Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39162.[MT7]-ALTNLIDQQQQK[MT7].2b8_1.heavy 844.483 / 1013.57 638.0 31.816099166870117 42 12 10 10 10 1.4837100283876858 53.57035787538087 0.0 3 0.883748617449428 3.5839618080816145 638.0 3.2890625 2.0 - - - - - - - 0.0 1 0 BHLHE40 basic helix-loop-helix family, member e40 3 1 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39162.[MT7]-ALTNLIDQQQQK[MT7].2b4_1.heavy 844.483 / 544.321 3062.0 31.816099166870117 42 12 10 10 10 1.4837100283876858 53.57035787538087 0.0 3 0.883748617449428 3.5839618080816145 3062.0 14.001834843598012 0.0 - - - - - - - 198.66666666666666 6 9 BHLHE40 basic helix-loop-helix family, member e40 5 1 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39162.[MT7]-ALTNLIDQQQQK[MT7].2y6_1.heavy 844.483 / 918.476 2424.0 31.816099166870117 42 12 10 10 10 1.4837100283876858 53.57035787538087 0.0 3 0.883748617449428 3.5839618080816145 2424.0 34.845 0.0 - - - - - - - 128.0 4 6 BHLHE40 basic helix-loop-helix family, member e40 7 1 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39162.[MT7]-ALTNLIDQQQQK[MT7].2b5_1.heavy 844.483 / 657.405 4338.0 31.816099166870117 42 12 10 10 10 1.4837100283876858 53.57035787538087 0.0 3 0.883748617449428 3.5839618080816145 4338.0 63.714375 0.0 - - - - - - - 204.4 8 5 BHLHE40 basic helix-loop-helix family, member e40 9 2 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39097.[MT7]-DTSFTVC[CAM]PDVPR.2y8_1.heavy 769.375 / 943.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 11 2 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39097.[MT7]-DTSFTVC[CAM]PDVPR.2b4_1.heavy 769.375 / 595.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 13 2 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39097.[MT7]-DTSFTVC[CAM]PDVPR.2b5_1.heavy 769.375 / 696.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 15 2 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39097.[MT7]-DTSFTVC[CAM]PDVPR.2y7_1.heavy 769.375 / 842.419 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 17 3 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540950.[MT7]-DVFTK[MT7].2b3_1.heavy 449.268 / 506.273 5740.0 24.949199676513672 50 20 10 10 10 10.462234041405818 9.558188012640073 0.0 3 0.995066408821741 17.56313647291491 5740.0 12.25060934298925 0.0 - - - - - - - 702.875 11 8 VDAC1;CACNA1I voltage-dependent anion channel 1;calcium channel, voltage-dependent, T type, alpha 1I subunit 19 3 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540950.[MT7]-DVFTK[MT7].2y4_1.heavy 449.268 / 638.399 19798.0 24.949199676513672 50 20 10 10 10 10.462234041405818 9.558188012640073 0.0 3 0.995066408821741 17.56313647291491 19798.0 98.10928035938275 0.0 - - - - - - - 211.0 39 15 VDAC1;CACNA1I voltage-dependent anion channel 1;calcium channel, voltage-dependent, T type, alpha 1I subunit 21 3 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540950.[MT7]-DVFTK[MT7].2y3_1.heavy 449.268 / 539.331 23254.0 24.949199676513672 50 20 10 10 10 10.462234041405818 9.558188012640073 0.0 3 0.995066408821741 17.56313647291491 23254.0 46.794611890569286 0.0 - - - - - - - 695.375 46 8 VDAC1;CACNA1I voltage-dependent anion channel 1;calcium channel, voltage-dependent, T type, alpha 1I subunit 23 4 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22083.[MT7]-AYYIYSGGEK[MT7].2b3_1.heavy 719.876 / 542.273 3495.0 28.61549949645996 50 20 10 10 10 14.383530889359301 6.952395817773669 0.0 3 0.9952098088228299 17.824297870271238 3495.0 24.19970422229458 0.0 - - - - - - - 166.16666666666666 6 12 SOCS3 suppressor of cytokine signaling 3 25 4 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22083.[MT7]-AYYIYSGGEK[MT7].2y5_1.heavy 719.876 / 621.332 2996.0 28.61549949645996 50 20 10 10 10 14.383530889359301 6.952395817773669 0.0 3 0.9952098088228299 17.824297870271238 2996.0 17.626850769230767 1.0 - - - - - - - 171.5 5 16 SOCS3 suppressor of cytokine signaling 3 27 4 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22083.[MT7]-AYYIYSGGEK[MT7].2y6_1.heavy 719.876 / 784.396 3578.0 28.61549949645996 50 20 10 10 10 14.383530889359301 6.952395817773669 0.0 3 0.9952098088228299 17.824297870271238 3578.0 27.558328448930858 0.0 - - - - - - - 205.06666666666666 7 15 SOCS3 suppressor of cytokine signaling 3 29 4 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22083.[MT7]-AYYIYSGGEK[MT7].2y7_1.heavy 719.876 / 897.48 1165.0 28.61549949645996 50 20 10 10 10 14.383530889359301 6.952395817773669 0.0 3 0.9952098088228299 17.824297870271238 1165.0 11.689301204819278 0.0 - - - - - - - 191.2 2 10 SOCS3 suppressor of cytokine signaling 3 31 5 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21983.[MT7]-RSVLNNPSK[MT7].3b6_1.heavy 434.929 / 828.481 2092.0 18.640399932861328 44 14 10 10 10 3.5245912013223726 28.372084672537778 0.0 3 0.9485832327985673 5.41915231118997 2092.0 18.72647263161445 0.0 - - - - - - - 119.73333333333333 4 15 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 33 5 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21983.[MT7]-RSVLNNPSK[MT7].3y3_1.heavy 434.929 / 475.3 22816.0 18.640399932861328 44 14 10 10 10 3.5245912013223726 28.372084672537778 0.0 3 0.9485832327985673 5.41915231118997 22816.0 58.00533539233665 0.0 - - - - - - - 718.8571428571429 45 7 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 35 5 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21983.[MT7]-RSVLNNPSK[MT7].3b4_1.heavy 434.929 / 600.395 4334.0 18.640399932861328 44 14 10 10 10 3.5245912013223726 28.372084672537778 0.0 3 0.9485832327985673 5.41915231118997 4334.0 20.88674698795181 0.0 - - - - - - - 212.46666666666667 8 15 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 37 5 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21983.[MT7]-RSVLNNPSK[MT7].3b5_1.heavy 434.929 / 714.438 9266.0 18.640399932861328 44 14 10 10 10 3.5245912013223726 28.372084672537778 0.0 3 0.9485832327985673 5.41915231118997 9266.0 146.16648590604026 0.0 - - - - - - - 181.42857142857142 18 14 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 39 6 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21885.[MT7]-ARLAEQAER.2b8_1.heavy 594.334 / 1013.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAG;YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 41 6 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21885.[MT7]-ARLAEQAER.2y6_1.heavy 594.334 / 703.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAG;YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 43 6 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21885.[MT7]-ARLAEQAER.2b5_1.heavy 594.334 / 685.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAG;YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 45 6 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21885.[MT7]-ARLAEQAER.2y7_1.heavy 594.334 / 816.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - YWHAG;YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 47 7 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21980.[MT7]-LTTLGHLEK[MT7].3y3_1.heavy 433.934 / 533.341 86309.0 28.803699493408203 50 20 10 10 10 6.001518481317312 16.662449730230666 0.0 3 0.9927874367143107 14.522994541118711 86309.0 189.84954414342297 0.0 - - - - - - - 655.8888888888889 172 9 BHLHE41;BHLHE40 basic helix-loop-helix family, member e41;basic helix-loop-helix family, member e40 49 7 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21980.[MT7]-LTTLGHLEK[MT7].3b5_1.heavy 433.934 / 630.394 61417.0 28.803699493408203 50 20 10 10 10 6.001518481317312 16.662449730230666 0.0 3 0.9927874367143107 14.522994541118711 61417.0 248.7208918128655 0.0 - - - - - - - 250.71428571428572 122 14 BHLHE41;BHLHE40 basic helix-loop-helix family, member e41;basic helix-loop-helix family, member e40 51 7 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21980.[MT7]-LTTLGHLEK[MT7].3b3_1.heavy 433.934 / 460.289 18904.0 28.803699493408203 50 20 10 10 10 6.001518481317312 16.662449730230666 0.0 3 0.9927874367143107 14.522994541118711 18904.0 50.81670437776684 0.0 - - - - - - - 780.375 37 8 BHLHE41;BHLHE40 basic helix-loop-helix family, member e41;basic helix-loop-helix family, member e40 53 7 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21980.[MT7]-LTTLGHLEK[MT7].3y5_1.heavy 433.934 / 727.422 8554.0 28.803699493408203 50 20 10 10 10 6.001518481317312 16.662449730230666 0.0 3 0.9927874367143107 14.522994541118711 8554.0 41.68615984405458 0.0 - - - - - - - 186.47058823529412 17 17 BHLHE41;BHLHE40 basic helix-loop-helix family, member e41;basic helix-loop-helix family, member e40 55 8 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22485.[MT7]-NPNLGEDQAEEISDELMEFSLK[MT7].4y4_1.heavy 699.843 / 638.399 889.0 46.620399475097656 39 16 10 3 10 7.694357708052427 12.996536396448835 0.05059814453125 3 0.96180504530959 6.2945873684513876 889.0 8.540000000000001 0.0 - - - - - - - 0.0 1 0 CDC25C cell division cycle 25 homolog C (S. pombe) 57 8 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22485.[MT7]-NPNLGEDQAEEISDELMEFSLK[MT7].4y5_1.heavy 699.843 / 767.442 559.0 46.620399475097656 39 16 10 3 10 7.694357708052427 12.996536396448835 0.05059814453125 3 0.96180504530959 6.2945873684513876 559.0 1.528679713790963 1.0 - - - - - - - 0.0 1 0 CDC25C cell division cycle 25 homolog C (S. pombe) 59 8 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22485.[MT7]-NPNLGEDQAEEISDELMEFSLK[MT7].4b7_1.heavy 699.843 / 884.423 305.0 46.620399475097656 39 16 10 3 10 7.694357708052427 12.996536396448835 0.05059814453125 3 0.96180504530959 6.2945873684513876 305.0 0.9914860681114552 0.0 - - - - - - - 0.0 0 0 CDC25C cell division cycle 25 homolog C (S. pombe) 61 8 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22485.[MT7]-NPNLGEDQAEEISDELMEFSLK[MT7].4b4_1.heavy 699.843 / 583.332 1193.0 46.620399475097656 39 16 10 3 10 7.694357708052427 12.996536396448835 0.05059814453125 3 0.96180504530959 6.2945873684513876 1193.0 10.429058900388542 0.0 - - - - - - - 113.0909090909091 2 33 CDC25C cell division cycle 25 homolog C (S. pombe) 63 9 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21884.[MT7]-IRANEPGAGR.2y8_1.heavy 592.834 / 771.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBE inhibin, beta E 65 9 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21884.[MT7]-IRANEPGAGR.2b4_1.heavy 592.834 / 599.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBE inhibin, beta E 67 9 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21884.[MT7]-IRANEPGAGR.2b5_1.heavy 592.834 / 728.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBE inhibin, beta E 69 9 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21884.[MT7]-IRANEPGAGR.2y7_1.heavy 592.834 / 700.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBE inhibin, beta E 71 10 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544680.[MT7]-FPIDYPYSPPAFR.3y6_1.heavy 571.963 / 674.362 102859.0 40.1088981628418 50 20 10 10 10 5.434151182000015 18.40213800661973 0.0 3 0.9906970007866727 12.785379256543221 102859.0 263.57050833665426 0.0 - - - - - - - 409.0 205 1 CDC34 cell division cycle 34 homolog (S. cerevisiae) 73 10 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544680.[MT7]-FPIDYPYSPPAFR.3b4_1.heavy 571.963 / 617.341 157404.0 40.1088981628418 50 20 10 10 10 5.434151182000015 18.40213800661973 0.0 3 0.9906970007866727 12.785379256543221 157404.0 293.5218076997214 0.0 - - - - - - - 1226.0 314 1 CDC34 cell division cycle 34 homolog (S. cerevisiae) 75 10 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544680.[MT7]-FPIDYPYSPPAFR.3b5_1.heavy 571.963 / 780.405 97956.0 40.1088981628418 50 20 10 10 10 5.434151182000015 18.40213800661973 0.0 3 0.9906970007866727 12.785379256543221 97956.0 360.76957792401436 0.0 - - - - - - - 460.0 195 1 CDC34 cell division cycle 34 homolog (S. cerevisiae) 77 10 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544680.[MT7]-FPIDYPYSPPAFR.3y5_1.heavy 571.963 / 587.33 114861.0 40.1088981628418 50 20 10 10 10 5.434151182000015 18.40213800661973 0.0 3 0.9906970007866727 12.785379256543221 114861.0 198.4925115207373 0.0 - - - - - - - 766.0 229 2 CDC34 cell division cycle 34 homolog (S. cerevisiae) 79 11 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540465.[MT7]-ALFTDR.2b3_1.heavy 433.746 / 476.299 3362.0 28.02477502822876 39 15 10 6 8 2.2634894687549285 34.718368993776885 0.03190040588378906 4 0.9556179873392875 5.836324127315467 3362.0 3.978698224852071 1.0 - - - - - - - 784.0909090909091 6 11 WEE1 WEE1 homolog (S. pombe) 81 11 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540465.[MT7]-ALFTDR.2y4_1.heavy 433.746 / 538.262 6470.0 28.02477502822876 39 15 10 6 8 2.2634894687549285 34.718368993776885 0.03190040588378906 4 0.9556179873392875 5.836324127315467 6470.0 17.588901630802642 1.0 - - - - - - - 238.7058823529412 13 17 WEE1 WEE1 homolog (S. pombe) 83 11 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540465.[MT7]-ALFTDR.2y5_1.heavy 433.746 / 651.346 14715.0 28.02477502822876 39 15 10 6 8 2.2634894687549285 34.718368993776885 0.03190040588378906 4 0.9556179873392875 5.836324127315467 14715.0 80.40330485108919 0.0 - - - - - - - 213.47368421052633 29 19 WEE1 WEE1 homolog (S. pombe) 85 11 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540465.[MT7]-ALFTDR.2b5_1.heavy 433.746 / 692.374 10466.0 28.02477502822876 39 15 10 6 8 2.2634894687549285 34.718368993776885 0.03190040588378906 4 0.9556179873392875 5.836324127315467 10466.0 52.825236593059934 0.0 - - - - - - - 176.5 20 14 WEE1 WEE1 homolog (S. pombe) 87 12 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39278.[MT7]-WK[MT7]QPLTVIVTPVSK[MT7].3b6_2.heavy 676.758 / 521.818 2324.0 35.69460105895996 38 15 10 3 10 49.01780071480635 2.0400752082252014 0.06439971923828125 3 0.9596741724639746 6.124919341921717 2324.0 11.273134328358207 0.0 - - - - - - - 191.42857142857142 4 14 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 89 12 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39278.[MT7]-WK[MT7]QPLTVIVTPVSK[MT7].3b3_1.heavy 676.758 / 731.444 894.0 35.69460105895996 38 15 10 3 10 49.01780071480635 2.0400752082252014 0.06439971923828125 3 0.9596741724639746 6.124919341921717 894.0 4.0454748603351955 3.0 - - - - - - - 0.0 1 0 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 91 12 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39278.[MT7]-WK[MT7]QPLTVIVTPVSK[MT7].3y4_1.heavy 676.758 / 574.368 4290.0 35.69460105895996 38 15 10 3 10 49.01780071480635 2.0400752082252014 0.06439971923828125 3 0.9596741724639746 6.124919341921717 4290.0 4.850203186089863 1.0 - - - - - - - 278.1111111111111 8 9 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 93 12 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39278.[MT7]-WK[MT7]QPLTVIVTPVSK[MT7].3y5_1.heavy 676.758 / 675.416 2413.0 35.69460105895996 38 15 10 3 10 49.01780071480635 2.0400752082252014 0.06439971923828125 3 0.9596741724639746 6.124919341921717 2413.0 5.394332196976457 0.0 - - - - - - - 172.8 4 15 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 95 13 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22360.[MT7]-ELETVC[CAM]NDVLSLLDK[MT7].2b8_1.heavy 1018.54 / 1105.5 372.0 50.03310012817383 42 12 10 10 10 1.5707217589436016 53.049492392113116 0.0 3 0.8991296301269329 3.852658289074966 372.0 -0.2807547169811322 0.0 - - - - - - - 0.0 0 0 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 97 13 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22360.[MT7]-ELETVC[CAM]NDVLSLLDK[MT7].2b3_1.heavy 1018.54 / 516.279 1700.0 50.03310012817383 42 12 10 10 10 1.5707217589436016 53.049492392113116 0.0 3 0.8991296301269329 3.852658289074966 1700.0 62.459259259259255 0.0 - - - - - - - 82.08333333333333 3 12 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 99 13 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22360.[MT7]-ELETVC[CAM]NDVLSLLDK[MT7].2b4_1.heavy 1018.54 / 617.326 638.0 50.03310012817383 42 12 10 10 10 1.5707217589436016 53.049492392113116 0.0 3 0.8991296301269329 3.852658289074966 638.0 16.6722641509434 0.0 - - - - - - - 0.0 1 0 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 101 13 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22360.[MT7]-ELETVC[CAM]NDVLSLLDK[MT7].2y3_1.heavy 1018.54 / 519.326 213.0 50.03310012817383 42 12 10 10 10 1.5707217589436016 53.049492392113116 0.0 3 0.8991296301269329 3.852658289074966 213.0 1.0650000000000002 3.0 - - - - - - - 0.0 0 0 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 103 14 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22066.[MT7]-RLFDASSFGK[MT7].3y3_1.heavy 472.601 / 495.305 57268.0 31.324499130249023 41 11 10 10 10 0.644617876311703 81.76667394751928 0.0 3 0.8595771455375271 3.2540577528588615 57268.0 119.82005814123912 0.0 - - - - - - - 255.6 114 5 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 105 14 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22066.[MT7]-RLFDASSFGK[MT7].3b4_1.heavy 472.601 / 676.39 16874.0 31.324499130249023 41 11 10 10 10 0.644617876311703 81.76667394751928 0.0 3 0.8595771455375271 3.2540577528588615 16874.0 46.67504758696201 0.0 - - - - - - - 255.625 33 8 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 107 14 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22066.[MT7]-RLFDASSFGK[MT7].3b5_1.heavy 472.601 / 747.427 14828.0 31.324499130249023 41 11 10 10 10 0.644617876311703 81.76667394751928 0.0 3 0.8595771455375271 3.2540577528588615 14828.0 72.42499898142111 0.0 - - - - - - - 230.2 29 10 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 109 14 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22066.[MT7]-RLFDASSFGK[MT7].3y4_1.heavy 472.601 / 582.337 38349.0 31.324499130249023 41 11 10 10 10 0.644617876311703 81.76667394751928 0.0 3 0.8595771455375271 3.2540577528588615 38349.0 65.75120142802498 0.0 - - - - - - - 292.14285714285717 76 7 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 111 15 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21970.[MT7]-IPQVLSQEFTELLK[MT7].3y3_1.heavy 645.046 / 517.383 4900.0 48.847676277160645 43 17 10 6 10 3.1575986797912496 31.66963573933691 0.039699554443359375 3 0.9729652745195075 7.488900881592975 4900.0 26.795756017242336 0.0 - - - - - - - 87.0 9 15 WEE1 WEE1 homolog (S. pombe) 113 15 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21970.[MT7]-IPQVLSQEFTELLK[MT7].3b4_1.heavy 645.046 / 582.373 7431.0 48.847676277160645 43 17 10 6 10 3.1575986797912496 31.66963573933691 0.039699554443359375 3 0.9729652745195075 7.488900881592975 7431.0 45.042687045019576 0.0 - - - - - - - 60.64705882352941 14 17 WEE1 WEE1 homolog (S. pombe) 115 15 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21970.[MT7]-IPQVLSQEFTELLK[MT7].3b5_1.heavy 645.046 / 695.457 3158.0 48.847676277160645 43 17 10 6 10 3.1575986797912496 31.66963573933691 0.039699554443359375 3 0.9729652745195075 7.488900881592975 3158.0 70.48896364254162 0.0 - - - - - - - 45.166666666666664 6 6 WEE1 WEE1 homolog (S. pombe) 117 15 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21970.[MT7]-IPQVLSQEFTELLK[MT7].3y5_1.heavy 645.046 / 747.473 4845.0 48.847676277160645 43 17 10 6 10 3.1575986797912496 31.66963573933691 0.039699554443359375 3 0.9729652745195075 7.488900881592975 4845.0 44.60779096018061 0.0 - - - - - - - 67.9 9 10 WEE1 WEE1 homolog (S. pombe) 119 16 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22072.[MT7]-SEYQLVVNAVR.2y8_1.heavy 711.397 / 898.547 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 121 16 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22072.[MT7]-SEYQLVVNAVR.2y9_1.heavy 711.397 / 1061.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 123 16 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22072.[MT7]-SEYQLVVNAVR.2b4_1.heavy 711.397 / 652.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 125 16 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22072.[MT7]-SEYQLVVNAVR.2y7_1.heavy 711.397 / 770.488 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 127 17 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39377.[MT7]-WFLANLASGGAAGATSLC[CAM]VVYPLDFAR.3b6_1.heavy 991.18 / 889.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 129 17 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39377.[MT7]-WFLANLASGGAAGATSLC[CAM]VVYPLDFAR.3b4_1.heavy 991.18 / 662.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 131 17 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39377.[MT7]-WFLANLASGGAAGATSLC[CAM]VVYPLDFAR.3b5_1.heavy 991.18 / 776.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 133 17 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39377.[MT7]-WFLANLASGGAAGATSLC[CAM]VVYPLDFAR.3y10_1.heavy 991.18 / 1239.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 135 18 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39370.[MT7]-NPNLGEDQAEEISDELMEFSLK[MT7].3b4_1.heavy 932.788 / 583.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 137 18 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39370.[MT7]-NPNLGEDQAEEISDELMEFSLK[MT7].3y4_1.heavy 932.788 / 638.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 139 18 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39370.[MT7]-NPNLGEDQAEEISDELMEFSLK[MT7].3b8_1.heavy 932.788 / 1012.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 141 18 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39370.[MT7]-NPNLGEDQAEEISDELMEFSLK[MT7].3b7_1.heavy 932.788 / 884.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 143 19 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39268.[MT7]-IETSINLAWTAGSNNTR.2b7_1.heavy 996.517 / 915.527 1478.0 36.95642375946045 43 17 10 6 10 13.575569065824284 7.366173713612069 0.032100677490234375 3 0.9760163278453307 7.953031273570359 1478.0 5.998654749557684 0.0 - - - - - - - 218.36363636363637 2 22 VDAC3 voltage-dependent anion channel 3 145 19 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39268.[MT7]-IETSINLAWTAGSNNTR.2y9_1.heavy 996.517 / 1006.47 1330.0 36.95642375946045 43 17 10 6 10 13.575569065824284 7.366173713612069 0.032100677490234375 3 0.9760163278453307 7.953031273570359 1330.0 7.437596132718083 0.0 - - - - - - - 184.92857142857142 2 14 VDAC3 voltage-dependent anion channel 3 147 19 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39268.[MT7]-IETSINLAWTAGSNNTR.2b4_1.heavy 996.517 / 575.316 739.0 36.95642375946045 43 17 10 6 10 13.575569065824284 7.366173713612069 0.032100677490234375 3 0.9760163278453307 7.953031273570359 739.0 1.3345372460496616 1.0 - - - - - - - 0.0 1 0 VDAC3 voltage-dependent anion channel 3 149 19 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39268.[MT7]-IETSINLAWTAGSNNTR.2b6_1.heavy 996.517 / 802.443 1034.0 36.95642375946045 43 17 10 6 10 13.575569065824284 7.366173713612069 0.032100677490234375 3 0.9760163278453307 7.953031273570359 1034.0 12.075675675675676 1.0 - - - - - - - 179.0 2 19 VDAC3 voltage-dependent anion channel 3 151 20 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21621.[MT7]-SLLSK[MT7].2b3_1.heavy 418.278 / 458.31 2285.0 25.487366994222004 42 16 10 6 10 2.5349262182506176 32.63454607851824 0.03849983215332031 3 0.9650256119063334 6.57980990605474 2285.0 11.70983379501385 0.0 - - - - - - - 291.2631578947368 4 19 ADAD1;WEE1;XPC adenosine deaminase domain containing 1 (testis-specific);WEE1 homolog (S. pombe);xeroderma pigmentosum, complementation group C 153 20 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21621.[MT7]-SLLSK[MT7].2y4_1.heavy 418.278 / 604.415 4810.0 25.487366994222004 42 16 10 6 10 2.5349262182506176 32.63454607851824 0.03849983215332031 3 0.9650256119063334 6.57980990605474 4810.0 18.794074971999574 0.0 - - - - - - - 227.11111111111111 9 18 ADAD1;WEE1;XPC adenosine deaminase domain containing 1 (testis-specific);WEE1 homolog (S. pombe);xeroderma pigmentosum, complementation group C 155 20 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21621.[MT7]-SLLSK[MT7].2y3_2.heavy 418.278 / 246.169 N/A 25.487366994222004 42 16 10 6 10 2.5349262182506176 32.63454607851824 0.03849983215332031 3 0.9650256119063334 6.57980990605474 2946.0 5.591479747677851 2.0 - - - - - - - 761.7777777777778 9 9 ADAD1;WEE1;XPC adenosine deaminase domain containing 1 (testis-specific);WEE1 homolog (S. pombe);xeroderma pigmentosum, complementation group C 157 20 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21621.[MT7]-SLLSK[MT7].2y3_1.heavy 418.278 / 491.331 4269.0 25.487366994222004 42 16 10 6 10 2.5349262182506176 32.63454607851824 0.03849983215332031 3 0.9650256119063334 6.57980990605474 4269.0 25.474057618198128 0.0 - - - - - - - 268.88235294117646 8 17 ADAD1;WEE1;XPC adenosine deaminase domain containing 1 (testis-specific);WEE1 homolog (S. pombe);xeroderma pigmentosum, complementation group C 159 21 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21762.[MT7]-IFIAGSK[MT7].2b3_1.heavy 512.326 / 518.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K14 mitogen-activated protein kinase kinase kinase 14 161 21 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21762.[MT7]-IFIAGSK[MT7].2y4_1.heavy 512.326 / 506.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K14 mitogen-activated protein kinase kinase kinase 14 163 21 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21762.[MT7]-IFIAGSK[MT7].2y5_1.heavy 512.326 / 619.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K14 mitogen-activated protein kinase kinase kinase 14 165 21 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21762.[MT7]-IFIAGSK[MT7].2y6_1.heavy 512.326 / 766.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K14 mitogen-activated protein kinase kinase kinase 14 167 22 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1354440.0 29.723400115966797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1354440.0 6646.475046883551 0.0 - - - - - - - 682.375 2708 8 169 22 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 392853.0 29.723400115966797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 392853.0 319.6542818133848 0.0 - - - - - - - 669.5 785 14 171 22 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 294717.0 29.723400115966797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 294717.0 467.826202798095 0.0 - - - - - - - 309.0 589 4 173 23 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21870.[MT7]-ELEDLQK[MT7].2y4_1.heavy 581.832 / 647.385 4054.0 26.29669952392578 50 20 10 10 10 15.708181677862028 6.366109206702947 0.0 3 0.9989584277650542 38.23666178340171 4054.0 21.92869775626925 0.0 - - - - - - - 207.25 8 16 UBE2L6 ubiquitin-conjugating enzyme E2L 6 175 23 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21870.[MT7]-ELEDLQK[MT7].2b4_1.heavy 581.832 / 631.305 9766.0 26.29669952392578 50 20 10 10 10 15.708181677862028 6.366109206702947 0.0 3 0.9989584277650542 38.23666178340171 9766.0 29.108512453557175 0.0 - - - - - - - 278.05263157894734 19 19 UBE2L6 ubiquitin-conjugating enzyme E2L 6 177 23 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21870.[MT7]-ELEDLQK[MT7].2y3_1.heavy 581.832 / 532.357 8722.0 26.29669952392578 50 20 10 10 10 15.708181677862028 6.366109206702947 0.0 3 0.9989584277650542 38.23666178340171 8722.0 12.619513673206576 0.0 - - - - - - - 344.0 17 5 UBE2L6 ubiquitin-conjugating enzyme E2L 6 179 23 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21870.[MT7]-ELEDLQK[MT7].2y6_1.heavy 581.832 / 889.511 5774.0 26.29669952392578 50 20 10 10 10 15.708181677862028 6.366109206702947 0.0 3 0.9989584277650542 38.23666178340171 5774.0 32.5708621667612 0.0 - - - - - - - 225.11111111111111 11 18 UBE2L6 ubiquitin-conjugating enzyme E2L 6 181 24 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22497.[MT7]-WFLANLASGGAAGATSLC[CAM]VVYPLDFAR.4y8_1.heavy 743.637 / 980.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 183 24 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22497.[MT7]-WFLANLASGGAAGATSLC[CAM]VVYPLDFAR.4b4_1.heavy 743.637 / 662.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 185 24 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22497.[MT7]-WFLANLASGGAAGATSLC[CAM]VVYPLDFAR.4b5_1.heavy 743.637 / 776.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 187 24 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22497.[MT7]-WFLANLASGGAAGATSLC[CAM]VVYPLDFAR.4y6_1.heavy 743.637 / 718.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 189 25 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21872.[MT7]-LSAGC[CAM]VEER.2y8_1.heavy 582.794 / 907.394 21866.0 22.862899780273438 48 18 10 10 10 7.583099681093806 13.187219501982828 0.0 3 0.9829347252347216 9.433789313845175 21866.0 126.50526418786694 0.0 - - - - - - - 193.05263157894737 43 19 ACVR2B activin A receptor, type IIB 191 25 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21872.[MT7]-LSAGC[CAM]VEER.2y6_1.heavy 582.794 / 749.325 5803.0 22.862899780273438 48 18 10 10 10 7.583099681093806 13.187219501982828 0.0 3 0.9829347252347216 9.433789313845175 5803.0 48.089377085650725 0.0 - - - - - - - 170.14285714285714 11 21 ACVR2B activin A receptor, type IIB 193 25 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21872.[MT7]-LSAGC[CAM]VEER.2b5_1.heavy 582.794 / 633.315 2321.0 22.862899780273438 48 18 10 10 10 7.583099681093806 13.187219501982828 0.0 3 0.9829347252347216 9.433789313845175 2321.0 10.729497696823724 0.0 - - - - - - - 211.6 4 25 ACVR2B activin A receptor, type IIB 195 25 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21872.[MT7]-LSAGC[CAM]VEER.2y7_1.heavy 582.794 / 820.362 4085.0 22.862899780273438 48 18 10 10 10 7.583099681093806 13.187219501982828 0.0 3 0.9829347252347216 9.433789313845175 4085.0 70.67141641525488 0.0 - - - - - - - 120.55 8 20 ACVR2B activin A receptor, type IIB 197 26 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38796.[MT7]-DPGTVANK[MT7].2y4_1.heavy 545.311 / 575.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 199 26 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38796.[MT7]-DPGTVANK[MT7].2y5_1.heavy 545.311 / 676.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 201 26 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38796.[MT7]-DPGTVANK[MT7].2y6_1.heavy 545.311 / 733.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 203 26 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38796.[MT7]-DPGTVANK[MT7].2y7_1.heavy 545.311 / 830.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 205 27 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 486506.0 15.447099685668945 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 486506.0 6211.180550321584 0.0 - - - - - - - 662.0 973 9 207 27 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 1010120.0 15.447099685668945 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1010120.0 6643.914903888556 0.0 - - - - - - - 773.125 2020 8 209 27 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 313715.0 15.447099685668945 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 313715.0 796.384732605541 0.0 - - - - - - - 274.45454545454544 627 11 211 28 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39281.[MT7]-ELETVC[CAM]NDVLSLLDK[MT7].3y3_1.heavy 679.366 / 519.326 5472.0 48.221574783325195 37 14 10 3 10 1.9914285889348848 39.940184592203735 0.06189727783203125 3 0.930783148324794 4.6635753566535225 5472.0 59.501359223300966 0.0 - - - - - - - 105.33333333333333 10 24 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 213 28 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39281.[MT7]-ELETVC[CAM]NDVLSLLDK[MT7].3b4_1.heavy 679.366 / 617.326 3484.0 48.221574783325195 37 14 10 3 10 1.9914285889348848 39.940184592203735 0.06189727783203125 3 0.930783148324794 4.6635753566535225 3484.0 155.06271844660193 0.0 - - - - - - - 89.13636363636364 6 22 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 215 28 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39281.