21135.0 24.445899963378906 48 18 10 10 10 3.9750770273884113 25.156745218016336 0.0 3 0.9810564466020609 8.952486255008989 21135.0 131.698374890151 0.0 - - - - - - - 258.05882352941177 42 17 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1607 205 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540649.[MT7]-EYFER.2b4_1.heavy 444.223 / 713.326 10209.0 24.445899963378906 48 18 10 10 10 3.9750770273884113 25.156745218016336 0.0 3 0.9810564466020609 8.952486255008989 10209.0 37.30121594308352 0.0 - - - - - - - 252.83333333333334 20 12 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1609 205 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB540649.[MT7]-EYFER.2y3_1.heavy 444.223 / 451.23 4147.0 24.445899963378906 48 18 10 10 10 3.9750770273884113 25.156745218016336 0.0 3 0.9810564466020609 8.952486255008989 4147.0 9.488045112781954 0.0 - - - - - - - 245.14285714285714 8 14 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1611 206 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544340.[MT7]-RLDGC[CAM]VYAIK[MT7].3b6_1.heavy 494.95 / 845.442 6309.0 27.49180030822754 41 13 10 10 8 3.253417218874471 30.73691238241964 0.0 4 0.9141285418116044 4.180998785709958 6309.0 5.595735630456921 2.0 - - - - - - - 307.44444444444446 33 9 WEE2 WEE1 homolog 2 (S. pombe) 1613 206 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544340.[MT7]-RLDGC[CAM]VYAIK[MT7].3b5_1.heavy 494.95 / 746.374 8634.0 27.49180030822754 41 13 10 10 8 3.253417218874471 30.73691238241964 0.0 4 0.9141285418116044 4.180998785709958 8634.0 72.61868328595017 1.0 - - - - - - - 227.8235294117647 17 17 WEE2 WEE1 homolog 2 (S. pombe) 1615 206 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544340.[MT7]-RLDGC[CAM]VYAIK[MT7].3b3_1.heavy 494.95 / 529.321 2767.0 27.49180030822754 41 13 10 10 8 3.253417218874471 30.73691238241964 0.0 4 0.9141285418116044 4.180998785709958 2767.0 2.663971754578673 4.0 - - - - - - - 728.5 11 12 WEE2 WEE1 homolog 2 (S. pombe) 1617 206 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544340.[MT7]-RLDGC[CAM]VYAIK[MT7].3y4_1.heavy 494.95 / 638.399 16050.0 27.49180030822754 41 13 10 10 8 3.253417218874471 30.73691238241964 0.0 4 0.9141285418116044 4.180998785709958 16050.0 84.56730130843795 0.0 - - - - - - - 242.1875 32 16 WEE2 WEE1 homolog 2 (S. pombe) 1619 207 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22036.[MT7]-NTVLRPSLGK[MT7].3b4_1.heavy 458.289 / 572.352 1895.0 24.850550651550293 37 12 10 5 10 1.099904316497167 62.665418134840934 0.04450035095214844 3 0.8809548887618738 3.540796441261876 1895.0 2.877467255427761 5.0 - - - - - - - 813.5384615384615 10 13 WEE2 WEE1 homolog 2 (S. pombe) 1621 207 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22036.[MT7]-NTVLRPSLGK[MT7].3y4_1.heavy 458.289 / 548.352 2693.0 24.850550651550293 37 12 10 5 10 1.099904316497167 62.665418134840934 0.04450035095214844 3 0.8809548887618738 3.540796441261876 2693.0 3.2799397526763614 0.0 - - - - - - - 773.25 5 12 WEE2 WEE1 homolog 2 (S. pombe) 1623 207 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22036.[MT7]-NTVLRPSLGK[MT7].3y9_2.heavy 458.289 / 557.857 10474.0 24.850550651550293 37 12 10 5 10 1.099904316497167 62.665418134840934 0.04450035095214844 3 0.8809548887618738 3.540796441261876 10474.0 31.525265889946084 0.0 - - - - - - - 698.375 20 8 WEE2 WEE1 homolog 2 (S. pombe) 1625 207 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22036.[MT7]-NTVLRPSLGK[MT7].3y5_1.heavy 458.289 / 645.405 8978.0 24.850550651550293 37 12 10 5 10 1.099904316497167 62.665418134840934 0.04450035095214844 3 0.8809548887618738 3.540796441261876 8978.0 29.31172574375111 0.0 - - - - - - - 261.0769230769231 17 13 WEE2 WEE1 homolog 2 (S. pombe) 1627 208 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544347.[MT7]-QAGEVVC[CAM]EAIK[MT7].3b6_1.heavy 497.941 / 728.406 16342.0 27.61479949951172 47 17 10 10 10 3.0072260040549263 33.253237324085575 0.0 3 0.9705795520939625 7.177400457433799 16342.0 48.06398117434196 0.0 - - - - - - - 175.91666666666666 32 12 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1629 208 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544347.[MT7]-QAGEVVC[CAM]EAIK[MT7].3b4_1.heavy 497.941 / 530.269 36241.0 27.61479949951172 47 17 10 10 10 3.0072260040549263 33.253237324085575 0.0 3 0.9705795520939625 7.177400457433799 36241.0 58.16436721677441 0.0 - - - - - - - 311.4 72 10 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1631 208 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544347.[MT7]-QAGEVVC[CAM]EAIK[MT7].3b5_1.heavy 497.941 / 629.338 43801.0 27.61479949951172 47 17 10 10 10 3.0072260040549263 33.253237324085575 0.0 3 0.9705795520939625 7.177400457433799 43801.0 108.69900066277322 0.0 - - - - - - - 278.0833333333333 87 12 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1633 208 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544347.[MT7]-QAGEVVC[CAM]EAIK[MT7].3y5_1.heavy 497.941 / 764.409 18121.0 27.61479949951172 47 17 10 10 10 3.0072260040549263 33.253237324085575 0.0 3 0.9705795520939625 7.177400457433799 18121.0 66.26041042400149 0.0 - - - - - - - 278.0833333333333 36 12 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1635 209 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544344.[MT7]-FAGNPWYYGK[MT7].3y3_1.heavy 497.594 / 511.3 114868.0 34.512001037597656 50 20 10 10 10 9.860619264039457 10.14135089513987 0.0 3 0.995484200339068 18.358257989766873 114868.0 217.14211521152117 0.0 - - - - - - - 298.5 229 2 NCK1 NCK adaptor protein 1 1637 209 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544344.[MT7]-FAGNPWYYGK[MT7].3b4_1.heavy 497.594 / 534.279 182452.0 34.512001037597656 50 20 10 10 10 9.860619264039457 10.14135089513987 0.0 3 0.995484200339068 18.358257989766873 182452.0 251.55913316582914 0.0 - - - - - - - 358.3333333333333 364 3 NCK1 NCK adaptor protein 1 1639 209 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544344.[MT7]-FAGNPWYYGK[MT7].3b5_1.heavy 497.594 / 631.332 23523.0 34.512001037597656 50 20 10 10 10 9.860619264039457 10.14135089513987 0.0 3 0.995484200339068 18.358257989766873 23523.0 102.48154641924705 0.0 - - - - - - - 702.8888888888889 47 9 NCK1 NCK adaptor protein 1 1641 209 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544344.[MT7]-FAGNPWYYGK[MT7].3y4_1.heavy 497.594 / 674.363 78808.0 34.512001037597656 50 20 10 10 10 9.860619264039457 10.14135089513987 0.0 3 0.995484200339068 18.358257989766873 78808.0 345.0140489606577 0.0 - - - - - - - 238.66666666666666 157 3 NCK1 NCK adaptor protein 1 1643 210 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541156.[MT7]-GAQGAGRR.2y5_1.heavy 458.763 / 516.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 1645 210 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541156.[MT7]-GAQGAGRR.2y6_1.heavy 458.763 / 644.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 1647 210 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541156.[MT7]-GAQGAGRR.2b7_1.heavy 458.763 / 742.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 1649 210 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541156.[MT7]-GAQGAGRR.2b5_1.heavy 458.763 / 529.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 1651 211 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544765.[MT7]-AFWDVMDEIDEK[MT7].3y3_1.heavy 595.958 / 535.284 15022.0 44.534576416015625 38 11 10 7 10 1.0832241685758017 60.512055793728884 0.0269012451171875 3 0.8558276861278171 3.21040629976681 15022.0 46.31163090128755 0.0 - - - - - - - 263.25 30 24 FANCL Fanconi anemia, complementation group L 1653 211 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544765.[MT7]-AFWDVMDEIDEK[MT7].3b4_1.heavy 595.958 / 664.321 12199.0 44.534576416015625 38 11 10 7 10 1.0832241685758017 60.512055793728884 0.0269012451171875 3 0.8558276861278171 3.21040629976681 12199.0 98.701 0.0 - - - - - - - 175.56521739130434 24 23 FANCL Fanconi anemia, complementation group L 1655 211 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544765.[MT7]-AFWDVMDEIDEK[MT7].3b5_1.heavy 595.958 / 763.39 7796.0 44.534576416015625 38 11 10 7 10 1.0832241685758017 60.512055793728884 0.0269012451171875 3 0.8558276861278171 3.21040629976681 7796.0 81.47039399624765 0.0 - - - - - - - 147.5 15 26 FANCL Fanconi anemia, complementation group L 1657 211 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544765.[MT7]-AFWDVMDEIDEK[MT7].3y4_1.heavy 595.958 / 648.369 4481.0 44.534576416015625 38 11 10 7 10 1.0832241685758017 60.512055793728884 0.0269012451171875 3 0.8558276861278171 3.21040629976681 4481.0 22.401208326281946 0.0 - - - - - - - 152.5185185185185 8 27 FANCL Fanconi anemia, complementation group L 1659 212 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543279.[MT7]-HNIQALLK[MT7].3y3_1.heavy 408.927 / 517.383 18453.0 27.938724994659424 41 15 10 6 10 2.095969493593578 32.41753169408668 0.03510093688964844 3 0.9547690995406524 5.780881220056368 18453.0 23.55991147099972 0.0 - - - - - - - 689.2 36 10 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1661 212 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543279.[MT7]-HNIQALLK[MT7].3b4_1.heavy 408.927 / 637.354 6781.0 27.938724994659424 41 15 10 6 10 2.095969493593578 32.41753169408668 0.03510093688964844 3 0.9547690995406524 5.780881220056368 6781.0 30.54065007453497 0.0 - - - - - - - 255.5 13 10 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1663 212 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543279.[MT7]-HNIQALLK[MT7].3y4_1.heavy 408.927 / 588.42 23121.0 27.938724994659424 41 15 10 6 10 2.095969493593578 32.41753169408668 0.03510093688964844 3 0.9547690995406524 5.780881220056368 23121.0 187.46756756756758 1.0 - - - - - - - 207.33333333333334 46 15 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1665 212 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB543279.[MT7]-HNIQALLK[MT7].3b3_1.heavy 408.927 / 509.295 17674.0 27.938724994659424 41 15 10 6 10 2.095969493593578 32.41753169408668 0.03510093688964844 3 0.9547690995406524 5.780881220056368 17674.0 56.37825472156008 0.0 - - - - - - - 213.46153846153845 35 13 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1667 213 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544866.[MT7]-AEDASGREHLITLK[MT7].4b4_1.heavy 457.76 / 531.253 3004.0 26.016700744628906 45 15 10 10 10 2.0222074871977216 49.45090977710463 0.0 3 0.9503735509666916 5.516875208627626 3004.0 2.853766120411506 0.0 - - - - - - - 725.125 6 8 FANCL Fanconi anemia, complementation group L 1669 213 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544866.[MT7]-AEDASGREHLITLK[MT7].4y3_1.heavy 457.76 / 505.347 61741.0 26.016700744628906 45 15 10 10 10 2.0222074871977216 49.45090977710463 0.0 3 0.9503735509666916 5.516875208627626 61741.0 68.73354568854569 0.0 - - - - - - - 323.75 123 8 FANCL Fanconi anemia, complementation group L 1671 213 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544866.[MT7]-AEDASGREHLITLK[MT7].4b3_1.heavy 457.76 / 460.216 13053.0 26.016700744628906 45 15 10 10 10 2.0222074871977216 49.45090977710463 0.0 3 0.9503735509666916 5.516875208627626 13053.0 16.197208768354063 0.0 - - - - - - - 652.7 26 10 FANCL Fanconi anemia, complementation group L 1673 213 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544866.[MT7]-AEDASGREHLITLK[MT7].4b9_2.heavy 457.76 / 549.258 89504.0 26.016700744628906 45 15 10 10 10 2.0222074871977216 49.45090977710463 0.0 3 0.9503735509666916 5.516875208627626 89504.0 133.26789002541346 0.0 - - - - - - - 241.66666666666666 179 6 FANCL Fanconi anemia, complementation group L 1675 214 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22442.