[MT7]-ELETVC[CAM]NDVLSLLDK[MT7].3b3_1.heavy 679.366 / 516.279 3329.0 48.221574783325195 37 14 10 3 10 1.9914285889348848 39.940184592203735 0.06189727783203125 3 0.930783148324794 4.6635753566535225 3329.0 77.37653349875931 0.0 - - - - - - - 93.0 6 25 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 217 28 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39281.[MT7]-ELETVC[CAM]NDVLSLLDK[MT7].3y5_1.heavy 679.366 / 719.442 6762.0 48.221574783325195 37 14 10 3 10 1.9914285889348848 39.940184592203735 0.06189727783203125 3 0.930783148324794 4.6635753566535225 6762.0 131.30949691085613 0.0 - - - - - - - 105.8 13 20 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 219 29 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39337.[MT7]-WNTDNTLGTEITVEDQLAR.2y4_1.heavy 1160.58 / 487.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC1 voltage-dependent anion channel 1 221 29 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39337.[MT7]-WNTDNTLGTEITVEDQLAR.2y9_1.heavy 1160.58 / 1044.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC1 voltage-dependent anion channel 1 223 29 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39337.[MT7]-WNTDNTLGTEITVEDQLAR.2b4_1.heavy 1160.58 / 661.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC1 voltage-dependent anion channel 1 225 29 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39337.[MT7]-WNTDNTLGTEITVEDQLAR.2b6_1.heavy 1160.58 / 876.397 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC1 voltage-dependent anion channel 1 227 30 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544946.[MT7]-LQHPLTILPIDQVK[MT7].4y4_1.heavy 476.546 / 633.369 63179.0 36.980499267578125 35 5 10 10 10 0.3498687434602652 128.33131156768252 0.0 3 0.6038129165988285 1.8919137761010956 63179.0 95.06231286001992 0.0 - - - - - - - 745.0 126 8 SPRY4 sprouty homolog 4 (Drosophila) 229 30 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544946.[MT7]-LQHPLTILPIDQVK[MT7].4b8_2.heavy 476.546 / 530.835 107329.0 36.980499267578125 35 5 10 10 10 0.3498687434602652 128.33131156768252 0.0 3 0.6038129165988285 1.8919137761010956 107329.0 166.14284773653026 0.0 - - - - - - - 258.54545454545456 214 11 SPRY4 sprouty homolog 4 (Drosophila) 231 30 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544946.[MT7]-LQHPLTILPIDQVK[MT7].4y3_1.heavy 476.546 / 518.342 31826.0 36.980499267578125 35 5 10 10 10 0.3498687434602652 128.33131156768252 0.0 3 0.6038129165988285 1.8919137761010956 31826.0 35.86822937830446 0.0 - - - - - - - 735.1428571428571 63 7 SPRY4 sprouty homolog 4 (Drosophila) 233 30 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544946.[MT7]-LQHPLTILPIDQVK[MT7].4b3_1.heavy 476.546 / 523.311 43474.0 36.980499267578125 35 5 10 10 10 0.3498687434602652 128.33131156768252 0.0 3 0.6038129165988285 1.8919137761010956 43474.0 106.45496535517658 0.0 - - - - - - - 284.46666666666664 86 15 SPRY4 sprouty homolog 4 (Drosophila) 235 31 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39075.[MT7]-ASYFGAYDTVK[MT7].2y8_1.heavy 755.395 / 1044.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 237 31 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39075.[MT7]-ASYFGAYDTVK[MT7].2b6_1.heavy 755.395 / 741.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 239 31 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39075.[MT7]-ASYFGAYDTVK[MT7].2b5_1.heavy 755.395 / 670.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 241 31 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39075.[MT7]-ASYFGAYDTVK[MT7].2y7_1.heavy 755.395 / 897.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 243 32 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB545005.[MT7]-WK[MT7]QPLTVIVTPVSK[MT7].4y4_1.heavy 507.82 / 574.368 30631.0 35.65480041503906 38 12 10 6 10 1.2670595255524428 45.15977663970981 0.0316009521484375 3 0.8856074962603021 3.6135487331174523 30631.0 58.41559157197186 0.0 - - - - - - - 744.3076923076923 61 13 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 245 32 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB545005.[MT7]-WK[MT7]QPLTVIVTPVSK[MT7].4b7_2.heavy 507.82 / 571.352 35070.0 35.65480041503906 38 12 10 6 10 1.2670595255524428 45.15977663970981 0.0316009521484375 3 0.8856074962603021 3.6135487331174523 35070.0 39.63570159761121 1.0 - - - - - - - 335.0 70 5 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 247 32 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB545005.[MT7]-WK[MT7]QPLTVIVTPVSK[MT7].4b3_1.heavy 507.82 / 731.444 2983.0 35.65480041503906 38 12 10 6 10 1.2670595255524428 45.15977663970981 0.0316009521484375 3 0.8856074962603021 3.6135487331174523 2983.0 16.928024212617046 1.0 - - - - - - - 646.6666666666666 7 9 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 249 32 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB545005.[MT7]-WK[MT7]QPLTVIVTPVSK[MT7].4b6_2.heavy 507.82 / 521.818 18117.0 35.65480041503906 38 12 10 6 10 1.2670595255524428 45.15977663970981 0.0316009521484375 3 0.8856074962603021 3.6135487331174523 18117.0 62.90938569162796 0.0 - - - - - - - 545.5 36 8 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 251 33 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38899.[MT7]-C[CAM]VPSYWK[MT7].2y4_1.heavy 614.325 / 727.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 253 33 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38899.[MT7]-C[CAM]VPSYWK[MT7].2y5_1.heavy 614.325 / 824.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 255 33 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38899.[MT7]-C[CAM]VPSYWK[MT7].2y3_1.heavy 614.325 / 640.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 257 33 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38899.[MT7]-C[CAM]VPSYWK[MT7].2y6_1.heavy 614.325 / 923.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 259 34 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542564.[MT7]-EQANLNSR.2y6_1.heavy 538.284 / 674.358 1073.0 16.331424713134766 43 17 10 6 10 3.14929245097788 31.75316410165376 0.032501220703125 3 0.97685573622292 8.096540428516096 1073.0 19.779397590361448 0.0 - - - - - - - 113.6 2 20 VEGFC vascular endothelial growth factor C 261 34 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542564.[MT7]-EQANLNSR.2y5_1.heavy 538.284 / 603.321 454.0 16.331424713134766 43 17 10 6 10 3.14929245097788 31.75316410165376 0.032501220703125 3 0.97685573622292 8.096540428516096 454.0 9.408839615668883 1.0 - - - - - - - 0.0 1 0 VEGFC vascular endothelial growth factor C 263 34 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542564.[MT7]-EQANLNSR.2b4_1.heavy 538.284 / 587.291 495.0 16.331424713134766 43 17 10 6 10 3.14929245097788 31.75316410165376 0.032501220703125 3 0.97685573622292 8.096540428516096 495.0 0.0 3.0 - - - - - - - 159.4090909090909 2 22 VEGFC vascular endothelial growth factor C 265 34 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542564.[MT7]-EQANLNSR.2y7_1.heavy 538.284 / 802.417 1817.0 16.331424713134766 43 17 10 6 10 3.14929245097788 31.75316410165376 0.032501220703125 3 0.97685573622292 8.096540428516096 1817.0 12.184939711869713 0.0 - - - - - - - 90.75 3 20 VEGFC vascular endothelial growth factor C 267 35 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39343.[MT7]-SLNQYPALYYPELYILK[MT7].3y7_1.heavy 792.775 / 1019.63 4886.0 46.76592445373535 37 14 10 3 10 1.8953012155037863 36.035172630534014 0.050701141357421875 3 0.9441091711980316 5.195750482440261 4886.0 42.05536005582937 0.0 - - - - - - - 115.92 9 25 CDC25C cell division cycle 25 homolog C (S. pombe) 269 35 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39343.[MT7]-SLNQYPALYYPELYILK[MT7].3b4_1.heavy 792.775 / 587.327 4836.0 46.76592445373535 37 14 10 3 10 1.8953012155037863 36.035172630534014 0.050701141357421875 3 0.9441091711980316 5.195750482440261 4836.0 27.656189707896367 0.0 - - - - - - - 207.58620689655172 9 29 CDC25C cell division cycle 25 homolog C (S. pombe) 271 35 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39343.[MT7]-SLNQYPALYYPELYILK[MT7].3b5_1.heavy 792.775 / 750.39 6977.0 46.76592445373535 37 14 10 3 10 1.8953012155037863 36.035172630534014 0.050701141357421875 3 0.9441091711980316 5.195750482440261 6977.0 26.039757049203587 0.0 - - - - - - - 217.56 13 25 CDC25C cell division cycle 25 homolog C (S. pombe) 273 35 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39343.[MT7]-SLNQYPALYYPELYILK[MT7].3b7_1.heavy 792.775 / 918.48 3023.0 46.76592445373535 37 14 10 3 10 1.8953012155037863 36.035172630534014 0.050701141357421875 3 0.9441091711980316 5.195750482440261 3023.0 13.893490184461482 1.0 - - - - - - - 133.75862068965517 6 29 CDC25C cell division cycle 25 homolog C (S. pombe) 275 36 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21865.[MT7]-NQPLNPGK[MT7].2y4_1.heavy 578.34 / 559.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 277 36 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21865.[MT7]-NQPLNPGK[MT7].2b4_1.heavy 578.34 / 597.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 279 36 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21865.[MT7]-NQPLNPGK[MT7].2y6_1.heavy 578.34 / 769.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 281 36 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21865.[MT7]-NQPLNPGK[MT7].2b5_1.heavy 578.34 / 711.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 283 37 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21735.[MT7]-QVHSIIR.2b3_1.heavy 498.807 / 509.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 285 37 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21735.[MT7]-QVHSIIR.2y5_1.heavy 498.807 / 625.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 287 37 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21735.[MT7]-QVHSIIR.2b4_1.heavy 498.807 / 596.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 289 37 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21735.[MT7]-QVHSIIR.2y6_1.heavy 498.807 / 724.446 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 291 38 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21863.[MT7]-C[CAM]EGEQDK[MT7].2y5_1.heavy 577.273 / 720.364 1014.0 13.349300384521484 36 12 10 10 4 4.348877732126518 22.99443814234389 0.0 7 0.8900857488856101 3.6878628337567374 1014.0 40.780434782608694 0.0 - - - - - - - 83.63636363636364 2 11 ACVR2B activin A receptor, type IIB 293 38 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21863.[MT7]-C[CAM]EGEQDK[MT7].2b4_1.heavy 577.273 / 620.247 230.0 13.349300384521484 36 12 10 10 4 4.348877732126518 22.99443814234389 0.0 7 0.8900857488856101 3.6878628337567374 230.0 5.95 0.0 - - - - - - - 0.0 0 0 ACVR2B activin A receptor, type IIB 295 38 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21863.[MT7]-C[CAM]EGEQDK[MT7].2b6_1.heavy 577.273 / 863.332 622.0 13.349300384521484 36 12 10 10 4 4.348877732126518 22.99443814234389 0.0 7 0.8900857488856101 3.6878628337567374 622.0 29.477391304347826 0.0 - - - - - - - 0.0 1 0 ACVR2B activin A receptor, type IIB 297 38 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21863.[MT7]-C[CAM]EGEQDK[MT7].2y3_1.heavy 577.273 / 534.3 323.0 13.349300384521484 36 12 10 10 4 4.348877732126518 22.99443814234389 0.0 7 0.8900857488856101 3.6878628337567374 323.0 1.4043478260869564 11.0 - - - - - - - 0.0 1 0 ACVR2B activin A receptor, type IIB 299 39 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21638.[MT7]-NVLLK[MT7].2b3_1.heavy 437.802 / 471.305 6116.0 26.904399871826172 44 20 4 10 10 29.765925784750753 3.359546103929029 0.0 3 0.9982814524636641 29.765924720310974 6116.0 5.369167602245389 1.0 - - - - - - - 630.6363636363636 28 11 ERBB3;SGK3;SGK1;ACVR2A;ACVR2B v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian);serum/glucocorticoid regulated kinase family, member 3;serum/glucocorticoid regulated kinase 1;activin A receptor, type IIA;activin A receptor, type IIB 301 39 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21638.[MT7]-NVLLK[MT7].2y4_1.heavy 437.802 / 616.451 8513.0 26.904399871826172 44 20 4 10 10 29.765925784750753 3.359546103929029 0.0 3 0.9982814524636641 29.765924720310974 8513.0 9.362740554785766 1.0 - - - - - - - 670.0 17 8 ERBB3;SGK3;SGK1;ACVR2A;ACVR2B v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian);serum/glucocorticoid regulated kinase family, member 3;serum/glucocorticoid regulated kinase 1;activin A receptor, type IIA;activin A receptor, type IIB 303 39 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21638.[MT7]-NVLLK[MT7].2y3_1.heavy 437.802 / 517.383 N/A 26.904399871826172 44 20 4 10 10 29.765925784750753 3.359546103929029 0.0 3 0.9982814524636641 29.765924720310974 9900.0 18.643360874826957 1.0 - - - - - - - 252.0 36 9 ERBB3;SGK3;SGK1;ACVR2A;ACVR2B v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian);serum/glucocorticoid regulated kinase family, member 3;serum/glucocorticoid regulated kinase 1;activin A receptor, type IIA;activin A receptor, type IIB 305 40 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21862.[MT7]-QVHSIIRR.2b3_1.heavy 576.858 / 509.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 307 40 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21862.[MT7]-QVHSIIRR.2b4_1.heavy 576.858 / 596.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 309 40 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21862.[MT7]-QVHSIIRR.2b6_1.heavy 576.858 / 822.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 311 40 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21862.[MT7]-QVHSIIRR.2b7_1.heavy 576.858 / 978.596 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 313 41 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22466.[MT7]-TSHVENDYIDNPSLALTTGPK[MT7].3y6_1.heavy 854.109 / 760.469 4560.0 32.46030044555664 42 12 10 10 10 2.3394804900046315 33.99870445761118 0.0 3 0.8822117402227477 3.5600270992610654 4560.0 19.888451858388496 0.0 - - - - - - - 211.11111111111111 9 9 SPRY4 sprouty homolog 4 (Drosophila) 315 41 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22466.[MT7]-TSHVENDYIDNPSLALTTGPK[MT7].3y4_1.heavy 854.109 / 546.337 5447.0 32.46030044555664 42 12 10 10 10 2.3394804900046315 33.99870445761118 0.0 3 0.8822117402227477 3.5600270992610654 5447.0 8.457184210526316 0.0 - - - - - - - 253.33333333333334 10 6 SPRY4 sprouty homolog 4 (Drosophila) 317 41 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22466.[MT7]-TSHVENDYIDNPSLALTTGPK[MT7].3y5_1.heavy 854.109 / 647.385 9754.0 32.46030044555664 42 12 10 10 10 2.3394804900046315 33.99870445761118 0.0 3 0.8822117402227477 3.5600270992610654 9754.0 27.735011545273654 0.0 - - - - - - - 235.14285714285714 19 7 SPRY4 sprouty homolog 4 (Drosophila) 319 41 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22466.[MT7]-TSHVENDYIDNPSLALTTGPK[MT7].3b7_1.heavy 854.109 / 927.429 2533.0 32.46030044555664 42 12 10 10 10 2.3394804900046315 33.99870445761118 0.0 3 0.8822117402227477 3.5600270992610654 2533.0 18.421818181818182 0.0 - - - - - - - 199.0 5 7 SPRY4 sprouty homolog 4 (Drosophila) 321 42 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22465.[MT7]-TSHVENDYIDNPSLALTTGPK[MT7].4b8_1.heavy 640.834 / 1090.49 1273.0 32.43564987182617 30 5 10 5 10 0.453090438688401 105.30236602030956 0.0493011474609375 3 0.6436549248479786 2.0025994185968856 1273.0 11.419067469507489 0.0 - - - - - - - 181.71428571428572 2 7 SPRY4 sprouty homolog 4 (Drosophila) 323 42 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22465.[MT7]-TSHVENDYIDNPSLALTTGPK[MT7].4y5_1.heavy 640.834 / 647.385 8657.0 32.43564987182617 30 5 10 5 10 0.453090438688401 105.30236602030956 0.0493011474609375 3 0.6436549248479786 2.0025994185968856 8657.0 16.73857331164301 0.0 - - - - - - - 238.625 17 8 SPRY4 sprouty homolog 4 (Drosophila) 325 42 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22465.[MT7]-TSHVENDYIDNPSLALTTGPK[MT7].4b7_1.heavy 640.834 / 927.429 2546.0 32.43564987182617 30 5 10 5 10 0.453090438688401 105.30236602030956 0.0493011474609375 3 0.6436549248479786 2.0025994185968856 2546.0 29.33029735988884 0.0 - - - - - - - 236.42857142857142 5 7 SPRY4 sprouty homolog 4 (Drosophila) 327 42 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22465.[MT7]-TSHVENDYIDNPSLALTTGPK[MT7].4b4_1.heavy 640.834 / 569.316 2292.0 32.43564987182617 30 5 10 5 10 0.453090438688401 105.30236602030956 0.0493011474609375 3 0.6436549248479786 2.0025994185968856 2292.0 5.2617263664807865 0.0 - - - - - - - 311.3333333333333 4 9 SPRY4 sprouty homolog 4 (Drosophila) 329 43 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21860.[MT7]-IFPLQDK[MT7].2y4_1.heavy 574.849 / 647.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR2B activin A receptor, type IIB 331 43 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21860.[MT7]-IFPLQDK[MT7].2y5_1.heavy 574.849 / 744.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR2B activin A receptor, type IIB 333 43 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21860.[MT7]-IFPLQDK[MT7].2y3_1.heavy 574.849 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR2B activin A receptor, type IIB 335 43 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21860.[MT7]-IFPLQDK[MT7].2y6_1.heavy 574.849 / 891.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR2B activin A receptor, type IIB 337 44 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543402.[MT7]-EC[CAM]IYYNANWELER.3y6_1.heavy 635.297 / 846.41 3472.0 35.4456262588501 46 20 10 6 10 57.77623345946105 1.7308154930204207 0.031902313232421875 3 0.9986419689783947 33.48562145795046 3472.0 9.470508474576272 0.0 - - - - - - - 252.94117647058823 6 17 ACVR2B activin A receptor, type IIB 339 44 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543402.[MT7]-EC[CAM]IYYNANWELER.3b4_1.heavy 635.297 / 710.33 6943.0 35.4456262588501 46 20 10 6 10 57.77623345946105 1.7308154930204207 0.031902313232421875 3 0.9986419689783947 33.48562145795046 6943.0 22.303937823834197 0.0 - - - - - - - 236.28571428571428 13 14 ACVR2B activin A receptor, type IIB 341 44 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543402.[MT7]-EC[CAM]IYYNANWELER.3b3_1.heavy 635.297 / 547.267 10250.0 35.4456262588501 46 20 10 6 10 57.77623345946105 1.7308154930204207 0.031902313232421875 3 0.9986419689783947 33.48562145795046 10250.0 33.98710587877067 0.0 - - - - - - - 298.84615384615387 20 13 ACVR2B activin A receptor, type IIB 343 44 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543402.[MT7]-EC[CAM]IYYNANWELER.3y5_1.heavy 635.297 / 732.367 4794.0 35.4456262588501 46 20 10 6 10 57.77623345946105 1.7308154930204207 0.031902313232421875 3 0.9986419689783947 33.48562145795046 4794.0 12.535581453675206 0.0 - - - - - - - 289.35714285714283 9 14 ACVR2B activin A receptor, type IIB 345 45 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21635.[MT7]-EIADK[MT7].2b3_1.heavy 432.257 / 458.273 1576.0 17.69029998779297 42 14 10 10 8 1.9009036500066354 41.65604708639295 0.0 4 0.9457549576507496 5.274719006184635 1576.0 4.6398272686860995 0.0 - - - - - - - 247.55555555555554 3 18 E2F4;TAX1BP1 E2F transcription factor 4, p107/p130-binding;Tax1 (human T-cell leukemia virus type I) binding protein 1 347 45 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21635.[MT7]-EIADK[MT7].2y4_1.heavy 432.257 / 590.363 4293.0 17.69029998779297 42 14 10 10 8 1.9009036500066354 41.65604708639295 0.0 4 0.9457549576507496 5.274719006184635 4293.0 5.407580828133863 0.0 - - - - - - - 380.3636363636364 8 11 E2F4;TAX1BP1 E2F transcription factor 4, p107/p130-binding;Tax1 (human T-cell leukemia virus type I) binding protein 1 349 45 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21635.[MT7]-EIADK[MT7].2b4_1.heavy 432.257 / 573.3 2608.0 17.69029998779297 42 14 10 10 8 1.9009036500066354 41.65604708639295 0.0 4 0.9457549576507496 5.274719006184635 2608.0 6.375903394850763 0.0 - - - - - - - 706.125 5 8 E2F4;TAX1BP1 E2F transcription factor 4, p107/p130-binding;Tax1 (human T-cell leukemia virus type I) binding protein 1 351 45 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21635.[MT7]-EIADK[MT7].2y3_1.heavy 432.257 / 477.279 2119.0 17.69029998779297 42 14 10 10 8 1.9009036500066354 41.65604708639295 0.0 4 0.9457549576507496 5.274719006184635 2119.0 12.900546984572228 1.0 - - - - - - - 208.68421052631578 4 19 E2F4;TAX1BP1 E2F transcription factor 4, p107/p130-binding;Tax1 (human T-cell leukemia virus type I) binding protein 1 353 46 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22461.[MT7]-TLQLVVLDADTINHPAQLSK[MT7].3y7_1.heavy 822.139 / 924.538 545.0 38.9276008605957 40 20 4 10 6 4.472952308926973 22.356598750320508 0.0 5 0.9914688853427297 13.352120556889753 545.0 1.0922182513091603 5.0 - - - - - - - 0.0 1 0 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 355 46 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22461.[MT7]-TLQLVVLDADTINHPAQLSK[MT7].3y6_1.heavy 822.139 / 787.479 8169.0 38.9276008605957 40 20 4 10 6 4.472952308926973 22.356598750320508 0.0 5 0.9914688853427297 13.352120556889753 8169.0 16.821838842975207 2.0 - - - - - - - 709.0 29 7 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 357 46 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22461.[MT7]-TLQLVVLDADTINHPAQLSK[MT7].3b4_1.heavy 822.139 / 600.384 3147.0 38.9276008605957 40 20 4 10 6 4.472952308926973 22.356598750320508 0.0 5 0.9914688853427297 13.352120556889753 3147.0 14.855989644836043 0.0 - - - - - - - 295.1875 6 16 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 359 46 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22461.[MT7]-TLQLVVLDADTINHPAQLSK[MT7].3b5_1.heavy 822.139 / 699.452 2723.0 38.9276008605957 40 20 4 10 6 4.472952308926973 22.356598750320508 0.0 5 0.9914688853427297 13.352120556889753 2723.0 10.023361726181193 0.0 - - - - - - - 329.25 5 16 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 361 47 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21633.[MT7]-VQEGER.2y4_1.heavy 431.231 / 490.226 1049.0 14.302000045776367 48 18 10 10 10 2.482531766333239 29.80508365720426 0.0 3 0.9898149983386779 12.218348830138739 1049.0 7.087837837837838 0.0 - - - - - - - 148.16 2 25 CDC25C cell division cycle 25 homolog C (S. pombe) 363 47 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21633.[MT7]-VQEGER.2y5_1.heavy 431.231 / 618.284 6512.0 14.302000045776367 48 18 10 10 10 2.482531766333239 29.80508365720426 0.0 3 0.9898149983386779 12.218348830138739 6512.0 40.76342857142857 0.0 - - - - - - - 175.82608695652175 13 23 CDC25C cell division cycle 25 homolog C (S. pombe) 365 47 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21633.[MT7]-VQEGER.2b4_1.heavy 431.231 / 558.3 802.0 14.302000045776367 48 18 10 10 10 2.482531766333239 29.80508365720426 0.0 3 0.9898149983386779 12.218348830138739 802.0 6.68004914004914 1.0 - - - - - - - 0.0 1 0 CDC25C cell division cycle 25 homolog C (S. pombe) 367 47 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21633.[MT7]-VQEGER.2b5_1.heavy 431.231 / 687.343 1759.0 14.302000045776367 48 18 10 10 10 2.482531766333239 29.80508365720426 0.0 3 0.9898149983386779 12.218348830138739 1759.0 4.56802634564628 0.0 - - - - - - - 171.04545454545453 3 22 CDC25C cell division cycle 25 homolog C (S. pombe) 369 48 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541448.[MT7]-QVLGTK[MT7].2b3_1.heavy 467.302 / 485.32 5455.0 20.35075044631958 41 15 10 6 10 2.861717459929569 26.68199062676422 0.03339958190917969 3 0.9568807854797361 5.921802620543033 5455.0 19.20896511309919 0.0 - - - - - - - 281.04761904761904 10 21 CDC34 cell division cycle 34 homolog (S. cerevisiae) 371 48 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541448.[MT7]-QVLGTK[MT7].2y4_1.heavy 467.302 / 562.368 17932.0 20.35075044631958 41 15 10 6 10 2.861717459929569 26.68199062676422 0.03339958190917969 3 0.9568807854797361 5.921802620543033 17932.0 50.10183004268018 0.0 - - - - - - - 680.8888888888889 35 9 CDC34 cell division cycle 34 homolog (S. cerevisiae) 373 48 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541448.[MT7]-QVLGTK[MT7].2y5_1.heavy 467.302 / 661.437 20883.0 20.35075044631958 41 15 10 6 10 2.861717459929569 26.68199062676422 0.03339958190917969 3 0.9568807854797361 5.921802620543033 20883.0 38.30977562554145 0.0 - - - - - - - 268.22222222222223 41 9 CDC34 cell division cycle 34 homolog (S. cerevisiae) 375 48 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541448.[MT7]-QVLGTK[MT7].2b5_1.heavy 467.302 / 643.39 1431.0 20.35075044631958 41 15 10 6 10 2.861717459929569 26.68199062676422 0.03339958190917969 3 0.9568807854797361 5.921802620543033 1431.0 2.0077754378859978 4.0 - - - - - - - 735.7272727272727 4 11 CDC34 cell division cycle 34 homolog (S. cerevisiae) 377 49 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544814.[MT7]-TRLGVDIGK[MT7]GPEER.4y4_1.heavy 454.514 / 530.257 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 379 49 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544814.[MT7]-TRLGVDIGK[MT7]GPEER.4y5_1.heavy 454.514 / 587.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 381 49 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544814.[MT7]-TRLGVDIGK[MT7]GPEER.4b4_1.heavy 454.514 / 572.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 383 49 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544814.[MT7]-TRLGVDIGK[MT7]GPEER.4b6_1.heavy 454.514 / 786.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 385 50 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544816.[MT7]-IQC[CAM]EGGSFSLQSDPR.3b6_1.heavy 608.96 / 789.368 6032.0 29.575599670410156 43 13 10 10 10 1.1045421458064575 54.09945209901524 0.0 3 0.9164401468177276 4.2392787985909965 6032.0 14.625319042372032 0.0 - - - - - - - 191.5 12 14 SOCS3 suppressor of cytokine signaling 3 387 50 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544816.[MT7]-IQC[CAM]EGGSFSLQSDPR.3b4_1.heavy 608.96 / 675.325 6032.0 29.575599670410156 43 13 10 10 10 1.1045421458064575 54.09945209901524 0.0 3 0.9164401468177276 4.2392787985909965 6032.0 20.922574777121103 0.0 - - - - - - - 247.28571428571428 12 14 SOCS3 suppressor of cytokine signaling 3 389 50 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544816.[MT7]-IQC[CAM]EGGSFSLQSDPR.3y5_1.heavy 608.96 / 602.289 12398.0 29.575599670410156 43 13 10 10 10 1.1045421458064575 54.09945209901524 0.0 3 0.9164401468177276 4.2392787985909965 12398.0 43.00324685298341 0.0 - - - - - - - 692.4 24 10 SOCS3 suppressor of cytokine signaling 3 391 50 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544816.[MT7]-IQC[CAM]EGGSFSLQSDPR.3b7_1.heavy 608.96 / 876.4 6590.0 29.575599670410156 43 13 10 10 10 1.1045421458064575 54.09945209901524 0.0 3 0.9164401468177276 4.2392787985909965 6590.0 38.0521473230789 0.0 - - - - - - - 186.2 13 15 SOCS3 suppressor of cytokine signaling 3 393 51 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22089.[MT7]-IYSLNEGYAK[MT7].2y4_1.heavy 723.398 / 582.337 1504.0 29.856300354003906 46 20 10 6 10 10.197666693917036 9.806164782739032 0.035800933837890625 3 0.9970013573407187 22.531568630339827 1504.0 6.25038961038961 1.0 - - - - - - - 214.78571428571428 3 14 FBP2 fructose-1,6-bisphosphatase 2 395 51 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22089.[MT7]-IYSLNEGYAK[MT7].2y5_1.heavy 723.398 / 711.379 1041.0 29.856300354003906 46 20 10 6 10 10.197666693917036 9.806164782739032 0.035800933837890625 3 0.9970013573407187 22.531568630339827 1041.0 3.6 4.0 - - - - - - - 254.46666666666667 2 15 FBP2 fructose-1,6-bisphosphatase 2 397 51 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22089.[MT7]-IYSLNEGYAK[MT7].2y9_1.heavy 723.398 / 1188.6 1735.0 29.856300354003906 46 20 10 6 10 10.197666693917036 9.806164782739032 0.035800933837890625 3 0.9970013573407187 22.531568630339827 1735.0 28.567672413793105 0.0 - - - - - - - 193.0 3 9 FBP2 fructose-1,6-bisphosphatase 2 399 51 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22089.[MT7]-IYSLNEGYAK[MT7].2y6_1.heavy 723.398 / 825.422 1388.0 29.856300354003906 46 20 10 6 10 10.197666693917036 9.806164782739032 0.035800933837890625 3 0.9970013573407187 22.531568630339827 1388.0 5.268311688311688 1.0 - - - - - - - 206.64285714285714 2 14 FBP2 fructose-1,6-bisphosphatase 2 401 52 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39345.[MT7]-VNNASLIGLGYTQTLRPGVK[MT7].3y7_1.heavy 797.132 / 914.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC3 voltage-dependent anion channel 3 403 52 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39345.[MT7]-VNNASLIGLGYTQTLRPGVK[MT7].3b6_1.heavy 797.132 / 743.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC3 voltage-dependent anion channel 3 405 52 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39345.[MT7]-VNNASLIGLGYTQTLRPGVK[MT7].3b5_1.heavy 797.132 / 630.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC3 voltage-dependent anion channel 3 407 52 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39345.[MT7]-VNNASLIGLGYTQTLRPGVK[MT7].3y9_1.heavy 797.132 / 1143.7 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC3 voltage-dependent anion channel 3 409 53 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22086.[MT7]-VMEALSLYTK[MT7].2b3_1.heavy 721.912 / 504.261 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 411 53 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22086.[MT7]-VMEALSLYTK[MT7].2y5_1.heavy 721.912 / 755.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 413 53 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22086.[MT7]-VMEALSLYTK[MT7].2b4_1.heavy 721.912 / 575.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 415 53 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22086.[MT7]-VMEALSLYTK[MT7].2y3_1.heavy 721.912 / 555.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 417 54 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22381.[MT7]-SDVLLGTAALDIYETLK[MT7].3y3_1.heavy 704.068 / 505.347 5629.0 49.58954906463623 40 14 10 6 10 2.6160012966252286 38.22628074726299 0.036197662353515625 3 0.9353046152713252 4.8256524353387595 5629.0 99.86023672883788 0.0 - - - - - - - 83.25 11 16 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 419 54 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22381.[MT7]-SDVLLGTAALDIYETLK[MT7].3b4_1.heavy 704.068 / 559.321 8484.0 49.58954906463623 40 14 10 6 10 2.6160012966252286 38.22628074726299 0.036197662353515625 3 0.9353046152713252 4.8256524353387595 8484.0 79.7474084597998 0.0 - - - - - - - 104.65 16 20 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 421 54 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22381.[MT7]-SDVLLGTAALDIYETLK[MT7].3b5_1.heavy 704.068 / 672.405 2638.0 49.58954906463623 40 14 10 6 10 2.6160012966252286 38.22628074726299 0.036197662353515625 3 0.9353046152713252 4.8256524353387595 2638.0 47.3862962962963 0.0 - - - - - - - 81.625 5 8 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 423 54 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22381.[MT7]-SDVLLGTAALDIYETLK[MT7].3y5_1.heavy 704.068 / 797.453 5901.0 49.58954906463623 40 14 10 6 10 2.6160012966252286 38.22628074726299 0.036197662353515625 3 0.9353046152713252 4.8256524353387595 5901.0 273.19444444444446 0.0 - - - - - - - 104.16666666666667 11 12 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 425 55 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22382.[MT7]-SDVLLGTAALDIYETLK[MT7].4y4_1.heavy 528.303 / 634.389 2015.0 49.57145023345947 38 12 10 6 10 1.1259315204827984 58.45651144953076 0.036197662353515625 3 0.885278793435368 3.6082649953430135 2015.0 46.21706349206349 0.0 - - - - - - - 137.1 4 10 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 427 55 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22382.[MT7]-SDVLLGTAALDIYETLK[MT7].4b4_1.heavy 528.303 / 559.321 4164.0 49.57145023345947 38 12 10 6 10 1.1259315204827984 58.45651144953076 0.036197662353515625 3 0.885278793435368 3.6082649953430135 4164.0 73.50778816199377 0.0 - - - - - - - 87.41666666666667 8 12 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 429 55 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22382.[MT7]-SDVLLGTAALDIYETLK[MT7].4b5_1.heavy 528.303 / 672.405 2042.0 49.57145023345947 38 12 10 6 10 1.1259315204827984 58.45651144953076 0.036197662353515625 3 0.885278793435368 3.6082649953430135 2042.0 40.94131071881851 0.0 - - - - - - - 73.91666666666667 4 12 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 431 55 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22382.[MT7]-SDVLLGTAALDIYETLK[MT7].4y3_1.heavy 528.303 / 505.347 5158.0 49.57145023345947 38 12 10 6 10 1.1259315204827984 58.45651144953076 0.036197662353515625 3 0.885278793435368 3.6082649953430135 5158.0 133.7259259259259 0.0 - - - - - - - 153.2941176470588 10 17 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 433 56 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 677251.0 18.14550018310547 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 677251.0 6393.261874493786 0.0 - - - - - - - 363.0 1354 3 435 56 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 454355.0 18.14550018310547 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 454355.0 3062.873284169435 0.0 - - - - - - - 190.5 908 6 437 56 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 377114.0 18.14550018310547 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 377114.0 3609.59523823044 0.0 - - - - - - - 254.16666666666666 754 6 439 57 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540302.[MT7]-TFSSK[MT7].2y4_1.heavy 429.252 / 612.347 17659.0 18.185199737548828 43 13 10 10 10 2.0496022876950084 24.39497667434311 0.0 2 0.9107198731415682 4.099204516985738 17659.0 50.91148254175778 0.0 - - - - - - - 185.7058823529412 35 17 SOCS3 suppressor of cytokine signaling 3 441 57 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540302.[MT7]-TFSSK[MT7].2y3_1.heavy 429.252 / 465.279 6718.0 18.185199737548828 43 13 10 10 10 2.0496022876950084 24.39497667434311 0.0 2 0.9107198731415682 4.099204516985738 6718.0 32.847209765209826 0.0 - - - - - - - 182.58823529411765 13 17 SOCS3 suppressor of cytokine signaling 3 443 58 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21857.[MT7]-ALVLELAK[MT7].2y4_1.heavy 572.881 / 604.379 12817.0 37.196274757385254 47 20 10 7 10 3.941828038241442 19.982182310633153 0.029499053955078125 3 0.9927880351363382 14.523597786853802 12817.0 16.308940396964392 0.0 - - - - - - - 674.1111111111111 25 9 INHBE inhibin, beta E 445 58 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21857.[MT7]-ALVLELAK[MT7].2y5_1.heavy 572.881 / 717.463 19566.0 37.196274757385254 47 20 10 7 10 3.941828038241442 19.982182310633153 0.029499053955078125 3 0.9927880351363382 14.523597786853802 19566.0 39.39954952569458 0.0 - - - - - - - 681.9 39 10 INHBE inhibin, beta E 447 58 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21857.[MT7]-ALVLELAK[MT7].2y6_1.heavy 572.881 / 816.531 8726.0 37.196274757385254 47 20 10 7 10 3.941828038241442 19.982182310633153 0.029499053955078125 3 0.9927880351363382 14.523597786853802 8726.0 22.577087529510205 0.0 - - - - - - - 630.625 17 8 INHBE inhibin, beta E 449 58 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21857.[MT7]-ALVLELAK[MT7].2y7_1.heavy 572.881 / 929.615 7090.0 37.196274757385254 47 20 10 7 10 3.941828038241442 19.982182310633153 0.029499053955078125 3 0.9927880351363382 14.523597786853802 7090.0 32.92829661071636 0.0 - - - - - - - 204.52173913043478 14 23 INHBE inhibin, beta E 451 59 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22091.[MT7]-ISSPQVEEGDSR.2y9_1.heavy 724.361 / 1016.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 453 59 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22091.[MT7]-ISSPQVEEGDSR.2y6_1.heavy 724.361 / 692.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 455 59 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22091.[MT7]-ISSPQVEEGDSR.2y10_1.heavy 724.361 / 1103.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 457 59 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22091.[MT7]-ISSPQVEEGDSR.2y11_1.heavy 724.361 / 1190.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 459 60 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21640.[MT7]-INTLK[MT7].2b3_1.heavy 438.791 / 473.284 980.0 23.53846613566081 36 18 10 6 2 4.590608129989353 21.783606260513448 0.03520011901855469 13 0.9876110008238056 11.076303901341904 980.0 -0.2495874367846686 16.0 - - - - - - - 307.5882352941176 10 17 SMC1B;FXR1 structural maintenance of chromosomes 1B;fragile X mental retardation, autosomal homolog 1 461 60 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21640.[MT7]-INTLK[MT7].2y4_1.heavy 438.791 / 619.39 8330.0 23.53846613566081 36 18 10 6 2 4.590608129989353 21.783606260513448 0.03520011901855469 13 0.9876110008238056 11.076303901341904 8330.0 21.656004072410557 2.0 - - - - - - - 398.0 16 13 SMC1B;FXR1 structural maintenance of chromosomes 1B;fragile X mental retardation, autosomal homolog 1 463 60 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21640.[MT7]-INTLK[MT7].2y3_1.heavy 438.791 / 505.347 2069.0 23.53846613566081 36 18 10 6 2 4.590608129989353 21.783606260513448 0.03520011901855469 13 0.9876110008238056 11.076303901341904 2069.0 1.039411556666481 3.0 - - - - - - - 707.7 5 10 SMC1B;FXR1 structural maintenance of chromosomes 1B;fragile X mental retardation, autosomal homolog 1 465 61 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22090.[MT7]-ITHPPPQAALTR.2y8_1.heavy 723.421 / 853.489 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBE inhibin, beta E 467 61 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22090.[MT7]-ITHPPPQAALTR.2y9_1.heavy 723.421 / 950.542 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBE inhibin, beta E 469 61 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22090.[MT7]-ITHPPPQAALTR.2y11_1.heavy 723.421 / 1188.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBE inhibin, beta E 471 61 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22090.[MT7]-ITHPPPQAALTR.2y7_1.heavy 723.421 / 756.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBE inhibin, beta E 473 62 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21990.[MT7]-GPAVPPELDK[MT7].3y3_1.heavy 437.59 / 519.326 17248.0 27.829999923706055 48 18 10 10 10 4.772659322179157 20.952679261075104 0.0 3 0.9818158346058244 9.138088744788075 17248.0 4.099459793459129 0.0 - - - - - - - 869.75 34 8 SPRY4 sprouty homolog 4 (Drosophila) 475 62 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21990.[MT7]-GPAVPPELDK[MT7].3b4_1.heavy 437.59 / 469.289 62533.0 27.829999923706055 48 18 10 10 10 4.772659322179157 20.952679261075104 0.0 3 0.9818158346058244 9.138088744788075 62533.0 59.079790358058176 0.0 - - - - - - - 260.3333333333333 125 9 SPRY4 sprouty homolog 4 (Drosophila) 477 62 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21990.[MT7]-GPAVPPELDK[MT7].3y4_1.heavy 437.59 / 648.369 8447.0 27.829999923706055 48 18 10 10 10 4.772659322179157 20.952679261075104 0.0 3 0.9818158346058244 9.138088744788075 8447.0 7.42903351423103 0.0 - - - - - - - 284.0 16 7 SPRY4 sprouty homolog 4 (Drosophila) 479 62 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21990.[MT7]-GPAVPPELDK[MT7].3y5_1.heavy 437.59 / 745.421 16964.0 27.829999923706055 48 18 10 10 10 4.772659322179157 20.952679261075104 0.0 3 0.9818158346058244 9.138088744788075 16964.0 63.718710733433305 0.0 - - - - - - - 177.5 33 6 SPRY4 sprouty homolog 4 (Drosophila) 481 63 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21859.[MT7]-MLNLLLER.2b3_1.heavy 573.345 / 503.277 2494.0 42.44385051727295 42 17 10 7 8 2.304003004856552 33.93357910493998 0.028598785400390625 4 0.975645636712819 7.892027753586907 2494.0 7.148117230227312 1.0 - - - - - - - 289.04545454545456 12 22 CDC25C cell division cycle 25 homolog C (S. pombe) 483 63 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21859.[MT7]-MLNLLLER.2b4_1.heavy 573.345 / 616.361 2424.0 42.44385051727295 42 17 10 7 8 2.304003004856552 33.93357910493998 0.028598785400390625 4 0.975645636712819 7.892027753586907 2424.0 13.334111070603964 0.0 - - - - - - - 244.59259259259258 4 27 CDC25C cell division cycle 25 homolog C (S. pombe) 485 63 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21859.[MT7]-MLNLLLER.2y6_1.heavy 573.345 / 757.457 2986.0 42.44385051727295 42 17 10 7 8 2.304003004856552 33.93357910493998 0.028598785400390625 4 0.975645636712819 7.892027753586907 2986.0 74.26263207252266 0.0 - - - - - - - 189.68 5 25 CDC25C cell division cycle 25 homolog C (S. pombe) 487 63 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21859.[MT7]-MLNLLLER.2y7_1.heavy 573.345 / 870.541 6323.0 42.44385051727295 42 17 10 7 8 2.304003004856552 33.93357910493998 0.028598785400390625 4 0.975645636712819 7.892027753586907 6323.0 203.58828246753245 0.0 - - - - - - - 119.95833333333333 12 24 CDC25C cell division cycle 25 homolog C (S. pombe) 489 64 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21747.[MT7]-TEETIK[MT7].2y4_1.heavy 504.794 / 634.389 1877.0 18.83152437210083 40 18 10 6 6 4.638561853079058 21.558406067954103 0.03989982604980469 5 0.9843824675839368 9.862552295689108 1877.0 2.252453420568418 1.0 - - - - - - - 233.33333333333334 4 15 VEGFC vascular endothelial growth factor C 491 64 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21747.[MT7]-TEETIK[MT7].2y5_1.heavy 504.794 / 763.432 1776.0 18.83152437210083 40 18 10 6 6 4.638561853079058 21.558406067954103 0.03989982604980469 5 0.9843824675839368 9.862552295689108 1776.0 4.509621540297268 1.0 - - - - - - - 182.53333333333333 8 15 VEGFC vascular endothelial growth factor C 493 64 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21747.[MT7]-TEETIK[MT7].2b4_1.heavy 504.794 / 605.29 8370.0 18.83152437210083 40 18 10 6 6 4.638561853079058 21.558406067954103 0.03989982604980469 5 0.9843824675839368 9.862552295689108 8370.0 35.72704225352113 0.0 - - - - - - - 236.66666666666666 16 12 VEGFC vascular endothelial growth factor C 495 64 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21747.[MT7]-TEETIK[MT7].2b5_1.heavy 504.794 / 718.374 862.0 18.83152437210083 40 18 10 6 6 4.638561853079058 21.558406067954103 0.03989982604980469 5 0.9843824675839368 9.862552295689108 862.0 0.8492610837438423 3.0 - - - - - - - 0.0 1 0 VEGFC vascular endothelial growth factor C 497 65 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21855.[MT7]-GYGFGLIK[MT7].2y4_1.heavy 571.844 / 574.404 10888.0 35.895973205566406 37 11 10 6 10 2.1066784984927556 32.099435502257926 0.0345001220703125 3 0.8671427138618247 3.3476482288506695 10888.0 31.944132231404957 0.0 - - - - - - - 280.2105263157895 21 19 VDAC1 voltage-dependent anion channel 1 499 65 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21855.[MT7]-GYGFGLIK[MT7].2b4_1.heavy 571.844 / 569.284 6210.0 35.895973205566406 37 11 10 6 10 2.1066784984927556 32.099435502257926 0.0345001220703125 3 0.8671427138618247 3.3476482288506695 6210.0 22.35563665618372 0.0 - - - - - - - 273.3888888888889 12 18 VDAC1 voltage-dependent anion channel 1 501 65 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21855.[MT7]-GYGFGLIK[MT7].2y6_1.heavy 571.844 / 778.494 8146.0 35.895973205566406 37 11 10 6 10 2.1066784984927556 32.099435502257926 0.0345001220703125 3 0.8671427138618247 3.3476482288506695 8146.0 36.34657099616652 0.0 - - - - - - - 256.1764705882353 16 17 VDAC1 voltage-dependent anion channel 1 503 65 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21855.[MT7]-GYGFGLIK[MT7].2b5_1.heavy 571.844 / 626.305 6130.0 35.895973205566406 37 11 10 6 10 2.1066784984927556 32.099435502257926 0.0345001220703125 3 0.8671427138618247 3.3476482288506695 6130.0 12.503997993878254 0.0 - - - - - - - 736.125 12 8 VDAC1 voltage-dependent anion channel 1 505 66 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22219.[MT7]-ALTNLIDQQQQK[MT7].3y3_1.heavy 563.324 / 547.332 34866.0 31.816099166870117 48 18 10 10 10 4.1884252911928535 23.875321403075624 0.0 3 0.9861255573593379 10.465287938423813 34866.0 99.40626122387383 0.0 - - - - - - - 235.2 69 5 BHLHE40 basic helix-loop-helix family, member e40 507 66 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22219.[MT7]-ALTNLIDQQQQK[MT7].3y6_1.heavy 563.324 / 918.476 26378.0 31.816099166870117 48 18 10 10 10 4.1884252911928535 23.875321403075624 0.0 3 0.9861255573593379 10.465287938423813 26378.0 280.2358725980521 0.0 - - - - - - - 224.0 52 7 BHLHE40 basic helix-loop-helix family, member e40 509 66 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22219.[MT7]-ALTNLIDQQQQK[MT7].3b4_1.heavy 563.324 / 544.321 113999.0 31.816099166870117 48 18 10 10 10 4.1884252911928535 23.875321403075624 0.0 3 0.9861255573593379 10.465287938423813 113999.0 172.83156202143948 0.0 - - - - - - - 1212.7142857142858 227 7 BHLHE40 basic helix-loop-helix family, member e40 511 66 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22219.[MT7]-ALTNLIDQQQQK[MT7].3b5_1.heavy 563.324 / 657.405 126797.0 31.816099166870117 48 18 10 10 10 4.1884252911928535 23.875321403075624 0.0 3 0.9861255573593379 10.465287938423813 126797.0 242.38162616607164 0.0 - - - - - - - 740.1111111111111 253 9 BHLHE40 basic helix-loop-helix family, member e40 513 67 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21996.[MT7]-SSQLVTHLHR.3b4_1.heavy 441.253 / 560.316 16534.0 21.274999618530273 45 18 10 7 10 4.844352081495805 20.642595401348842 0.02719879150390625 3 0.9828818094115634 9.419155346113849 16534.0 63.68116038297677 0.0 - - - - - - - 283.7916666666667 33 24 BHLHE40 basic helix-loop-helix family, member e40 515 67 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21996.[MT7]-SSQLVTHLHR.3y4_1.heavy 441.253 / 562.321 9015.0 21.274999618530273 45 18 10 7 10 4.844352081495805 20.642595401348842 0.02719879150390625 3 0.9828818094115634 9.419155346113849 9015.0 33.05019571089917 0.0 - - - - - - - 714.7 18 10 BHLHE40 basic helix-loop-helix family, member e40 517 67 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21996.[MT7]-SSQLVTHLHR.3b3_1.heavy 441.253 / 447.232 18362.0 21.274999618530273 45 18 10 7 10 4.844352081495805 20.642595401348842 0.02719879150390625 3 0.9828818094115634 9.419155346113849 18362.0 34.51055069127103 0.0 - - - - - - - 718.8 36 10 BHLHE40 basic helix-loop-helix family, member e40 519 67 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21996.[MT7]-SSQLVTHLHR.3y5_1.heavy 441.253 / 663.369 13460.0 21.274999618530273 45 18 10 7 10 4.844352081495805 20.642595401348842 0.02719879150390625 3 0.9828818094115634 9.419155346113849 13460.0 82.31561802766622 0.0 - - - - - - - 244.53846153846155 26 26 BHLHE40 basic helix-loop-helix family, member e40 521 68 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21850.[MT7]-NC[CAM]VPVIQR.2b3_1.heavy 565.317 / 518.251 4284.0 24.76789951324463 44 18 10 6 10 2.2394834197903917 34.609454305384105 0.03940010070800781 3 0.9833654542884607 9.555491458770868 4284.0 13.248000000000001 0.0 - - - - - - - 301.26666666666665 8 15 BHLHE40 basic helix-loop-helix family, member e40 523 68 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21850.[MT7]-NC[CAM]VPVIQR.2y5_1.heavy 565.317 / 612.383 8092.0 24.76789951324463 44 18 10 6 10 2.2394834197903917 34.609454305384105 0.03940010070800781 3 0.9833654542884607 9.555491458770868 8092.0 31.474285714285713 0.0 - - - - - - - 237.76923076923077 16 13 BHLHE40 basic helix-loop-helix family, member e40 525 68 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21850.[MT7]-NC[CAM]VPVIQR.2b5_1.heavy 565.317 / 714.372 1368.0 24.76789951324463 44 18 10 6 10 2.2394834197903917 34.609454305384105 0.03940010070800781 3 0.9833654542884607 9.555491458770868 1368.0 5.345546218487395 3.0 - - - - - - - 246.65 2 20 BHLHE40 basic helix-loop-helix family, member e40 527 68 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21850.[MT7]-NC[CAM]VPVIQR.2y7_1.heavy 565.317 / 871.482 2320.0 24.76789951324463 44 18 10 6 10 2.2394834197903917 34.609454305384105 0.03940010070800781 3 0.9833654542884607 9.555491458770868 2320.0 12.191780569491089 1.0 - - - - - - - 146.53333333333333 4 15 BHLHE40 basic helix-loop-helix family, member e40 529 69 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21851.[MT7]-IVPLYGAVR.2y8_1.heavy 566.354 / 874.515 13562.0 35.20119857788086 50 20 10 10 10 17.97055396709298 5.564658729114102 0.0 3 0.9992276890340362 44.40565845513409 13562.0 69.54871794871795 0.0 - - - - - - - 187.05555555555554 27 18 MAP3K14 mitogen-activated protein kinase kinase kinase 14 531 69 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21851.[MT7]-IVPLYGAVR.2y5_1.heavy 566.354 / 565.309 3095.0 35.20119857788086 50 20 10 10 10 17.97055396709298 5.564658729114102 0.0 3 0.9992276890340362 44.40565845513409 3095.0 1.8139194139194137 0.0 - - - - - - - 728.0 6 12 MAP3K14 mitogen-activated protein kinase kinase kinase 14 533 69 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21851.[MT7]-IVPLYGAVR.2y6_1.heavy 566.354 / 678.393 1274.0 35.20119857788086 50 20 10 10 10 17.97055396709298 5.564658729114102 0.0 3 0.9992276890340362 44.40565845513409 1274.0 4.48 6.0 - - - - - - - 277.7894736842105 3 19 MAP3K14 mitogen-activated protein kinase kinase kinase 14 535 69 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21851.[MT7]-IVPLYGAVR.2y7_1.heavy 566.354 / 775.446 36590.0 35.20119857788086 50 20 10 10 10 17.97055396709298 5.564658729114102 0.0 3 0.9992276890340362 44.40565845513409 36590.0 81.85361067503925 0.0 - - - - - - - 197.16666666666666 73 12 MAP3K14 mitogen-activated protein kinase kinase kinase 14 537 70 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38912.[MT7]-EVLQYLAK[MT7].2y4_1.heavy 626.381 / 638.399 6007.0 34.695701599121094 47 17 10 10 10 3.133207188416544 31.9161785309633 0.0 3 0.9745436664330013 7.718605021501994 6007.0 23.50558008914895 0.0 - - - - - - - 155.66666666666666 12 12 BHLHE40 basic helix-loop-helix family, member e40 539 70 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38912.[MT7]-EVLQYLAK[MT7].2b4_1.heavy 626.381 / 614.363 4246.0 34.695701599121094 47 17 10 10 10 3.133207188416544 31.9161785309633 0.0 3 0.9745436664330013 7.718605021501994 4246.0 11.516660231660232 0.0 - - - - - - - 244.9090909090909 8 11 BHLHE40 basic helix-loop-helix family, member e40 541 70 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38912.[MT7]-EVLQYLAK[MT7].2y6_1.heavy 626.381 / 879.542 3936.0 34.695701599121094 47 17 10 10 10 3.133207188416544 31.9161785309633 0.0 3 0.9745436664330013 7.718605021501994 3936.0 73.42153846153846 0.0 - - - - - - - 149.88888888888889 7 9 BHLHE40 basic helix-loop-helix family, member e40 543 70 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38912.[MT7]-EVLQYLAK[MT7].2b5_1.heavy 626.381 / 777.426 2693.0 34.695701599121094 47 17 10 10 10 3.133207188416544 31.9161785309633 0.0 3 0.9745436664330013 7.718605021501994 2693.0 6.796642950339502 0.0 - - - - - - - 149.88888888888889 5 9 BHLHE40 basic helix-loop-helix family, member e40 545 71 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 1902510.0 36.980499267578125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1902510.0 1947.228457889371 0.0 - - - - - - - 445.5 3805 2 547 71 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 969356.0 36.980499267578125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 969356.0 392.6487891826345 0.0 - - - - - - - 377.0 1938 4 549 71 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1340590.0 36.980499267578125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1340590.0 1556.9680618358543 0.0 - - - - - - - 411.0 2681 1 551 72 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21717.[MT7]-GSFQDK[MT7].2y4_1.heavy 485.266 / 681.369 589.0 18.12370014190674 41 16 10 5 10 3.2829646705707525 30.460272964988906 0.04360008239746094 3 0.9681779383294989 6.899851691533537 589.0 3.411254010322221 2.0 - - - - - - - 0.0 1 0 TNFRSF10D tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain 553 72 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21717.[MT7]-GSFQDK[MT7].2y5_1.heavy 485.266 / 768.401 1446.0 18.12370014190674 41 16 10 5 10 3.2829646705707525 30.460272964988906 0.04360008239746094 3 0.9681779383294989 6.899851691533537 1446.0 8.542090903813781 0.0 - - - - - - - 130.8125 2 16 TNFRSF10D tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain 555 72 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21717.[MT7]-GSFQDK[MT7].2b4_1.heavy 485.266 / 564.29 1125.0 18.12370014190674 41 16 10 5 10 3.2829646705707525 30.460272964988906 0.04360008239746094 3 0.9681779383294989 6.899851691533537 1125.0 2.8097808572349336 1.0 - - - - - - - 214.2 2 15 TNFRSF10D tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain 557 72 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21717.[MT7]-GSFQDK[MT7].2b5_1.heavy 485.266 / 679.317 2678.0 18.12370014190674 41 16 10 5 10 3.2829646705707525 30.460272964988906 0.04360008239746094 3 0.9681779383294989 6.899851691533537 2678.0 22.812304715466034 0.0 - - - - - - - 157.2 5 15 TNFRSF10D tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain 559 73 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540992.[MT7]-AASGDAK[MT7].2y4_1.heavy 454.258 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPRY4 sprouty homolog 4 (Drosophila) 561 73 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540992.[MT7]-AASGDAK[MT7].2y5_1.heavy 454.258 / 621.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPRY4 sprouty homolog 4 (Drosophila) 563 73 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540992.[MT7]-AASGDAK[MT7].2y6_1.heavy 454.258 / 692.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPRY4 sprouty homolog 4 (Drosophila) 565 73 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540992.[MT7]-AASGDAK[MT7].2b5_1.heavy 454.258 / 546.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPRY4 sprouty homolog 4 (Drosophila) 567 74 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543141.[MT7]-GSLTDYLK[MT7].2y5_1.heavy 592.842 / 783.437 1289.0 32.76319885253906 48 20 10 10 8 8.715191894233604 11.474216656797298 0.0 4 0.9942283201160219 16.236863753829038 1289.0 4.546472868217054 1.0 - - - - - - - 306.375 3 8 ACVR2B activin A receptor, type IIB 569 74 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543141.[MT7]-GSLTDYLK[MT7].2b6_1.heavy 592.842 / 781.385 1031.0 32.76319885253906 48 20 10 10 8 8.715191894233604 11.474216656797298 0.0 4 0.9942283201160219 16.236863753829038 1031.0 3.2302032982001774 3.0 - - - - - - - 206.4 4 10 ACVR2B activin A receptor, type IIB 571 74 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543141.[MT7]-GSLTDYLK[MT7].2y3_1.heavy 592.842 / 567.362 2320.0 32.76319885253906 48 20 10 10 8 8.715191894233604 11.474216656797298 0.0 4 0.9942283201160219 16.236863753829038 2320.0 4.441739130434783 2.0 - - - - - - - 708.625 4 8 ACVR2B activin A receptor, type IIB 573 74 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543141.[MT7]-GSLTDYLK[MT7].2b5_1.heavy 592.842 / 618.321 3867.0 32.76319885253906 48 20 10 10 8 8.715191894233604 11.474216656797298 0.0 4 0.9942283201160219 16.236863753829038 3867.0 7.836035531070169 0.0 - - - - - - - 241.875 8 8 ACVR2B activin A receptor, type IIB 575 75 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39221.[MT7]-SLPATLPQC[CAM]QAANK[MT7].3b6_1.heavy 596.329 / 727.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 577 75 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39221.[MT7]-SLPATLPQC[CAM]QAANK[MT7].3y6_1.heavy 596.329 / 835.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 579 75 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39221.[MT7]-SLPATLPQC[CAM]QAANK[MT7].3b4_1.heavy 596.329 / 513.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 581 75 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39221.[MT7]-SLPATLPQC[CAM]QAANK[MT7].3y4_1.heavy 596.329 / 547.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 583 76 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39219.[MT7]-K[MT7]PLAGSVDEQNALR.3y7_1.heavy 596.007 / 845.411 4836.0 24.671600341796875 45 15 10 10 10 1.3589169458698886 47.74572186311066 0.0 3 0.9522763759069964 5.626692383848911 4836.0 27.08824742268041 0.0 - - - - - - - 228.6153846153846 9 13 WEE1 WEE1 homolog (S. pombe) 585 76 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39219.[MT7]-K[MT7]PLAGSVDEQNALR.3y6_1.heavy 596.007 / 730.384 3204.0 24.671600341796875 45 15 10 10 10 1.3589169458698886 47.74572186311066 0.0 3 0.9522763759069964 5.626692383848911 3204.0 20.111926425505825 0.0 - - - - - - - 171.25 6 16 WEE1 WEE1 homolog (S. pombe) 587 76 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39219.[MT7]-K[MT7]PLAGSVDEQNALR.3y5_1.heavy 596.007 / 601.342 3146.0 24.671600341796875 45 15 10 10 10 1.3589169458698886 47.74572186311066 0.0 3 0.9522763759069964 5.626692383848911 3146.0 14.308105919507652 0.0 - - - - - - - 190.53333333333333 6 15 WEE1 WEE1 homolog (S. pombe) 589 76 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39219.[MT7]-K[MT7]PLAGSVDEQNALR.3b8_2.heavy 596.007 / 528.818 3787.0 24.671600341796875 45 15 10 10 10 1.3589169458698886 47.74572186311066 0.0 3 0.9522763759069964 5.626692383848911 3787.0 16.103612006861063 0.0 - - - - - - - 204.0 7 16 WEE1 WEE1 homolog (S. pombe) 591 77 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541004.[MT7]-DVFNK[MT7].2b3_1.heavy 455.765 / 506.273 4981.0 24.47474956512451 42 18 10 6 8 5.5017686594442115 18.17597325331778 0.036998748779296875 4 0.981339699260668 9.020391545296036 4981.0 10.938108067429258 1.0 - - - - - - - 730.9166666666666 16 12 CDC37L1;VDAC3 cell division cycle 37 homolog (S. cerevisiae)-like 1;voltage-dependent anion channel 3 593 77 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541004.[MT7]-DVFNK[MT7].2y4_1.heavy 455.765 / 651.395 14038.0 24.47474956512451 42 18 10 6 8 5.5017686594442115 18.17597325331778 0.036998748779296875 4 0.981339699260668 9.020391545296036 14038.0 74.45563615940841 0.0 - - - - - - - 278.4166666666667 28 12 CDC37L1;VDAC3 cell division cycle 37 homolog (S. cerevisiae)-like 1;voltage-dependent anion channel 3 595 77 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541004.[MT7]-DVFNK[MT7].2b4_1.heavy 455.765 / 620.316 2377.0 24.47474956512451 42 18 10 6 8 5.5017686594442115 18.17597325331778 0.036998748779296875 4 0.981339699260668 9.020391545296036 2377.0 7.45745250740096 2.0 - - - - - - - 263.05882352941177 8 17 CDC37L1;VDAC3 cell division cycle 37 homolog (S. cerevisiae)-like 1;voltage-dependent anion channel 3 597 77 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541004.[MT7]-DVFNK[MT7].2y3_1.heavy 455.765 / 552.326 14208.0 24.47474956512451 42 18 10 6 8 5.5017686594442115 18.17597325331778 0.036998748779296875 4 0.981339699260668 9.020391545296036 14208.0 39.357601231156195 0.0 - - - - - - - 707.375 28 8 CDC37L1;VDAC3 cell division cycle 37 homolog (S. cerevisiae)-like 1;voltage-dependent anion channel 3 599 78 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21844.[MT7]-VTGSLETK[MT7].2y4_1.heavy 561.834 / 634.389 2323.0 22.425899505615234 50 20 10 10 10 13.370698553461214 7.479040799563419 0.0 3 0.9949464689547901 17.35329052359633 2323.0 3.984380359960665 1.0 - - - - - - - 203.96153846153845 4 26 VDAC1 voltage-dependent anion channel 1 601 78 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21844.[MT7]-VTGSLETK[MT7].2y3_1.heavy 561.834 / 521.305 4602.0 22.425899505615234 50 20 10 10 10 13.370698553461214 7.479040799563419 0.0 3 0.9949464689547901 17.35329052359633 4602.0 11.95703422053232 1.0 - - - - - - - 654.75 9 16 VDAC1 voltage-dependent anion channel 1 603 78 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21844.[MT7]-VTGSLETK[MT7].2y6_1.heavy 561.834 / 778.443 5917.0 22.425899505615234 50 20 10 10 10 13.370698553461214 7.479040799563419 0.0 3 0.9949464689547901 17.35329052359633 5917.0 42.51965586692195 0.0 - - - - - - - 175.2173913043478 11 23 VDAC1 voltage-dependent anion channel 1 605 78 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21844.[MT7]-VTGSLETK[MT7].2y7_1.heavy 561.834 / 879.49 18892.0 22.425899505615234 50 20 10 10 10 13.370698553461214 7.479040799563419 0.0 3 0.9949464689547901 17.35329052359633 18892.0 140.51063639921722 0.0 - - - - - - - 163.04 37 25 VDAC1 voltage-dependent anion channel 1 607 79 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21848.[MT7]-NAEEFTLR.2y4_1.heavy 562.297 / 536.319 11776.0 29.264699935913086 45 15 10 10 10 1.4087423104125705 47.188010529016616 0.0 3 0.9588613333362656 6.063690801426693 11776.0 8.884571332118764 0.0 - - - - - - - 1246.2222222222222 23 9 UBE2L6 ubiquitin-conjugating enzyme E2L 6 609 79 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21848.[MT7]-NAEEFTLR.2y5_1.heavy 562.297 / 665.362 7477.0 29.264699935913086 45 15 10 10 10 1.4087423104125705 47.188010529016616 0.0 3 0.9588613333362656 6.063690801426693 7477.0 29.28182922042879 0.0 - - - - - - - 724.375 14 8 UBE2L6 ubiquitin-conjugating enzyme E2L 6 611 79 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21848.[MT7]-NAEEFTLR.2b4_1.heavy 562.297 / 588.275 10000.0 29.264699935913086 45 15 10 10 10 1.4087423104125705 47.188010529016616 0.0 3 0.9588613333362656 6.063690801426693 10000.0 27.746968596641796 0.0 - - - - - - - 759.625 20 8 UBE2L6 ubiquitin-conjugating enzyme E2L 6 613 79 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21848.[MT7]-NAEEFTLR.2y7_1.heavy 562.297 / 865.441 16169.0 29.264699935913086 45 15 10 10 10 1.4087423104125705 47.188010529016616 0.0 3 0.9588613333362656 6.063690801426693 16169.0 180.29862141337475 0.0 - - - - - - - 224.13333333333333 32 15 UBE2L6 ubiquitin-conjugating enzyme E2L 6 615 80 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540997.[MT7]-TQSGTK[MT7].2y4_1.heavy 455.266 / 536.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 617 80 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540997.[MT7]-TQSGTK[MT7].2y5_1.heavy 455.266 / 664.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 619 80 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540997.[MT7]-TQSGTK[MT7].2b4_1.heavy 455.266 / 518.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 621 80 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540997.[MT7]-TQSGTK[MT7].2b5_1.heavy 455.266 / 619.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 623 81 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22385.[MT7]-EQGVTFPAIGSQAAEQAK[MT7].3b6_1.heavy 707.379 / 806.417 4201.0 32.4109992980957 48 20 10 10 8 7.550642774120751 13.2439055841368 0.0 4 0.9956115487615231 18.622920097518545 4201.0 31.53402622197756 1.0 - - - - - - - 212.0 8 6 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 625 81 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22385.[MT7]-EQGVTFPAIGSQAAEQAK[MT7].3b4_1.heavy 707.379 / 558.3 3310.0 32.4109992980957 48 20 10 10 8 7.550642774120751 13.2439055841368 0.0 4 0.9956115487615231 18.622920097518545 3310.0 12.913362262937962 1.0 - - - - - - - 241.9 6 10 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 627 81 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22385.[MT7]-EQGVTFPAIGSQAAEQAK[MT7].3b5_1.heavy 707.379 / 659.348 3310.0 32.4109992980957 48 20 10 10 8 7.550642774120751 13.2439055841368 0.0 4 0.9956115487615231 18.622920097518545 3310.0 4.92345136766809 1.0 - - - - - - - 233.5 7 6 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 629 81 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22385.