[MT7]-GNFPDVPQELSESFSSLLK[MT7].4y5_1.heavy 596.316 / 691.447 1268.0 48.5984001159668 39 13 10 6 10 2.3584846800023365 42.40010581705408 0.0337982177734375 3 0.927051182797076 4.541267670949203 1268.0 1.5216 0.0 - - - - - - - 139.48 2 25 WEE2 WEE1 homolog 2 (S. pombe) 1677 214 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22442.[MT7]-GNFPDVPQELSESFSSLLK[MT7].4b5_1.heavy 596.316 / 675.322 2643.0 48.5984001159668 39 13 10 6 10 2.3584846800023365 42.40010581705408 0.0337982177734375 3 0.927051182797076 4.541267670949203 2643.0 28.80573033707865 2.0 - - - - - - - 111.3529411764706 5 17 WEE2 WEE1 homolog 2 (S. pombe) 1679 214 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22442.[MT7]-GNFPDVPQELSESFSSLLK[MT7].4y3_1.heavy 596.316 / 517.383 839.0 48.5984001159668 39 13 10 6 10 2.3584846800023365 42.40010581705408 0.0337982177734375 3 0.927051182797076 4.541267670949203 839.0 1.9830218068535825 2.0 - - - - - - - 0.0 1 0 WEE2 WEE1 homolog 2 (S. pombe) 1681 214 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22442.[MT7]-GNFPDVPQELSESFSSLLK[MT7].4b6_1.heavy 596.316 / 774.39 1803.0 48.5984001159668 39 13 10 6 10 2.3584846800023365 42.40010581705408 0.0337982177734375 3 0.927051182797076 4.541267670949203 1803.0 23.616760563380282 0.0 - - - - - - - 104.22222222222223 3 18 WEE2 WEE1 homolog 2 (S. pombe) 1683 215 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 171712.0 42.237998962402344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 171712.0 555.9396258607293 0.0 - - - - - - - 1139.2857142857142 343 7 1685 215 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 342074.0 42.237998962402344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 342074.0 436.665324640584 0.0 - - - - - - - 856.7142857142857 684 7 1687 215 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 242657.0 42.237998962402344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 242657.0 498.1373838496096 0.0 - - - - - - - 767.4444444444445 485 9 1689 216 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22446.[MT7]-VTYQGYSPYQLTWGRPSTR.3y18_2.heavy 802.077 / 1081.03 6770.0 34.780799865722656 43 13 10 10 10 1.313874165469214 50.02286307508818 0.0 3 0.9260558974545738 4.510216982426796 6770.0 60.27580887592411 1.0 - - - - - - - 184.8 13 5 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1691 216 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22446.[MT7]-VTYQGYSPYQLTWGRPSTR.3y15_2.heavy 802.077 / 884.942 8207.0 34.780799865722656 43 13 10 10 10 1.313874165469214 50.02286307508818 0.0 3 0.9260558974545738 4.510216982426796 8207.0 94.39781827816576 0.0 - - - - - - - 256.5 16 8 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1693 216 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22446.[MT7]-VTYQGYSPYQLTWGRPSTR.3b5_1.heavy 802.077 / 693.369 1846.0 34.780799865722656 43 13 10 10 10 1.313874165469214 50.02286307508818 0.0 3 0.9260558974545738 4.510216982426796 1846.0 2.878752436647173 0.0 - - - - - - - 191.66666666666666 3 15 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1695 216 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22446.[MT7]-VTYQGYSPYQLTWGRPSTR.3b7_1.heavy 802.077 / 943.464 2565.0 34.780799865722656 43 13 10 10 10 1.313874165469214 50.02286307508818 0.0 3 0.9260558974545738 4.510216982426796 2565.0 17.642195121951218 0.0 - - - - - - - 233.1818181818182 5 11 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1697 217 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22447.[MT7]-DSIVQLC[CAM]TARPERPMAFLR.4y9_2.heavy 601.823 / 558.803 1665.0 34.37139892578125 50 20 10 10 10 12.863024746611078 7.7742212247820035 0.0 3 0.998566029425782 32.586696759808426 1665.0 2.735795454545454 1.0 - - - - - - - 745.2857142857143 3 7 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1699 217 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22447.[MT7]-DSIVQLC[CAM]TARPERPMAFLR.4b4_1.heavy 601.823 / 559.321 4328.0 34.37139892578125 50 20 10 10 10 12.863024746611078 7.7742212247820035 0.0 3 0.998566029425782 32.586696759808426 4328.0 7.32955647955648 0.0 - - - - - - - 745.2857142857143 8 7 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1701 217 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22447.[MT7]-DSIVQLC[CAM]TARPERPMAFLR.4b5_1.heavy 601.823 / 687.379 N/A 34.37139892578125 50 20 10 10 10 12.863024746611078 7.7742212247820035 0.0 3 0.998566029425782 32.586696759808426 666.0 -0.22564102564102562 20.0 - - - - - - - 299.7 2 10 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1703 217 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22447.[MT7]-DSIVQLC[CAM]TARPERPMAFLR.4y6_1.heavy 601.823 / 734.402 2664.0 34.37139892578125 50 20 10 10 10 12.863024746611078 7.7742212247820035 0.0 3 0.998566029425782 32.586696759808426 2664.0 9.6 0.0 - - - - - - - 222.0 5 12 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1705 218 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22448.[MT7]-QFITSC[CAM]PC[CAM]WLEILLNNPR.3y7_1.heavy 802.412 / 839.51 N/A 48.73923365275065 42 16 10 6 10 2.0070362014067897 34.782185923680345 0.0337982177734375 3 0.9675607915326194 6.833547005873614 768.0 16.678352059925093 0.0 - - - - - - - 0.0 1 0 SMAD6 SMAD family member 6 1707 218 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22448.[MT7]-QFITSC[CAM]PC[CAM]WLEILLNNPR.3y8_1.heavy 802.412 / 968.552 840.0 48.73923365275065 42 16 10 6 10 2.0070362014067897 34.782185923680345 0.0337982177734375 3 0.9675607915326194 6.833547005873614 840.0 7.598268832716553 0.0 - - - - - - - 0.0 1 0 SMAD6 SMAD family member 6 1709 218 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22448.[MT7]-QFITSC[CAM]PC[CAM]WLEILLNNPR.3y6_1.heavy 802.412 / 726.426 947.0 48.73923365275065 42 16 10 6 10 2.0070362014067897 34.782185923680345 0.0337982177734375 3 0.9675607915326194 6.833547005873614 947.0 14.926126102408846 0.0 - - - - - - - 0.0 1 0 SMAD6 SMAD family member 6 1711 218 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22448.[MT7]-QFITSC[CAM]PC[CAM]WLEILLNNPR.3y4_1.heavy 802.412 / 500.258 1161.0 48.73923365275065 42 16 10 6 10 2.0070362014067897 34.782185923680345 0.0337982177734375 3 0.9675607915326194 6.833547005873614 1161.0 6.16369446811664 0.0 - - - - - - - 112.55555555555556 2 27 SMAD6 SMAD family member 6 1713 219 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39039.[MT7]-GYVNNTTVAVK[MT7].2y8_1.heavy 727.416 / 990.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 1715 219 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39039.[MT7]-GYVNNTTVAVK[MT7].2y9_1.heavy 727.416 / 1089.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 1717 219 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39039.[MT7]-GYVNNTTVAVK[MT7].2b4_1.heavy 727.416 / 578.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 1719 219 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39039.[MT7]-GYVNNTTVAVK[MT7].2b9_1.heavy 727.416 / 1064.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 1721 220 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544012.[MT7]-VLGPC[CAM]SDILK[MT7].3b5_1.heavy 463.939 / 671.367 2517.0 33.22840118408203 44 14 10 10 10 2.546335009155735 39.272130195137244 0.0 3 0.9402907646969361 5.025237750063639 2517.0 7.064661082976237 1.0 - - - - - - - 214.2 5 10 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1723 220 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544012.[MT7]-VLGPC[CAM]SDILK[MT7].3y4_1.heavy 463.939 / 632.41 3524.0 33.22840118408203 44 14 10 10 10 2.546335009155735 39.272130195137244 0.0 3 0.9402907646969361 5.025237750063639 3524.0 -0.32474771177236095 2.0 - - - - - - - 234.0 8 7 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1725 220 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544012.[MT7]-VLGPC[CAM]SDILK[MT7].3y5_1.heavy 463.939 / 719.442 4153.0 33.22840118408203 44 14 10 10 10 2.546335009155735 39.272130195137244 0.0 3 0.9402907646969361 5.025237750063639 4153.0 9.456750249945413 0.0 - - - - - - - 294.0 8 3 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1727 220 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544012.[MT7]-VLGPC[CAM]SDILK[MT7].3b7_1.heavy 463.939 / 873.426 5915.0 33.22840118408203 44 14 10 10 10 2.546335009155735 39.272130195137244 0.0 3 0.9402907646969361 5.025237750063639 5915.0 33.823332228849125 0.0 - - - - - - - 210.0 11 3 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1729 221 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544976.[MT7]-LVISPTGK[MT7]LPSRGPK[MT7].4y9_2.heavy 496.318 / 614.392 5116.0 27.57379913330078 42 12 10 10 10 4.145873234492302 19.894400506709797 0.0 3 0.8914027983567284 3.7105826593101248 5116.0 11.047403598971723 0.0 - - - - - - - 654.6666666666666 10 9 WEE2 WEE1 homolog 2 (S. pombe) 1731 221 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544976.[MT7]-LVISPTGK[MT7]LPSRGPK[MT7].4y12_2.heavy 496.318 / 756.959 8786.0 27.57379913330078 42 12 10 10 10 4.145873234492302 19.894400506709797 0.0 3 0.8914027983567284 3.7105826593101248 8786.0 81.17979943954236 0.0 - - - - - - - 222.3 17 10 WEE2 WEE1 homolog 2 (S. pombe) 1733 221 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544976.[MT7]-LVISPTGK[MT7]LPSRGPK[MT7].4y11_2.heavy 496.318 / 713.443 8230.0 27.57379913330078 42 12 10 10 10 4.145873234492302 19.894400506709797 0.0 3 0.8914027983567284 3.7105826593101248 8230.0 11.968167434549496 0.0 - - - - - - - 308.8888888888889 16 9 WEE2 WEE1 homolog 2 (S. pombe) 1735 221 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544976.[MT7]-LVISPTGK[MT7]LPSRGPK[MT7].4y6_1.heavy 496.318 / 785.475 2780.0 27.57379913330078 42 12 10 10 10 4.145873234492302 19.894400506709797 0.0 3 0.8914027983567284 3.7105826593101248 2780.0 14.668018018018017 0.0 - - - - - - - 231.58333333333334 5 12 WEE2 WEE1 homolog 2 (S. pombe) 1737 222 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22020.[MT7]-RNVIEAVYSR.3b6_1.heavy 450.925 / 827.486 2892.0 28.12809944152832 48 18 10 10 10 18.07937398000902 5.531164967911688 0.0 3 0.9896889188631135 12.143290641938457 2892.0 27.611047449248346 0.0 - - - - - - - 222.25 5 8 PPM1B protein phosphatase, Mg2+/Mn2+ dependent, 1B 1739 222 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22020.[MT7]-RNVIEAVYSR.3y6_1.heavy 450.925 / 724.362 19021.0 28.12809944152832 48 18 10 10 10 18.07937398000902 5.531164967911688 0.0 3 0.9896889188631135 12.143290641938457 19021.0 103.91836905871389 0.0 - - - - - - - 211.2 38 10 PPM1B protein phosphatase, Mg2+/Mn2+ dependent, 1B 1741 222 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22020.[MT7]-RNVIEAVYSR.3b3_1.heavy 450.925 / 514.322 10790.0 28.12809944152832 48 18 10 10 10 18.07937398000902 5.531164967911688 0.0 3 0.9896889188631135 12.143290641938457 10790.0 23.377217983297513 0.0 - - - - - - - 689.5 21 10 PPM1B protein phosphatase, Mg2+/Mn2+ dependent, 1B 1743 222 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22020.[MT7]-RNVIEAVYSR.3y5_1.heavy 450.925 / 595.32 24138.0 28.12809944152832 48 18 10 10 10 18.07937398000902 5.531164967911688 0.0 3 0.9896889188631135 12.143290641938457 24138.0 28.493909411226447 0.0 - - - - - - - 266.9 48 10 PPM1B protein phosphatase, Mg2+/Mn2+ dependent, 1B 1745 223 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544773.[MT7]-RNIQQYNSFVSLSV.3b4_1.heavy 600.324 / 656.396 2330.0 37.573049545288086 37 10 10 7 10 0.9882268418501873 73.16622066021603 0.028697967529296875 3 0.833733044106062 2.9836623887134297 2330.0 1.9341009189542866 1.0 - - - - - - - 301.04761904761904 4 21 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1747 223 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544773.[MT7]-RNIQQYNSFVSLSV.3b5_1.heavy 600.324 / 784.455 1581.0 37.573049545288086 37 10 10 7 10 0.9882268418501873 73.16622066021603 0.028697967529296875 3 0.833733044106062 2.9836623887134297 1581.0 2.422770798416459 1.0 - - - - - - - 249.64 3 25 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1749 223 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544773.[MT7]-RNIQQYNSFVSLSV.3b7_2.heavy 600.324 / 531.284 6740.0 37.573049545288086 37 10 10 7 10 0.9882268418501873 73.16622066021603 0.028697967529296875 3 0.833733044106062 2.9836623887134297 6740.0 4.991602543283284 0.0 - - - - - - - 258.8888888888889 13 18 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1751 223 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544773.[MT7]-RNIQQYNSFVSLSV.3b8_2.heavy 600.324 / 574.8 17725.0 37.573049545288086 37 10 10 7 10 0.9882268418501873 73.16622066021603 0.028697967529296875 3 0.833733044106062 2.9836623887134297 17725.0 81.04246998284735 0.0 - - - - - - - 749.1428571428571 35 7 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1753 224 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545158.[MT7]-GFTGGVQTVTLIPGDGIGPEISAAVMK[MT7].4b7_1.heavy 726.65 / 791.417 3760.0 43.678725242614746 29 8 10 3 8 0.679020124605524 83.85933328491352 0.055500030517578125 4 0.7557209993582356 2.444295067789854 3760.0 21.064604613495646 0.0 - - - - - - - 220.22727272727272 7 22 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1755 224 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545158.[MT7]-GFTGGVQTVTLIPGDGIGPEISAAVMK[MT7].4b5_1.heavy 726.65 / 564.29 1110.0 43.678725242614746 29 8 10 3 8 0.679020124605524 83.85933328491352 0.055500030517578125 4 0.7557209993582356 2.444295067789854 1110.0 4.734454238106738 1.0 - - - - - - - 180.64 2 25 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1757 224 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545158.[MT7]-GFTGGVQTVTLIPGDGIGPEISAAVMK[MT7].4b9_1.heavy 726.65 / 991.533 328.0 43.678725242614746 29 8 10 3 8 0.679020124605524 83.85933328491352 0.055500030517578125 4 0.7557209993582356 2.444295067789854 328.0 1.7754277802450429 2.0 - - - - - - - 0.0 0 0 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1759 224 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545158.[MT7]-GFTGGVQTVTLIPGDGIGPEISAAVMK[MT7].4y6_1.heavy 726.65 / 750.43 1186.0 43.678725242614746 29 8 10 3 8 0.679020124605524 83.85933328491352 0.055500030517578125 4 0.7557209993582356 2.444295067789854 1186.0 6.254282059481932 1.0 - - - - - - - 202.92307692307693 7 26 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1761 225 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22028.[MT7]-IAEFAFEYAR.2y6_1.heavy 680.854 / 756.367 1361.0 39.13213348388672 39 14 10 5 10 0.8922126969476405 70.21753110354477 0.04689788818359375 3 0.9389083198308733 4.967468989668589 1361.0 8.675100655430711 0.0 - - - - - - - 245.92857142857142 2 14 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1763 225 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22028.[MT7]-IAEFAFEYAR.2y8_1.heavy 680.854 / 1032.48 N/A 39.13213348388672 39 14 10 5 10 0.8922126969476405 70.21753110354477 0.04689788818359375 3 0.9389083198308733 4.967468989668589 481.0 2.04425 1.0 - - - - - - - 0.0 0 0 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1765 225 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22028.[MT7]-IAEFAFEYAR.2y9_1.heavy 680.854 / 1103.52 3203.0 39.13213348388672 39 14 10 5 10 0.8922126969476405 70.21753110354477 0.04689788818359375 3 0.9389083198308733 4.967468989668589 3203.0 26.865162499999997 0.0 - - - - - - - 203.23076923076923 6 13 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1767 225 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22028.[MT7]-IAEFAFEYAR.2y7_1.heavy 680.854 / 903.436 801.0 39.13213348388672 39 14 10 5 10 0.8922126969476405 70.21753110354477 0.04689788818359375 3 0.9389083198308733 4.967468989668589 801.0 10.513125 0.0 - - - - - - - 0.0 1 0 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1769 226 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541466.[MT7]-IPFGSK[MT7].2y4_1.heavy 468.791 / 582.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA lactate dehydrogenase A 1771 226 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541466.[MT7]-IPFGSK[MT7].2y5_1.heavy 468.791 / 679.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA lactate dehydrogenase A 1773 226 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541466.[MT7]-IPFGSK[MT7].2y3_1.heavy 468.791 / 435.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA lactate dehydrogenase A 1775 227 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542317.[MT7]-LVIITAGAR.2b3_1.heavy 529.346 / 470.346 48992.0 33.280601501464844 47 17 10 10 10 4.141048077087644 24.148475974789683 0.0 3 0.97879081060017 8.459208825904431 48992.0 108.77499429809916 0.0 - - - - - - - 215.66666666666666 97 3 LDHA lactate dehydrogenase A 1777 227 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542317.[MT7]-LVIITAGAR.2y8_1.heavy 529.346 / 800.499 84281.0 33.280601501464844 47 17 10 10 10 4.141048077087644 24.148475974789683 0.0 3 0.97879081060017 8.459208825904431 84281.0 385.9415455966961 0.0 - - - - - - - 233.0 168 5 LDHA lactate dehydrogenase A 1779 227 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542317.[MT7]-LVIITAGAR.2y6_1.heavy 529.346 / 588.346 66184.0 33.280601501464844 47 17 10 10 10 4.141048077087644 24.148475974789683 0.0 3 0.97879081060017 8.459208825904431 66184.0 108.61274420850702 0.0 - - - - - - - 388.0 132 2 LDHA lactate dehydrogenase A 1781 227 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542317.[MT7]-LVIITAGAR.2y7_1.heavy 529.346 / 701.43 73293.0 33.280601501464844 47 17 10 10 10 4.141048077087644 24.148475974789683 0.0 3 0.97879081060017 8.459208825904431 73293.0 234.91754297010044 0.0 - - - - - - - 301.6666666666667 146 3 LDHA lactate dehydrogenase A 1783 228 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544647.[MT7]-DFINQYYSSIK[MT7].3b4_1.heavy 555.962 / 634.332 19565.0 35.57059860229492 45 15 10 10 10 3.2857030354627432 30.43488681743159 0.0 3 0.9568239492501567 5.917875175410805 19565.0 34.25530956365041 0.0 - - - - - - - 731.2222222222222 39 9 NOS3 nitric oxide synthase 3 (endothelial cell) 1785 228 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544647.[MT7]-DFINQYYSSIK[MT7].3b5_1.heavy 555.962 / 762.39 38124.0 35.57059860229492 45 15 10 10 10 3.2857030354627432 30.43488681743159 0.0 3 0.9568239492501567 5.917875175410805 38124.0 70.56431350386377 0.0 - - - - - - - 701.0 76 9 NOS3 nitric oxide synthase 3 (endothelial cell) 1787 228 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544647.[MT7]-DFINQYYSSIK[MT7].3b3_1.heavy 555.962 / 520.289 22673.0 35.57059860229492 45 15 10 10 10 3.2857030354627432 30.43488681743159 0.0 3 0.9568239492501567 5.917875175410805 22673.0 31.1565118412655 0.0 - - - - - - - 1213.6363636363637 45 11 NOS3 nitric oxide synthase 3 (endothelial cell) 1789 228 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544647.[MT7]-DFINQYYSSIK[MT7].3y4_1.heavy 555.962 / 578.363 51564.0 35.57059860229492 45 15 10 10 10 3.2857030354627432 30.43488681743159 0.0 3 0.9568239492501567 5.917875175410805 51564.0 136.4929411764706 0.0 - - - - - - - 647.6666666666666 103 12 NOS3 nitric oxide synthase 3 (endothelial cell) 1791 229 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544263.[MT7]-C[CAM]YDLIPTSSK[MT7].3b4_1.heavy 491.262 / 696.314 34690.0 30.63559913635254 42 12 10 10 10 2.0145066217516616 49.63994603951592 0.0 3 0.8975202216532709 3.8217537075292625 34690.0 44.90025540424991 0.0 - - - - - - - 674.1428571428571 69 7 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1793 229 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544263.[MT7]-C[CAM]YDLIPTSSK[MT7].3y4_1.heavy 491.262 / 566.327 14157.0 30.63559913635254 42 12 10 10 10 2.0145066217516616 49.63994603951592 0.0 3 0.8975202216532709 3.8217537075292625 14157.0 23.13235294117647 0.0 - - - - - - - 685.75 28 8 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1795 229 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544263.[MT7]-C[CAM]YDLIPTSSK[MT7].3b3_1.heavy 491.262 / 583.23 38261.0 30.63559913635254 42 12 10 10 10 2.0145066217516616 49.63994603951592 0.0 3 0.8975202216532709 3.8217537075292625 38261.0 4.822291690923934 1.0 - - - - - - - 793.6666666666666 86 9 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1797 229 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544263.[MT7]-C[CAM]YDLIPTSSK[MT7].3y5_1.heavy 491.262 / 663.379 26273.0 30.63559913635254 42 12 10 10 10 2.0145066217516616 49.63994603951592 0.0 3 0.8975202216532709 3.8217537075292625 26273.0 27.66386584107327 0.0 - - - - - - - 708.4444444444445 52 9 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1799 230 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21677.[MT7]-GTEEAK[MT7].2y4_1.heavy 461.758 / 620.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGAM2 phosphoglycerate mutase 2 (muscle) 1801 230 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21677.[MT7]-GTEEAK[MT7].2y5_1.heavy 461.758 / 721.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGAM2 phosphoglycerate mutase 2 (muscle) 1803 230 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21677.[MT7]-GTEEAK[MT7].2b4_1.heavy 461.758 / 561.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGAM2 phosphoglycerate mutase 2 (muscle) 1805 230 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21677.[MT7]-GTEEAK[MT7].2y3_1.heavy 461.758 / 491.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - PGAM2 phosphoglycerate mutase 2 (muscle) 1807 231 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22433.[MT7]-QALTFFLDITSPPSPQLLR.3y7_1.heavy 763.431 / 810.483 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 1809 231 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22433.[MT7]-QALTFFLDITSPPSPQLLR.3b8_1.heavy 763.431 / 1080.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 1811 231 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22433.[MT7]-QALTFFLDITSPPSPQLLR.3y8_1.heavy 763.431 / 907.536 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 1813 231 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22433.[MT7]-QALTFFLDITSPPSPQLLR.3y10_1.heavy 763.431 / 1095.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS3 nitric oxide synthase 3 (endothelial cell) 1815 232 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22111.[MT7]-SLDTLLEAVESR.2y9_1.heavy 738.905 / 1017.56 4653.0 43.6510009765625 50 20 10 10 10 8.959041286905402 11.161908601332234 0.0 3 0.9931452246658573 14.897636115781422 4653.0 86.72120963006458 0.0 - - - - - - - 121.6086956521739 9 23 SMAD6 SMAD family member 6 1817 232 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22111.[MT7]-SLDTLLEAVESR.2y10_1.heavy 738.905 / 1132.58 1412.0 43.6510009765625 50 20 10 10 10 8.959041286905402 11.161908601332234 0.0 3 0.9931452246658573 14.897636115781422 1412.0 37.98079372856443 0.0 - - - - - - - 103.05555555555556 2 18 SMAD6 SMAD family member 6 1819 232 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22111.[MT7]-SLDTLLEAVESR.2b5_1.heavy 738.905 / 674.384 2196.0 43.6510009765625 50 20 10 10 10 8.959041286905402 11.161908601332234 0.0 3 0.9931452246658573 14.897636115781422 2196.0 19.133124018838306 0.0 - - - - - - - 199.20689655172413 4 29 SMAD6 SMAD family member 6 1821 232 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22111.