[MT7]-EQGVTFPAIGSQAAEQAK[MT7].3b8_1.heavy 707.379 / 974.506 3056.0 32.4109992980957 48 20 10 10 8 7.550642774120751 13.2439055841368 0.0 4 0.9956115487615231 18.622920097518545 3056.0 16.71776129265363 1.0 - - - - - - - 226.22222222222223 9 9 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 631 82 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542589.[MT7]-ALLLELK[MT7].2y4_1.heavy 544.37 / 646.426 56946.0 39.16640090942383 50 20 10 10 10 11.402615433864037 8.769917794738143 0.0 3 0.9982516403099417 29.51098339684856 56946.0 141.0258453520326 0.0 - - - - - - - 310.54545454545456 113 11 CDC34 cell division cycle 34 homolog (S. cerevisiae) 633 82 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542589.[MT7]-ALLLELK[MT7].2y5_1.heavy 544.37 / 759.51 29419.0 39.16640090942383 50 20 10 10 10 11.402615433864037 8.769917794738143 0.0 3 0.9982516403099417 29.51098339684856 29419.0 124.70348946135832 0.0 - - - - - - - 145.46153846153845 58 13 CDC34 cell division cycle 34 homolog (S. cerevisiae) 635 82 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542589.[MT7]-ALLLELK[MT7].2y3_1.heavy 544.37 / 533.341 38940.0 39.16640090942383 50 20 10 10 10 11.402615433864037 8.769917794738143 0.0 3 0.9982516403099417 29.51098339684856 38940.0 104.15109674965319 0.0 - - - - - - - 726.6363636363636 77 11 CDC34 cell division cycle 34 homolog (S. cerevisiae) 637 82 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542589.[MT7]-ALLLELK[MT7].2y6_1.heavy 544.37 / 872.594 22705.0 39.16640090942383 50 20 10 10 10 11.402615433864037 8.769917794738143 0.0 3 0.9982516403099417 29.51098339684856 22705.0 167.26548399687744 0.0 - - - - - - - 148.6875 45 16 CDC34 cell division cycle 34 homolog (S. cerevisiae) 639 83 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21710.[MT7]-QQPPPPR.2y4_1.heavy 482.278 / 466.277 1129.0 14.121699810028076 40 17 10 3 10 1.4407130149641398 42.05265360648306 0.07040023803710938 3 0.9724336363658374 7.416002862374409 1129.0 3.6120797448165876 0.0 - - - - - - - 226.0 2 23 WEE1 WEE1 homolog (S. pombe) 641 83 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21710.[MT7]-QQPPPPR.2y5_1.heavy 482.278 / 563.33 8049.0 14.121699810028076 40 17 10 3 10 1.4407130149641398 42.05265360648306 0.07040023803710938 3 0.9724336363658374 7.416002862374409 8049.0 86.82067415730337 1.0 - - - - - - - 105.45454545454545 16 11 WEE1 WEE1 homolog (S. pombe) 643 83 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21710.[MT7]-QQPPPPR.2y3_1.heavy 482.278 / 369.224 653.0 14.121699810028076 40 17 10 3 10 1.4407130149641398 42.05265360648306 0.07040023803710938 3 0.9724336363658374 7.416002862374409 653.0 0.19999999999999996 11.0 - - - - - - - 0.0 1 0 WEE1 WEE1 homolog (S. pombe) 645 83 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21710.[MT7]-QQPPPPR.2y6_1.heavy 482.278 / 691.389 3119.0 14.121699810028076 40 17 10 3 10 1.4407130149641398 42.05265360648306 0.07040023803710938 3 0.9724336363658374 7.416002862374409 3119.0 17.92223293492875 0.0 - - - - - - - 182.13333333333333 6 15 WEE1 WEE1 homolog (S. pombe) 647 84 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21845.[MT7]-FQGLIEK[MT7].2y4_1.heavy 561.842 / 646.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 649 84 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21845.[MT7]-FQGLIEK[MT7].2b4_1.heavy 561.842 / 590.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 651 84 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21845.[MT7]-FQGLIEK[MT7].2y3_1.heavy 561.842 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 653 84 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21845.[MT7]-FQGLIEK[MT7].2y6_1.heavy 561.842 / 831.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 655 85 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39114.[MT7]-VPTTLAEYC[CAM]VK[MT7].2y4_1.heavy 784.933 / 713.377 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC34 cell division cycle 34 homolog (S. cerevisiae) 657 85 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39114.[MT7]-VPTTLAEYC[CAM]VK[MT7].2y5_1.heavy 784.933 / 842.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC34 cell division cycle 34 homolog (S. cerevisiae) 659 85 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39114.[MT7]-VPTTLAEYC[CAM]VK[MT7].2y3_1.heavy 784.933 / 550.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC34 cell division cycle 34 homolog (S. cerevisiae) 661 85 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39114.[MT7]-VPTTLAEYC[CAM]VK[MT7].2y6_1.heavy 784.933 / 913.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC34 cell division cycle 34 homolog (S. cerevisiae) 663 86 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542292.[MT7]-TNQSGLER.2y5_1.heavy 524.779 / 561.299 2995.0 16.22142505645752 45 18 10 7 10 2.710310910655127 28.693654532351026 0.029499053955078125 3 0.9806068109695273 8.847760998534731 2995.0 27.391250107545385 0.0 - - - - - - - 143.91304347826087 5 23 ACVR2B activin A receptor, type IIB 665 86 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542292.[MT7]-TNQSGLER.2y6_1.heavy 524.779 / 689.358 1300.0 16.22142505645752 45 18 10 7 10 2.710310910655127 28.693654532351026 0.029499053955078125 3 0.9806068109695273 8.847760998534731 1300.0 8.13849065362161 1.0 - - - - - - - 142.22222222222223 5 18 ACVR2B activin A receptor, type IIB 667 86 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542292.[MT7]-TNQSGLER.2b5_1.heavy 524.779 / 632.312 2049.0 16.22142505645752 45 18 10 7 10 2.710310910655127 28.693654532351026 0.029499053955078125 3 0.9806068109695273 8.847760998534731 2049.0 17.8897461928934 0.0 - - - - - - - 156.17857142857142 4 28 ACVR2B activin A receptor, type IIB 669 86 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542292.[MT7]-TNQSGLER.2y7_1.heavy 524.779 / 803.401 5990.0 16.22142505645752 45 18 10 7 10 2.710310910655127 28.693654532351026 0.029499053955078125 3 0.9806068109695273 8.847760998534731 5990.0 82.46691697060716 0.0 - - - - - - - 119.82608695652173 11 23 ACVR2B activin A receptor, type IIB 671 87 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542598.[MT7]-DNTIPDK[MT7].2y4_1.heavy 545.803 / 616.379 1606.0 20.029399871826172 41 18 10 3 10 5.103547628058969 19.59421314111121 0.0652008056640625 3 0.9839047594928614 9.714700180484082 1606.0 9.879383695527194 1.0 - - - - - - - 211.34782608695653 3 23 CDC25C cell division cycle 25 homolog C (S. pombe) 673 87 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542598.[MT7]-DNTIPDK[MT7].2b4_1.heavy 545.803 / 588.311 4996.0 20.029399871826172 41 18 10 3 10 5.103547628058969 19.59421314111121 0.0652008056640625 3 0.9839047594928614 9.714700180484082 4996.0 12.797230654205606 1.0 - - - - - - - 624.5714285714286 9 7 CDC25C cell division cycle 25 homolog C (S. pombe) 675 87 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542598.[MT7]-DNTIPDK[MT7].2y3_1.heavy 545.803 / 503.295 13516.0 20.029399871826172 41 18 10 3 10 5.103547628058969 19.59421314111121 0.0652008056640625 3 0.9839047594928614 9.714700180484082 13516.0 48.253383177570086 0.0 - - - - - - - 695.8 27 10 CDC25C cell division cycle 25 homolog C (S. pombe) 677 87 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542598.[MT7]-DNTIPDK[MT7].2y6_1.heavy 545.803 / 831.469 1026.0 20.029399871826172 41 18 10 3 10 5.103547628058969 19.59421314111121 0.0652008056640625 3 0.9839047594928614 9.714700180484082 1026.0 3.560373134328358 2.0 - - - - - - - 205.2 2 20 CDC25C cell division cycle 25 homolog C (S. pombe) 679 88 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543748.[MT7]-YLAEVASGEK[MT7].3y3_1.heavy 452.253 / 477.279 75405.0 30.32550048828125 48 18 10 10 10 5.297477700071933 18.876908155487307 0.0 3 0.9890990637110221 11.809599244421761 75405.0 159.60687681704866 0.0 - - - - - - - 763.4 150 10 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 681 88 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543748.[MT7]-YLAEVASGEK[MT7].3b4_1.heavy 452.253 / 621.336 143058.0 30.32550048828125 48 18 10 10 10 5.297477700071933 18.876908155487307 0.0 3 0.9890990637110221 11.809599244421761 143058.0 450.29415800837 0.0 - - - - - - - 287.0 286 9 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 683 88 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543748.[MT7]-YLAEVASGEK[MT7].3b5_1.heavy 452.253 / 720.405 35941.0 30.32550048828125 48 18 10 10 10 5.297477700071933 18.876908155487307 0.0 3 0.9890990637110221 11.809599244421761 35941.0 140.29677103481623 0.0 - - - - - - - 221.66666666666666 71 9 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 685 88 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543748.[MT7]-YLAEVASGEK[MT7].3y4_1.heavy 452.253 / 564.311 102889.0 30.32550048828125 48 18 10 10 10 5.297477700071933 18.876908155487307 0.0 3 0.9890990637110221 11.809599244421761 102889.0 138.26391812910907 0.0 - - - - - - - 318.7142857142857 205 7 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 687 89 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21932.[MT7]-EVLQYLAK[MT7].3y3_1.heavy 417.923 / 475.336 51631.0 34.695701599121094 46 16 10 10 10 1.8534092844904653 37.42913792662525 0.0 3 0.9655282620826646 6.627889299827353 51631.0 172.1033333333333 0.0 - - - - - - - 278.46153846153845 103 13 BHLHE40 basic helix-loop-helix family, member e40 689 89 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21932.[MT7]-EVLQYLAK[MT7].3b4_1.heavy 417.923 / 614.363 76303.0 34.695701599121094 46 16 10 10 10 1.8534092844904653 37.42913792662525 0.0 3 0.9655282620826646 6.627889299827353 76303.0 398.5897972027972 0.0 - - - - - - - 228.7 152 10 BHLHE40 basic helix-loop-helix family, member e40 691 89 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21932.[MT7]-EVLQYLAK[MT7].3y4_1.heavy 417.923 / 638.399 17909.0 34.695701599121094 46 16 10 10 10 1.8534092844904653 37.42913792662525 0.0 3 0.9655282620826646 6.627889299827353 17909.0 109.6185940014286 0.0 - - - - - - - 150.75 35 12 BHLHE40 basic helix-loop-helix family, member e40 693 89 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21932.[MT7]-EVLQYLAK[MT7].3b3_1.heavy 417.923 / 486.304 47153.0 34.695701599121094 46 16 10 10 10 1.8534092844904653 37.42913792662525 0.0 3 0.9655282620826646 6.627889299827353 47153.0 621.5102083179978 0.0 - - - - - - - 190.5 94 10 BHLHE40 basic helix-loop-helix family, member e40 695 90 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22399.[MT7]-RLLDTAGHQQPFLELK[MT7].4y4_1.heavy 539.312 / 646.426 20363.0 33.18280029296875 31 3 8 10 10 0.2848326537643402 134.03903684146502 0.0 3 0.5309270971563316 1.7261651772324047 20363.0 37.41940742193214 0.0 - - - - - - - 699.0 40 8 INHBE inhibin, beta E 697 90 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22399.[MT7]-RLLDTAGHQQPFLELK[MT7].4b7_1.heavy 539.312 / 871.512 5706.0 33.18280029296875 31 3 8 10 10 0.2848326537643402 134.03903684146502 0.0 3 0.5309270971563316 1.7261651772324047 5706.0 95.26982142857142 0.0 - - - - - - - 248.88888888888889 11 9 INHBE inhibin, beta E 699 90 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22399.[MT7]-RLLDTAGHQQPFLELK[MT7].4y3_1.heavy 539.312 / 533.341 N/A 33.18280029296875 31 3 8 10 10 0.2848326537643402 134.03903684146502 0.0 3 0.5309270971563316 1.7261651772324047 27076.0 16.2617270323144 2.0 - - - - - - - 336.0 86 1 INHBE inhibin, beta E 701 90 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22399.[MT7]-RLLDTAGHQQPFLELK[MT7].4b10_2.heavy 539.312 / 632.848 31216.0 33.18280029296875 31 3 8 10 10 0.2848326537643402 134.03903684146502 0.0 3 0.5309270971563316 1.7261651772324047 31216.0 40.358130725670975 1.0 - - - - - - - 308.0 62 4 INHBE inhibin, beta E 703 91 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 624395.0 34.13240051269531 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 624395.0 189.04380757167374 0.0 - - - - - - - 644.6 1248 10 705 91 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 167901.0 34.13240051269531 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 167901.0 403.1630913823019 0.0 - - - - - - - 671.4444444444445 335 9 707 91 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 235082.0 34.13240051269531 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 235082.0 133.88253628496983 0.0 - - - - - - - 705.0 470 9 709 92 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21726.[MT7]-LGVDIGK[MT7].2y4_1.heavy 495.315 / 576.347 3310.0 23.291833241780598 42 18 8 6 10 5.04425325403558 19.82453991975849 0.03249931335449219 3 0.9875771828825193 11.061186110515427 3310.0 11.15723877157001 1.0 - - - - - - - 276.6 6 20 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 711 92 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21726.[MT7]-LGVDIGK[MT7].2y5_1.heavy 495.315 / 675.416 2793.0 23.291833241780598 42 18 8 6 10 5.04425325403558 19.82453991975849 0.03249931335449219 3 0.9875771828825193 11.061186110515427 2793.0 5.672375690607735 1.0 - - - - - - - 272.0 5 23 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 713 92 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21726.[MT7]-LGVDIGK[MT7].2b4_1.heavy 495.315 / 529.31 3982.0 23.291833241780598 42 18 8 6 10 5.04425325403558 19.82453991975849 0.03249931335449219 3 0.9875771828825193 11.061186110515427 3982.0 7.067475329801033 0.0 - - - - - - - 724.1111111111111 7 9 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 715 92 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21726.[MT7]-LGVDIGK[MT7].2y3_1.heavy 495.315 / 461.32 N/A 23.291833241780598 42 18 8 6 10 5.04425325403558 19.82453991975849 0.03249931335449219 3 0.9875771828825193 11.061186110515427 6775.0 6.448537386292118 2.0 - - - - - - - 1168.8 19 10 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 717 93 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21832.[MT7]-EAFEISK[MT7].2y5_1.heavy 556.315 / 767.442 5696.0 28.387049674987793 43 16 10 7 10 16.571031065360454 6.034627513856802 0.029399871826171875 3 0.9606619180631866 6.201856402577213 5696.0 39.92068376068376 0.0 - - - - - - - 242.66666666666666 11 18 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 719 93 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21832.[MT7]-EAFEISK[MT7].2y3_2.heavy 556.315 / 246.169 5227.0 28.387049674987793 43 16 10 7 10 16.571031065360454 6.034627513856802 0.029399871826171875 3 0.9606619180631866 6.201856402577213 5227.0 3.253193914556715 0.0 - - - - - - - 765.8181818181819 10 11 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 721 93 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21832.[MT7]-EAFEISK[MT7].2b4_1.heavy 556.315 / 621.3 10611.0 28.387049674987793 43 16 10 7 10 16.571031065360454 6.034627513856802 0.029399871826171875 3 0.9606619180631866 6.201856402577213 10611.0 16.66814685314685 0.0 - - - - - - - 757.7142857142857 21 7 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 723 93 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21832.[MT7]-EAFEISK[MT7].2y6_1.heavy 556.315 / 838.479 9831.0 28.387049674987793 43 16 10 7 10 16.571031065360454 6.034627513856802 0.029399871826171875 3 0.9606619180631866 6.201856402577213 9831.0 42.01282051282051 0.0 - - - - - - - 175.5 19 20 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 725 94 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21834.[MT7]-SPTEPGPER.2b8_1.heavy 557.286 / 939.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 727 94 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21834.[MT7]-SPTEPGPER.2y8_1.heavy 557.286 / 882.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 729 94 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21834.[MT7]-SPTEPGPER.2y6_1.heavy 557.286 / 684.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 731 94 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21834.[MT7]-SPTEPGPER.2y7_1.heavy 557.286 / 785.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 733 95 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39128.[MT7]-DFASEVSNVLNK[MT7].3b9_2.heavy 537.626 / 547.268 17023.0 38.11800003051758 32 8 10 6 8 0.5631820453929552 95.64890067890153 0.0355987548828125 4 0.7618511010066017 2.4769433569271966 17023.0 29.934997731427078 1.0 - - - - - - - 346.14285714285717 127 7 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 735 95 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39128.[MT7]-DFASEVSNVLNK[MT7].3y3_1.heavy 537.626 / 518.342 87277.0 38.11800003051758 32 8 10 6 8 0.5631820453929552 95.64890067890153 0.0355987548828125 4 0.7618511010066017 2.4769433569271966 87277.0 84.22028997357353 0.0 - - - - - - - 1786.2857142857142 174 7 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 737 95 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39128.[MT7]-DFASEVSNVLNK[MT7].3b4_1.heavy 537.626 / 565.274 9756.0 38.11800003051758 32 8 10 6 8 0.5631820453929552 95.64890067890153 0.0355987548828125 4 0.7618511010066017 2.4769433569271966 9756.0 25.40532581371305 0.0 - - - - - - - 654.75 19 8 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 739 95 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39128.[MT7]-DFASEVSNVLNK[MT7].3b5_1.heavy 537.626 / 694.316 42165.0 38.11800003051758 32 8 10 6 8 0.5631820453929552 95.64890067890153 0.0355987548828125 4 0.7618511010066017 2.4769433569271966 42165.0 150.8163806989285 0.0 - - - - - - - 736.625 84 8 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 741 96 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21722.[MT7]-VSNC[CAM]TPR.2y4_1.heavy 489.251 / 533.25 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10D tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain 743 96 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21722.[MT7]-VSNC[CAM]TPR.2y5_1.heavy 489.251 / 647.293 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10D tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain 745 96 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21722.[MT7]-VSNC[CAM]TPR.2b4_1.heavy 489.251 / 605.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10D tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain 747 96 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21722.[MT7]-VSNC[CAM]TPR.2y6_1.heavy 489.251 / 734.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10D tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain 749 97 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21836.[MT7]-FYVIDC[CAM]R.2y4_1.heavy 558.785 / 563.261 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 751 97 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21836.[MT7]-FYVIDC[CAM]R.2b3_1.heavy 558.785 / 554.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 753 97 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21836.[MT7]-FYVIDC[CAM]R.2y5_1.heavy 558.785 / 662.329 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 755 97 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21836.[MT7]-FYVIDC[CAM]R.2y6_1.heavy 558.785 / 825.392 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 757 98 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542879.[MT7]-TTTYIDPR.2b3_1.heavy 555.799 / 448.252 1447.0 23.6205997467041 41 11 10 10 10 2.618164793200138 38.19469280914579 0.0 3 0.8792106282723191 3.5146034720478383 1447.0 3.8753522109080762 5.0 - - - - - - - 239.8095238095238 2 21 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 759 98 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542879.[MT7]-TTTYIDPR.2b4_1.heavy 555.799 / 611.316 3215.0 23.6205997467041 41 11 10 10 10 2.618164793200138 38.19469280914579 0.0 3 0.8792106282723191 3.5146034720478383 3215.0 8.058933333333334 0.0 - - - - - - - 214.35294117647058 6 17 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 761 98 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542879.[MT7]-TTTYIDPR.2b6_1.heavy 555.799 / 839.427 20252.0 23.6205997467041 41 11 10 10 10 2.618164793200138 38.19469280914579 0.0 3 0.8792106282723191 3.5146034720478383 20252.0 221.00217464081462 0.0 - - - - - - - 167.93333333333334 40 15 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 763 98 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542879.[MT7]-TTTYIDPR.2b5_1.heavy 555.799 / 724.4 1822.0 23.6205997467041 41 11 10 10 10 2.618164793200138 38.19469280914579 0.0 3 0.8792106282723191 3.5146034720478383 1822.0 6.811214953271028 0.0 - - - - - - - 216.8181818181818 3 22 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 765 99 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39102.[MT7]-LSQNNFALGYK[MT7].2y4_1.heavy 771.93 / 624.384 1688.0 32.37342548370361 38 15 10 3 10 2.3974975902276836 33.28218517135311 0.050098419189453125 3 0.954056668999656 5.735538511819307 1688.0 4.977991507850301 0.0 - - - - - - - 230.88888888888889 3 9 VDAC3 voltage-dependent anion channel 3 767 99 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39102.[MT7]-LSQNNFALGYK[MT7].2y5_1.heavy 771.93 / 695.421 2726.0 32.37342548370361 38 15 10 3 10 2.3974975902276836 33.28218517135311 0.050098419189453125 3 0.954056668999656 5.735538511819307 2726.0 4.573948593199232 0.0 - - - - - - - 241.14285714285714 5 7 VDAC3 voltage-dependent anion channel 3 769 99 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39102.[MT7]-LSQNNFALGYK[MT7].2y7_1.heavy 771.93 / 956.532 260.0 32.37342548370361 38 15 10 3 10 2.3974975902276836 33.28218517135311 0.050098419189453125 3 0.954056668999656 5.735538511819307 260.0 0.7999999999999999 13.0 - - - - - - - 0.0 1 0 VDAC3 voltage-dependent anion channel 3 771 99 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39102.[MT7]-LSQNNFALGYK[MT7].2y3_1.heavy 771.93 / 511.3 2726.0 32.37342548370361 38 15 10 3 10 2.3974975902276836 33.28218517135311 0.050098419189453125 3 0.954056668999656 5.735538511819307 2726.0 17.194769230769232 0.0 - - - - - - - 259.6666666666667 5 6 VDAC3 voltage-dependent anion channel 3 773 100 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21828.[MT7]-ASGNLETK[MT7].2b6_1.heavy 554.316 / 716.37 2809.0 17.776199340820312 44 16 10 10 8 2.5497344055197146 31.076740155055973 0.0 4 0.9684870468324016 6.933789916748672 2809.0 17.339506172839506 0.0 - - - - - - - 224.30769230769232 5 13 VDAC3 voltage-dependent anion channel 3 775 100 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21828.[MT7]-ASGNLETK[MT7].2y3_1.heavy 554.316 / 521.305 1566.0 17.776199340820312 44 16 10 10 8 2.5497344055197146 31.076740155055973 0.0 4 0.9684870468324016 6.933789916748672 1566.0 7.567619047619048 3.0 - - - - - - - 228.7058823529412 4 17 VDAC3 voltage-dependent anion channel 3 777 100 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21828.[MT7]-ASGNLETK[MT7].2b5_1.heavy 554.316 / 587.327 1350.0 17.776199340820312 44 16 10 10 8 2.5497344055197146 31.076740155055973 0.0 4 0.9684870468324016 6.933789916748672 1350.0 9.666666666666668 0.0 - - - - - - - 146.57142857142858 2 14 VDAC3 voltage-dependent anion channel 3 779 100 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21828.[MT7]-ASGNLETK[MT7].2y7_1.heavy 554.316 / 892.486 3619.0 17.776199340820312 44 16 10 10 8 2.5497344055197146 31.076740155055973 0.0 4 0.9684870468324016 6.933789916748672 3619.0 44.90240740740741 0.0 - - - - - - - 150.42857142857142 7 14 VDAC3 voltage-dependent anion channel 3 781 101 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22199.[MT7]-ETIQDQLVGSEK[MT7].2y4_1.heavy 817.946 / 564.311 2411.0 28.668450355529785 39 13 10 6 10 1.128052596673112 53.45795195432129 0.030200958251953125 3 0.9215241298256202 4.3763534954399 2411.0 21.446686046511623 0.0 - - - - - - - 186.33333333333334 4 12 TNFRSF10D tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain 783 101 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22199.[MT7]-ETIQDQLVGSEK[MT7].2y5_1.heavy 817.946 / 663.379 1722.0 28.668450355529785 39 13 10 6 10 1.128052596673112 53.45795195432129 0.030200958251953125 3 0.9215241298256202 4.3763534954399 1722.0 7.668906976744187 0.0 - - - - - - - 215.0 3 10 TNFRSF10D tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain 785 101 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22199.[MT7]-ETIQDQLVGSEK[MT7].2b6_1.heavy 817.946 / 859.428 775.0 28.668450355529785 39 13 10 6 10 1.128052596673112 53.45795195432129 0.030200958251953125 3 0.9215241298256202 4.3763534954399 775.0 11.414728682170542 0.0 - - - - - - - 0.0 1 0 TNFRSF10D tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain 787 101 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22199.[MT7]-ETIQDQLVGSEK[MT7].2b5_1.heavy 817.946 / 731.369 2583.0 28.668450355529785 39 13 10 6 10 1.128052596673112 53.45795195432129 0.030200958251953125 3 0.9215241298256202 4.3763534954399 2583.0 10.633540351706213 0.0 - - - - - - - 172.0 5 12 TNFRSF10D tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain 789 102 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21825.[MT7]-IELNAEK[MT7].2y4_1.heavy 552.829 / 605.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 791 102 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21825.[MT7]-IELNAEK[MT7].2y5_1.heavy 552.829 / 718.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 793 102 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21825.[MT7]-IELNAEK[MT7].2b4_1.heavy 552.829 / 614.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 795 102 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21825.[MT7]-IELNAEK[MT7].2y6_1.heavy 552.829 / 847.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 797 103 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 197021.0 22.48973337809245 24 -3 10 7 10 null 0.0 0.028600692749023438 3 0.0 0.0 197021.0 171.12822229935628 0.0 - - - - - - - 314.8888888888889 394 9 799 103 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 359545.0 22.48973337809245 24 -3 10 7 10 null 0.0 0.028600692749023438 3 0.0 0.0 359545.0 2122.8335956563424 0.0 - - - - - - - 208.71428571428572 719 7 801 103 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 1257160.0 22.48973337809245 24 -3 10 7 10 null 0.0 0.028600692749023438 3 0.0 0.0 1257160.0 3528.406272096168 0.0 - - - - - - - 487.0 2514 1 803 104 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21959.[MT7]-GGAPELAPTPAR.3b6_1.heavy 427.574 / 669.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPRY4 sprouty homolog 4 (Drosophila) 805 104 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21959.[MT7]-GGAPELAPTPAR.3b4_1.heavy 427.574 / 427.242 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPRY4 sprouty homolog 4 (Drosophila) 807 104 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21959.[MT7]-GGAPELAPTPAR.3b5_1.heavy 427.574 / 556.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPRY4 sprouty homolog 4 (Drosophila) 809 104 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21959.[MT7]-GGAPELAPTPAR.3y5_1.heavy 427.574 / 541.309 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPRY4 sprouty homolog 4 (Drosophila) 811 105 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543725.[MT7]-EQGFFSFWR.2y8_1.heavy 674.334 / 1074.52 3278.0 45.020851135253906 44 18 10 6 10 6.194325090566521 16.143808814989754 0.03179931640625 3 0.9876020300215312 11.072287619104625 3278.0 84.54535399027202 0.0 - - - - - - - 81.0 6 15 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 813 105 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543725.[MT7]-EQGFFSFWR.2y5_1.heavy 674.334 / 742.367 1032.0 45.020851135253906 44 18 10 6 10 6.194325090566521 16.143808814989754 0.03179931640625 3 0.9876020300215312 11.072287619104625 1032.0 5.8068376068376075 0.0 - - - - - - - 158.38888888888889 2 18 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 815 105 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543725.[MT7]-EQGFFSFWR.2b4_1.heavy 674.334 / 606.3 1305.0 45.020851135253906 44 18 10 6 10 6.194325090566521 16.143808814989754 0.03179931640625 3 0.9876020300215312 11.072287619104625 1305.0 24.079769410916953 0.0 - - - - - - - 130.125 2 24 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 817 105 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543725.[MT7]-EQGFFSFWR.2y7_1.heavy 674.334 / 946.457 1973.0 45.020851135253906 44 18 10 6 10 6.194325090566521 16.143808814989754 0.03179931640625 3 0.9876020300215312 11.072287619104625 1973.0 27.498848412353198 0.0 - - - - - - - 109.25 3 20 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 819 106 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543430.[MT7]-AVVLELTLK[MT7].2y4_1.heavy 637.42 / 618.431 2297.0 39.330101013183594 50 20 10 10 10 3.8454783454141244 20.817108935459302 0.0 3 0.990532584363591 12.673699757089633 2297.0 9.701824871228844 0.0 - - - - - - - 194.05263157894737 4 19 BHLHE41;BHLHE40 basic helix-loop-helix family, member e41;basic helix-loop-helix family, member e40 821 106 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543430.[MT7]-AVVLELTLK[MT7].2y5_1.heavy 637.42 / 747.473 2600.0 39.330101013183594 50 20 10 10 10 3.8454783454141244 20.817108935459302 0.0 3 0.990532584363591 12.673699757089633 2600.0 14.181818181818183 0.0 - - - - - - - 201.46666666666667 5 15 BHLHE41;BHLHE40 basic helix-loop-helix family, member e41;basic helix-loop-helix family, member e40 823 106 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543430.[MT7]-AVVLELTLK[MT7].2y3_1.heavy 637.42 / 505.347 2539.0 39.330101013183594 50 20 10 10 10 3.8454783454141244 20.817108935459302 0.0 3 0.990532584363591 12.673699757089633 2539.0 7.711945426480108 1.0 - - - - - - - 221.55555555555554 5 18 BHLHE41;BHLHE40 basic helix-loop-helix family, member e41;basic helix-loop-helix family, member e40 825 106 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543430.[MT7]-AVVLELTLK[MT7].2y6_1.heavy 637.42 / 860.557 3144.0 39.330101013183594 50 20 10 10 10 3.8454783454141244 20.817108935459302 0.0 3 0.990532584363591 12.673699757089633 3144.0 23.128878133418567 0.0 - - - - - - - 173.13333333333333 6 15 BHLHE41;BHLHE40 basic helix-loop-helix family, member e41;basic helix-loop-helix family, member e40 827 107 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21604.[MT7]-EFDVR.2b4_1.heavy 405.217 / 635.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 829 108 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21954.[MT7]-VDAERDGVK[MT7].2y8_1.heavy 638.859 / 1033.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC34 cell division cycle 34 homolog (S. cerevisiae) 831 108 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21954.[MT7]-VDAERDGVK[MT7].2b6_1.heavy 638.859 / 830.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC34 cell division cycle 34 homolog (S. cerevisiae) 833 108 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21954.[MT7]-VDAERDGVK[MT7].2b5_1.heavy 638.859 / 715.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC34 cell division cycle 34 homolog (S. cerevisiae) 835 108 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21954.[MT7]-VDAERDGVK[MT7].2y7_1.heavy 638.859 / 918.513 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC34 cell division cycle 34 homolog (S. cerevisiae) 837 109 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21605.[MT7]-LDVYR.2b3_1.heavy 405.236 / 472.289 10496.0 26.151199340820312 43 15 10 10 8 2.1581992438865676 36.626339201770435 0.0 4 0.9507245145437272 5.5366521863151785 10496.0 8.075307520114444 1.0 - - - - - - - 334.54545454545456 43 11 VEGFC vascular endothelial growth factor C 839 109 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21605.[MT7]-LDVYR.2y4_1.heavy 405.236 / 552.278 20267.0 26.151199340820312 43 15 10 10 8 2.1581992438865676 36.626339201770435 0.0 4 0.9507245145437272 5.5366521863151785 20267.0 75.10544041247161 0.0 - - - - - - - 237.88888888888889 40 18 VEGFC vascular endothelial growth factor C 841 109 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21605.[MT7]-LDVYR.2y3_1.heavy 405.236 / 437.251 14839.0 26.151199340820312 43 15 10 10 8 2.1581992438865676 36.626339201770435 0.0 4 0.9507245145437272 5.5366521863151785 14839.0 48.416005804479674 0.0 - - - - - - - 283.2307692307692 29 13 VEGFC vascular endothelial growth factor C 843 110 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21953.[MT7]-EK[MT7]PSSPAK[MT7].3y3_1.heavy 425.926 / 459.305 6874.0 14.842425107955933 37 11 10 6 10 1.9011545439294086 52.599616543174136 0.03509998321533203 3 0.8659466472423558 3.3323310121257634 6874.0 34.59017862590245 0.0 - - - - - - - 217.0909090909091 13 22 BHLHE40 basic helix-loop-helix family, member e40 845 110 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21953.[MT7]-EK[MT7]PSSPAK[MT7].3y7_2.heavy 425.926 / 501.813 3184.0 14.842425107955933 37 11 10 6 10 1.9011545439294086 52.599616543174136 0.03509998321533203 3 0.8659466472423558 3.3323310121257634 3184.0 5.592449952335558 1.0 - - - - - - - 764.8571428571429 6 7 BHLHE40 basic helix-loop-helix family, member e40 847 110 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21953.[MT7]-EK[MT7]PSSPAK[MT7].3b5_2.heavy 425.926 / 409.237 4631.0 14.842425107955933 37 11 10 6 10 1.9011545439294086 52.599616543174136 0.03509998321533203 3 0.8659466472423558 3.3323310121257634 4631.0 6.340303811971439 0.0 - - - - - - - 723.4615384615385 9 13 BHLHE40 basic helix-loop-helix family, member e40 849 110 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21953.[MT7]-EK[MT7]PSSPAK[MT7].3y5_1.heavy 425.926 / 633.369 977.0 14.842425107955933 37 11 10 6 10 1.9011545439294086 52.599616543174136 0.03509998321533203 3 0.8659466472423558 3.3323310121257634 977.0 8.621788069353565 0.0 - - - - - - - 0.0 1 0 BHLHE40 basic helix-loop-helix family, member e40 851 111 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21956.[MT7]-TK[MT7]PVAFAVR.2y8_1.heavy 638.903 / 1031.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNB1;CACNB2 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit 853 111 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21956.[MT7]-TK[MT7]PVAFAVR.2b6_1.heavy 638.903 / 932.581 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNB1;CACNB2 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit 855 111 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21956.[MT7]-TK[MT7]PVAFAVR.2b5_1.heavy 638.903 / 785.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNB1;CACNB2 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit 857 111 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21956.[MT7]-TK[MT7]PVAFAVR.2y7_1.heavy 638.903 / 759.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNB1;CACNB2 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit 859 112 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21813.[MT7]-NVNAGGHK[MT7].2y4_1.heavy 542.809 / 542.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC1 voltage-dependent anion channel 1 861 112 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21813.[MT7]-NVNAGGHK[MT7].2y5_1.heavy 542.809 / 613.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC1 voltage-dependent anion channel 1 863 112 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21813.[MT7]-NVNAGGHK[MT7].2y6_1.heavy 542.809 / 727.397 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC1 voltage-dependent anion channel 1 865 112 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21813.[MT7]-NVNAGGHK[MT7].2y7_1.heavy 542.809 / 826.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC1 voltage-dependent anion channel 1 867 113 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 434577.0 31.57159996032715 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 434577.0 677.7702070183337 0.0 - - - - - - - 1305.4285714285713 869 7 869 113 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 462889.0 31.57159996032715 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 462889.0 3852.202528617906 0.0 - - - - - - - 334.4 925 5 871 113 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1040030.0 31.57159996032715 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1040030.0 1932.296327136414 0.0 - - - - - - - 756.0 2080 8 873 114 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21812.[MT7]-GIDSSSVK[MT7].2y6_1.heavy 540.811 / 766.406 867.0 19.768400192260742 38 17 10 10 1 3.507733951275869 28.508433475585278 0.0 18 0.9749205124111174 7.776625425940911 867.0 3.006936416184971 0.0 - - - - - - - 0.0 1 0 WEE1 WEE1 homolog (S. pombe) 875 114 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21812.[MT7]-GIDSSSVK[MT7].2y4_1.heavy 540.811 / 564.347 347.0 19.768400192260742 38 17 10 10 1 3.507733951275869 28.508433475585278 0.0 18 0.9749205124111174 7.776625425940911 347.0 0.0 29.0 - - - - - - - 0.0 1 0 WEE1 WEE1 homolog (S. pombe) 877 114 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21812.[MT7]-GIDSSSVK[MT7].2y5_1.heavy 540.811 / 651.379 2993.0 19.768400192260742 38 17 10 10 1 3.507733951275869 28.508433475585278 0.0 18 0.9749205124111174 7.776625425940911 2993.0 13.031158794162824 0.0 - - - - - - - 188.65 5 20 WEE1 WEE1 homolog (S. pombe) 879 114 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21812.[MT7]-GIDSSSVK[MT7].2b6_1.heavy 540.811 / 691.338 347.0 19.768400192260742 38 17 10 10 1 3.507733951275869 28.508433475585278 0.0 18 0.9749205124111174 7.776625425940911 347.0 1.6046242774566473 24.0 - - - - - - - 0.0 1 0 WEE1 WEE1 homolog (S. pombe) 881 115 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39204.[MT7]-IIALQSGLQAGELSGR.2y6_1.heavy 879.005 / 618.321 6422.0 36.42275047302246 38 12 10 6 10 0.919405634391153 64.73716995654645 0.036899566650390625 3 0.8822431570537167 3.5605117095583467 6422.0 13.546150870406187 0.0 - - - - - - - 191.44444444444446 12 18 BHLHE40 basic helix-loop-helix family, member e40 883 115 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39204.[MT7]-IIALQSGLQAGELSGR.2y10_1.heavy 879.005 / 987.522 8694.0 36.42275047302246 38 12 10 6 10 0.919405634391153 64.73716995654645 0.036899566650390625 3 0.8822431570537167 3.5605117095583467 8694.0 63.158722860198054 0.0 - - - - - - - 150.6153846153846 17 13 BHLHE40 basic helix-loop-helix family, member e40 885 115 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39204.[MT7]-IIALQSGLQAGELSGR.2y11_1.heavy 879.005 / 1074.55 13471.0 36.42275047302246 38 12 10 6 10 0.919405634391153 64.73716995654645 0.036899566650390625 3 0.8822431570537167 3.5605117095583467 13471.0 90.59775398653838 0.0 - - - - - - - 171.375 26 16 BHLHE40 basic helix-loop-helix family, member e40 887 115 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39204.[MT7]-IIALQSGLQAGELSGR.2y7_1.heavy 879.005 / 689.358 7910.0 36.42275047302246 38 12 10 6 10 0.919405634391153 64.73716995654645 0.036899566650390625 3 0.8822431570537167 3.5605117095583467 7910.0 28.1664070718382 0.0 - - - - - - - 256.8888888888889 15 18 BHLHE40 basic helix-loop-helix family, member e40 889 116 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21800.[MT7]-FDC[CAM]VLK[MT7].2b3_1.heavy 535.301 / 567.235 3247.0 30.39234972000122 38 16 10 6 6 2.646769836184328 37.781902541311766 0.03819847106933594 5 0.9699269002521987 7.098700277050331 3247.0 3.6893680620458147 4.0 - - - - - - - 757.7 6 10 SOCS3 suppressor of cytokine signaling 3 891 116 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21800.[MT7]-FDC[CAM]VLK[MT7].2y4_1.heavy 535.301 / 663.398 7577.0 30.39234972000122 38 16 10 6 6 2.646769836184328 37.781902541311766 0.03819847106933594 5 0.9699269002521987 7.098700277050331 7577.0 18.02397729832702 1.0 - - - - - - - 743.4545454545455 15 11 SOCS3 suppressor of cytokine signaling 3 893 116 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21800.[MT7]-FDC[CAM]VLK[MT7].2y5_1.heavy 535.301 / 778.425 7577.0 30.39234972000122 38 16 10 6 6 2.646769836184328 37.781902541311766 0.03819847106933594 5 0.9699269002521987 7.098700277050331 7577.0 71.33117235163616 0.0 - - - - - - - 216.5 15 10 SOCS3 suppressor of cytokine signaling 3 895 116 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21800.[MT7]-FDC[CAM]VLK[MT7].2y3_1.heavy 535.301 / 503.367 3007.0 30.39234972000122 38 16 10 6 6 2.646769836184328 37.781902541311766 0.03819847106933594 5 0.9699269002521987 7.098700277050331 3007.0 2.6850281600281596 3.0 - - - - - - - 1216.0 6 9 SOCS3 suppressor of cytokine signaling 3 897 117 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22417.[MT7]-ALYYLGQALEGLEYLHSR.3b4_1.heavy 747.399 / 655.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K14 mitogen-activated protein kinase kinase kinase 14 899 117 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22417.[MT7]-ALYYLGQALEGLEYLHSR.3y8_1.heavy 747.399 / 974.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K14 mitogen-activated protein kinase kinase kinase 14 901 117 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22417.[MT7]-ALYYLGQALEGLEYLHSR.3y10_1.heavy 747.399 / 1216.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K14 mitogen-activated protein kinase kinase kinase 14 903 117 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22417.[MT7]-ALYYLGQALEGLEYLHSR.3y9_1.heavy 747.399 / 1103.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K14 mitogen-activated protein kinase kinase kinase 14 905 118 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21803.[MT7]-YFSGQGK[MT7].2y4_1.heavy 537.795 / 533.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 907 118 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21803.[MT7]-YFSGQGK[MT7].2y5_1.heavy 537.795 / 620.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 909 118 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21803.[MT7]-YFSGQGK[MT7].2y3_1.heavy 537.795 / 476.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 911 118 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21803.[MT7]-YFSGQGK[MT7].2y6_1.heavy 537.795 / 767.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 913 119 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22414.[MT7]-K[MT7]LETAVNLAWTAGNSNTR.4b7_1.heavy 559.309 / 1044.63 2590.0 34.13240051269531 42 12 10 10 10 1.4594179274803656 68.52046841211998 0.0 3 0.8882579794974726 3.656996422524372 2590.0 32.43356783919598 0.0 - - - - - - - 235.45454545454547 5 11 VDAC1 voltage-dependent anion channel 1 915 119 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22414.[MT7]-K[MT7]LETAVNLAWTAGNSNTR.4b7_2.heavy 559.309 / 522.818 65745.0 34.13240051269531 42 12 10 10 10 1.4594179274803656 68.52046841211998 0.0 3 0.8882579794974726 3.656996422524372 65745.0 59.06001760961849 0.0 - - - - - - - 265.6666666666667 131 3 VDAC1 voltage-dependent anion channel 1 917 119 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22414.[MT7]-K[MT7]LETAVNLAWTAGNSNTR.4b5_1.heavy 559.309 / 831.518 2889.0 34.13240051269531 42 12 10 10 10 1.4594179274803656 68.52046841211998 0.0 3 0.8882579794974726 3.656996422524372 2889.0 15.833153308347757 0.0 - - - - - - - 214.53846153846155 5 13 VDAC1 voltage-dependent anion channel 1 919 119 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22414.[MT7]-K[MT7]LETAVNLAWTAGNSNTR.4y6_1.heavy 559.309 / 648.306 29585.0 34.13240051269531 42 12 10 10 10 1.4594179274803656 68.52046841211998 0.0 3 0.8882579794974726 3.656996422524372 29585.0 93.99916387959865 0.0 - - - - - - - 734.75 59 8 VDAC1 voltage-dependent anion channel 1 921 120 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544729.[MT7]-YVNPETVAALLSGK[MT7].3b6_1.heavy 584.004 / 848.427 10600.0 44.45174980163574 36 10 10 6 10 1.0520202324113246 59.89406689992906 0.030300140380859375 3 0.8336953898908773 2.983314619139475 10600.0 112.33055555555556 0.0 - - - - - - - 150.47619047619048 21 21 CDC25C cell division cycle 25 homolog C (S. pombe) 923 120 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544729.[MT7]-YVNPETVAALLSGK[MT7].3b5_1.heavy 584.004 / 747.379 9221.0 44.45174980163574 36 10 10 6 10 1.0520202324113246 59.89406689992906 0.030300140380859375 3 0.8336953898908773 2.983314619139475 9221.0 140.37413393719805 0.0 - - - - - - - 158.0 18 24 CDC25C cell division cycle 25 homolog C (S. pombe) 925 120 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544729.[MT7]-YVNPETVAALLSGK[MT7].3y4_1.heavy 584.004 / 548.352 40246.0 44.45174980163574 36 10 10 6 10 1.0520202324113246 59.89406689992906 0.030300140380859375 3 0.8336953898908773 2.983314619139475 40246.0 215.2733539764394 0.0 - - - - - - - 664.375 80 8 CDC25C cell division cycle 25 homolog C (S. pombe) 927 120 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544729.[MT7]-YVNPETVAALLSGK[MT7].3b3_1.heavy 584.004 / 521.284 22177.0 44.45174980163574 36 10 10 6 10 1.0520202324113246 59.89406689992906 0.030300140380859375 3 0.8336953898908773 2.983314619139475 22177.0 98.88098183464433 0.0 - - - - - - - 237.83333333333334 44 18 CDC25C cell division cycle 25 homolog C (S. pombe) 929 121 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22413.[MT7]-K[MT7]LETAVNLAWTAGNSNTR.3y8_1.heavy 745.409 / 820.391 12426.0 34.13240051269531 40 10 10 10 10 1.1939199085897527 59.351690817612415 0.0 3 0.8280958116829176 2.9328631688798867 12426.0 42.50123586437773 0.0 - - - - - - - 214.57142857142858 24 7 VDAC1 voltage-dependent anion channel 1 931 121 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22413.[MT7]-K[MT7]LETAVNLAWTAGNSNTR.3b7_1.heavy 745.409 / 1044.63 4710.0 34.13240051269531 40 10 10 10 10 1.1939199085897527 59.351690817612415 0.0 3 0.8280958116829176 2.9328631688798867 4710.0 15.696483342541848 0.0 - - - - - - - 255.0909090909091 9 11 VDAC1 voltage-dependent anion channel 1 933 121 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22413.[MT7]-K[MT7]LETAVNLAWTAGNSNTR.3b7_2.heavy 745.409 / 522.818 31766.0 34.13240051269531 40 10 10 10 10 1.1939199085897527 59.351690817612415 0.0 3 0.8280958116829176 2.9328631688798867 31766.0 83.31673640753954 0.0 - - - - - - - 701.4285714285714 63 7 VDAC1 voltage-dependent anion channel 1 935 121 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22413.[MT7]-K[MT7]LETAVNLAWTAGNSNTR.3y9_1.heavy 745.409 / 1006.47 8918.0 34.13240051269531 40 10 10 10 10 1.1939199085897527 59.351690817612415 0.0 3 0.8280958116829176 2.9328631688798867 8918.0 54.636425962910124 0.0 - - - - - - - 114.28571428571429 17 7 VDAC1 voltage-dependent anion channel 1 937 122 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21698.[MT7]-LQHEQR.2y4_1.heavy 477.766 / 569.279 1579.0 13.822199821472168 43 17 10 6 10 2.713707610792004 29.273064158080903 0.030399322509765625 3 0.9731351622733053 7.512650125775583 1579.0 32.60316154309825 0.0 - - - - - - - 110.5 3 20 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 939 122 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21698.[MT7]-LQHEQR.2b3_1.heavy 477.766 / 523.311 284.0 13.822199821472168 43 17 10 6 10 2.713707610792004 29.273064158080903 0.030399322509765625 3 0.9731351622733053 7.512650125775583 284.0 0.0 13.0 - - - - - - - 0.0 1 0 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 941 122 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21698.[MT7]-LQHEQR.2y5_1.heavy 477.766 / 697.338 3127.0 13.822199821472168 43 17 10 6 10 2.713707610792004 29.273064158080903 0.030399322509765625 3 0.9731351622733053 7.512650125775583 3127.0 50.690315789473686 0.0 - - - - - - - 142.25 6 12 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 943 122 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21698.[MT7]-LQHEQR.2b4_1.heavy 477.766 / 652.354 2211.0 13.822199821472168 43 17 10 6 10 2.713707610792004 29.273064158080903 0.030399322509765625 3 0.9731351622733053 7.512650125775583 2211.0 39.67609022556391 0.0 - - - - - - - 72.92307692307692 4 13 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 945 123 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 309504.0 26.189899444580078 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 309504.0 817.6601284411304 0.0 - - - - - - - 924.3333333333334 619 3 947 123 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 371899.0 26.189899444580078 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 371899.0 1209.2874972074899 0.0 - - - - - - - 934.5 743 2 949 123 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 421815.0 26.189899444580078 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 421815.0 2218.338716668678 0.0 - - - - - - - 1266.0 843 2 951 124 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541940.[MT7]-RSEDSK[MT7].2y4_1.heavy 505.279 / 622.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - BHLHE40 basic helix-loop-helix family, member e40 953 124 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541940.[MT7]-RSEDSK[MT7].2b3_1.heavy 505.279 / 517.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - BHLHE40 basic helix-loop-helix family, member e40 955 124 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541940.[MT7]-RSEDSK[MT7].2y5_1.heavy 505.279 / 709.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - BHLHE40 basic helix-loop-helix family, member e40 957 124 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541940.[MT7]-RSEDSK[MT7].2b4_1.heavy 505.279 / 632.312 N/A N/A - - - - - - - - - 0.0 - - - - - - - BHLHE40 basic helix-loop-helix family, member e40 959 125 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38980.[MT7]-EEGSSGSGPSFR.2b8_1.heavy 670.814 / 835.355 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 961 125 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38980.[MT7]-EEGSSGSGPSFR.2y10_1.heavy 670.814 / 938.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 963 125 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38980.[MT7]-EEGSSGSGPSFR.2y11_1.heavy 670.814 / 1067.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 965 125 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38980.[MT7]-EEGSSGSGPSFR.2b9_1.heavy 670.814 / 932.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 967 126 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22181.[MT7]-LRLFDTPHTPK[MT7].4b4_1.heavy 403.991 / 674.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 969 126 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22181.[MT7]-LRLFDTPHTPK[MT7].4b5_1.heavy 403.991 / 789.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 971 126 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22181.[MT7]-LRLFDTPHTPK[MT7].4b6_1.heavy 403.991 / 890.522 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 973 126 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22181.[MT7]-LRLFDTPHTPK[MT7].4b6_2.heavy 403.991 / 445.764 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 975 127 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39014.[MT7]-RLFDASSFGK[MT7].2y4_1.heavy 708.398 / 582.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 977 127 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39014.[MT7]-RLFDASSFGK[MT7].2b4_1.heavy 708.398 / 676.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 979 127 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39014.[MT7]-RLFDASSFGK[MT7].2y6_1.heavy 708.398 / 740.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 981 127 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39014.[MT7]-RLFDASSFGK[MT7].2b9_1.heavy 708.398 / 1125.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 983 128 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22282.[MT7]-IQC[CAM]EGGSFSLQSDPR.2b4_1.heavy 912.937 / 675.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 985 128 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22282.[MT7]-IQC[CAM]EGGSFSLQSDPR.2b6_1.heavy 912.937 / 789.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 987 128 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22282.[MT7]-IQC[CAM]EGGSFSLQSDPR.2b7_1.heavy 912.937 / 876.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 989 128 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22282.[MT7]-IQC[CAM]EGGSFSLQSDPR.2y11_1.heavy 912.937 / 1150.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 991 129 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38834.[MT7]-GYGFGMVK[MT7].2b4_1.heavy 573.815 / 569.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC3 voltage-dependent anion channel 3 993 129 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38834.[MT7]-GYGFGMVK[MT7].2b6_1.heavy 573.815 / 757.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC3 voltage-dependent anion channel 3 995 129 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38834.[MT7]-GYGFGMVK[MT7].2y6_1.heavy 573.815 / 782.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC3 voltage-dependent anion channel 3 997 129 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38834.[MT7]-GYGFGMVK[MT7].2b5_1.heavy 573.815 / 626.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC3 voltage-dependent anion channel 3 999 130 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21919.[MT7]-VQVMDAC[CAM]LR.2y4_1.heavy 618.321 / 519.271 1991.0 29.983025074005127 33 13 9 3 8 1.704384866784521 46.22662036498496 0.07309913635253906 4 0.9150271274170063 4.203372581856945 1991.0 2.3783276450511943 6.0 - - - - - - - 749.8 6 10 RNF7 ring finger protein 7 1001 130 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21919.[MT7]-VQVMDAC[CAM]LR.2y8_1.heavy 618.321 / 992.465 3045.0 29.983025074005127 33 13 9 3 8 1.704384866784521 46.22662036498496 0.07309913635253906 4 0.9150271274170063 4.203372581856945 3045.0 18.54326923076923 0.0 - - - - - - - 208.0 6 9 RNF7 ring finger protein 7 1003 130 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21919.[MT7]-VQVMDAC[CAM]LR.2y6_1.heavy 618.321 / 765.338 1522.0 29.983025074005127 33 13 9 3 8 1.704384866784521 46.22662036498496 0.07309913635253906 4 0.9150271274170063 4.203372581856945 1522.0 11.707692307692309 1.0 - - - - - - - 175.5 4 10 RNF7 ring finger protein 7 1005 130 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21919.[MT7]-VQVMDAC[CAM]LR.2y7_1.heavy 618.321 / 864.407 937.0 29.983025074005127 33 13 9 3 8 1.704384866784521 46.22662036498496 0.07309913635253906 4 0.9150271274170063 4.203372581856945 937.0 0.0 1.0 - - - - - - - 0.0 1 0 RNF7 ring finger protein 7 1007 131 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543877.[MT7]-LLLQVQASSK[MT7].3b4_1.heavy 458.957 / 612.42 81268.0 33.049800872802734 46 16 10 10 10 1.7707344230818813 41.32709289448165 0.0 3 0.9616129768566146 6.278718290743511 81268.0 122.68243785718886 0.0 - - - - - - - 361.25 162 4 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1009 131 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543877.[MT7]-LLLQVQASSK[MT7].3b5_1.heavy 458.957 / 711.489 19625.0 33.049800872802734 46 16 10 10 10 1.7707344230818813 41.32709289448165 0.0 3 0.9616129768566146 6.278718290743511 19625.0 94.68382001266788 0.0 - - - - - - - 240.77777777777777 39 9 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1011 131 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543877.[MT7]-LLLQVQASSK[MT7].3y4_1.heavy 458.957 / 536.316 89937.0 33.049800872802734 46 16 10 10 10 1.7707344230818813 41.32709289448165 0.0 3 0.9616129768566146 6.278718290743511 89937.0 62.6357103602145 0.0 - - - - - - - 240.625 179 8 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1013 131 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543877.[MT7]-LLLQVQASSK[MT7].3b3_1.heavy 458.957 / 484.362 50567.0 33.049800872802734 46 16 10 10 10 1.7707344230818813 41.32709289448165 0.0 3 0.9616129768566146 6.278718290743511 50567.0 29.221823943235325 0.0 - - - - - - - 265.0 101 5 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1015 132 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22408.[MT7]-FLANEVLQENYTHLPK[MT7].3y3_1.heavy 735.403 / 501.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 1017 132 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22408.[MT7]-FLANEVLQENYTHLPK[MT7].3b6_1.heavy 735.403 / 818.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 1019 132 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22408.[MT7]-FLANEVLQENYTHLPK[MT7].3b4_1.heavy 735.403 / 590.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 1021 132 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22408.[MT7]-FLANEVLQENYTHLPK[MT7].3b5_1.heavy 735.403 / 719.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - WEE1 WEE1 homolog (S. pombe) 1023 133 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544113.[MT7]-AYYIYSGGEK[MT7].3b4_1.heavy 480.253 / 655.357 38106.0 28.61549949645996 48 18 10 10 10 5.018214238407208 19.927407489828536 0.0 3 0.9828220957718499 9.402722626631602 38106.0 82.04954102552797 0.0 - - - - - - - 715.5833333333334 76 12 SOCS3 suppressor of cytokine signaling 3 1025 133 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544113.[MT7]-AYYIYSGGEK[MT7].3y4_1.heavy 480.253 / 534.3 43319.0 28.61549949645996 48 18 10 10 10 5.018214238407208 19.927407489828536 0.0 3 0.9828220957718499 9.402722626631602 43319.0 119.4714718826406 0.0 - - - - - - - 674.6 86 10 SOCS3 suppressor of cytokine signaling 3 1027 133 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544113.[MT7]-AYYIYSGGEK[MT7].3b3_1.heavy 480.253 / 542.273 63484.0 28.61549949645996 48 18 10 10 10 5.018214238407208 19.927407489828536 0.0 3 0.9828220957718499 9.402722626631602 63484.0 73.50249238218728 0.0 - - - - - - - 744.8571428571429 126 14 SOCS3 suppressor of cytokine signaling 3 1029 133 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544113.[MT7]-AYYIYSGGEK[MT7].3y5_1.heavy 480.253 / 621.332 38949.0 28.61549949645996 48 18 10 10 10 5.018214238407208 19.927407489828536 0.0 3 0.9828220957718499 9.402722626631602 38949.0 89.95768470288084 0.0 - - - - - - - 272.55555555555554 77 18 SOCS3 suppressor of cytokine signaling 3 1031 134 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22402.[MT7]-DTSFTVC[CAM]PDVPRTPVGK[MT7].3b5_1.heavy 722.049 / 696.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1033 134 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22402.[MT7]-DTSFTVC[CAM]PDVPRTPVGK[MT7].3y4_1.heavy 722.049 / 544.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1035 134 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22402.[MT7]-DTSFTVC[CAM]PDVPRTPVGK[MT7].3y8_1.heavy 722.049 / 997.628 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1037 134 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22402.[MT7]-DTSFTVC[CAM]PDVPRTPVGK[MT7].3y10_1.heavy 722.049 / 1209.71 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1039 135 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544738.[MT7]-IIALQSGLQAGELSGR.3y7_1.heavy 586.339 / 689.358 121002.0 36.42275047302246 46 20 10 6 10 6.815792352106988 14.671808475662655 0.036899566650390625 3 0.9930580524931328 14.803695699241112 121002.0 88.28197691695439 0.0 - - - - - - - 1247.2857142857142 242 7 BHLHE40 basic helix-loop-helix family, member e40 1041 135 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544738.[MT7]-IIALQSGLQAGELSGR.3y6_1.heavy 586.339 / 618.321 141284.0 36.42275047302246 46 20 10 6 10 6.815792352106988 14.671808475662655 0.036899566650390625 3 0.9930580524931328 14.803695699241112 141284.0 180.03937391304348 0.0 - - - - - - - 290.44444444444446 282 9 BHLHE40 basic helix-loop-helix family, member e40 1043 135 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544738.[MT7]-IIALQSGLQAGELSGR.3b4_1.heavy 586.339 / 555.399 82226.0 36.42275047302246 46 20 10 6 10 6.815792352106988 14.671808475662655 0.036899566650390625 3 0.9930580524931328 14.803695699241112 82226.0 191.41065659035473 0.0 - - - - - - - 787.0 164 9 BHLHE40 basic helix-loop-helix family, member e40 1045 135 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544738.[MT7]-IIALQSGLQAGELSGR.3y8_1.heavy 586.339 / 817.416 68751.0 36.42275047302246 46 20 10 6 10 6.815792352106988 14.671808475662655 0.036899566650390625 3 0.9930580524931328 14.803695699241112 68751.0 364.25529818181815 0.0 - - - - - - - 298.0 137 15 BHLHE40 basic helix-loop-helix family, member e40 1047 136 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38960.[MT7]-GPAVPPELDK[MT7].2y4_1.heavy 655.882 / 648.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPRY4 sprouty homolog 4 (Drosophila) 1049 136 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38960.[MT7]-GPAVPPELDK[MT7].2y5_1.heavy 655.882 / 745.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPRY4 sprouty homolog 4 (Drosophila) 1051 136 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38960.[MT7]-GPAVPPELDK[MT7].2y3_1.heavy 655.882 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPRY4 sprouty homolog 4 (Drosophila) 1053 136 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38960.[MT7]-GPAVPPELDK[MT7].2y6_1.heavy 655.882 / 842.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPRY4 sprouty homolog 4 (Drosophila) 1055 137 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 127863.0 36.03176625569662 23 -3 10 6 10 null 0.0 0.034900665283203125 3 0.0 0.0 127863.0 165.0176785468905 0.0 - - - - - - - 250.46666666666667 255 15 1057 137 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 283804.0 36.03176625569662 23 -3 10 6 10 null 0.0 0.034900665283203125 3 0.0 0.0 283804.0 220.77143512129555 0.0 - - - - - - - 225.625 567 16 1059 137 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 250788.0 36.03176625569662 23 -3 10 6 10 null 0.0 0.034900665283203125 3 0.0 0.0 250788.0 123.12170366422386 0.0 - - - - - - - 234.45454545454547 501 11 1061 138 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22163.[MT7]-VPTTLAEYC[CAM]VK[MT7].3b6_1.heavy 523.625 / 727.447 22107.0 32.33590126037598 45 20 10 5 10 6.393615966238108 15.64060158258743 0.049999237060546875 3 0.9964735225903941 20.77610381016033 22107.0 76.05367795004133 0.0 - - - - - - - 285.77777777777777 44 9 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1063 138 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22163.[MT7]-VPTTLAEYC[CAM]VK[MT7].3y3_1.heavy 523.625 / 550.314 58352.0 32.33590126037598 45 20 10 5 10 6.393615966238108 15.64060158258743 0.049999237060546875 3 0.9964735225903941 20.77610381016033 58352.0 138.45142044526204 0.0 - - - - - - - 716.2857142857143 116 7 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1065 138 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22163.[MT7]-VPTTLAEYC[CAM]VK[MT7].3b4_1.heavy 523.625 / 543.326 25192.0 32.33590126037598 45 20 10 5 10 6.393615966238108 15.64060158258743 0.049999237060546875 3 0.9964735225903941 20.77610381016033 25192.0 25.115734696239837 0.0 - - - - - - - 257.3333333333333 50 3 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1067 138 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22163.[MT7]-VPTTLAEYC[CAM]VK[MT7].3y4_1.heavy 523.625 / 713.377 30847.0 32.33590126037598 45 20 10 5 10 6.393615966238108 15.64060158258743 0.049999237060546875 3 0.9964735225903941 20.77610381016033 30847.0 37.722846025569766 0.0 - - - - - - - 171.66666666666666 61 3 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1069 139 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38966.[MT7]-VC[CAM]ALPTVSGK[MT7].2y4_1.heavy 660.383 / 534.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1071 139 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38966.[MT7]-VC[CAM]ALPTVSGK[MT7].2y8_1.heavy 660.383 / 916.558 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1073 139 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38966.[MT7]-VC[CAM]ALPTVSGK[MT7].2b4_1.heavy 660.383 / 588.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1075 139 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38966.[MT7]-VC[CAM]ALPTVSGK[MT7].2y6_1.heavy 660.383 / 732.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1077 140 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB545050.[MT7]-DTSFTVC[CAM]PDVPRTPVGK[MT7].4y4_1.heavy 541.788 / 544.357 3103.0 29.621574878692627 39 13 10 6 10 2.9185032782383566 34.26413831556879 0.03669929504394531 3 0.9278909682694332 4.567963470694773 3103.0 1.9006125080593164 1.0 - - - - - - - 823.6 6 10 CDC25C cell division cycle 25 homolog C (S. pombe) 1079 140 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB545050.