[MT7]-SLDTLLEAVESR.2y7_1.heavy 738.905 / 803.426 2379.0 43.6510009765625 50 20 10 10 10 8.959041286905402 11.161908601332234 0.0 3 0.9931452246658573 14.897636115781422 2379.0 34.91967284623773 0.0 - - - - - - - 122.32 4 25 SMAD6 SMAD family member 6 1823 233 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39028.[MT7]-SENEEFVEVGR.2b6_1.heavy 719.85 / 880.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1825 233 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39028.[MT7]-SENEEFVEVGR.2y6_1.heavy 719.85 / 706.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1827 233 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39028.[MT7]-SENEEFVEVGR.2b5_1.heavy 719.85 / 733.312 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1829 233 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39028.[MT7]-SENEEFVEVGR.2y7_1.heavy 719.85 / 835.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1831 234 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21675.[MT7]-QVSATK[MT7].2y4_1.heavy 461.284 / 550.332 2809.0 14.855025053024292 42 18 10 6 8 3.7704783822922785 26.521833534344406 0.038100242614746094 4 0.9830269276128675 9.459451211848233 2809.0 18.504690268196107 0.0 - - - - - - - 146.1904761904762 5 21 UBE2R2 ubiquitin-conjugating enzyme E2R 2 1833 234 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21675.[MT7]-QVSATK[MT7].2y5_1.heavy 461.284 / 649.4 3184.0 14.855025053024292 42 18 10 6 8 3.7704783822922785 26.521833534344406 0.038100242614746094 4 0.9830269276128675 9.459451211848233 3184.0 12.849376854599406 0.0 - - - - - - - 226.57142857142858 6 21 UBE2R2 ubiquitin-conjugating enzyme E2R 2 1835 234 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21675.[MT7]-QVSATK[MT7].2b4_1.heavy 461.284 / 530.305 599.0 14.855025053024292 42 18 10 6 8 3.7704783822922785 26.521833534344406 0.038100242614746094 4 0.9830269276128675 9.459451211848233 599.0 0.7986666666666666 6.0 - - - - - - - 0.0 1 0 UBE2R2 ubiquitin-conjugating enzyme E2R 2 1837 234 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21675.[MT7]-QVSATK[MT7].2y3_1.heavy 461.284 / 463.3 787.0 14.855025053024292 42 18 10 6 8 3.7704783822922785 26.521833534344406 0.038100242614746094 4 0.9830269276128675 9.459451211848233 787.0 0.8394666666666666 2.0 - - - - - - - 0.0 1 0 UBE2R2 ubiquitin-conjugating enzyme E2R 2 1839 235 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22332.[MT7]-ALPFWNEEIVPQIK[MT7].3b4_1.heavy 658.043 / 573.352 23912.0 44.09684944152832 41 15 10 6 10 2.135280000342699 46.83226555016233 0.03099822998046875 3 0.9519377108969347 5.606672371456166 23912.0 202.62562228381753 0.0 - - - - - - - 200.58333333333334 47 24 PGAM4;PGAM1;PGAM2 phosphoglycerate mutase family member 4;phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 1841 235 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22332.[MT7]-ALPFWNEEIVPQIK[MT7].3b5_1.heavy 658.043 / 759.431 8022.0 44.09684944152832 41 15 10 6 10 2.135280000342699 46.83226555016233 0.03099822998046875 3 0.9519377108969347 5.606672371456166 8022.0 107.3976161803304 0.0 - - - - - - - 124.08 16 25 PGAM4;PGAM1;PGAM2 phosphoglycerate mutase family member 4;phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 1843 235 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22332.[MT7]-ALPFWNEEIVPQIK[MT7].3y4_1.heavy 658.043 / 629.41 68833.0 44.09684944152832 41 15 10 6 10 2.135280000342699 46.83226555016233 0.03099822998046875 3 0.9519377108969347 5.606672371456166 68833.0 193.5703919116114 0.0 - - - - - - - 227.625 137 16 PGAM4;PGAM1;PGAM2 phosphoglycerate mutase family member 4;phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 1845 235 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22332.[MT7]-ALPFWNEEIVPQIK[MT7].3b8_1.heavy 658.043 / 1131.56 8073.0 44.09684944152832 41 15 10 6 10 2.135280000342699 46.83226555016233 0.03099822998046875 3 0.9519377108969347 5.606672371456166 8073.0 131.93253821213523 0.0 - - - - - - - 99.1 16 20 PGAM4;PGAM1;PGAM2 phosphoglycerate mutase family member 4;phosphoglycerate mutase 1 (brain);phosphoglycerate mutase 2 (muscle) 1847 236 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544985.[MT7]-SLLVTELGSSRTPETVR.3y15_2.heavy 663.708 / 822.949 4877.0 33.280601501464844 43 13 10 10 10 1.3659662132525876 51.957346070126604 0.0 3 0.9171931061088203 4.258784623379714 4877.0 7.16906720381082 1.0 - - - - - - - 250.0 11 6 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1849 236 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544985.[MT7]-SLLVTELGSSRTPETVR.3b4_1.heavy 663.708 / 557.378 3002.0 33.280601501464844 43 13 10 10 10 1.3659662132525876 51.957346070126604 0.0 3 0.9171931061088203 4.258784623379714 3002.0 0.866429840142096 4.0 - - - - - - - 270.8333333333333 6 6 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1851 236 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544985.[MT7]-SLLVTELGSSRTPETVR.3y14_2.heavy 663.708 / 766.407 6878.0 33.280601501464844 43 13 10 10 10 1.3659662132525876 51.957346070126604 0.0 3 0.9171931061088203 4.258784623379714 6878.0 17.587552519379845 0.0 - - - - - - - 222.22222222222223 13 9 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1853 236 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544985.[MT7]-SLLVTELGSSRTPETVR.3y5_1.heavy 663.708 / 601.33 3627.0 33.280601501464844 43 13 10 10 10 1.3659662132525876 51.957346070126604 0.0 3 0.9171931061088203 4.258784623379714 3627.0 9.733759928952043 0.0 - - - - - - - 312.5 7 8 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 1855 237 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21674.[MT7]-IQWGK[MT7].2y4_1.heavy 460.284 / 662.374 7002.0 28.04243278503418 38 12 10 6 10 1.3903522550615406 45.14182715195467 0.035900115966796875 3 0.8859787713346239 3.6195440648175095 7002.0 9.540000000000001 1.0 - - - - - - - 194.25 14 12 NOS3 nitric oxide synthase 3 (endothelial cell) 1857 237 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21674.[MT7]-IQWGK[MT7].2b4_1.heavy 460.284 / 629.353 1890.0 28.04243278503418 38 12 10 6 10 1.3903522550615406 45.14182715195467 0.035900115966796875 3 0.8859787713346239 3.6195440648175095 1890.0 6.94600668083814 2.0 - - - - - - - 233.8421052631579 3 19 NOS3 nitric oxide synthase 3 (endothelial cell) 1859 237 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21674.[MT7]-IQWGK[MT7].2y3_1.heavy 460.284 / 534.316 6113.0 28.04243278503418 38 12 10 6 10 1.3903522550615406 45.14182715195467 0.035900115966796875 3 0.8859787713346239 3.6195440648175095 6113.0 3.4423230800801012 0.0 - - - - - - - 711.4 12 10 NOS3 nitric oxide synthase 3 (endothelial cell) 1861 238 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22063.[MT7]-IEAAC[CAM]FATIK[MT7].2y9_1.heavy 706.396 / 1154.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1863 238 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22063.[MT7]-IEAAC[CAM]FATIK[MT7].2b4_1.heavy 706.396 / 529.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1865 238 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22063.[MT7]-IEAAC[CAM]FATIK[MT7].2y3_1.heavy 706.396 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1867 238 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22063.[MT7]-IEAAC[CAM]FATIK[MT7].2y6_1.heavy 706.396 / 883.483 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 1869 239 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22119.[MT7]-FAGNPWYYGK[MT7].2y4_1.heavy 745.887 / 674.363 1899.0 34.512001037597656 43 13 10 10 10 1.4181888676055197 56.02209119532806 0.0 3 0.9091582673246913 4.063271353343612 1899.0 5.694146649303817 0.0 - - - - - - - 316.4166666666667 3 12 NCK1 NCK adaptor protein 1 1871 239 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22119.[MT7]-FAGNPWYYGK[MT7].2b4_1.heavy 745.887 / 534.279 9046.0 34.512001037597656 43 13 10 10 10 1.4181888676055197 56.02209119532806 0.0 3 0.9091582673246913 4.063271353343612 9046.0 43.12322347991585 0.0 - - - - - - - 253.8181818181818 18 11 NCK1 NCK adaptor protein 1 1873 239 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22119.[MT7]-FAGNPWYYGK[MT7].2y3_1.heavy 745.887 / 511.3 2680.0 34.512001037597656 43 13 10 10 10 1.4181888676055197 56.02209119532806 0.0 3 0.9091582673246913 4.063271353343612 2680.0 15.04 0.0 - - - - - - - 256.8 5 10 NCK1 NCK adaptor protein 1 1875 239 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22119.[MT7]-FAGNPWYYGK[MT7].2y6_1.heavy 745.887 / 957.495 4244.0 34.512001037597656 43 13 10 10 10 1.4181888676055197 56.02209119532806 0.0 3 0.9091582673246913 4.063271353343612 4244.0 26.90961928552081 0.0 - - - - - - - 231.84615384615384 8 13 NCK1 NCK adaptor protein 1 1877 240 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22060.[MT7]-DQLIYNLLK[MT7].2b3_1.heavy 704.426 / 501.279 5483.0 41.31194877624512 40 14 10 6 10 2.0140523634096006 41.32320161408264 0.03820037841796875 3 0.9478332712157641 5.379715017856774 5483.0 38.75168872390047 0.0 - - - - - - - 219.7 10 20 LDHA lactate dehydrogenase A 1879 240 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22060.[MT7]-DQLIYNLLK[MT7].2y5_1.heavy 704.426 / 794.489 6338.0 41.31194877624512 40 14 10 6 10 2.0140523634096006 41.32320161408264 0.03820037841796875 3 0.9478332712157641 5.379715017856774 6338.0 94.92891169923324 0.0 - - - - - - - 112.55555555555556 12 18 LDHA lactate dehydrogenase A 1881 240 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22060.[MT7]-DQLIYNLLK[MT7].2b4_1.heavy 704.426 / 614.363 5483.0 41.31194877624512 40 14 10 6 10 2.0140523634096006 41.32320161408264 0.03820037841796875 3 0.9478332712157641 5.379715017856774 5483.0 150.3377005435678 0.0 - - - - - - - 209.61111111111111 10 18 LDHA lactate dehydrogenase A 1883 240 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22060.[MT7]-DQLIYNLLK[MT7].2y3_1.heavy 704.426 / 517.383 1828.0 41.31194877624512 40 14 10 6 10 2.0140523634096006 41.32320161408264 0.03820037841796875 3 0.9478332712157641 5.379715017856774 1828.0 7.846976769025366 0.0 - - - - - - - 204.65217391304347 3 23 LDHA lactate dehydrogenase A 1885 241 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21671.[MT7]-AVAQATGR.2y5_1.heavy 459.268 / 532.284 1862.0 15.240400314331055 50 20 10 10 10 6.1880422136669235 16.160200035342324 0.0 3 0.9930079414901521 14.750490655968592 1862.0 2.3212121212121213 1.0 - - - - - - - 184.85714285714286 3 21 LIG1 ligase I, DNA, ATP-dependent 1887 241 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21671.[MT7]-AVAQATGR.2b4_1.heavy 459.268 / 514.311 2615.0 15.240400314331055 50 20 10 10 10 6.1880422136669235 16.160200035342324 0.0 3 0.9930079414901521 14.750490655968592 2615.0 15.968347338935574 0.0 - - - - - - - 170.04166666666666 5 24 LIG1 ligase I, DNA, ATP-dependent 1889 241 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21671.[MT7]-AVAQATGR.2y6_1.heavy 459.268 / 603.321 11053.0 15.240400314331055 50 20 10 10 10 6.1880422136669235 16.160200035342324 0.0 3 0.9930079414901521 14.750490655968592 11053.0 121.05618562354337 0.0 - - - - - - - 162.5 22 20 LIG1 ligase I, DNA, ATP-dependent 1891 241 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21671.[MT7]-AVAQATGR.2y7_1.heavy 459.268 / 702.389 11172.0 15.240400314331055 50 20 10 10 10 6.1880422136669235 16.160200035342324 0.0 3 0.9930079414901521 14.750490655968592 11172.0 50.07058823529412 0.0 - - - - - - - 183.04761904761904 22 21 LIG1 ligase I, DNA, ATP-dependent 1893 242 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544260.