[MT7]-DTSFTVC[CAM]PDVPRTPVGK[MT7].4y10_2.heavy 541.788 / 605.357 55611.0 29.621574878692627 39 13 10 6 10 2.9185032782383566 34.26413831556879 0.03669929504394531 3 0.9278909682694332 4.567963470694773 55611.0 140.16230446927372 0.0 - - - - - - - 735.9166666666666 111 12 CDC25C cell division cycle 25 homolog C (S. pombe) 1081 140 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB545050.[MT7]-DTSFTVC[CAM]PDVPRTPVGK[MT7].4b4_1.heavy 541.788 / 595.284 8831.0 29.621574878692627 39 13 10 6 10 2.9185032782383566 34.26413831556879 0.03669929504394531 3 0.9278909682694332 4.567963470694773 8831.0 9.345026887681197 0.0 - - - - - - - 716.1428571428571 17 7 CDC25C cell division cycle 25 homolog C (S. pombe) 1083 140 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB545050.[MT7]-DTSFTVC[CAM]PDVPRTPVGK[MT7].4b5_1.heavy 541.788 / 696.332 13485.0 29.621574878692627 39 13 10 6 10 2.9185032782383566 34.26413831556879 0.03669929504394531 3 0.9278909682694332 4.567963470694773 13485.0 34.268680693972655 0.0 - - - - - - - 308.1666666666667 26 12 CDC25C cell division cycle 25 homolog C (S. pombe) 1085 141 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540261.[MT7]-LAVEK[MT7].2b3_1.heavy 424.278 / 428.299 2852.0 23.14367437362671 34 20 2 6 6 3.835101623846659 26.07492833519719 0.03209877014160156 6 0.9907271425659883 12.806174357529137 2852.0 9.46485223861245 1.0 - - - - - - - 689.125 12 8 PXMP4;PLA2G4E;DLAT;TNRC18 peroxisomal membrane protein 4, 24kDa;phospholipase A2, group IVE;dihydrolipoamide S-acetyltransferase;trinucleotide repeat containing 18 1087 141 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540261.[MT7]-LAVEK[MT7].2y4_1.heavy 424.278 / 590.363 12928.0 23.14367437362671 34 20 2 6 6 3.835101623846659 26.07492833519719 0.03209877014160156 6 0.9907271425659883 12.806174357529137 12928.0 41.40218974621018 0.0 - - - - - - - 1209.3333333333333 25 9 PXMP4;PLA2G4E;DLAT;TNRC18 peroxisomal membrane protein 4, 24kDa;phospholipase A2, group IVE;dihydrolipoamide S-acetyltransferase;trinucleotide repeat containing 18 1089 141 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540261.[MT7]-LAVEK[MT7].2b4_1.heavy 424.278 / 557.341 1473.0 23.14367437362671 34 20 2 6 6 3.835101623846659 26.07492833519719 0.03209877014160156 6 0.9907271425659883 12.806174357529137 1473.0 2.1703019118624045 7.0 - - - - - - - 1235.7142857142858 4 7 PXMP4;PLA2G4E;DLAT;TNRC18 peroxisomal membrane protein 4, 24kDa;phospholipase A2, group IVE;dihydrolipoamide S-acetyltransferase;trinucleotide repeat containing 18 1091 141 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB540261.[MT7]-LAVEK[MT7].2y3_1.heavy 424.278 / 519.326 4135.0 23.14367437362671 34 20 2 6 6 3.835101623846659 26.07492833519719 0.03209877014160156 6 0.9907271425659883 12.806174357529137 4135.0 13.449049008755157 2.0 - - - - - - - 691.7777777777778 52 9 PXMP4;PLA2G4E;DLAT;TNRC18 peroxisomal membrane protein 4, 24kDa;phospholipase A2, group IVE;dihydrolipoamide S-acetyltransferase;trinucleotide repeat containing 18 1093 142 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541516.[MT7]-IYSLNEGYAK[MT7].3y3_1.heavy 482.601 / 525.315 38207.0 29.86525058746338 46 20 10 6 10 3.727952576319204 21.467129540465823 0.035800933837890625 3 0.9900919986517284 12.388254123968306 38207.0 59.27034169593255 0.0 - - - - - - - 308.0 76 5 FBP2 fructose-1,6-bisphosphatase 2 1095 142 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541516.[MT7]-IYSLNEGYAK[MT7].3b5_1.heavy 482.601 / 735.416 26976.0 29.86525058746338 46 20 10 6 10 3.727952576319204 21.467129540465823 0.035800933837890625 3 0.9900919986517284 12.388254123968306 26976.0 93.54042084995186 0.0 - - - - - - - 264.0 53 10 FBP2 fructose-1,6-bisphosphatase 2 1097 142 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541516.[MT7]-IYSLNEGYAK[MT7].3y4_1.heavy 482.601 / 582.337 39748.0 29.86525058746338 46 20 10 6 10 3.727952576319204 21.467129540465823 0.035800933837890625 3 0.9900919986517284 12.388254123968306 39748.0 57.018607703019434 0.0 - - - - - - - 314.2857142857143 79 7 FBP2 fructose-1,6-bisphosphatase 2 1099 142 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541516.[MT7]-IYSLNEGYAK[MT7].3b3_1.heavy 482.601 / 508.289 33913.0 29.86525058746338 46 20 10 6 10 3.727952576319204 21.467129540465823 0.035800933837890625 3 0.9900919986517284 12.388254123968306 33913.0 56.3777595382494 0.0 - - - - - - - 683.0 67 10 FBP2 fructose-1,6-bisphosphatase 2 1101 143 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22171.[MT7]-GTGGALVLVLYDK[MT7].3y3_1.heavy 531.987 / 569.305 17319.0 40.51060104370117 45 15 10 10 10 1.8258569218097052 38.65507848882771 0.0 3 0.9533629116582683 5.69238392037674 17319.0 78.63014260265756 0.0 - - - - - - - 243.11111111111111 34 18 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1103 143 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22171.[MT7]-GTGGALVLVLYDK[MT7].3b6_1.heavy 531.987 / 601.343 15560.0 40.51060104370117 45 15 10 10 10 1.8258569218097052 38.65507848882771 0.0 3 0.9533629116582683 5.69238392037674 15560.0 63.751970729770356 0.0 - - - - - - - 254.7058823529412 31 17 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1105 143 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22171.[MT7]-GTGGALVLVLYDK[MT7].3y4_1.heavy 531.987 / 682.389 10644.0 40.51060104370117 45 15 10 10 10 1.8258569218097052 38.65507848882771 0.0 3 0.9533629116582683 5.69238392037674 10644.0 81.53028808864265 0.0 - - - - - - - 176.52173913043478 21 23 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1107 143 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22171.[MT7]-GTGGALVLVLYDK[MT7].3b7_1.heavy 531.987 / 700.411 18221.0 40.51060104370117 45 15 10 10 10 1.8258569218097052 38.65507848882771 0.0 3 0.9533629116582683 5.69238392037674 18221.0 70.2279414175638 0.0 - - - - - - - 273.10526315789474 36 19 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1109 144 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38825.[MT7]-VTQLPGPIR.2y8_1.heavy 562.849 / 881.52 14367.0 29.658299446105957 42 16 10 6 10 2.2192925564890893 39.1272189376723 0.036800384521484375 3 0.962988329478548 6.395055914707411 14367.0 42.94459409020217 0.0 - - - - - - - 566.5714285714286 28 7 SOCS3 suppressor of cytokine signaling 3 1111 144 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38825.[MT7]-VTQLPGPIR.2y5_1.heavy 562.849 / 539.33 21551.0 29.658299446105957 42 16 10 6 10 2.2192925564890893 39.1272189376723 0.036800384521484375 3 0.962988329478548 6.395055914707411 21551.0 20.764706972646046 0.0 - - - - - - - 1200.9 43 10 SOCS3 suppressor of cytokine signaling 3 1113 144 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38825.[MT7]-VTQLPGPIR.2b4_1.heavy 562.849 / 586.368 8792.0 29.658299446105957 42 16 10 6 10 2.2192925564890893 39.1272189376723 0.036800384521484375 3 0.962988329478548 6.395055914707411 8792.0 13.084307982173268 0.0 - - - - - - - 286.0 17 9 SOCS3 suppressor of cytokine signaling 3 1115 144 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38825.[MT7]-VTQLPGPIR.2y6_1.heavy 562.849 / 652.414 5147.0 29.658299446105957 42 16 10 6 10 2.2192925564890893 39.1272189376723 0.036800384521484375 3 0.962988329478548 6.395055914707411 5147.0 19.782252969943485 0.0 - - - - - - - 272.0769230769231 10 13 SOCS3 suppressor of cytokine signaling 3 1117 145 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22173.[MT7]-RAYYIYSGGEK[MT7].3b4_1.heavy 532.287 / 698.374 24959.0 25.343299865722656 44 14 10 10 10 1.3130538043925142 54.209342434221945 0.0 3 0.9338261171753854 4.770836701692893 24959.0 91.70642754626805 0.0 - - - - - - - 272.6 49 15 SOCS3 suppressor of cytokine signaling 3 1119 145 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22173.[MT7]-RAYYIYSGGEK[MT7].3b5_1.heavy 532.287 / 811.458 23035.0 25.343299865722656 44 14 10 10 10 1.3130538043925142 54.209342434221945 0.0 3 0.9338261171753854 4.770836701692893 23035.0 271.23473547717845 0.0 - - - - - - - 175.69230769230768 46 13 SOCS3 suppressor of cytokine signaling 3 1121 145 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22173.[MT7]-RAYYIYSGGEK[MT7].3y4_1.heavy 532.287 / 534.3 39454.0 25.343299865722656 44 14 10 10 10 1.3130538043925142 54.209342434221945 0.0 3 0.9338261171753854 4.770836701692893 39454.0 67.66600766674202 0.0 - - - - - - - 695.7142857142857 78 7 SOCS3 suppressor of cytokine signaling 3 1123 145 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22173.[MT7]-RAYYIYSGGEK[MT7].3y5_1.heavy 532.287 / 621.332 45588.0 25.343299865722656 44 14 10 10 10 1.3130538043925142 54.209342434221945 0.0 3 0.9338261171753854 4.770836701692893 45588.0 120.51611043998429 0.0 - - - - - - - 669.0 91 8 SOCS3 suppressor of cytokine signaling 3 1125 146 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 251065.0 38.965999603271484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 251065.0 182.11228870527142 0.0 - - - - - - - 297.2 502 10 1127 146 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 454293.0 38.965999603271484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 454293.0 215.896994961188 0.0 - - - - - - - 250.25 908 8 1129 146 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 592259.0 38.965999603271484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 592259.0 246.5258953494319 0.0 - - - - - - - 242.625 1184 8 1131 147 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22152.[MT7]-LSQNNFALGYK[MT7].3y3_1.heavy 514.955 / 511.3 83676.0 32.36090087890625 47 17 10 10 10 4.193711212350521 23.84522799412106 0.0 3 0.9744506558383742 7.704482410475677 83676.0 80.88590280859052 0.0 - - - - - - - 302.0 167 3 VDAC3 voltage-dependent anion channel 3 1133 147 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22152.[MT7]-LSQNNFALGYK[MT7].3b4_1.heavy 514.955 / 587.327 16942.0 32.36090087890625 47 17 10 10 10 4.193711212350521 23.84522799412106 0.0 3 0.9744506558383742 7.704482410475677 16942.0 28.01953421819978 1.0 - - - - - - - 302.0 43 3 VDAC3 voltage-dependent anion channel 3 1135 147 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22152.[MT7]-LSQNNFALGYK[MT7].3b5_1.heavy 514.955 / 701.37 46817.0 32.36090087890625 47 17 10 10 10 4.193711212350521 23.84522799412106 0.0 3 0.9744506558383742 7.704482410475677 46817.0 56.88761446227681 0.0 - - - - - - - 388.0 93 1 VDAC3 voltage-dependent anion channel 3 1137 147 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22152.[MT7]-LSQNNFALGYK[MT7].3y4_1.heavy 514.955 / 624.384 36083.0 32.36090087890625 47 17 10 10 10 4.193711212350521 23.84522799412106 0.0 3 0.9744506558383742 7.704482410475677 36083.0 43.23176105723713 0.0 - - - - - - - 259.0 72 3 VDAC3 voltage-dependent anion channel 3 1139 148 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543355.[MT7]-DLLPEHLK[MT7].3y3_1.heavy 418.255 / 541.358 20498.0 29.501100540161133 50 20 10 10 10 3.343223509184224 22.597662928839643 0.0 3 0.9938482964508122 15.726851331432519 20498.0 119.65837563451777 0.0 - - - - - - - 269.46666666666664 40 15 BHLHE41;BHLHE40 basic helix-loop-helix family, member e41;basic helix-loop-helix family, member e40 1141 148 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543355.[MT7]-DLLPEHLK[MT7].3b5_1.heavy 418.255 / 712.4 12811.0 29.501100540161133 50 20 10 10 10 3.343223509184224 22.597662928839643 0.0 3 0.9938482964508122 15.726851331432519 12811.0 183.41216325693483 0.0 - - - - - - - 197.22222222222223 25 9 BHLHE41;BHLHE40 basic helix-loop-helix family, member e41;basic helix-loop-helix family, member e40 1143 148 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543355.[MT7]-DLLPEHLK[MT7].3b3_1.heavy 418.255 / 486.304 56764.0 29.501100540161133 50 20 10 10 10 3.343223509184224 22.597662928839643 0.0 3 0.9938482964508122 15.726851331432519 56764.0 86.43350189416297 0.0 - - - - - - - 755.3333333333334 113 9 BHLHE41;BHLHE40 basic helix-loop-helix family, member e41;basic helix-loop-helix family, member e40 1145 148 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543355.[MT7]-DLLPEHLK[MT7].3y5_1.heavy 418.255 / 767.453 4139.0 29.501100540161133 50 20 10 10 10 3.343223509184224 22.597662928839643 0.0 3 0.9938482964508122 15.726851331432519 4139.0 48.80509819002204 0.0 - - - - - - - 148.0 8 6 BHLHE41;BHLHE40 basic helix-loop-helix family, member e41;basic helix-loop-helix family, member e40 1147 149 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541233.[MT7]-LAPQAER.2y5_1.heavy 464.77 / 600.31 31270.0 19.09469985961914 46 20 10 6 10 137.99046259704258 0.724687765501724 0.03820037841796875 3 0.999242685431504 44.84322126248299 31270.0 72.2742321707444 0.0 - - - - - - - 684.4285714285714 62 7 INHBE inhibin, beta E 1149 149 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541233.[MT7]-LAPQAER.2b4_1.heavy 464.77 / 554.342 3175.0 19.09469985961914 46 20 10 6 10 137.99046259704258 0.724687765501724 0.03820037841796875 3 0.999242685431504 44.84322126248299 3175.0 8.346165121733303 0.0 - - - - - - - 181.625 6 16 INHBE inhibin, beta E 1151 149 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541233.[MT7]-LAPQAER.2y6_1.heavy 464.77 / 671.347 39936.0 19.09469985961914 46 20 10 6 10 137.99046259704258 0.724687765501724 0.03820037841796875 3 0.999242685431504 44.84322126248299 39936.0 211.7122434511974 0.0 - - - - - - - 205.1875 79 16 INHBE inhibin, beta E 1153 149 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541233.[MT7]-LAPQAER.2b5_1.heavy 464.77 / 625.379 3606.0 19.09469985961914 46 20 10 6 10 137.99046259704258 0.724687765501724 0.03820037841796875 3 0.999242685431504 44.84322126248299 3606.0 17.07809133537542 0.0 - - - - - - - 237.89473684210526 7 19 INHBE inhibin, beta E 1155 150 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 661822.0 34.17599868774414 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 661822.0 161.47492315700333 1.0 - - - - - - - 721.25 1400 12 1157 150 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 112505.0 34.17599868774414 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 112505.0 188.69139685064607 1.0 - - - - - - - 729.75 388 12 1159 150 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 83692.0 34.17599868774414 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 83692.0 119.31588106585787 0.0 - - - - - - - 629.5454545454545 167 11 1161 151 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543502.[MT7]-GGAPELAPTPAR.2y5_1.heavy 640.858 / 541.309 1781.0 23.726200103759766 50 20 10 10 10 14.844249345993038 6.73661548450029 0.0 3 0.9953585494118049 18.10787055380295 1781.0 7.354378109452735 0.0 - - - - - - - 182.2941176470588 3 17 SPRY4 sprouty homolog 4 (Drosophila) 1163 151 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543502.[MT7]-GGAPELAPTPAR.2y9_1.heavy 640.858 / 951.526 4080.0 23.726200103759766 50 20 10 10 10 14.844249345993038 6.73661548450029 0.0 3 0.9953585494118049 18.10787055380295 4080.0 102.78114416475972 0.0 - - - - - - - 93.81818181818181 8 11 SPRY4 sprouty homolog 4 (Drosophila) 1165 151 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543502.[MT7]-GGAPELAPTPAR.2b5_1.heavy 640.858 / 556.285 1781.0 23.726200103759766 50 20 10 10 10 14.844249345993038 6.73661548450029 0.0 3 0.9953585494118049 18.10787055380295 1781.0 17.861623188405797 0.0 - - - - - - - 178.66666666666666 3 18 SPRY4 sprouty homolog 4 (Drosophila) 1167 151 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543502.[MT7]-GGAPELAPTPAR.2y7_1.heavy 640.858 / 725.43 919.0 23.726200103759766 50 20 10 10 10 14.844249345993038 6.73661548450029 0.0 3 0.9953585494118049 18.10787055380295 919.0 3.676 0.0 - - - - - - - 0.0 1 0 SPRY4 sprouty homolog 4 (Drosophila) 1169 152 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22016.[MT7]-EQGFFSFWR.3y3_1.heavy 449.892 / 508.267 26884.0 45.020851135253906 41 15 10 6 10 2.3192565726537544 34.76441883510306 0.03179931640625 3 0.9568687416428762 5.9209697317747345 26884.0 134.00820711128966 0.0 - - - - - - - 142.94117647058823 53 17 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1171 152 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22016.[MT7]-EQGFFSFWR.3b4_1.heavy 449.892 / 606.3 36269.0 45.020851135253906 41 15 10 6 10 2.3192565726537544 34.76441883510306 0.03179931640625 3 0.9568687416428762 5.9209697317747345 36269.0 333.677251436296 0.0 - - - - - - - 169.0 72 16 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1173 152 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22016.[MT7]-EQGFFSFWR.3b3_1.heavy 449.892 / 459.232 58047.0 45.020851135253906 41 15 10 6 10 2.3192565726537544 34.76441883510306 0.03179931640625 3 0.9568687416428762 5.9209697317747345 58047.0 636.4591169916436 0.0 - - - - - - - 157.83333333333334 116 18 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1175 152 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22016.[MT7]-EQGFFSFWR.3y4_1.heavy 449.892 / 595.299 44632.0 45.020851135253906 41 15 10 6 10 2.3192565726537544 34.76441883510306 0.03179931640625 3 0.9568687416428762 5.9209697317747345 44632.0 484.0951829702228 0.0 - - - - - - - 122.5625 89 16 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1177 153 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544756.[MT7]-QQILDGLHLTSRPR.4y5_1.heavy 445.259 / 616.352 6970.0 31.09239959716797 38 8 10 10 10 0.748641113851149 77.56240495939156 0.0 3 0.7882670472394097 2.6332322021674828 6970.0 23.104109247883112 1.0 - - - - - - - 669.8571428571429 25 7 INHBE inhibin, beta E 1179 153 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544756.[MT7]-QQILDGLHLTSRPR.4y10_2.heavy 445.259 / 576.318 38146.0 31.09239959716797 38 8 10 10 10 0.748641113851149 77.56240495939156 0.0 3 0.7882670472394097 2.6332322021674828 38146.0 52.98336687720128 0.0 - - - - - - - 732.3333333333334 76 9 INHBE inhibin, beta E 1181 153 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544756.[MT7]-QQILDGLHLTSRPR.4y9_2.heavy 445.259 / 518.804 37766.0 31.09239959716797 38 8 10 10 10 0.748641113851149 77.56240495939156 0.0 3 0.7882670472394097 2.6332322021674828 37766.0 71.6531689665941 0.0 - - - - - - - 269.125 75 8 INHBE inhibin, beta E 1183 153 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544756.[MT7]-QQILDGLHLTSRPR.4b3_1.heavy 445.259 / 514.311 20024.0 31.09239959716797 38 8 10 10 10 0.748641113851149 77.56240495939156 0.0 3 0.7882670472394097 2.6332322021674828 20024.0 161.89223046505688 0.0 - - - - - - - 287.06666666666666 40 15 INHBE inhibin, beta E 1185 154 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38681.[MT7]-DC[CAM]LTK[MT7].2b3_1.heavy 462.757 / 533.251 N/A 18.921199798583984 43 17 6 10 10 7.656203022923834 13.06130463110563 0.0 2 0.9741288192442854 7.656203396031925 1111.0 2.101891891891892 8.0 - - - - - - - 264.5625 9 16 MAST1;MAP2K7;TPST2;TPST1 microtubule associated serine/threonine kinase 1;mitogen-activated protein kinase kinase 7;tyrosylprotein sulfotransferase 2;tyrosylprotein sulfotransferase 1 1187 154 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38681.[MT7]-DC[CAM]LTK[MT7].2y4_1.heavy 462.757 / 665.377 3175.0 18.921199798583984 43 17 6 10 10 7.656203022923834 13.06130463110563 0.0 2 0.9741288192442854 7.656203396031925 3175.0 16.367197858235592 0.0 - - - - - - - 177.58823529411765 6 17 MAST1;MAP2K7;TPST2;TPST1 microtubule associated serine/threonine kinase 1;mitogen-activated protein kinase kinase 7;tyrosylprotein sulfotransferase 2;tyrosylprotein sulfotransferase 1 1189 154 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38681.[MT7]-DC[CAM]LTK[MT7].2y3_1.heavy 462.757 / 505.347 1482.0 18.921199798583984 43 17 6 10 10 7.656203022923834 13.06130463110563 0.0 2 0.9741288192442854 7.656203396031925 1482.0 7.362854322071083 0.0 - - - - - - - 245.10526315789474 2 19 MAST1;MAP2K7;TPST2;TPST1 microtubule associated serine/threonine kinase 1;mitogen-activated protein kinase kinase 7;tyrosylprotein sulfotransferase 2;tyrosylprotein sulfotransferase 1 1191 155 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39316.[MT7]-MDLADLLTQNPELFRK[MT7].3b6_1.heavy 731.404 / 803.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2L6 ubiquitin-conjugating enzyme E2L 6 1193 155 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39316.[MT7]-MDLADLLTQNPELFRK[MT7].3b5_1.heavy 731.404 / 690.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2L6 ubiquitin-conjugating enzyme E2L 6 1195 155 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39316.[MT7]-MDLADLLTQNPELFRK[MT7].3b3_1.heavy 731.404 / 504.261 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2L6 ubiquitin-conjugating enzyme E2L 6 1197 155 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39316.[MT7]-MDLADLLTQNPELFRK[MT7].3b7_1.heavy 731.404 / 916.493 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2L6 ubiquitin-conjugating enzyme E2L 6 1199 156 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39317.[MT7]-WNTDNTLGTEISWENK[MT7].2b3_1.heavy 1098.54 / 546.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC3 voltage-dependent anion channel 3 1201 156 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39317.[MT7]-WNTDNTLGTEISWENK[MT7].2y5_1.heavy 1098.54 / 807.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC3 voltage-dependent anion channel 3 1203 156 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39317.[MT7]-WNTDNTLGTEISWENK[MT7].2b4_1.heavy 1098.54 / 661.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC3 voltage-dependent anion channel 3 1205 156 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39317.[MT7]-WNTDNTLGTEISWENK[MT7].2y6_1.heavy 1098.54 / 920.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC3 voltage-dependent anion channel 3 1207 157 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22150.[MT7]-DTSFTVC[CAM]PDVPR.3y6_1.heavy 513.253 / 743.351 11090.0 30.27775001525879 44 18 10 6 10 5.611609668813321 17.82019882026949 0.03820037841796875 3 0.983909835778045 9.71623663940946 11090.0 21.681898246227096 0.0 - - - - - - - 723.2857142857143 22 7 CDC25C cell division cycle 25 homolog C (S. pombe) 1209 157 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22150.[MT7]-DTSFTVC[CAM]PDVPR.3b4_1.heavy 513.253 / 595.284 7474.0 30.27775001525879 44 18 10 6 10 5.611609668813321 17.82019882026949 0.03820037841796875 3 0.983909835778045 9.71623663940946 7474.0 11.64152995391705 0.0 - - - - - - - 331.5 14 12 CDC25C cell division cycle 25 homolog C (S. pombe) 1211 157 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22150.[MT7]-DTSFTVC[CAM]PDVPR.3b5_1.heavy 513.253 / 696.332 8679.0 30.27775001525879 44 18 10 6 10 5.611609668813321 17.82019882026949 0.03820037841796875 3 0.983909835778045 9.71623663940946 8679.0 23.228029045643154 0.0 - - - - - - - 334.0 17 13 CDC25C cell division cycle 25 homolog C (S. pombe) 1213 157 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22150.[MT7]-DTSFTVC[CAM]PDVPR.3y5_1.heavy 513.253 / 583.32 26640.0 30.27775001525879 44 18 10 6 10 5.611609668813321 17.82019882026949 0.03820037841796875 3 0.983909835778045 9.71623663940946 26640.0 38.64487920503236 0.0 - - - - - - - 813.625 53 8 CDC25C cell division cycle 25 homolog C (S. pombe) 1215 158 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22009.[MT7]-SIDNEWRK[MT7].3b4_1.heavy 445.913 / 574.295 11653.0 23.972700119018555 47 17 10 10 10 3.2261471964361337 30.99672578810669 0.0 3 0.9768739300350375 8.099737055414048 11653.0 13.956113397085101 1.0 - - - - - - - 724.1428571428571 23 14 VEGFC vascular endothelial growth factor C 1217 158 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22009.[MT7]-SIDNEWRK[MT7].3y7_2.heavy 445.913 / 552.799 14100.0 23.972700119018555 47 17 10 10 10 3.2261471964361337 30.99672578810669 0.0 3 0.9768739300350375 8.099737055414048 14100.0 30.39357585139319 0.0 - - - - - - - 717.0 28 13 VEGFC vascular endothelial growth factor C 1219 158 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22009.[MT7]-SIDNEWRK[MT7].3b5_1.heavy 445.913 / 703.338 18178.0 23.972700119018555 47 17 10 10 10 3.2261471964361337 30.99672578810669 0.0 3 0.9768739300350375 8.099737055414048 18178.0 44.29411492682883 0.0 - - - - - - - 291.3529411764706 36 17 VEGFC vascular endothelial growth factor C 1221 158 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22009.[MT7]-SIDNEWRK[MT7].3b3_1.heavy 445.913 / 460.252 29131.0 23.972700119018555 47 17 10 10 10 3.2261471964361337 30.99672578810669 0.0 3 0.9768739300350375 8.099737055414048 29131.0 37.99482869113595 0.0 - - - - - - - 739.0625 58 16 VEGFC vascular endothelial growth factor C 1223 159 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22000.[MT7]-DREYTDIIR.3b6_2.heavy 442.237 / 462.713 21445.0 26.53569984436035 50 20 10 10 10 6.144441256670165 16.2748728196309 0.0 3 0.9910575776708617 13.04099151843585 21445.0 33.683142276046965 0.0 - - - - - - - 707.0 42 8 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1225 159 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22000.[MT7]-DREYTDIIR.3b6_1.heavy 442.237 / 924.418 N/A 26.53569984436035 50 20 10 10 10 6.144441256670165 16.2748728196309 0.0 3 0.9910575776708617 13.04099151843585 0.0 0.0 2.0 - - - - - - - 0.0 0 0 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1227 159 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22000.[MT7]-DREYTDIIR.3y4_1.heavy 442.237 / 516.314 6589.0 26.53569984436035 50 20 10 10 10 6.144441256670165 16.2748728196309 0.0 3 0.9910575776708617 13.04099151843585 6589.0 17.807253854251336 0.0 - - - - - - - 327.1578947368421 13 19 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1229 159 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22000.[MT7]-DREYTDIIR.3y5_1.heavy 442.237 / 617.362 4724.0 26.53569984436035 50 20 10 10 10 6.144441256670165 16.2748728196309 0.0 3 0.9910575776708617 13.04099151843585 4724.0 17.094736515434946 0.0 - - - - - - - 238.22222222222223 9 18 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1231 160 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21655.[MT7]-TSLSAK[MT7].2y4_1.heavy 447.779 / 562.368 1140.0 17.931999683380127 38 12 10 6 10 1.7776794799183067 42.653145989469564 0.03999900817871094 3 0.8929132112745949 3.737148939814068 1140.0 2.5848847926267284 3.0 - - - - - - - 251.3684210526316 2 19 VDAC3 voltage-dependent anion channel 3 1233 160 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21655.[MT7]-TSLSAK[MT7].2y5_1.heavy 447.779 / 649.4 4558.0 17.931999683380127 38 12 10 6 10 1.7776794799183067 42.653145989469564 0.03999900817871094 3 0.8929132112745949 3.737148939814068 4558.0 20.62602754381352 0.0 - - - - - - - 249.6 9 15 VDAC3 voltage-dependent anion channel 3 1235 160 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21655.[MT7]-TSLSAK[MT7].2b4_1.heavy 447.779 / 533.305 760.0 17.931999683380127 38 12 10 6 10 1.7776794799183067 42.653145989469564 0.03999900817871094 3 0.8929132112745949 3.737148939814068 760.0 2.0319018404907974 15.0 - - - - - - - 268.3888888888889 2 18 VDAC3 voltage-dependent anion channel 3 1237 160 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21655.[MT7]-TSLSAK[MT7].2y3_1.heavy 447.779 / 449.284 2768.0 17.931999683380127 38 12 10 6 10 1.7776794799183067 42.653145989469564 0.03999900817871094 3 0.8929132112745949 3.737148939814068 2768.0 11.007995658793206 0.0 - - - - - - - 246.23076923076923 5 13 VDAC3 voltage-dependent anion channel 3 1239 161 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22132.[MT7]-ASYFGAYDTVK[MT7].3y3_1.heavy 503.932 / 491.331 N/A 31.91469955444336 41 13 8 10 10 1.418527887029445 55.443454844073585 0.0 3 0.9230433602650548 4.419916023427988 17019.0 8.534365498217145 2.0 - - - - - - - 393.0 52 2 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1241 161 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22132.[MT7]-ASYFGAYDTVK[MT7].3b6_1.heavy 503.932 / 741.369 13484.0 31.91469955444336 41 13 8 10 10 1.418527887029445 55.443454844073585 0.0 3 0.9230433602650548 4.419916023427988 13484.0 67.09743822628482 0.0 - - - - - - - 241.84615384615384 26 13 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1243 161 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22132.[MT7]-ASYFGAYDTVK[MT7].3b4_1.heavy 503.932 / 613.31 7069.0 31.91469955444336 41 13 8 10 10 1.418527887029445 55.443454844073585 0.0 3 0.9230433602650548 4.419916023427988 7069.0 13.292095173150152 0.0 - - - - - - - 318.14285714285717 14 7 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1245 161 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22132.[MT7]-ASYFGAYDTVK[MT7].3b5_1.heavy 503.932 / 670.332 18328.0 31.91469955444336 41 13 8 10 10 1.418527887029445 55.443454844073585 0.0 3 0.9230433602650548 4.419916023427988 18328.0 40.93890738350941 0.0 - - - - - - - 288.2 36 10 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1247 162 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21656.[MT7]-FGIAAK[MT7].2y4_1.heavy 447.786 / 546.373 1330.0 26.97605037689209 41 16 10 7 8 2.676893915588571 37.356728788414806 0.028699874877929688 4 0.9624237356488596 6.346527575641302 1330.0 4.9055335968379445 3.0 - - - - - - - 264.47058823529414 2 17 VDAC1;VDAC2;VDAC3 voltage-dependent anion channel 1;voltage-dependent anion channel 2;voltage-dependent anion channel 3 1249 162 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21656.[MT7]-FGIAAK[MT7].2b3_1.heavy 447.786 / 462.283 5318.0 26.97605037689209 41 16 10 7 8 2.676893915588571 37.356728788414806 0.028699874877929688 4 0.9624237356488596 6.346527575641302 5318.0 9.875783675470572 0.0 - - - - - - - 652.2 10 10 VDAC1;VDAC2;VDAC3 voltage-dependent anion channel 1;voltage-dependent anion channel 2;voltage-dependent anion channel 3 1251 162 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21656.[MT7]-FGIAAK[MT7].2y5_1.heavy 447.786 / 603.395 9560.0 26.97605037689209 41 16 10 7 8 2.676893915588571 37.356728788414806 0.028699874877929688 4 0.9624237356488596 6.346527575641302 9560.0 31.952902488470077 0.0 - - - - - - - 660.4285714285714 19 7 VDAC1;VDAC2;VDAC3 voltage-dependent anion channel 1;voltage-dependent anion channel 2;voltage-dependent anion channel 3 1253 162 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21656.[MT7]-FGIAAK[MT7].2b4_1.heavy 447.786 / 533.32 2279.0 26.97605037689209 41 16 10 7 8 2.676893915588571 37.356728788414806 0.028699874877929688 4 0.9624237356488596 6.346527575641302 2279.0 6.995828385380449 2.0 - - - - - - - 633.2 5 10 VDAC1;VDAC2;VDAC3 voltage-dependent anion channel 1;voltage-dependent anion channel 2;voltage-dependent anion channel 3 1255 163 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22451.[MT7]-SVSSVDELMTVLYPEYWK[MT7].3b6_1.heavy 812.087 / 719.369 898.0 49.25727462768555 42 18 10 6 8 9.93861518157291 10.061763955345512 0.03790283203125 4 0.9889462205932636 11.72751805558877 898.0 30.104447147279963 1.0 - - - - - - - 0.0 1 0 VEGFC vascular endothelial growth factor C 1257 163 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22451.[MT7]-SVSSVDELMTVLYPEYWK[MT7].3b8_1.heavy 812.087 / 961.496 954.0 49.25727462768555 42 18 10 6 8 9.93861518157291 10.061763955345512 0.03790283203125 4 0.9889462205932636 11.72751805558877 954.0 16.675711740753307 1.0 - - - - - - - 152.21428571428572 2 14 VEGFC vascular endothelial growth factor C 1259 163 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22451.[MT7]-SVSSVDELMTVLYPEYWK[MT7].3y5_1.heavy 812.087 / 866.453 1768.0 49.25727462768555 42 18 10 6 8 9.93861518157291 10.061763955345512 0.03790283203125 4 0.9889462205932636 11.72751805558877 1768.0 6.286222222222222 1.0 - - - - - - - 91.08333333333333 3 12 VEGFC vascular endothelial growth factor C 1261 163 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22451.[MT7]-SVSSVDELMTVLYPEYWK[MT7].3b7_1.heavy 812.087 / 848.412 2582.0 49.25727462768555 42 18 10 6 8 9.93861518157291 10.061763955345512 0.03790283203125 4 0.9889462205932636 11.72751805558877 2582.0 18.435369984613562 0.0 - - - - - - - 107.41666666666667 5 12 VEGFC vascular endothelial growth factor C 1263 164 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22452.[MT7]-SVSSVDELMTVLYPEYWK[MT7].4y5_1.heavy 609.317 / 866.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 1265 164 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22452.[MT7]-SVSSVDELMTVLYPEYWK[MT7].4b7_1.heavy 609.317 / 848.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 1267 164 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22452.[MT7]-SVSSVDELMTVLYPEYWK[MT7].4y3_1.heavy 609.317 / 640.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 1269 164 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22452.[MT7]-SVSSVDELMTVLYPEYWK[MT7].4b6_1.heavy 609.317 / 719.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - VEGFC vascular endothelial growth factor C 1271 165 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21658.[MT7]-LIFSK[MT7].2b3_1.heavy 448.296 / 518.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDKN1A;HSPA14;CCNG2 cyclin-dependent kinase inhibitor 1A (p21, Cip1);heat shock 70kDa protein 14;cyclin G2 1273 165 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21658.[MT7]-LIFSK[MT7].2y4_1.heavy 448.296 / 638.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDKN1A;HSPA14;CCNG2 cyclin-dependent kinase inhibitor 1A (p21, Cip1);heat shock 70kDa protein 14;cyclin G2 1275 165 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21658.[MT7]-LIFSK[MT7].2y3_1.heavy 448.296 / 525.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDKN1A;HSPA14;CCNG2 cyclin-dependent kinase inhibitor 1A (p21, Cip1);heat shock 70kDa protein 14;cyclin G2 1277 166 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21791.[MT7]-DLLLQVGR.2y5_1.heavy 529.328 / 572.352 23890.0 35.22400029500326 43 17 10 6 10 2.6882920537327784 25.367246294352327 0.03420257568359375 3 0.9791572728800274 8.533513422372794 23890.0 26.543745832894686 0.0 - - - - - - - 759.9 47 10 WEE1 WEE1 homolog (S. pombe) 1279 166 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21791.[MT7]-DLLLQVGR.2b4_1.heavy 529.328 / 599.388 N/A 35.22400029500326 43 17 10 6 10 2.6882920537327784 25.367246294352327 0.03420257568359375 3 0.9791572728800274 8.533513422372794 11312.0 12.245082656817797 1.0 - - - - - - - 786.3846153846154 22 13 WEE1 WEE1 homolog (S. pombe) 1281 166 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21791.[MT7]-DLLLQVGR.2y6_1.heavy 529.328 / 685.435 17918.0 35.22400029500326 43 17 10 6 10 2.6882920537327784 25.367246294352327 0.03420257568359375 3 0.9791572728800274 8.533513422372794 17918.0 35.09332919373924 0.0 - - - - - - - 789.6363636363636 35 11 WEE1 WEE1 homolog (S. pombe) 1283 166 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21791.[MT7]-DLLLQVGR.2y7_1.heavy 529.328 / 798.52 17827.0 35.22400029500326 43 17 10 6 10 2.6882920537327784 25.367246294352327 0.03420257568359375 3 0.9791572728800274 8.533513422372794 17827.0 52.20060773480663 0.0 - - - - - - - 191.9375 35 16 WEE1 WEE1 homolog (S. pombe) 1285 167 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22236.[MT7]-FPIDYPYSPPAFR.2y8_1.heavy 857.441 / 934.478 16264.0 40.090999603271484 35 9 10 6 10 0.7012694545190647 86.00198581355548 0.035797119140625 3 0.8113392806632534 2.7954035658196914 16264.0 30.359466666666666 1.0 - - - - - - - 0.0 32 0 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1287 167 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22236.[MT7]-FPIDYPYSPPAFR.2y5_1.heavy 857.441 / 587.33 6201.0 40.090999603271484 35 9 10 6 10 0.7012694545190647 86.00198581355548 0.035797119140625 3 0.8113392806632534 2.7954035658196914 6201.0 -0.5 2.0 - - - - - - - 0.0 13 0 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1289 167 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22236.[MT7]-FPIDYPYSPPAFR.2b4_1.heavy 857.441 / 617.341 27473.0 40.090999603271484 35 9 10 6 10 0.7012694545190647 86.00198581355548 0.035797119140625 3 0.8113392806632534 2.7954035658196914 27473.0 41.086118263473054 1.0 - - - - - - - 0.0 54 0 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1291 167 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22236.[MT7]-FPIDYPYSPPAFR.2y9_1.heavy 857.441 / 1097.54 18411.0 40.090999603271484 35 9 10 6 10 0.7012694545190647 86.00198581355548 0.035797119140625 3 0.8113392806632534 2.7954035658196914 18411.0 0.0 2.0 - - - - - - - 0.0 36 0 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1293 168 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544349.[MT7]-TSLAPIIVYVK[MT7].3b6_1.heavy 497.984 / 727.447 48426.0 39.006099700927734 44 14 10 10 10 2.7454143727692246 36.42437403689001 0.0 3 0.9481339431867574 5.395423639465275 48426.0 134.0185872816752 0.0 - - - - - - - 199.07692307692307 96 13 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 1295 168 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544349.[MT7]-TSLAPIIVYVK[MT7].3y3_1.heavy 497.984 / 553.347 73060.0 39.006099700927734 44 14 10 10 10 2.7454143727692246 36.42437403689001 0.0 3 0.9481339431867574 5.395423639465275 73060.0 108.16071922544951 0.0 - - - - - - - 226.92307692307693 146 13 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 1297 168 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544349.[MT7]-TSLAPIIVYVK[MT7].3b4_1.heavy 497.984 / 517.31 84263.0 39.006099700927734 44 14 10 10 10 2.7454143727692246 36.42437403689001 0.0 3 0.9481339431867574 5.395423639465275 84263.0 286.5454368954653 0.0 - - - - - - - 319.3 168 10 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 1299 168 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544349.[MT7]-TSLAPIIVYVK[MT7].3y4_1.heavy 497.984 / 652.415 34512.0 39.006099700927734 44 14 10 10 10 2.7454143727692246 36.42437403689001 0.0 3 0.9481339431867574 5.395423639465275 34512.0 279.384968704686 0.0 - - - - - - - 184.85714285714286 69 14 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 1301 169 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543477.[MT7]-VDAERDGVK[MT7].3y3_1.heavy 426.241 / 447.305 12035.0 17.644800186157227 41 13 10 10 8 1.263517793805066 53.42464928578076 0.0 4 0.9029519440425098 3.9290942429843856 12035.0 41.36907819166393 1.0 - - - - - - - 676.2857142857143 32 7 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1303 169 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543477.[MT7]-VDAERDGVK[MT7].3y7_2.heavy 426.241 / 459.76 21452.0 17.644800186157227 41 13 10 10 8 1.263517793805066 53.42464928578076 0.0 4 0.9029519440425098 3.9290942429843856 21452.0 99.66008082332023 0.0 - - - - - - - 192.88888888888889 42 18 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1305 169 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543477.[MT7]-VDAERDGVK[MT7].3y4_1.heavy 426.241 / 562.332 6647.0 17.644800186157227 41 13 10 10 8 1.263517793805066 53.42464928578076 0.0 4 0.9029519440425098 3.9290942429843856 6647.0 33.57670183982684 0.0 - - - - - - - 213.38095238095238 13 21 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1307 169 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543477.[MT7]-VDAERDGVK[MT7].3y8_2.heavy 426.241 / 517.273 22660.0 17.644800186157227 41 13 10 10 8 1.263517793805066 53.42464928578076 0.0 4 0.9029519440425098 3.9290942429843856 22660.0 66.7794701986755 0.0 - - - - - - - 248.94736842105263 45 19 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1309 170 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21799.[MT7]-AIELSLK[MT7].2y4_1.heavy 531.344 / 604.415 6238.0 32.81520080566406 50 20 10 10 10 8.578133732616818 11.657547331043336 0.0 3 0.9959734891244524 19.44249963849564 6238.0 6.735574367599227 1.0 - - - - - - - 280.1 12 10 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1311 170 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21799.[MT7]-AIELSLK[MT7].2y5_1.heavy 531.344 / 733.458 5729.0 32.81520080566406 50 20 10 10 10 8.578133732616818 11.657547331043336 0.0 3 0.9959734891244524 19.44249963849564 5729.0 22.738553565818407 0.0 - - - - - - - 254.625 11 8 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1313 170 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21799.[MT7]-AIELSLK[MT7].2y6_1.heavy 531.344 / 846.542 5347.0 32.81520080566406 50 20 10 10 10 8.578133732616818 11.657547331043336 0.0 3 0.9959734891244524 19.44249963849564 5347.0 39.819423529411765 0.0 - - - - - - - 233.41666666666666 10 12 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1315 170 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21799.[MT7]-AIELSLK[MT7].2b5_1.heavy 531.344 / 658.389 N/A 32.81520080566406 50 20 10 10 10 8.578133732616818 11.657547331043336 0.0 3 0.9959734891244524 19.44249963849564 1273.0 0.5043805783777914 14.0 - - - - - - - 1218.5714285714287 7 7 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1317 171 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21652.[MT7]-IFELAR.2b3_1.heavy 446.772 / 534.304 15933.0 34.73659896850586 50 20 10 10 10 5.763169400781304 17.351563531421295 0.0 3 0.997500054734634 24.677809202082337 15933.0 32.618986083174995 0.0 - - - - - - - 629.8571428571429 31 7 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1319 171 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21652.[MT7]-IFELAR.2y5_1.heavy 446.772 / 635.351 62229.0 34.73659896850586 50 20 10 10 10 5.763169400781304 17.351563531421295 0.0 3 0.997500054734634 24.677809202082337 62229.0 93.12621067092748 0.0 - - - - - - - 225.375 124 8 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1321 171 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21652.[MT7]-IFELAR.2b4_1.heavy 446.772 / 647.388 9119.0 34.73659896850586 50 20 10 10 10 5.763169400781304 17.351563531421295 0.0 3 0.997500054734634 24.677809202082337 9119.0 90.64200375586854 0.0 - - - - - - - 256.1111111111111 18 9 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1323 171 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21652.[MT7]-IFELAR.2b5_1.heavy 446.772 / 718.426 4008.0 34.73659896850586 50 20 10 10 10 5.763169400781304 17.351563531421295 0.0 3 0.997500054734634 24.677809202082337 4008.0 8.14606170598911 0.0 - - - - - - - 181.9090909090909 8 11 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1325 172 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38878.[MT7]-EQIALLVK[MT7].2b3_1.heavy 601.392 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1327 172 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38878.[MT7]-EQIALLVK[MT7].2y5_1.heavy 601.392 / 687.489 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1329 172 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38878.[MT7]-EQIALLVK[MT7].2b4_1.heavy 601.392 / 586.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1331 172 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38878.[MT7]-EQIALLVK[MT7].2y3_1.heavy 601.392 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1333 173 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544964.[MT7]-FLGDSANLSILSGGTPK[MT7].3y6_1.heavy 655.701 / 690.39 13943.0 38.86039924621582 39 13 10 6 10 0.9940942736452939 59.04257144130623 0.03839874267578125 3 0.9041751014536793 3.954509105735243 13943.0 17.23032555744151 0.0 - - - - - - - 283.6 27 10 CDC25C cell division cycle 25 homolog C (S. pombe) 1335 173 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544964.[MT7]-FLGDSANLSILSGGTPK[MT7].3b4_1.heavy 655.701 / 577.31 6277.0 38.86039924621582 39 13 10 6 10 0.9940942736452939 59.04257144130623 0.03839874267578125 3 0.9041751014536793 3.954509105735243 6277.0 13.505368511806312 0.0 - - - - - - - 633.75 12 8 CDC25C cell division cycle 25 homolog C (S. pombe) 1337 173 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544964.[MT7]-FLGDSANLSILSGGTPK[MT7].3b5_1.heavy 655.701 / 664.342 5130.0 38.86039924621582 39 13 10 6 10 0.9940942736452939 59.04257144130623 0.03839874267578125 3 0.9041751014536793 3.954509105735243 5130.0 16.744096572625907 0.0 - - - - - - - 205.13333333333333 10 15 CDC25C cell division cycle 25 homolog C (S. pombe) 1339 173 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544964.[MT7]-FLGDSANLSILSGGTPK[MT7].3b7_1.heavy 655.701 / 849.422 9718.0 38.86039924621582 39 13 10 6 10 0.9940942736452939 59.04257144130623 0.03839874267578125 3 0.9041751014536793 3.954509105735243 9718.0 23.82990618660509 0.0 - - - - - - - 679.0 19 8 CDC25C cell division cycle 25 homolog C (S. pombe) 1341 174 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22037.[MT7]-LLLQVQASSK[MT7].2y4_1.heavy 687.932 / 536.316 1229.0 33.049800872802734 43 13 10 10 10 1.4778619367384616 53.7919586096458 0.0 3 0.9028000273578153 3.925971047828592 1229.0 2.918874152081643 0.0 - - - - - - - 259.55555555555554 2 9 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1343 174 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22037.[MT7]-LLLQVQASSK[MT7].2b4_1.heavy 687.932 / 612.42 2703.0 33.049800872802734 43 13 10 10 10 1.4778619367384616 53.7919586096458 0.0 3 0.9028000273578153 3.925971047828592 2703.0 15.74918699186992 0.0 - - - - - - - 230.625 5 8 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1345 174 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22037.[MT7]-LLLQVQASSK[MT7].2y6_1.heavy 687.932 / 763.443 1597.0 33.049800872802734 43 13 10 10 10 1.4778619367384616 53.7919586096458 0.0 3 0.9028000273578153 3.925971047828592 1597.0 4.153377590190454 1.0 - - - - - - - 307.4 4 10 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1347 174 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22037.[MT7]-LLLQVQASSK[MT7].2y7_1.heavy 687.932 / 891.502 1597.0 33.049800872802734 43 13 10 10 10 1.4778619367384616 53.7919586096458 0.0 3 0.9028000273578153 3.925971047828592 1597.0 15.969999999999999 0.0 - - - - - - - 164.0 3 9 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1349 175 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39056.[MT7]-SQLQITVISAK[MT7].2y4_1.heavy 738.455 / 562.368 1176.0 32.4109992980957 43 15 8 10 10 2.053307702556474 48.701906623880504 0.0 3 0.955743867050794 5.84468081839722 1176.0 12.029312977099234 1.0 - - - - - - - 196.0 4 6 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1351 175 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39056.[MT7]-SQLQITVISAK[MT7].2b4_1.heavy 738.455 / 601.343 1699.0 32.4109992980957 43 15 8 10 10 2.053307702556474 48.701906623880504 0.0 3 0.955743867050794 5.84468081839722 1699.0 5.849148817242112 0.0 - - - - - - - 261.4 3 5 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1353 175 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39056.[MT7]-SQLQITVISAK[MT7].2y6_1.heavy 738.455 / 762.484 1438.0 32.4109992980957 43 15 8 10 10 2.053307702556474 48.701906623880504 0.0 3 0.955743867050794 5.84468081839722 1438.0 8.810828055360075 1.0 - - - - - - - 261.375 2 8 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1355 175 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39056.[MT7]-SQLQITVISAK[MT7].2y7_1.heavy 738.455 / 875.568 1307.0 32.4109992980957 43 15 8 10 10 2.053307702556474 48.701906623880504 0.0 3 0.955743867050794 5.84468081839722 1307.0 6.840825123152709 0.0 - - - - - - - 261.3333333333333 2 9 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1357 176 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22510.[MT7]-NLSSDDANVLVWHALLLPDQPPYHLK[MT7].4b8_1.heavy 811.691 / 961.434 2531.0 43.61155033111572 46 20 10 6 10 9.35151229324992 10.693457578212422 0.032199859619140625 3 0.9945538732547022 16.715570309250893 2531.0 11.410245901639344 0.0 - - - - - - - 178.7826086956522 5 23 UBE2L6 ubiquitin-conjugating enzyme E2L 6 1359 176 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22510.[MT7]-NLSSDDANVLVWHALLLPDQPPYHLK[MT7].4y5_1.heavy 811.691 / 801.474 4941.0 43.61155033111572 46 20 10 6 10 9.35151229324992 10.693457578212422 0.032199859619140625 3 0.9945538732547022 16.715570309250893 4941.0 25.821783248316095 0.0 - - - - - - - 265.90909090909093 9 22 UBE2L6 ubiquitin-conjugating enzyme E2L 6 1361 176 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22510.[MT7]-NLSSDDANVLVWHALLLPDQPPYHLK[MT7].4y3_1.heavy 811.691 / 541.358 2043.0 43.61155033111572 46 20 10 6 10 9.35151229324992 10.693457578212422 0.032199859619140625 3 0.9945538732547022 16.715570309250893 2043.0 4.533276279985037 0.0 - - - - - - - 246.2 4 25 UBE2L6 ubiquitin-conjugating enzyme E2L 6 1363 176 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22510.[MT7]-NLSSDDANVLVWHALLLPDQPPYHLK[MT7].4b6_1.heavy 811.691 / 776.354 2196.0 43.61155033111572 46 20 10 6 10 9.35151229324992 10.693457578212422 0.032199859619140625 3 0.9945538732547022 16.715570309250893 2196.0 6.4799999999999995 1.0 - - - - - - - 322.0869565217391 4 23 UBE2L6 ubiquitin-conjugating enzyme E2L 6 1365 177 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22515.[MT7]-LQESGFYWSAVTGGEANLLLSAEPAGTFLIR.3b6_1.heavy 1147.93 / 806.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 1367 177 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22515.[MT7]-LQESGFYWSAVTGGEANLLLSAEPAGTFLIR.3y11_1.heavy 1147.93 / 1161.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 1369 177 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22515.[MT7]-LQESGFYWSAVTGGEANLLLSAEPAGTFLIR.3y8_1.heavy 1147.93 / 874.515 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 1371 177 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22515.[MT7]-LQESGFYWSAVTGGEANLLLSAEPAGTFLIR.3b7_1.heavy 1147.93 / 969.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 1373 178 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21668.[MT7]-ANEPGAGR.2y5_1.heavy 458.242 / 457.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBE inhibin, beta E 1375 178 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21668.[MT7]-ANEPGAGR.2y6_1.heavy 458.242 / 586.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBE inhibin, beta E 1377 178 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21668.[MT7]-ANEPGAGR.2b5_1.heavy 458.242 / 613.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBE inhibin, beta E 1379 178 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21668.[MT7]-ANEPGAGR.2y7_1.heavy 458.242 / 700.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBE inhibin, beta E 1381 179 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21667.[MT7]-MFSLK[MT7].2b3_1.heavy 457.275 / 510.25 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100507901;MMP8;MTMR10;ZSCAN5D;RNF7 putative zinc finger and SCAN domain-containing protein 5D-like;matrix metallopeptidase 8 (neutrophil collagenase);myotubularin related protein 10;zinc finger and SCAN domain containing 5D;ring finger protein 7 1383 179 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21667.[MT7]-MFSLK[MT7].2y4_1.heavy 457.275 / 638.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100507901;MMP8;MTMR10;ZSCAN5D;RNF7 putative zinc finger and SCAN domain-containing protein 5D-like;matrix metallopeptidase 8 (neutrophil collagenase);myotubularin related protein 10;zinc finger and SCAN domain containing 5D;ring finger protein 7 1385 179 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21667.[MT7]-MFSLK[MT7].2y3_2.heavy 457.275 / 246.169 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100507901;MMP8;MTMR10;ZSCAN5D;RNF7 putative zinc finger and SCAN domain-containing protein 5D-like;matrix metallopeptidase 8 (neutrophil collagenase);myotubularin related protein 10;zinc finger and SCAN domain containing 5D;ring finger protein 7 1387 179 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21667.[MT7]-MFSLK[MT7].2y3_1.heavy 457.275 / 491.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100507901;MMP8;MTMR10;ZSCAN5D;RNF7 putative zinc finger and SCAN domain-containing protein 5D-like;matrix metallopeptidase 8 (neutrophil collagenase);myotubularin related protein 10;zinc finger and SCAN domain containing 5D;ring finger protein 7 1389 180 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22121.[MT7]-SSLAEVQSEIER.2y8_1.heavy 746.392 / 989.49 1019.0 32.38595008850098 36 13 10 3 10 1.8648968932223746 42.64484920230668 0.050098419189453125 3 0.91824539680477 4.286492717864292 1019.0 2.9078798383032125 0.0 - - - - - - - 318.5 2 6 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1391 180 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22121.[MT7]-SSLAEVQSEIER.2y9_1.heavy 746.392 / 1060.53 2546.0 32.38595008850098 36 13 10 3 10 1.8648968932223746 42.64484920230668 0.050098419189453125 3 0.91824539680477 4.286492717864292 2546.0 19.569254901960782 0.0 - - - - - - - 191.0 5 2 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1393 180 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22121.[MT7]-SSLAEVQSEIER.2b5_1.heavy 746.392 / 632.337 3819.0 32.38595008850098 36 13 10 3 10 1.8648968932223746 42.64484920230668 0.050098419189453125 3 0.91824539680477 4.286492717864292 3819.0 7.785279055828793 0.0 - - - - - - - 297.0 7 9 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1395 180 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22121.[MT7]-SSLAEVQSEIER.2y7_1.heavy 746.392 / 860.447 2546.0 32.38595008850098 36 13 10 3 10 1.8648968932223746 42.64484920230668 0.050098419189453125 3 0.91824539680477 4.286492717864292 2546.0 11.881333333333332 0.0 - - - - - - - 169.66666666666666 5 6 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1397 181 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22444.[MT7]-VNNASLIGLGYTQTLRPGVK[MT7].4b8_1.heavy 598.101 / 913.522 1861.0 35.16619873046875 41 11 10 10 10 1.148042415227016 56.92800873683768 0.0 3 0.860064383019269 3.25985751206607 1861.0 5.495619860663651 0.0 - - - - - - - 194.1764705882353 3 17 VDAC3 voltage-dependent anion channel 3 1399 181 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22444.[MT7]-VNNASLIGLGYTQTLRPGVK[MT7].4b4_1.heavy 598.101 / 543.301 5074.0 35.16619873046875 41 11 10 10 10 1.148042415227016 56.92800873683768 0.0 3 0.860064383019269 3.25985751206607 5074.0 11.912196505015654 0.0 - - - - - - - 670.0 10 13 VDAC3 voltage-dependent anion channel 3 1401 181 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22444.[MT7]-VNNASLIGLGYTQTLRPGVK[MT7].4b5_1.heavy 598.101 / 630.333 8964.0 35.16619873046875 41 11 10 10 10 1.148042415227016 56.92800873683768 0.0 3 0.860064383019269 3.25985751206607 8964.0 12.085280885487693 0.0 - - - - - - - 702.4615384615385 17 13 VDAC3 voltage-dependent anion channel 3 1403 181 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22444.[MT7]-VNNASLIGLGYTQTLRPGVK[MT7].4b6_1.heavy 598.101 / 743.417 9218.0 35.16619873046875 41 11 10 10 10 1.148042415227016 56.92800873683768 0.0 3 0.860064383019269 3.25985751206607 9218.0 23.231851351351352 0.0 - - - - - - - 667.1111111111111 18 9 VDAC3 voltage-dependent anion channel 3 1405 182 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 160735.0 42.422401428222656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 160735.0 964.1758330565317 0.0 - - - - - - - 706.1428571428571 321 7 1407 182 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 297590.0 42.422401428222656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 297590.0 1035.7194974855026 0.0 - - - - - - - 1209.4285714285713 595 7 1409 182 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 246442.0 42.422401428222656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 246442.0 589.2295604524486 0.0 - - - - - - - 295.6666666666667 492 9 1411 183 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22122.[MT7]-TSLAPIIVYVK[MT7].2y4_1.heavy 746.473 / 652.415 850.0 39.006099700927734 45 15 10 10 10 2.969570183940659 33.674907076046495 0.0 3 0.9562209149032455 5.876675883014416 850.0 9.751453933272114 1.0 - - - - - - - 0.0 1 0 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 1413 183 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22122.[MT7]-TSLAPIIVYVK[MT7].2b4_1.heavy 746.473 / 517.31 7891.0 39.006099700927734 45 15 10 10 10 2.969570183940659 33.674907076046495 0.0 3 0.9562209149032455 5.876675883014416 7891.0 46.599115226337446 0.0 - - - - - - - 171.41176470588235 15 17 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 1415 183 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22122.[MT7]-TSLAPIIVYVK[MT7].2y3_1.heavy 746.473 / 553.347 1942.0 39.006099700927734 45 15 10 10 10 2.969570183940659 33.674907076046495 0.0 3 0.9562209149032455 5.876675883014416 1942.0 13.007974262579525 0.0 - - - - - - - 169.3684210526316 3 19 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 1417 183 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22122.[MT7]-TSLAPIIVYVK[MT7].2y7_1.heavy 746.473 / 975.636 4613.0 39.006099700927734 45 15 10 10 10 2.969570183940659 33.674907076046495 0.0 3 0.9562209149032455 5.876675883014416 4613.0 22.784625324574073 0.0 - - - - - - - 226.0 9 18 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 1419 184 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22226.[MT7]-HENLLQFIAAEK[MT7].2y4_1.heavy 850.982 / 562.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR2B activin A receptor, type IIB 1421 184 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22226.[MT7]-HENLLQFIAAEK[MT7].2y5_1.heavy 850.982 / 675.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR2B activin A receptor, type IIB 1423 184 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22226.[MT7]-HENLLQFIAAEK[MT7].2b4_1.heavy 850.982 / 638.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR2B activin A receptor, type IIB 1425 184 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22226.[MT7]-HENLLQFIAAEK[MT7].2b6_1.heavy 850.982 / 879.481 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR2B activin A receptor, type IIB 1427 185 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22440.[MT7]-DLESIDPEFYNSLIWVK[MT7].3y3_1.heavy 786.082 / 576.363 4618.0 46.887550354003906 28 13 2 7 6 1.5066091832094244 41.70616656911551 0.02809906005859375 5 0.9123702367020176 4.138213624316612 4618.0 29.37735576234789 0.0 - - - - - - - 147.0 9 34 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1429 185 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22440.[MT7]-DLESIDPEFYNSLIWVK[MT7].3b6_1.heavy 786.082 / 817.406 3958.0 46.887550354003906 28 13 2 7 6 1.5066091832094244 41.70616656911551 0.02809906005859375 5 0.9123702367020176 4.138213624316612 3958.0 20.83833996556882 1.0 - - - - - - - 165.52173913043478 20 23 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1431 185 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22440.[MT7]-DLESIDPEFYNSLIWVK[MT7].3b4_1.heavy 786.082 / 589.295 1040.0 46.887550354003906 28 13 2 7 6 1.5066091832094244 41.70616656911551 0.02809906005859375 5 0.9123702367020176 4.138213624316612 1040.0 0.6910394265232975 2.0 - - - - - - - 177.53571428571428 5 28 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1433 185 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22440.[MT7]-DLESIDPEFYNSLIWVK[MT7].3b8_1.heavy 786.082 / 1043.5 1218.0 46.887550354003906 28 13 2 7 6 1.5066091832094244 41.70616656911551 0.02809906005859375 5 0.9123702367020176 4.138213624316612 1218.0 4.873920756948552 1.0 - - - - - - - 118.57142857142857 5 28 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1435 186 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22441.[MT7]-SLNQYPALYYPELYILK[MT7].4b7_1.heavy 594.833 / 918.48 809.0 46.759599685668945 43 16 10 7 10 2.8241308951205335 27.488194568014706 0.025402069091796875 3 0.9651034565216112 6.58718797997184 809.0 32.8213702970297 0.0 - - - - - - - 0.0 1 0 CDC25C cell division cycle 25 homolog C (S. pombe) 1437 186 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22441.[MT7]-SLNQYPALYYPELYILK[MT7].4b4_1.heavy 594.833 / 587.327 5484.0 46.759599685668945 43 16 10 7 10 2.8241308951205335 27.488194568014706 0.025402069091796875 3 0.9651034565216112 6.58718797997184 5484.0 35.206888389315 0.0 - - - - - - - 208.23809523809524 10 21 CDC25C cell division cycle 25 homolog C (S. pombe) 1439 186 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22441.[MT7]-SLNQYPALYYPELYILK[MT7].4b5_1.heavy 594.833 / 750.39 1996.0 46.759599685668945 43 16 10 7 10 2.8241308951205335 27.488194568014706 0.025402069091796875 3 0.9651034565216112 6.58718797997184 1996.0 21.145742574257422 0.0 - - - - - - - 112.89285714285714 3 28 CDC25C cell division cycle 25 homolog C (S. pombe) 1441 186 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22441.[MT7]-SLNQYPALYYPELYILK[MT7].4y3_1.heavy 594.833 / 517.383 2376.0 46.759599685668945 43 16 10 7 10 2.8241308951205335 27.488194568014706 0.025402069091796875 3 0.9651034565216112 6.58718797997184 2376.0 4.078220912086007 0.0 - - - - - - - 225.46153846153845 4 26 CDC25C cell division cycle 25 homolog C (S. pombe) 1443 187 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22229.[MT7]-LTLDTIFVPNTGK[MT7].2y5_1.heavy 854 / 660.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC3 voltage-dependent anion channel 3 1445 187 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22229.[MT7]-LTLDTIFVPNTGK[MT7].2b4_1.heavy 854 / 587.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC3 voltage-dependent anion channel 3 1447 187 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22229.[MT7]-LTLDTIFVPNTGK[MT7].2b5_1.heavy 854 / 688.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC3 voltage-dependent anion channel 3 1449 187 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22229.[MT7]-LTLDTIFVPNTGK[MT7].2y7_1.heavy 854 / 906.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC3 voltage-dependent anion channel 3 1451 188 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38922.[MT7]-HFFTLSVK[MT7].2y3_1.heavy 633.876 / 477.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 1453 188 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38922.[MT7]-HFFTLSVK[MT7].2y6_1.heavy 633.876 / 838.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 1455 188 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38922.[MT7]-HFFTLSVK[MT7].2y7_1.heavy 633.876 / 985.584 N/A N/A - - - - - - - - - 0.0 - - - - - - - SOCS3 suppressor of cytokine signaling 3 1457 189 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544970.[MT7]-LTLDTIFVPNTGK[MT7]K[MT7].4b4_1.heavy 495.553 / 587.352 28526.0 37.86999988555908 39 13 10 6 10 1.9191708153138047 41.69894384307285 0.035198211669921875 3 0.9299025031039895 4.633839151874744 28526.0 93.31457288506388 0.0 - - - - - - - 297.3125 57 16 VDAC3 voltage-dependent anion channel 3 1459 189 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544970.[MT7]-LTLDTIFVPNTGK[MT7]K[MT7].4b5_1.heavy 495.553 / 688.4 39468.0 37.86999988555908 39 13 10 6 10 1.9191708153138047 41.69894384307285 0.035198211669921875 3 0.9299025031039895 4.633839151874744 39468.0 115.76816112869855 0.0 - - - - - - - 680.2222222222222 78 9 VDAC3 voltage-dependent anion channel 3 1461 189 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544970.[MT7]-LTLDTIFVPNTGK[MT7]K[MT7].4y6_1.heavy 495.553 / 932.577 8662.0 37.86999988555908 39 13 10 6 10 1.9191708153138047 41.69894384307285 0.035198211669921875 3 0.9299025031039895 4.633839151874744 8662.0 169.68635897435897 0.0 - - - - - - - 143.2 17 15 VDAC3 voltage-dependent anion channel 3 1463 189 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544970.[MT7]-LTLDTIFVPNTGK[MT7]K[MT7].4b6_1.heavy 495.553 / 801.484 16999.0 37.86999988555908 39 13 10 6 10 1.9191708153138047 41.69894384307285 0.035198211669921875 3 0.9299025031039895 4.633839151874744 16999.0 118.60300944669365 0.0 - - - - - - - 206.76470588235293 33 17 VDAC3 voltage-dependent anion channel 3 1465 190 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544154.