[MT7]-TVYEGFISAQGR.3y6_1.heavy 491.26 / 631.352 69807.0 32.91469955444336 50 20 10 10 10 11.82097293818389 8.45954055752736 0.0 3 0.9948422968011457 17.17700159673298 69807.0 82.36690000984397 0.0 - - - - - - - 214.5 139 8 FANCL Fanconi anemia, complementation group L 1895 242 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544260.[MT7]-TVYEGFISAQGR.3b5_1.heavy 491.26 / 694.353 131828.0 32.91469955444336 50 20 10 10 10 11.82097293818389 8.45954055752736 0.0 3 0.9948422968011457 17.17700159673298 131828.0 157.97125985967148 0.0 - - - - - - - 231.0 263 4 FANCL Fanconi anemia, complementation group L 1897 242 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544260.[MT7]-TVYEGFISAQGR.3b3_1.heavy 491.26 / 508.289 42491.0 32.91469955444336 50 20 10 10 10 11.82097293818389 8.45954055752736 0.0 3 0.9948422968011457 17.17700159673298 42491.0 123.39558080808081 0.0 - - - - - - - 290.4 84 5 FANCL Fanconi anemia, complementation group L 1899 242 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544260.[MT7]-TVYEGFISAQGR.3y5_1.heavy 491.26 / 518.268 304960.0 32.91469955444336 50 20 10 10 10 11.82097293818389 8.45954055752736 0.0 3 0.9948422968011457 17.17700159673298 304960.0 158.70147477120761 0.0 - - - - - - - 198.0 609 2 FANCL Fanconi anemia, complementation group L 1901 243 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39183.[MT7]-LAAMVDITTEELK[MT7].2b8_1.heavy 861.484 / 959.535 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 1903 243 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39183.[MT7]-LAAMVDITTEELK[MT7].2b4_1.heavy 861.484 / 531.308 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 1905 243 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39183.[MT7]-LAAMVDITTEELK[MT7].2y3_1.heavy 861.484 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 1907 243 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39183.[MT7]-LAAMVDITTEELK[MT7].2y7_1.heavy 861.484 / 977.563 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK4 interleukin-1 receptor-associated kinase 4 1909 244 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB539942.[MT7]-DALAK[MT7].2b3_1.heavy 403.255 / 444.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASGRP1;BTBD11;MYO1B;MYO1F;MYO1A;MYO1C;MYO1E;MYO5A;MYO6;MYO5C;PURA;PURB RAS guanyl releasing protein 1 (calcium and DAG-regulated);BTB (POZ) domain containing 11;myosin IB;myosin IF;myosin IA;myosin IC;myosin IE;myosin VA (heavy chain 12, myoxin);myosin VI;myosin VC;purine-rich element binding protein A;purine-rich element binding protein B 1911 244 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB539942.[MT7]-DALAK[MT7].2y4_1.heavy 403.255 / 546.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASGRP1;BTBD11;MYO1B;MYO1F;MYO1A;MYO1C;MYO1E;MYO5A;MYO6;MYO5C;PURA;PURB RAS guanyl releasing protein 1 (calcium and DAG-regulated);BTB (POZ) domain containing 11;myosin IB;myosin IF;myosin IA;myosin IC;myosin IE;myosin VA (heavy chain 12, myoxin);myosin VI;myosin VC;purine-rich element binding protein A;purine-rich element binding protein B 1913 244 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB539942.[MT7]-DALAK[MT7].2b4_1.heavy 403.255 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASGRP1;BTBD11;MYO1B;MYO1F;MYO1A;MYO1C;MYO1E;MYO5A;MYO6;MYO5C;PURA;PURB RAS guanyl releasing protein 1 (calcium and DAG-regulated);BTB (POZ) domain containing 11;myosin IB;myosin IF;myosin IA;myosin IC;myosin IE;myosin VA (heavy chain 12, myoxin);myosin VI;myosin VC;purine-rich element binding protein A;purine-rich element binding protein B 1915 244 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB539942.[MT7]-DALAK[MT7].2y3_1.heavy 403.255 / 475.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - RASGRP1;BTBD11;MYO1B;MYO1F;MYO1A;MYO1C;MYO1E;MYO5A;MYO6;MYO5C;PURA;PURB RAS guanyl releasing protein 1 (calcium and DAG-regulated);BTB (POZ) domain containing 11;myosin IB;myosin IF;myosin IA;myosin IC;myosin IE;myosin VA (heavy chain 12, myoxin);myosin VI;myosin VC;purine-rich element binding protein A;purine-rich element binding protein B 1917 245 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39184.[MT7]-LSDFIDPQEGWK[MT7].2b4_1.heavy 861.951 / 607.321 1493.0 39.44999980926514 35 10 10 5 10 0.5884953497484563 89.37795295786566 0.048000335693359375 3 0.8244877248878417 2.90162803258286 1493.0 11.692168674698795 0.0 - - - - - - - 210.69230769230768 2 13 IRAK4 interleukin-1 receptor-associated kinase 4 1919 245 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39184.[MT7]-LSDFIDPQEGWK[MT7].2b6_1.heavy 861.951 / 835.432 5557.0 39.44999980926514 35 10 10 5 10 0.5884953497484563 89.37795295786566 0.048000335693359375 3 0.8244877248878417 2.90162803258286 5557.0 7.6044946406749006 1.0 - - - - - - - 746.375 12 8 IRAK4 interleukin-1 receptor-associated kinase 4 1921 245 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39184.[MT7]-LSDFIDPQEGWK[MT7].2y3_1.heavy 861.951 / 534.316 1576.0 39.44999980926514 35 10 10 5 10 0.5884953497484563 89.37795295786566 0.048000335693359375 3 0.8244877248878417 2.90162803258286 1576.0 17.84867469879518 0.0 - - - - - - - 179.83333333333334 3 12 IRAK4 interleukin-1 receptor-associated kinase 4 1923 245 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39184.[MT7]-LSDFIDPQEGWK[MT7].2y6_1.heavy 861.951 / 888.47 4977.0 39.44999980926514 35 10 10 5 10 0.5884953497484563 89.37795295786566 0.048000335693359375 3 0.8244877248878417 2.90162803258286 4977.0 23.235993975903618 0.0 - - - - - - - 200.58333333333334 9 12 IRAK4 interleukin-1 receptor-associated kinase 4 1925 246 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542721.[MT7]-IC[CAM]DFGLAR.2b3_1.heavy 548.291 / 533.251 21319.0 33.06880187988281 43 13 10 10 10 1.252445275497982 53.229205276182206 0.0 3 0.9185088706776541 4.293513772631718 21319.0 13.253988024211438 0.0 - - - - - - - 794.0 42 3 FLT1;FLT3;FLT4;KDR;KIT;PDGFRA;PDGFRB;NLK;MAPK1;MAPK3 fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor);fms-related tyrosine kinase 3;fms-related tyrosine kinase 4;kinase insert domain receptor (a type III receptor tyrosine kinase);v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog;platelet-derived growth factor receptor, alpha polypeptide;platelet-derived growth factor receptor, beta polypeptide;nemo-like kinase;mitogen-activated protein kinase 1;mitogen-activated protein kinase 3 1927 246 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542721.[MT7]-IC[CAM]DFGLAR.2y5_1.heavy 548.291 / 563.33 15758.0 33.06880187988281 43 13 10 10 10 1.252445275497982 53.229205276182206 0.0 3 0.9185088706776541 4.293513772631718 15758.0 35.666562802464 0.0 - - - - - - - 681.0 31 7 FLT1;FLT3;FLT4;KDR;KIT;PDGFRA;PDGFRB;NLK;MAPK1;MAPK3 fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor);fms-related tyrosine kinase 3;fms-related tyrosine kinase 4;kinase insert domain receptor (a type III receptor tyrosine kinase);v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog;platelet-derived growth factor receptor, alpha polypeptide;platelet-derived growth factor receptor, beta polypeptide;nemo-like kinase;mitogen-activated protein kinase 1;mitogen-activated protein kinase 3 1929 246 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542721.[MT7]-IC[CAM]DFGLAR.2b5_1.heavy 548.291 / 737.341 3575.0 33.06880187988281 43 13 10 10 10 1.252445275497982 53.229205276182206 0.0 3 0.9185088706776541 4.293513772631718 3575.0 1.2082398804403471 3.0 - - - - - - - 264.6666666666667 25 6 FLT1;FLT3;FLT4;KDR;KIT;PDGFRA;PDGFRB;NLK;MAPK1;MAPK3 fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor);fms-related tyrosine kinase 3;fms-related tyrosine kinase 4;kinase insert domain receptor (a type III receptor tyrosine kinase);v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog;platelet-derived growth factor receptor, alpha polypeptide;platelet-derived growth factor receptor, beta polypeptide;nemo-like kinase;mitogen-activated protein kinase 1;mitogen-activated protein kinase 3 1931 246 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542721.[MT7]-IC[CAM]DFGLAR.2y7_1.heavy 548.291 / 838.388 17611.0 33.06880187988281 43 13 10 10 10 1.252445275497982 53.229205276182206 0.0 3 0.9185088706776541 4.293513772631718 17611.0 104.61139898293806 0.0 - - - - - - - 242.66666666666666 35 6 FLT1;FLT3;FLT4;KDR;KIT;PDGFRA;PDGFRB;NLK;MAPK1;MAPK3 fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor);fms-related tyrosine kinase 3;fms-related tyrosine kinase 4;kinase insert domain receptor (a type III receptor tyrosine kinase);v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog;platelet-derived growth factor receptor, alpha polypeptide;platelet-derived growth factor receptor, beta polypeptide;nemo-like kinase;mitogen-activated protein kinase 1;mitogen-activated protein kinase 3 1933 247 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22261.[MT7]-TEELQQQLNLEK[MT7].3b4_1.heavy 587.659 / 617.326 18672.0 30.3164005279541 46 16 10 10 10 2.404129340770408 36.8821099410582 0.0 3 0.9653308650766967 6.608883515301154 18672.0 93.40109154929578 0.0 - - - - - - - 675.8571428571429 37 7 WEE2 WEE1 homolog 2 (S. pombe) 1935 247 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22261.[MT7]-TEELQQQLNLEK[MT7].3b5_1.heavy 587.659 / 745.385 13684.0 30.3164005279541 46 16 10 10 10 2.404129340770408 36.8821099410582 0.0 3 0.9653308650766967 6.608883515301154 13684.0 65.92552083333334 0.0 - - - - - - - 267.6363636363636 27 11 WEE2 WEE1 homolog 2 (S. pombe) 1937 247 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22261.[MT7]-TEELQQQLNLEK[MT7].3y4_1.heavy 587.659 / 647.385 17137.0 30.3164005279541 46 16 10 10 10 2.404129340770408 36.8821099410582 0.0 3 0.9653308650766967 6.608883515301154 17137.0 77.68974471830987 0.0 - - - - - - - 213.33333333333334 34 6 WEE2 WEE1 homolog 2 (S. pombe) 1939 247 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22261.[MT7]-TEELQQQLNLEK[MT7].3b3_1.heavy 587.659 / 504.242 17777.0 30.3164005279541 46 16 10 10 10 2.404129340770408 36.8821099410582 0.0 3 0.9653308650766967 6.608883515301154 17777.0 52.81459066901409 0.0 - - - - - - - 611.0 35 9 WEE2 WEE1 homolog 2 (S. pombe) 1941 248 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22059.[MT7]-FDVINLAAEK[MT7].2y4_1.heavy 704.408 / 562.332 3779.0 36.889774322509766 44 18 10 6 10 28.615130718441538 3.4946546630854005 0.032501220703125 3 0.9829467888958452 9.437135062909336 3779.0 8.24781746031746 0.0 - - - - - - - 179.45454545454547 7 22 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1943 248 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22059.[MT7]-FDVINLAAEK[MT7].2b3_1.heavy 704.408 / 506.273 5458.0 36.889774322509766 44 18 10 6 10 28.615130718441538 3.4946546630854005 0.032501220703125 3 0.9829467888958452 9.437135062909336 5458.0 23.066547619047622 0.0 - - - - - - - 262.95652173913044 10 23 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1945 248 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22059.[MT7]-FDVINLAAEK[MT7].2y6_1.heavy 704.408 / 789.459 3527.0 36.889774322509766 44 18 10 6 10 28.615130718441538 3.4946546630854005 0.032501220703125 3 0.9829467888958452 9.437135062909336 3527.0 19.17456349206349 0.0 - - - - - - - 199.5 7 16 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1947 248 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22059.[MT7]-FDVINLAAEK[MT7].2b5_1.heavy 704.408 / 733.4 1763.0 36.889774322509766 44 18 10 6 10 28.615130718441538 3.4946546630854005 0.032501220703125 3 0.9829467888958452 9.437135062909336 1763.0 5.456904761904762 0.0 - - - - - - - 204.0 3 21 PRKAG2;PRKAG1 protein kinase, AMP-activated, gamma 2 non-catalytic subunit;protein kinase, AMP-activated, gamma 1 non-catalytic subunit 1949 249 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545142.[MT7]-QQLTEDGDSFLHLAIIHEEK[MT7].4y4_1.heavy 653.596 / 686.359 4809.0 37.467225074768066 41 14 10 7 10 2.266736803360023 35.98497693053456 0.024700164794921875 3 0.9487934870396839 5.4303634242079575 4809.0 9.503939337266967 0.0 - - - - - - - 261.35 9 20 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1951 249 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545142.[MT7]-QQLTEDGDSFLHLAIIHEEK[MT7].4y7_1.heavy 653.596 / 983.564 1741.0 37.467225074768066 41 14 10 7 10 2.266736803360023 35.98497693053456 0.024700164794921875 3 0.9487934870396839 5.4303634242079575 1741.0 20.97590361445783 0.0 - - - - - - - 193.66666666666666 3 18 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1953 249 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545142.[MT7]-QQLTEDGDSFLHLAIIHEEK[MT7].4y3_1.heavy 653.596 / 549.3 7793.0 37.467225074768066 41 14 10 7 10 2.266736803360023 35.98497693053456 0.024700164794921875 3 0.9487934870396839 5.4303634242079575 7793.0 14.120416454746861 0.0 - - - - - - - 746.0 15 9 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1955 249 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545142.[MT7]-QQLTEDGDSFLHLAIIHEEK[MT7].4b3_1.heavy 653.596 / 514.311 2819.0 37.467225074768066 41 14 10 7 10 2.266736803360023 35.98497693053456 0.024700164794921875 3 0.9487934870396839 5.4303634242079575 2819.0 6.155568087270038 0.0 - - - - - - - 700.7272727272727 5 11 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1957 250 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545047.[MT7]-LTVADALEPVQFEDGQK[MT7].3b6_1.heavy 716.719 / 715.411 23807.0 38.79690170288086 46 16 10 10 10 2.2624407449460726 37.234624638614356 0.0 3 0.9601504208840932 6.161658752130785 23807.0 50.35223319593519 0.0 - - - - - - - 811.625 47 8 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1959 250 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545047.[MT7]-LTVADALEPVQFEDGQK[MT7].3b5_1.heavy 716.719 / 644.374 16066.0 38.79690170288086 46 16 10 10 10 2.2624407449460726 37.234624638614356 0.0 3 0.9601504208840932 6.161658752130785 16066.0 4.7416858243812126 1.0 - - - - - - - 305.0 33 3 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1961 250 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545047.[MT7]-LTVADALEPVQFEDGQK[MT7].3y4_1.heavy 716.719 / 591.322 8075.0 38.79690170288086 46 16 10 10 10 2.2624407449460726 37.234624638614356 0.0 3 0.9601504208840932 6.161658752130785 8075.0 34.55518018018017 0.0 - - - - - - - 277.22222222222223 16 9 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1963 250 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545047.[MT7]-LTVADALEPVQFEDGQK[MT7].3b8_1.heavy 716.719 / 957.537 9906.0 38.79690170288086 46 16 10 10 10 2.2624407449460726 37.234624638614356 0.0 3 0.9601504208840932 6.161658752130785 9906.0 65.01072792792793 0.0 - - - - - - - 194.08333333333334 19 12 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 1965 251 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545144.[MT7]-RK[MT7]PSVPDSASPADDSFVDPGER.4b7_1.heavy 655.083 / 1068.64 627.0 25.906825065612793 30 7 10 3 10 1.36857451069532 73.0687289720118 0.07859992980957031 3 0.718060962966294 2.2672971540978897 627.0 8.078653846153847 0.0 - - - - - - - 0.0 1 0 NCK1 NCK adaptor protein 1 1967 251 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545144.[MT7]-RK[MT7]PSVPDSASPADDSFVDPGER.4b7_2.heavy 655.083 / 534.824 627.0 25.906825065612793 30 7 10 3 10 1.36857451069532 73.0687289720118 0.07859992980957031 3 0.718060962966294 2.2672971540978897 627.0 0.20015961691939346 5.0 - - - - - - - 208.66666666666666 2 6 NCK1 NCK adaptor protein 1 1969 251 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545144.[MT7]-RK[MT7]PSVPDSASPADDSFVDPGER.4y6_1.heavy 655.083 / 672.331 4908.0 25.906825065612793 30 7 10 3 10 1.36857451069532 73.0687289720118 0.07859992980957031 3 0.718060962966294 2.2672971540978897 4908.0 24.99353440237247 0.0 - - - - - - - 243.55555555555554 9 9 NCK1 NCK adaptor protein 1 1971 251 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB545144.[MT7]-RK[MT7]PSVPDSASPADDSFVDPGER.4b10_2.heavy 655.083 / 657.374 5430.0 25.906825065612793 30 7 10 3 10 1.36857451069532 73.0687289720118 0.07859992980957031 3 0.718060962966294 2.2672971540978897 5430.0 22.423375130570843 0.0 - - - - - - - 298.2857142857143 10 7 NCK1 NCK adaptor protein 1 1973 252 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542923.[MT7]-LFLQSGGK[MT7].2y4_1.heavy 569.347 / 492.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 1975 252 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542923.[MT7]-LFLQSGGK[MT7].2y5_1.heavy 569.347 / 620.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 1977 252 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542923.[MT7]-LFLQSGGK[MT7].2b4_1.heavy 569.347 / 646.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 1979 252 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542923.[MT7]-LFLQSGGK[MT7].2y7_1.heavy 569.347 / 880.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE2 WEE1 homolog 2 (S. pombe) 1981 253 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38758.[MT7]-LEELGGER.2b3_1.heavy 523.784 / 516.279 3110.0 26.4233341217041 40 18 9 5 8 4.658361808957704 21.466773964982067 0.04220008850097656 4 0.9886877351269505 11.59250603861837 3110.0 3.59884281581485 1.0 - - - - - - - 737.0 13 9 NOS3 nitric oxide synthase 3 (endothelial cell) 1983 253 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38758.[MT7]-LEELGGER.2y5_1.heavy 523.784 / 531.289 3317.0 26.4233341217041 40 18 9 5 8 4.658361808957704 21.466773964982067 0.04220008850097656 4 0.9886877351269505 11.59250603861837 3317.0 4.65101061021314 1.0 - - - - - - - 814.7142857142857 6 7 NOS3 nitric oxide synthase 3 (endothelial cell) 1985 253 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38758.[MT7]-LEELGGER.2y6_1.heavy 523.784 / 660.331 2695.0 26.4233341217041 40 18 9 5 8 4.658361808957704 21.466773964982067 0.04220008850097656 4 0.9886877351269505 11.59250603861837 2695.0 8.40830364126184 0.0 - - - - - - - 578.5833333333334 5 12 NOS3 nitric oxide synthase 3 (endothelial cell) 1987 253 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38758.[MT7]-LEELGGER.2y7_1.heavy 523.784 / 789.374 N/A 26.4233341217041 40 18 9 5 8 4.658361808957704 21.466773964982067 0.04220008850097656 4 0.9886877351269505 11.59250603861837 5391.0 -0.2894091989375087 5.0 - - - - - - - 241.66666666666666 16 6 NOS3 nitric oxide synthase 3 (endothelial cell) 1989 254 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544642.[MT7]-FLANEILQEDYR.2y9_1.heavy 827.931 / 1179.56 3163.0 39.16339874267578 50 20 10 10 10 42.00656578358526 2.380580229176378 0.0 3 0.9998650991048034 106.25517027511366 3163.0 42.846239010094436 0.0 - - - - - - - 175.55555555555554 6 9 WEE2 WEE1 homolog 2 (S. pombe) 1991 254 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544642.[MT7]-FLANEILQEDYR.2b6_1.heavy 827.931 / 832.469 3579.0 39.16339874267578 50 20 10 10 10 42.00656578358526 2.380580229176378 0.0 3 0.9998650991048034 106.25517027511366 3579.0 20.528198198198197 0.0 - - - - - - - 207.85714285714286 7 14 WEE2 WEE1 homolog 2 (S. pombe) 1993 254 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544642.[MT7]-FLANEILQEDYR.2y6_1.heavy 827.931 / 823.394 N/A 39.16339874267578 50 20 10 10 10 42.00656578358526 2.380580229176378 0.0 3 0.9998650991048034 106.25517027511366 3246.0 3.835458930225285 1.0 - - - - - - - 260.73333333333335 6 15 WEE2 WEE1 homolog 2 (S. pombe) 1995 254 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544642.[MT7]-FLANEILQEDYR.2b5_1.heavy 827.931 / 719.385 6826.0 39.16339874267578 50 20 10 10 10 42.00656578358526 2.380580229176378 0.0 3 0.9998650991048034 106.25517027511366 6826.0 26.650784830224083 0.0 - - - - - - - 277.3333333333333 13 12 WEE2 WEE1 homolog 2 (S. pombe) 1997 255 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22249.[MT7]-FPIDYPYSPPTFR.3y7_1.heavy 581.967 / 867.436 7678.0 39.58209991455078 50 20 10 10 10 33.68904466669539 2.9683240053066533 0.0 3 0.999237696384415 44.696219114741304 7678.0 28.21135219055633 1.0 - - - - - - - 239.875 15 8 UBE2R2 ubiquitin-conjugating enzyme E2R 2 1999 255 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22249.[MT7]-FPIDYPYSPPTFR.3y6_1.heavy 581.967 / 704.373 20497.0 39.58209991455078 50 20 10 10 10 33.68904466669539 2.9683240053066533 0.0 3 0.999237696384415 44.696219114741304 20497.0 59.91032300012684 1.0 - - - - - - - 288.0 40 5 UBE2R2 ubiquitin-conjugating enzyme E2R 2 2001 255 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22249.[MT7]-FPIDYPYSPPTFR.3b5_1.heavy 581.967 / 780.405 17549.0 39.58209991455078 50 20 10 10 10 33.68904466669539 2.9683240053066533 0.0 3 0.999237696384415 44.696219114741304 17549.0 11.72900308582953 1.0 - - - - - - - 308.5 37 4 UBE2R2 ubiquitin-conjugating enzyme E2R 2 2003 255 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22249.[MT7]-FPIDYPYSPPTFR.3y4_1.heavy 581.967 / 520.288 12956.0 39.58209991455078 50 20 10 10 10 33.68904466669539 2.9683240053066533 0.0 3 0.999237696384415 44.696219114741304 12956.0 29.004333252328877 0.0 - - - - - - - 288.0 25 5 UBE2R2 ubiquitin-conjugating enzyme E2R 2 2005 256 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21893.[MT7]-TLSSFFTPR.2y8_1.heavy 600.331 / 954.504 3075.0 38.88779830932617 43 15 10 10 8 1.1720482562309888 54.66094319262696 0.0 4 0.9505860564120089 5.528824909404222 3075.0 47.42168674698795 0.0 - - - - - - - 166.0 6 7 LIG1 ligase I, DNA, ATP-dependent 2007 256 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21893.[MT7]-TLSSFFTPR.2y5_1.heavy 600.331 / 667.356 831.0 38.88779830932617 43 15 10 10 8 1.1720482562309888 54.66094319262696 0.0 4 0.9505860564120089 5.528824909404222 831.0 2.3610817851039196 6.0 - - - - - - - 296.7142857142857 2 14 LIG1 ligase I, DNA, ATP-dependent 2009 256 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21893.[MT7]-TLSSFFTPR.2y6_1.heavy 600.331 / 754.388 1745.0 38.88779830932617 43 15 10 10 8 1.1720482562309888 54.66094319262696 0.0 4 0.9505860564120089 5.528824909404222 1745.0 5.420340681362726 1.0 - - - - - - - 234.0909090909091 3 11 LIG1 ligase I, DNA, ATP-dependent 2011 256 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21893.[MT7]-TLSSFFTPR.2y7_1.heavy 600.331 / 841.42 1662.0 38.88779830932617 43 15 10 10 8 1.1720482562309888 54.66094319262696 0.0 4 0.9505860564120089 5.528824909404222 1662.0 13.274435588507878 4.0 - - - - - - - 242.84615384615384 5 13 LIG1 ligase I, DNA, ATP-dependent 2013 257 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22104.[MT7]-C[CAM]SDFTEEIC[CAM]R.2y4_1.heavy 730.817 / 577.276 999.0 28.118674755096436 44 18 10 6 10 4.512857377355439 22.158909896372705 0.03769874572753906 3 0.9886024502625401 11.54897034007717 999.0 3.2925 0.0 - - - - - - - 0.0 1 0 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 2015 257 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22104.[MT7]-C[CAM]SDFTEEIC[CAM]R.2y9_1.heavy 730.817 / 1156.49 1777.0 28.118674755096436 44 18 10 6 10 4.512857377355439 22.158909896372705 0.03769874572753906 3 0.9886024502625401 11.54897034007717 1777.0 31.85792792792793 0.0 - - - - - - - 259.0 3 3 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 2017 257 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22104.[MT7]-C[CAM]SDFTEEIC[CAM]R.2b7_1.heavy 730.817 / 1013.4 1333.0 28.118674755096436 44 18 10 6 10 4.512857377355439 22.158909896372705 0.03769874572753906 3 0.9886024502625401 11.54897034007717 1333.0 8.406306306306305 0.0 - - - - - - - 148.0 2 3 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 2019 257 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22104.[MT7]-C[CAM]SDFTEEIC[CAM]R.2y7_1.heavy 730.817 / 954.435 2554.0 28.118674755096436 44 18 10 6 10 4.512857377355439 22.158909896372705 0.03769874572753906 3 0.9886024502625401 11.54897034007717 2554.0 20.132882882882882 0.0 - - - - - - - 206.14285714285714 5 7 IDH3A isocitrate dehydrogenase 3 (NAD+) alpha 2021 258 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22420.[MT7]-LQGRPSPGPPAPEQLLSQAR.3y7_1.heavy 748.417 / 815.473 2656.0 32.00870132446289 38 8 10 10 10 0.43033182577195067 110.3899168736857 0.0 3 0.7731467279439685 2.540476740665692 2656.0 5.628570803717878 0.0 - - - - - - - 265.6666666666667 5 6 NOS3 nitric oxide synthase 3 (endothelial cell) 2023 258 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22420.[MT7]-LQGRPSPGPPAPEQLLSQAR.3b11_2.heavy 748.417 / 601.842 10625.0 32.00870132446289 38 8 10 10 10 0.43033182577195067 110.3899168736857 0.0 3 0.7731467279439685 2.540476740665692 10625.0 87.2033410138249 0.0 - - - - - - - 133.0 21 5 NOS3 nitric oxide synthase 3 (endothelial cell) 2025 258 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22420.[MT7]-LQGRPSPGPPAPEQLLSQAR.3y11_1.heavy 748.417 / 1209.66 3055.0 32.00870132446289 38 8 10 10 10 0.43033182577195067 110.3899168736857 0.0 3 0.7731467279439685 2.540476740665692 3055.0 22.53636868205646 1.0 - - - - - - - 265.6666666666667 6 6 NOS3 nitric oxide synthase 3 (endothelial cell) 2027 258 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22420.[MT7]-LQGRPSPGPPAPEQLLSQAR.3y9_1.heavy 748.417 / 1041.57 9164.0 32.00870132446289 38 8 10 10 10 0.43033182577195067 110.3899168736857 0.0 3 0.7731467279439685 2.540476740665692 9164.0 70.03789309001455 0.0 - - - - - - - 221.66666666666666 18 9 NOS3 nitric oxide synthase 3 (endothelial cell) 2029 259 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21784.[MT7]-SNMATLK[MT7].2y4_1.heavy 526.804 / 576.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA lactate dehydrogenase A 2031 259 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21784.[MT7]-SNMATLK[MT7].2b4_1.heavy 526.804 / 548.262 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA lactate dehydrogenase A 2033 259 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21784.[MT7]-SNMATLK[MT7].2y3_1.heavy 526.804 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA lactate dehydrogenase A 2035 259 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21784.[MT7]-SNMATLK[MT7].2b5_1.heavy 526.804 / 649.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA lactate dehydrogenase A 2037 260 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542302.[MT7]-SLEVSDTR.2y5_1.heavy 525.781 / 577.294 6772.0 21.510974884033203 39 12 10 7 10 2.184492432585193 45.77722426882342 0.028900146484375 3 0.8956202816733649 3.7861885551606047 6772.0 23.402159827213822 0.0 - - - - - - - 685.0 13 7 IRAK4 interleukin-1 receptor-associated kinase 4 2039 260 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542302.[MT7]-SLEVSDTR.2b4_1.heavy 525.781 / 573.336 8117.0 21.510974884033203 39 12 10 7 10 2.184492432585193 45.77722426882342 0.028900146484375 3 0.8956202816733649 3.7861885551606047 8117.0 26.800078809913817 0.0 - - - - - - - 225.875 16 24 IRAK4 interleukin-1 receptor-associated kinase 4 2041 260 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542302.[MT7]-SLEVSDTR.2b6_1.heavy 525.781 / 775.395 55055.0 21.510974884033203 39 12 10 7 10 2.184492432585193 45.77722426882342 0.028900146484375 3 0.8956202816733649 3.7861885551606047 55055.0 281.79363766048505 0.0 - - - - - - - 139.1875 110 16 IRAK4 interleukin-1 receptor-associated kinase 4 2043 260 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB542302.[MT7]-SLEVSDTR.2y7_1.heavy 525.781 / 819.421 7108.0 21.510974884033203 39 12 10 7 10 2.184492432585193 45.77722426882342 0.028900146484375 3 0.8956202816733649 3.7861885551606047 7108.0 24.43556645908033 0.0 - - - - - - - 186.04761904761904 14 21 IRAK4 interleukin-1 receptor-associated kinase 4 2045 261 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541343.[MT7]-ELQEIR.2y4_1.heavy 466.27 / 545.304 21864.0 24.15880012512207 43 13 10 10 10 1.43401722150725 58.701485817363114 0.0 3 0.9011030479994212 3.891571312776196 21864.0 69.55352697095437 0.0 - - - - - - - 733.625 43 8 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 2047 261 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541343.[MT7]-ELQEIR.2b3_1.heavy 466.27 / 515.295 36413.0 24.15880012512207 43 13 10 10 10 1.43401722150725 58.701485817363114 0.0 3 0.9011030479994212 3.891571312776196 36413.0 78.53615462343862 0.0 - - - - - - - 723.4 72 10 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 2049 261 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541343.[MT7]-ELQEIR.2y5_1.heavy 466.27 / 658.388 82954.0 24.15880012512207 43 13 10 10 10 1.43401722150725 58.701485817363114 0.0 3 0.9011030479994212 3.891571312776196 82954.0 124.51119617590192 0.0 - - - - - - - 361.75 165 8 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 2051 261 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB541343.[MT7]-ELQEIR.2b4_1.heavy 466.27 / 644.337 139462.0 24.15880012512207 43 13 10 10 10 1.43401722150725 58.701485817363114 0.0 3 0.9011030479994212 3.891571312776196 139462.0 242.8442786069652 0.0 - - - - - - - 289.6 278 5 NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 2053 262 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544996.[MT7]-FDYVAQQEQELDIK[MT7].3y3_1.heavy 672.017 / 519.326 25826.0 35.19240188598633 47 17 10 10 10 2.8192795812275366 35.47005435922719 0.0 3 0.9750459508721104 7.796228859189042 25826.0 77.69334933973589 0.0 - - - - - - - 257.92857142857144 51 14 NCK1 NCK adaptor protein 1 2055 262 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544996.[MT7]-FDYVAQQEQELDIK[MT7].3b4_1.heavy 672.017 / 669.336 40914.0 35.19240188598633 47 17 10 10 10 2.8192795812275366 35.47005435922719 0.0 3 0.9750459508721104 7.796228859189042 40914.0 112.7558168168168 0.0 - - - - - - - 336.72727272727275 81 11 NCK1 NCK adaptor protein 1 2057 262 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544996.[MT7]-FDYVAQQEQELDIK[MT7].3b5_1.heavy 672.017 / 740.374 21660.0 35.19240188598633 47 17 10 10 10 2.8192795812275366 35.47005435922719 0.0 3 0.9750459508721104 7.796228859189042 21660.0 186.80749756951195 0.0 - - - - - - - 239.64705882352942 43 17 NCK1 NCK adaptor protein 1 2059 262 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB544996.[MT7]-FDYVAQQEQELDIK[MT7].3b3_1.heavy 672.017 / 570.268 35082.0 35.19240188598633 47 17 10 10 10 2.8192795812275366 35.47005435922719 0.0 3 0.9750459508721104 7.796228859189042 35082.0 79.59781512605042 0.0 - - - - - - - 249.30769230769232 70 13 NCK1 NCK adaptor protein 1 2061 263 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21789.[MT7]-RVIAANNR.2y5_1.heavy 529.321 / 545.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 2063 263 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21789.[MT7]-RVIAANNR.2y6_1.heavy 529.321 / 658.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 2065 263 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21789.[MT7]-RVIAANNR.2b5_1.heavy 529.321 / 655.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 2067 263 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21789.[MT7]-RVIAANNR.2y7_1.heavy 529.321 / 757.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 2069 264 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22321.[MT7]-DLADELALVDVIEDK[MT7].3b6_1.heavy 649.357 / 801.411 35807.0 46.12280082702637 41 15 10 6 10 3.358016671958416 23.698251469178906 0.031398773193359375 3 0.9514805388876122 5.579979141240421 35807.0 202.59767144186048 0.0 - - - - - - - 188.21052631578948 71 19 LDHA lactate dehydrogenase A 2071 264 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22321.[MT7]-DLADELALVDVIEDK[MT7].3b4_1.heavy 649.357 / 559.284 21760.0 46.12280082702637 41 15 10 6 10 3.358016671958416 23.698251469178906 0.031398773193359375 3 0.9514805388876122 5.579979141240421 21760.0 93.20806166991734 0.0 - - - - - - - 195.85714285714286 43 21 LDHA lactate dehydrogenase A 2073 264 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22321.[MT7]-DLADELALVDVIEDK[MT7].3b5_1.heavy 649.357 / 688.327 51599.0 46.12280082702637 41 15 10 6 10 3.358016671958416 23.698251469178906 0.031398773193359375 3 0.9514805388876122 5.579979141240421 51599.0 287.27900392189497 0.0 - - - - - - - 708.25 103 8 LDHA lactate dehydrogenase A 2075 264 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22321.[MT7]-DLADELALVDVIEDK[MT7].3b7_1.heavy 649.357 / 872.448 59893.0 46.12280082702637 41 15 10 6 10 3.358016671958416 23.698251469178906 0.031398773193359375 3 0.9514805388876122 5.579979141240421 59893.0 180.46363387884608 0.0 - - - - - - - 258.5 119 16 LDHA lactate dehydrogenase A 2077 265 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22323.[MT7]-TTTPVYVALGIFVQHR.3y7_1.heavy 649.371 / 856.479 5330.0 45.51124954223633 46 20 10 6 10 6.617779188944129 15.110809403714036 0.0364990234375 3 0.9913053406357976 13.225768318690642 5330.0 61.309508949222504 0.0 - - - - - - - 118.9375 10 16 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 2079 265 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22323.[MT7]-TTTPVYVALGIFVQHR.3b6_1.heavy 649.371 / 807.437 4412.0 45.51124954223633 46 20 10 6 10 6.617779188944129 15.110809403714036 0.0364990234375 3 0.9913053406357976 13.225768318690642 4412.0 41.05480798098574 0.0 - - - - - - - 164.33333333333334 8 18 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 2081 265 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22323.[MT7]-TTTPVYVALGIFVQHR.3b5_1.heavy 649.371 / 644.374 5599.0 45.51124954223633 46 20 10 6 10 6.617779188944129 15.110809403714036 0.0364990234375 3 0.9913053406357976 13.225768318690642 5599.0 28.776983240223466 1.0 - - - - - - - 183.1764705882353 11 17 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 2083 265 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22323.[MT7]-TTTPVYVALGIFVQHR.3y5_1.heavy 649.371 / 686.373 3180.0 45.51124954223633 46 20 10 6 10 6.617779188944129 15.110809403714036 0.0364990234375 3 0.9913053406357976 13.225768318690642 3180.0 10.195599140011407 0.0 - - - - - - - 202.94444444444446 6 18 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit 2085 266 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21786.[MT7]-YSPNC[CAM]K[MT7].2y4_1.heavy 528.773 / 662.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA lactate dehydrogenase A 2087 266 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21786.[MT7]-YSPNC[CAM]K[MT7].2y5_1.heavy 528.773 / 749.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA lactate dehydrogenase A 2089 266 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21786.[MT7]-YSPNC[CAM]K[MT7].2b4_1.heavy 528.773 / 606.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA lactate dehydrogenase A 2091 266 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21786.[MT7]-YSPNC[CAM]K[MT7].2y3_1.heavy 528.773 / 565.288 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDHA lactate dehydrogenase A 2093 267 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21681.[MT7]-LLLLEQELK[MT7].3y3_1.heavy 462.965 / 533.341 34482.0 41.739498138427734 50 20 10 10 10 7.324588199739076 13.652644663840938 0.0 3 0.9930338192492566 14.77789454931401 34482.0 380.15611016721806 0.0 - - - - - - - 234.0 68 20 SMAD6 SMAD family member 6 2095 267 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21681.[MT7]-LLLLEQELK[MT7].3b4_1.heavy 462.965 / 597.446 33321.0 41.739498138427734 50 20 10 10 10 7.324588199739076 13.652644663840938 0.0 3 0.9930338192492566 14.77789454931401 33321.0 950.9471596638655 0.0 - - - - - - - 182.9 66 20 SMAD6 SMAD family member 6 2097 267 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21681.[MT7]-LLLLEQELK[MT7].3b5_1.heavy 462.965 / 726.488 15165.0 41.739498138427734 50 20 10 10 10 7.324588199739076 13.652644663840938 0.0 3 0.9930338192492566 14.77789454931401 15165.0 168.39522941680963 0.0 - - - - - - - 142.8235294117647 30 17 SMAD6 SMAD family member 6 2099 267 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21681.[MT7]-LLLLEQELK[MT7].3b3_1.heavy 462.965 / 484.362 81068.0 41.739498138427734 50 20 10 10 10 7.324588199739076 13.652644663840938 0.0 3 0.9930338192492566 14.77789454931401 81068.0 604.9719100580271 0.0 - - - - - - - 653.5714285714286 162 7 SMAD6 SMAD family member 6 2101 268 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21680.[MT7]-LYLVK[MT7].2b3_1.heavy 462.312 / 534.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCK1 NCK adaptor protein 1 2103 268 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21680.[MT7]-LYLVK[MT7].2y4_1.heavy 462.312 / 666.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCK1 NCK adaptor protein 1 2105 268 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21680.[MT7]-LYLVK[MT7].2b4_1.heavy 462.312 / 633.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCK1 NCK adaptor protein 1 2107 268 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21680.[MT7]-LYLVK[MT7].2y3_1.heavy 462.312 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - NCK1 NCK adaptor protein 1 2109 269 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22107.[MT7]-TVYEGFISAQGR.2y8_1.heavy 736.387 / 835.442 12502.0 32.91469955444336 50 20 10 10 10 5.77311538462604 17.321670075450537 0.0 3 0.9905315460677347 12.673003748638152 12502.0 72.15301550387598 0.0 - - - - - - - 215.0 25 9 FANCL Fanconi anemia, complementation group L 2111 269 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22107.[MT7]-TVYEGFISAQGR.2y9_1.heavy 736.387 / 964.485 7604.0 32.91469955444336 50 20 10 10 10 5.77311538462604 17.321670075450537 0.0 3 0.9905315460677347 12.673003748638152 7604.0 32.0271834625323 0.0 - - - - - - - 241.875 15 8 FANCL Fanconi anemia, complementation group L 2113 269 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22107.[MT7]-TVYEGFISAQGR.2y10_1.heavy 736.387 / 1127.55 7862.0 32.91469955444336 50 20 10 10 10 5.77311538462604 17.321670075450537 0.0 3 0.9905315460677347 12.673003748638152 7862.0 16.0187462573272 0.0 - - - - - - - 172.0 15 9 FANCL Fanconi anemia, complementation group L 2115 269 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22107.[MT7]-TVYEGFISAQGR.2y11_1.heavy 736.387 / 1226.62 4769.0 32.91469955444336 50 20 10 10 10 5.77311538462604 17.321670075450537 0.0 3 0.9905315460677347 12.673003748638152 4769.0 68.39263565891473 0.0 - - - - - - - 129.0 9 7 FANCL Fanconi anemia, complementation group L 2117 270 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22051.[MT7]-VLGPC[CAM]SDILK[MT7].2y8_1.heavy 695.404 / 1033.55 1266.0 33.241451263427734 17 10 0 3 4 2.8845055966293147 29.705823713401752 0.0522003173828125 10 0.8472415293242326 3.1165170868392873 1266.0 14.972456506177835 0.0 - - - - - - - 253.0 2 2 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 2119 270 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22051.[MT7]-VLGPC[CAM]SDILK[MT7].2y9_1.heavy 695.404 / 1146.63 3039.0 33.241451263427734 17 10 0 3 4 2.8845055966293147 29.705823713401752 0.0522003173828125 10 0.8472415293242326 3.1165170868392873 3039.0 11.196315789473685 1.0 - - - - - - - 235.28571428571428 36 7 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 2121 270 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22051.[MT7]-VLGPC[CAM]SDILK[MT7].2b7_1.heavy 695.404 / 873.426 2533.0 33.241451263427734 17 10 0 3 4 2.8845055966293147 29.705823713401752 0.0522003173828125 10 0.8472415293242326 3.1165170868392873 2533.0 17.458655981611763 1.0 - - - - - - - 199.0 14 7 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 2123 270 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22051.[MT7]-VLGPC[CAM]SDILK[MT7].2y7_1.heavy 695.404 / 976.525 2279.0 33.241451263427734 17 10 0 3 4 2.8845055966293147 29.705823713401752 0.0522003173828125 10 0.8472415293242326 3.1165170868392873 2279.0 21.569322461174565 0.0 - - - - - - - 190.0 4 4 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) 2125 271 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22320.[MT7]-DLADELALVDVIEDK[MT7].2y9_1.heavy 973.532 / 1145.65 1289.0 46.12280082702637 43 17 10 6 10 2.8057203525616603 27.960761273870084 0.031398773193359375 3 0.9728537327302756 7.473429239409718 1289.0 14.242229237493929 0.0 - - - - - - - 92.45454545454545 2 22 LDHA lactate dehydrogenase A 2127 271 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22320.[MT7]-DLADELALVDVIEDK[MT7].2b4_1.heavy 973.532 / 559.284 3278.0 46.12280082702637 43 17 10 6 10 2.8057203525616603 27.960761273870084 0.031398773193359375 3 0.9728537327302756 7.473429239409718 3278.0 47.33233333333333 0.0 - - - - - - - 106.0 6 26 LDHA lactate dehydrogenase A 2129 271 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22320.[MT7]-DLADELALVDVIEDK[MT7].2b6_1.heavy 973.532 / 801.411 2120.0 46.12280082702637 43 17 10 6 10 2.8057203525616603 27.960761273870084 0.031398773193359375 3 0.9728537327302756 7.473429239409718 2120.0 28.720142602495542 0.0 - - - - - - - 155.42857142857142 4 28 LDHA lactate dehydrogenase A 2131 271 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22320.[MT7]-DLADELALVDVIEDK[MT7].2b5_1.heavy 973.532 / 688.327 1945.0 46.12280082702637 43 17 10 6 10 2.8057203525616603 27.960761273870084 0.031398773193359375 3 0.9728537327302756 7.473429239409718 1945.0 21.668542848611523 0.0 - - - - - - - 125.55555555555556 3 27 LDHA lactate dehydrogenase A 2133 272 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21896.[MT7]-MLLEVALK[MT7].2y4_1.heavy 602.883 / 574.404 1642.0 40.37460136413574 25 5 10 6 4 0.34317308682675124 124.38116147615239 0.039600372314453125 8 0.6398231545684739 1.9911843833932776 1642.0 4.606966980904036 2.0 - - - - - - - 730.5 3 8 FANCL Fanconi anemia, complementation group L 2135 272 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21896.[MT7]-MLLEVALK[MT7].2y5_1.heavy 602.883 / 703.447 2758.0 40.37460136413574 25 5 10 6 4 0.34317308682675124 124.38116147615239 0.039600372314453125 8 0.6398231545684739 1.9911843833932776 2758.0 8.482991304347825 0.0 - - - - - - - 270.47058823529414 5 17 FANCL Fanconi anemia, complementation group L 2137 272 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21896.[MT7]-MLLEVALK[MT7].2b4_1.heavy 602.883 / 631.36 525.0 40.37460136413574 25 5 10 6 4 0.34317308682675124 124.38116147615239 0.039600372314453125 8 0.6398231545684739 1.9911843833932776 525.0 2.129953098762811 15.0 - - - - - - - 259.05555555555554 2 18 FANCL Fanconi anemia, complementation group L 2139 272 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB21896.[MT7]-MLLEVALK[MT7].2y6_1.heavy 602.883 / 816.531 263.0 40.37460136413574 25 5 10 6 4 0.34317308682675124 124.38116147615239 0.039600372314453125 8 0.6398231545684739 1.9911843833932776 263.0 -0.33963414634146344 23.0 - - - - - - - 0.0 1 0 FANCL Fanconi anemia, complementation group L 2141 273 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22520.[MT7]-NRQELYALPPPPQFYSSLIEEIGTLGWDK[MT7].4y4_1.heavy 913.234 / 649.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - FANCL Fanconi anemia, complementation group L 2143 273 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22520.[MT7]-NRQELYALPPPPQFYSSLIEEIGTLGWDK[MT7].4b8_1.heavy 913.234 / 1132.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - FANCL Fanconi anemia, complementation group L 2145 273 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22520.[MT7]-NRQELYALPPPPQFYSSLIEEIGTLGWDK[MT7].4b8_2.heavy 913.234 / 566.815 N/A N/A - - - - - - - - - 0.0 - - - - - - - FANCL Fanconi anemia, complementation group L 2147 273 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22520.[MT7]-NRQELYALPPPPQFYSSLIEEIGTLGWDK[MT7].4b7_2.heavy 913.234 / 510.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - FANCL Fanconi anemia, complementation group L 2149 274 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39197.[MT7]-FPIDYPYSPPTFR.2y8_1.heavy 872.447 / 964.489 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2R2 ubiquitin-conjugating enzyme E2R 2 2151 274 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39197.[MT7]-FPIDYPYSPPTFR.2y6_1.heavy 872.447 / 704.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2R2 ubiquitin-conjugating enzyme E2R 2 2153 274 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB39197.[MT7]-FPIDYPYSPPTFR.2y10_1.heavy 872.447 / 1242.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2R2 ubiquitin-conjugating enzyme E2R 2 2155 275 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22045.[MT7]-TLHPDLGTDK[MT7].3y3_1.heavy 462.261 / 507.289 19318.0 23.209199905395508 48 18 10 10 10 2.841053292295718 27.634857926024186 0.0 3 0.9848754585479947 10.022414544451571 19318.0 68.69642763220912 0.0 - - - - - - - 649.1428571428571 38 7 LDHA lactate dehydrogenase A 2157 275 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22045.[MT7]-TLHPDLGTDK[MT7].3b3_1.heavy 462.261 / 496.3 40454.0 23.209199905395508 48 18 10 10 10 2.841053292295718 27.634857926024186 0.0 3 0.9848754585479947 10.022414544451571 40454.0 107.83530180422906 0.0 - - - - - - - 589.1111111111111 80 9 LDHA lactate dehydrogenase A 2159 275 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22045.[MT7]-TLHPDLGTDK[MT7].3y4_1.heavy 462.261 / 564.311 70529.0 23.209199905395508 48 18 10 10 10 2.841053292295718 27.634857926024186 0.0 3 0.9848754585479947 10.022414544451571 70529.0 198.8875285807501 0.0 - - - - - - - 313.2 141 15 LDHA lactate dehydrogenase A 2161 275 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB22045.[MT7]-TLHPDLGTDK[MT7].3y5_1.heavy 462.261 / 677.395 30530.0 23.209199905395508 48 18 10 10 10 2.841053292295718 27.634857926024186 0.0 3 0.9848754585479947 10.022414544451571 30530.0 104.71857541798136 0.0 - - - - - - - 649.2857142857143 61 7 LDHA lactate dehydrogenase A 2163 276 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38841.[MT7]-SEVRPVAPR.2b3_1.heavy 577.842 / 460.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 2165 276 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38841.[MT7]-SEVRPVAPR.2y5_1.heavy 577.842 / 539.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 2167 276 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38841.[MT7]-SEVRPVAPR.2b6_1.heavy 577.842 / 812.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6 2169 276 B20140227_KEGG1700_set06_03 B20140227_KEGG1700_set06_03 TB38841.[MT7]-SEVRPVAPR.2b7_1.heavy 577.842 / 883.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD6 SMAD family member 6