[MT7]-DLLAGGVAAAVSK[MT7].3b6_1.heavy 487.296 / 671.385 167147.0 34.611000061035156 45 15 10 10 10 1.9427420426299855 40.97341312142758 0.0 3 0.9597827131322485 6.133235218904805 167147.0 521.5157816811131 0.0 - - - - - - - 254.0 334 6 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1467 190 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544154.[MT7]-DLLAGGVAAAVSK[MT7].3y4_1.heavy 487.296 / 548.352 110551.0 34.611000061035156 45 15 10 10 10 1.9427420426299855 40.97341312142758 0.0 3 0.9597827131322485 6.133235218904805 110551.0 134.62967825609798 0.0 - - - - - - - 264.0 221 5 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1469 190 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544154.[MT7]-DLLAGGVAAAVSK[MT7].3b8_1.heavy 487.296 / 841.49 36478.0 34.611000061035156 45 15 10 10 10 1.9427420426299855 40.97341312142758 0.0 3 0.9597827131322485 6.133235218904805 36478.0 258.760197044335 0.0 - - - - - - - 213.3 72 10 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1471 190 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544154.[MT7]-DLLAGGVAAAVSK[MT7].3b7_1.heavy 487.296 / 770.453 77325.0 34.611000061035156 45 15 10 10 10 1.9427420426299855 40.97341312142758 0.0 3 0.9597827131322485 6.133235218904805 77325.0 358.9908196721311 0.0 - - - - - - - 212.54545454545453 154 11 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1473 191 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22223.[MT7]-SEYQLVVNAVRK[MT7].4y5_1.heavy 424.251 / 731.464 9164.0 31.816099166870117 40 10 10 10 10 0.9789567337576511 65.04054070119473 0.0 3 0.833634492859852 2.9827524291224528 9164.0 52.37820610687023 0.0 - - - - - - - 209.6 18 5 SOCS3 suppressor of cytokine signaling 3 1475 191 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22223.[MT7]-SEYQLVVNAVRK[MT7].4b4_1.heavy 424.251 / 652.306 31942.0 31.816099166870117 40 10 10 10 10 0.9789567337576511 65.04054070119473 0.0 3 0.833634492859852 2.9827524291224528 31942.0 109.41032067735591 0.0 - - - - - - - 262.0 63 9 SOCS3 suppressor of cytokine signaling 3 1477 191 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22223.[MT7]-SEYQLVVNAVRK[MT7].4y7_2.heavy 424.251 / 465.304 83784.0 31.816099166870117 40 10 10 10 10 0.9789567337576511 65.04054070119473 0.0 3 0.833634492859852 2.9827524291224528 83784.0 56.725972310630176 0.0 - - - - - - - 229.25 167 4 SOCS3 suppressor of cytokine signaling 3 1479 191 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22223.[MT7]-SEYQLVVNAVRK[MT7].4b3_1.heavy 424.251 / 524.247 31026.0 31.816099166870117 40 10 10 10 10 0.9789567337576511 65.04054070119473 0.0 3 0.833634492859852 2.9827524291224528 31026.0 228.55030534351144 0.0 - - - - - - - 205.85714285714286 62 7 SOCS3 suppressor of cytokine signaling 3 1481 192 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22224.[MT7]-SEYQLVVNAVRK[MT7].3y7_1.heavy 565.333 / 929.601 10072.0 31.816099166870117 47 17 10 10 10 2.403149884358417 33.40508715921542 0.0 3 0.9761194807052512 7.970258603097194 10072.0 42.642381523734166 0.0 - - - - - - - 261.7142857142857 20 7 SOCS3 suppressor of cytokine signaling 3 1483 192 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22224.[MT7]-SEYQLVVNAVRK[MT7].3y6_1.heavy 565.333 / 830.533 16220.0 31.816099166870117 47 17 10 10 10 2.403149884358417 33.40508715921542 0.0 3 0.9761194807052512 7.970258603097194 16220.0 165.91450381679388 0.0 - - - - - - - 187.14285714285714 32 7 SOCS3 suppressor of cytokine signaling 3 1485 192 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22224.[MT7]-SEYQLVVNAVRK[MT7].3b4_1.heavy 565.333 / 652.306 17790.0 31.816099166870117 47 17 10 10 10 2.403149884358417 33.40508715921542 0.0 3 0.9761194807052512 7.970258603097194 17790.0 51.042476927076564 0.0 - - - - - - - 327.0 35 8 SOCS3 suppressor of cytokine signaling 3 1487 192 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22224.[MT7]-SEYQLVVNAVRK[MT7].3y5_1.heavy 565.333 / 731.464 16482.0 31.816099166870117 47 17 10 10 10 2.403149884358417 33.40508715921542 0.0 3 0.9761194807052512 7.970258603097194 16482.0 46.66522854690756 0.0 - - - - - - - 228.875 32 8 SOCS3 suppressor of cytokine signaling 3 1489 193 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544158.[MT7]-YLGSPITTVPK[MT7].3b6_1.heavy 488.629 / 775.447 20359.0 32.36090087890625 50 20 10 10 10 5.599345182545941 17.859231167193638 0.0 3 0.9915765251049845 13.437281000466227 20359.0 71.37131073072898 0.0 - - - - - - - 272.9 40 10 CDC25C cell division cycle 25 homolog C (S. pombe) 1491 193 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544158.[MT7]-YLGSPITTVPK[MT7].3b4_1.heavy 488.629 / 565.31 76347.0 32.36090087890625 50 20 10 10 10 5.599345182545941 17.859231167193638 0.0 3 0.9915765251049845 13.437281000466227 76347.0 87.63777169042356 0.0 - - - - - - - 403.25 152 4 CDC25C cell division cycle 25 homolog C (S. pombe) 1493 193 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544158.[MT7]-YLGSPITTVPK[MT7].3b3_1.heavy 488.629 / 478.278 9559.0 32.36090087890625 50 20 10 10 10 5.599345182545941 17.859231167193638 0.0 3 0.9915765251049845 13.437281000466227 9559.0 10.665562356930458 0.0 - - - - - - - 780.4285714285714 19 7 CDC25C cell division cycle 25 homolog C (S. pombe) 1495 193 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544158.[MT7]-YLGSPITTVPK[MT7].3y5_1.heavy 488.629 / 689.431 11421.0 32.36090087890625 50 20 10 10 10 5.599345182545941 17.859231167193638 0.0 3 0.9915765251049845 13.437281000466227 11421.0 31.081304347826084 0.0 - - - - - - - 347.5 22 10 CDC25C cell division cycle 25 homolog C (S. pombe) 1497 194 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21663.[MT7]-LEETK[MT7].2b3_1.heavy 454.271 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - FPGS;MPP2;SERPINB5;TTK;VEPH1;LZTS2 folylpolyglutamate synthase;membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2);serpin peptidase inhibitor, clade B (ovalbumin), member 5;TTK protein kinase;ventricular zone expressed PH domain homolog 1 (zebrafish);leucine zipper, putative tumor suppressor 2 1499 194 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21663.[MT7]-LEETK[MT7].2y4_1.heavy 454.271 / 650.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - FPGS;MPP2;SERPINB5;TTK;VEPH1;LZTS2 folylpolyglutamate synthase;membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2);serpin peptidase inhibitor, clade B (ovalbumin), member 5;TTK protein kinase;ventricular zone expressed PH domain homolog 1 (zebrafish);leucine zipper, putative tumor suppressor 2 1501 194 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21663.[MT7]-LEETK[MT7].2b4_1.heavy 454.271 / 617.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - FPGS;MPP2;SERPINB5;TTK;VEPH1;LZTS2 folylpolyglutamate synthase;membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2);serpin peptidase inhibitor, clade B (ovalbumin), member 5;TTK protein kinase;ventricular zone expressed PH domain homolog 1 (zebrafish);leucine zipper, putative tumor suppressor 2 1503 194 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21663.[MT7]-LEETK[MT7].2y3_1.heavy 454.271 / 521.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - FPGS;MPP2;SERPINB5;TTK;VEPH1;LZTS2 folylpolyglutamate synthase;membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2);serpin peptidase inhibitor, clade B (ovalbumin), member 5;TTK protein kinase;ventricular zone expressed PH domain homolog 1 (zebrafish);leucine zipper, putative tumor suppressor 2 1505 195 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22220.[MT7]-SDLTAVLADFGLAVR.2y9_1.heavy 846.476 / 961.547 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR2B activin A receptor, type IIB 1507 195 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22220.[MT7]-SDLTAVLADFGLAVR.2y6_1.heavy 846.476 / 662.398 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR2B activin A receptor, type IIB 1509 195 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22220.[MT7]-SDLTAVLADFGLAVR.2b5_1.heavy 846.476 / 632.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR2B activin A receptor, type IIB 1511 195 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22220.[MT7]-SDLTAVLADFGLAVR.2y11_1.heavy 846.476 / 1131.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACVR2B activin A receptor, type IIB 1513 196 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22301.[MT7]-LQHPLTILPIDQVK[MT7].3y3_1.heavy 635.059 / 518.342 7648.0 36.980499267578125 46 16 10 10 10 2.6082346071363465 30.362209468932463 0.0 3 0.96633985463001 6.7077765477630455 7648.0 20.56905459387483 0.0 - - - - - - - 322.0 15 21 SPRY4 sprouty homolog 4 (Drosophila) 1515 196 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22301.[MT7]-LQHPLTILPIDQVK[MT7].3y6_1.heavy 635.059 / 843.506 33051.0 36.980499267578125 46 16 10 10 10 2.6082346071363465 30.362209468932463 0.0 3 0.96633985463001 6.7077765477630455 33051.0 122.56426553729972 0.0 - - - - - - - 269.75 66 20 SPRY4 sprouty homolog 4 (Drosophila) 1517 196 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22301.[MT7]-LQHPLTILPIDQVK[MT7].3y4_1.heavy 635.059 / 633.369 14067.0 36.980499267578125 46 16 10 10 10 2.6082346071363465 30.362209468932463 0.0 3 0.96633985463001 6.7077765477630455 14067.0 36.57092577993017 0.0 - - - - - - - 702.2857142857143 28 7 SPRY4 sprouty homolog 4 (Drosophila) 1519 196 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22301.[MT7]-LQHPLTILPIDQVK[MT7].3b3_1.heavy 635.059 / 523.311 18369.0 36.980499267578125 46 16 10 10 10 2.6082346071363465 30.362209468932463 0.0 3 0.96633985463001 6.7077765477630455 18369.0 33.56516921913405 0.0 - - - - - - - 254.86666666666667 36 15 SPRY4 sprouty homolog 4 (Drosophila) 1521 197 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543487.[MT7]-TK[MT7]PVAFAVR.3y7_1.heavy 426.271 / 759.451 18334.0 25.904399871826172 46 16 10 10 10 3.3799102325945634 29.586584589033816 0.0 3 0.9682804792456028 6.911055153100235 18334.0 109.69084662792744 0.0 - - - - - - - 101.53846153846153 36 13 CACNB1;CACNB2 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit 1523 197 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543487.[MT7]-TK[MT7]PVAFAVR.3y6_1.heavy 426.271 / 662.398 5590.0 25.904399871826172 46 16 10 10 10 3.3799102325945634 29.586584589033816 0.0 3 0.9682804792456028 6.911055153100235 5590.0 31.331697665215675 0.0 - - - - - - - 225.45 11 20 CACNB1;CACNB2 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit 1525 197 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543487.[MT7]-TK[MT7]PVAFAVR.3y4_1.heavy 426.271 / 492.293 11301.0 25.904399871826172 46 16 10 10 10 3.3799102325945634 29.586584589033816 0.0 3 0.9682804792456028 6.911055153100235 11301.0 22.338074613160735 0.0 - - - - - - - 726.8181818181819 22 11 CACNB1;CACNB2 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit 1527 197 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543487.[MT7]-TK[MT7]PVAFAVR.3y5_1.heavy 426.271 / 563.33 16951.0 25.904399871826172 46 16 10 10 10 3.3799102325945634 29.586584589033816 0.0 3 0.9682804792456028 6.911055153100235 16951.0 74.38035157887946 0.0 - - - - - - - 251.625 33 16 CACNB1;CACNB2 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit 1529 198 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542713.[MT7]-LGLGLEFQA.2b4_1.heavy 546.315 / 485.32 4660.0 43.087700843811035 33 7 10 6 10 0.4829166669745844 100.22517393459927 0.030399322509765625 3 0.7272756547956869 2.3072567416553835 4660.0 13.881000056351787 0.0 - - - - - - - 344.25 9 20 VDAC1 voltage-dependent anion channel 1 1531 198 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542713.[MT7]-LGLGLEFQA.2b6_1.heavy 546.315 / 727.447 28549.0 43.087700843811035 33 7 10 6 10 0.4829166669745844 100.22517393459927 0.030399322509765625 3 0.7272756547956869 2.3072567416553835 28549.0 143.77194244604317 0.0 - - - - - - - 208.76470588235293 57 17 VDAC1 voltage-dependent anion channel 1 1533 198 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542713.[MT7]-LGLGLEFQA.2b7_1.heavy 546.315 / 874.516 4138.0 43.087700843811035 33 7 10 6 10 0.4829166669745844 100.22517393459927 0.030399322509765625 3 0.7272756547956869 2.3072567416553835 4138.0 25.29046847333513 0.0 - - - - - - - 121.0 8 19 VDAC1 voltage-dependent anion channel 1 1535 198 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542713.[MT7]-LGLGLEFQA.2b5_1.heavy 546.315 / 598.404 9319.0 43.087700843811035 33 7 10 6 10 0.4829166669745844 100.22517393459927 0.030399322509765625 3 0.7272756547956869 2.3072567416553835 9319.0 67.83946360153257 0.0 - - - - - - - 207.04545454545453 18 22 VDAC1 voltage-dependent anion channel 1 1537 199 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544354.[MT7]-RLDGC[CAM]IYAIK[MT7].3b6_1.heavy 499.621 / 859.458 6743.0 29.60319995880127 41 15 10 6 10 6.1982932925020595 16.133473406456552 0.036800384521484375 3 0.9587602208957583 6.056200891670782 6743.0 44.42817757009345 0.0 - - - - - - - 206.86666666666667 13 15 WEE1 WEE1 homolog (S. pombe) 1539 199 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544354.[MT7]-RLDGC[CAM]IYAIK[MT7].3b5_1.heavy 499.621 / 746.374 7813.0 29.60319995880127 41 15 10 6 10 6.1982932925020595 16.133473406456552 0.036800384521484375 3 0.9587602208957583 6.056200891670782 7813.0 26.359747663551403 0.0 - - - - - - - 231.83333333333334 15 12 WEE1 WEE1 homolog (S. pombe) 1541 199 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544354.[MT7]-RLDGC[CAM]IYAIK[MT7].3b3_1.heavy 499.621 / 529.321 2141.0 29.60319995880127 41 15 10 6 10 6.1982932925020595 16.133473406456552 0.036800384521484375 3 0.9587602208957583 6.056200891670782 2141.0 3.387946049277825 1.0 - - - - - - - 642.0 4 13 WEE1 WEE1 homolog (S. pombe) 1543 199 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544354.[MT7]-RLDGC[CAM]IYAIK[MT7].3y4_1.heavy 499.621 / 638.399 13165.0 29.60319995880127 41 15 10 6 10 6.1982932925020595 16.133473406456552 0.036800384521484375 3 0.9587602208957583 6.056200891670782 13165.0 28.606191588785045 0.0 - - - - - - - 749.0 26 11 WEE1 WEE1 homolog (S. pombe) 1545 200 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544355.[MT7]-VVHC[CAM]QPLDLK[MT7].3y3_1.heavy 499.621 / 519.326 27384.0 27.105100631713867 50 20 10 10 10 5.929566599543777 16.86463897845317 0.0 3 0.994100882730695 16.060354509694886 27384.0 69.98539794787256 0.0 - - - - - - - 1211.5714285714287 54 7 SPRY4 sprouty homolog 4 (Drosophila) 1547 200 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544355.[MT7]-VVHC[CAM]QPLDLK[MT7].3b4_1.heavy 499.621 / 640.336 5503.0 27.105100631713867 50 20 10 10 10 5.929566599543777 16.86463897845317 0.0 3 0.994100882730695 16.060354509694886 5503.0 9.488398468957545 0.0 - - - - - - - 752.625 11 8 SPRY4 sprouty homolog 4 (Drosophila) 1549 200 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544355.[MT7]-VVHC[CAM]QPLDLK[MT7].3y4_1.heavy 499.621 / 632.41 8481.0 27.105100631713867 50 20 10 10 10 5.929566599543777 16.86463897845317 0.0 3 0.994100882730695 16.060354509694886 8481.0 22.028196032782244 0.0 - - - - - - - 625.8888888888889 16 9 SPRY4 sprouty homolog 4 (Drosophila) 1551 200 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544355.[MT7]-VVHC[CAM]QPLDLK[MT7].3y5_1.heavy 499.621 / 729.463 34700.0 27.105100631713867 50 20 10 10 10 5.929566599543777 16.86463897845317 0.0 3 0.994100882730695 16.060354509694886 34700.0 150.06884178407358 0.0 - - - - - - - 673.2 69 10 SPRY4 sprouty homolog 4 (Drosophila) 1553 201 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22021.[MT7]-FNNDWWIGR.2y4_1.heavy 676.337 / 531.304 655.0 39.20640182495117 48 18 10 10 10 4.175854272307801 23.947195826049416 0.0 3 0.9893217688389866 11.932336542364288 655.0 4.615329483748807 5.0 - - - - - - - 200.73684210526315 2 19 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 1555 201 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22021.[MT7]-FNNDWWIGR.2y8_1.heavy 676.337 / 1060.5 1429.0 39.20640182495117 48 18 10 10 10 4.175854272307801 23.947195826049416 0.0 3 0.9893217688389866 11.932336542364288 1429.0 7.743385424812477 1.0 - - - - - - - 134.375 3 8 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 1557 201 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22021.[MT7]-FNNDWWIGR.2y5_1.heavy 676.337 / 717.383 3156.0 39.20640182495117 48 18 10 10 10 4.175854272307801 23.947195826049416 0.0 3 0.9893217688389866 11.932336542364288 3156.0 11.128432835820895 0.0 - - - - - - - 165.07692307692307 6 13 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 1559 201 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22021.[MT7]-FNNDWWIGR.2b4_1.heavy 676.337 / 635.291 2799.0 39.20640182495117 48 18 10 10 10 4.175854272307801 23.947195826049416 0.0 3 0.9893217688389866 11.932336542364288 2799.0 24.12223557421919 0.0 - - - - - - - 178.76470588235293 5 17 CACNB2 calcium channel, voltage-dependent, beta 2 subunit 1561 202 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22023.[MT7]-YLAEVASGEK[MT7].2y4_1.heavy 677.876 / 564.311 4581.0 30.32550048828125 48 18 10 10 10 2.88564039966813 23.72307776638008 0.0 3 0.983786669606777 9.679161167887015 4581.0 8.741295596705271 0.0 - - - - - - - 315.38461538461536 9 13 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 1563 202 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22023.[MT7]-YLAEVASGEK[MT7].2y8_1.heavy 677.876 / 934.496 3255.0 30.32550048828125 48 18 10 10 10 2.88564039966813 23.72307776638008 0.0 3 0.983786669606777 9.679161167887015 3255.0 32.95172644971023 0.0 - - - - - - - 217.2 6 5 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 1565 202 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22023.[MT7]-YLAEVASGEK[MT7].2y5_1.heavy 677.876 / 635.348 4581.0 30.32550048828125 48 18 10 10 10 2.88564039966813 23.72307776638008 0.0 3 0.983786669606777 9.679161167887015 4581.0 9.945866034380556 0.0 - - - - - - - 271.5 9 8 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 1567 202 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22023.[MT7]-YLAEVASGEK[MT7].2b4_1.heavy 677.876 / 621.336 6027.0 30.32550048828125 48 18 10 10 10 2.88564039966813 23.72307776638008 0.0 3 0.983786669606777 9.679161167887015 6027.0 14.694528968062912 0.0 - - - - - - - 259.9230769230769 12 13 YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide 1569 203 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544670.[MT7]-HENLLQFIAAEK[MT7].4y4_1.heavy 425.995 / 562.332 10652.0 39.621498107910156 38 8 10 10 10 0.820180053529639 80.1922995602223 0.0 3 0.783921344011524 2.6055933336689696 10652.0 268.198022273074 0.0 - - - - - - - 130.85714285714286 21 7 ACVR2B activin A receptor, type IIB 1571 203 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544670.[MT7]-HENLLQFIAAEK[MT7].4b4_1.heavy 425.995 / 638.338 4639.0 39.621498107910156 38 8 10 10 10 0.820180053529639 80.1922995602223 0.0 3 0.783921344011524 2.6055933336689696 4639.0 15.996567986580592 0.0 - - - - - - - 206.1 9 10 ACVR2B activin A receptor, type IIB 1573 203 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544670.[MT7]-HENLLQFIAAEK[MT7].4b5_1.heavy 425.995 / 751.422 3665.0 39.621498107910156 38 8 10 10 10 0.820180053529639 80.1922995602223 0.0 3 0.783921344011524 2.6055933336689696 3665.0 89.10059496567506 0.0 - - - - - - - 121.0 7 9 ACVR2B activin A receptor, type IIB 1575 203 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544670.[MT7]-HENLLQFIAAEK[MT7].4b3_1.heavy 425.995 / 525.254 3493.0 39.621498107910156 38 8 10 10 10 0.820180053529639 80.1922995602223 0.0 3 0.783921344011524 2.6055933336689696 3493.0 36.67473407482306 0.0 - - - - - - - 172.0 6 9 ACVR2B activin A receptor, type IIB 1577 204 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38955.[MT7]-RSVLNNPSK[MT7].2y8_1.heavy 651.89 / 1002.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1579 204 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38955.[MT7]-RSVLNNPSK[MT7].2y5_1.heavy 651.89 / 703.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1581 204 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38955.[MT7]-RSVLNNPSK[MT7].2b6_1.heavy 651.89 / 828.481 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1583 204 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB38955.[MT7]-RSVLNNPSK[MT7].2y7_1.heavy 651.89 / 915.538 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1585 205 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22110.[MT7]-SQLQITVISAK[MT7].3b4_1.heavy 492.639 / 601.343 33588.0 32.4109992980957 43 13 10 10 10 2.1614911332725426 35.02954129160087 0.0 3 0.9245272560498677 4.4637231399292565 33588.0 19.25502805114786 0.0 - - - - - - - 258.0 67 1 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1587 205 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22110.[MT7]-SQLQITVISAK[MT7].3b5_1.heavy 492.639 / 714.427 9172.0 32.4109992980957 43 13 10 10 10 2.1614911332725426 35.02954129160087 0.0 3 0.9245272560498677 4.4637231399292565 9172.0 33.11009644163618 0.0 - - - - - - - 631.6666666666666 18 9 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1589 205 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22110.[MT7]-SQLQITVISAK[MT7].3y4_1.heavy 492.639 / 562.368 44181.0 32.4109992980957 43 13 10 10 10 2.1614911332725426 35.02954129160087 0.0 3 0.9245272560498677 4.4637231399292565 44181.0 44.3868932427645 0.0 - - - - - - - 258.25 88 4 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1591 205 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22110.[MT7]-SQLQITVISAK[MT7].3y5_1.heavy 492.639 / 661.437 14339.0 32.4109992980957 43 13 10 10 10 2.1614911332725426 35.02954129160087 0.0 3 0.9245272560498677 4.4637231399292565 14339.0 51.390556368473554 0.0 - - - - - - - 215.16666666666666 28 6 ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1593 206 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21771.[MT7]-C[CAM]QAENK[MT7].2y4_1.heavy 519.268 / 605.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF7 ring finger protein 7 1595 206 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21771.[MT7]-C[CAM]QAENK[MT7].2b3_1.heavy 519.268 / 504.236 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF7 ring finger protein 7 1597 206 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21771.[MT7]-C[CAM]QAENK[MT7].2y5_1.heavy 519.268 / 733.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF7 ring finger protein 7 1599 206 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21771.[MT7]-C[CAM]QAENK[MT7].2y3_1.heavy 519.268 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF7 ring finger protein 7 1601 207 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22336.[MT7]-YRWTEYGLTFTEK[MT7].3y3_1.heavy 661.347 / 521.305 17948.0 36.54477500915527 40 14 10 6 10 4.559749331607162 17.384336938154142 0.03730010986328125 3 0.9316922589795327 4.694871538731419 17948.0 65.71653649635036 0.0 - - - - - - - 241.66666666666666 35 21 VDAC1 voltage-dependent anion channel 1 1603 207 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22336.[MT7]-YRWTEYGLTFTEK[MT7].3y4_1.heavy 661.347 / 668.374 10344.0 36.54477500915527 40 14 10 6 10 4.559749331607162 17.384336938154142 0.03730010986328125 3 0.9316922589795327 4.694871538731419 10344.0 37.649597018041774 0.0 - - - - - - - 285.6111111111111 20 18 VDAC1 voltage-dependent anion channel 1 1605 207 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22336.[MT7]-YRWTEYGLTFTEK[MT7].3b7_1.heavy 661.347 / 1100.53 4932.0 36.54477500915527 40 14 10 6 10 4.559749331607162 17.384336938154142 0.03730010986328125 3 0.9316922589795327 4.694871538731419 4932.0 53.947572815533974 0.0 - - - - - - - 127.57142857142857 9 14 VDAC1 voltage-dependent anion channel 1 1607 207 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22336.[MT7]-YRWTEYGLTFTEK[MT7].3b7_2.heavy 661.347 / 550.768 13084.0 36.54477500915527 40 14 10 6 10 4.559749331607162 17.384336938154142 0.03730010986328125 3 0.9316922589795327 4.694871538731419 13084.0 55.528550573514075 0.0 - - - - - - - 235.8125 26 16 VDAC1 voltage-dependent anion channel 1 1609 208 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22432.[MT7]-LQLDC[CAM]RPLEGNSTVTGQPR.3y18_2.heavy 762.398 / 1014.5 4446.0 29.86525058746338 41 15 10 6 10 3.1326590891165482 31.9217626799606 0.035800933837890625 3 0.9587760029708773 6.057368138918395 4446.0 27.714666666666666 0.0 - - - - - - - 292.5 8 8 INHBE inhibin, beta E 1611 208 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22432.[MT7]-LQLDC[CAM]RPLEGNSTVTGQPR.3y15_2.heavy 762.398 / 836.415 9478.0 29.86525058746338 41 15 10 6 10 3.1326590891165482 31.9217626799606 0.035800933837890625 3 0.9587760029708773 6.057368138918395 9478.0 94.1724358974359 0.0 - - - - - - - 277.875 18 8 INHBE inhibin, beta E 1613 208 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22432.[MT7]-LQLDC[CAM]RPLEGNSTVTGQPR.3b4_1.heavy 762.398 / 614.363 5148.0 29.86525058746338 41 15 10 6 10 3.1326590891165482 31.9217626799606 0.035800933837890625 3 0.9587760029708773 6.057368138918395 5148.0 33.733333333333334 0.0 - - - - - - - 216.0 10 13 INHBE inhibin, beta E 1615 208 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22432.[MT7]-LQLDC[CAM]RPLEGNSTVTGQPR.3y10_1.heavy 762.398 / 1016.51 1521.0 29.86525058746338 41 15 10 6 10 3.1326590891165482 31.9217626799606 0.035800933837890625 3 0.9587760029708773 6.057368138918395 1521.0 17.94 0.0 - - - - - - - 183.85714285714286 3 7 INHBE inhibin, beta E 1617 209 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541476.[MT7]-QISPEAR.2y4_1.heavy 472.768 / 472.251 N/A 17.86009979248047 33 13 0 10 10 1.0662491698013377 55.10476870912178 0.0 3 0.9199951614546815 4.333764825663517 43054.0 2.652538062049718 8.0 - - - - - - - 12163.0 305 1 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1619 209 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541476.[MT7]-QISPEAR.2y5_1.heavy 472.768 / 559.284 6412.0 17.86009979248047 33 13 0 10 10 1.0662491698013377 55.10476870912178 0.0 3 0.9199951614546815 4.333764825663517 6412.0 26.04 0.0 - - - - - - - 261.7142857142857 12 14 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1621 209 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541476.[MT7]-QISPEAR.2y6_1.heavy 472.768 / 672.367 8804.0 17.86009979248047 33 13 0 10 10 1.0662491698013377 55.10476870912178 0.0 3 0.9199951614546815 4.333764825663517 8804.0 44.50731524169726 0.0 - - - - - - - 260.75 17 16 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1623 209 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB541476.[MT7]-QISPEAR.2b5_1.heavy 472.768 / 699.379 8957.0 17.86009979248047 33 13 0 10 10 1.0662491698013377 55.10476870912178 0.0 3 0.9199951614546815 4.333764825663517 8957.0 164.90257566069903 1.0 - - - - - - - 186.66666666666666 19 15 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1625 210 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21773.[MT7]-ASPALVAK[MT7].2y4_1.heavy 522.836 / 574.404 2138.0 23.611799716949463 31 17 2 6 6 10.30102817842909 9.707768804031176 0.03520011901855469 5 0.9784120928501543 8.384413641230328 2138.0 9.001045443842713 0.0 - - - - - - - 291.3157894736842 4 19 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1627 210 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21773.[MT7]-ASPALVAK[MT7].2y6_1.heavy 522.836 / 742.494 7126.0 23.611799716949463 31 17 2 6 6 10.30102817842909 9.707768804031176 0.03520011901855469 5 0.9784120928501543 8.384413641230328 7126.0 68.70182747179827 0.0 - - - - - - - 235.2941176470588 14 17 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1629 210 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21773.[MT7]-ASPALVAK[MT7].2b5_1.heavy 522.836 / 584.352 2850.0 23.611799716949463 31 17 2 6 6 10.30102817842909 9.707768804031176 0.03520011901855469 5 0.9784120928501543 8.384413641230328 2850.0 4.940693430656934 2.0 - - - - - - - 727.5454545454545 10 11 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1631 210 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21773.[MT7]-ASPALVAK[MT7].2y7_1.heavy 522.836 / 829.526 3618.0 23.611799716949463 31 17 2 6 6 10.30102817842909 9.707768804031176 0.03520011901855469 5 0.9784120928501543 8.384413641230328 3618.0 32.60241828378138 1.0 - - - - - - - 187.05882352941177 44 17 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1633 211 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21776.[MT7]-DLEEQLR.2b3_1.heavy 523.784 / 502.263 15483.0 26.461100101470947 46 20 10 6 10 13.556225852079013 7.3766844172682315 0.03439903259277344 3 0.9992484406202369 45.01461255665601 15483.0 15.803779796537672 1.0 - - - - - - - 1285.0 51 12 VEGFC vascular endothelial growth factor C 1635 211 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21776.[MT7]-DLEEQLR.2y5_1.heavy 523.784 / 674.347 16593.0 26.461100101470947 46 20 10 6 10 13.556225852079013 7.3766844172682315 0.03439903259277344 3 0.9992484406202369 45.01461255665601 16593.0 50.29152509652509 0.0 - - - - - - - 337.4117647058824 33 17 VEGFC vascular endothelial growth factor C 1637 211 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21776.[MT7]-DLEEQLR.2b4_1.heavy 523.784 / 631.305 16531.0 26.461100101470947 46 20 10 6 10 13.556225852079013 7.3766844172682315 0.03439903259277344 3 0.9992484406202369 45.01461255665601 16531.0 30.97700900900901 0.0 - - - - - - - 694.0 33 8 VEGFC vascular endothelial growth factor C 1639 211 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21776.[MT7]-DLEEQLR.2y6_1.heavy 523.784 / 787.431 38799.0 26.461100101470947 46 20 10 6 10 13.556225852079013 7.3766844172682315 0.03439903259277344 3 0.9992484406202369 45.01461255665601 38799.0 79.98628327490671 0.0 - - - - - - - 281.25 77 16 VEGFC vascular endothelial growth factor C 1641 212 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22334.[MT7]-LTLDTIFVPNTGK[MT7]K[MT7].3b6_1.heavy 660.402 / 801.484 2071.0 37.85240077972412 46 20 10 6 10 6.221794801978479 16.072532634506175 0.035198211669921875 3 0.9915945977059415 13.451739430656641 2071.0 8.31203584536918 0.0 - - - - - - - 197.42105263157896 4 19 VDAC3 voltage-dependent anion channel 3 1643 212 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22334.[MT7]-LTLDTIFVPNTGK[MT7]K[MT7].3y6_1.heavy 660.402 / 932.577 4531.0 37.85240077972412 46 20 10 6 10 6.221794801978479 16.072532634506175 0.035198211669921875 3 0.9915945977059415 13.451739430656641 4531.0 42.810633623656884 0.0 - - - - - - - 177.8125 9 16 VDAC3 voltage-dependent anion channel 3 1645 212 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22334.[MT7]-LTLDTIFVPNTGK[MT7]K[MT7].3b4_1.heavy 660.402 / 587.352 2654.0 37.85240077972412 46 20 10 6 10 6.221794801978479 16.072532634506175 0.035198211669921875 3 0.9915945977059415 13.451739430656641 2654.0 7.850684326710817 0.0 - - - - - - - 265.04761904761904 5 21 VDAC3 voltage-dependent anion channel 3 1647 212 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22334.[MT7]-LTLDTIFVPNTGK[MT7]K[MT7].3b5_1.heavy 660.402 / 688.4 2071.0 37.85240077972412 46 20 10 6 10 6.221794801978479 16.072532634506175 0.035198211669921875 3 0.9915945977059415 13.451739430656641 2071.0 9.997151152035233 1.0 - - - - - - - 175.52380952380952 6 21 VDAC3 voltage-dependent anion channel 3 1649 213 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22438.[MT7]-WNTDNTLGTEITVEDQLAR.3y6_1.heavy 774.056 / 731.368 28327.0 37.80970001220703 44 14 10 10 10 1.4092877475728522 56.516493197943554 0.0 3 0.931726901906176 4.69607642282823 28327.0 63.44968599331624 0.0 - - - - - - - 722.8571428571429 56 7 VDAC1 voltage-dependent anion channel 1 1651 213 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22438.[MT7]-WNTDNTLGTEITVEDQLAR.3b6_1.heavy 774.056 / 876.397 17403.0 37.80970001220703 44 14 10 10 10 1.4092877475728522 56.516493197943554 0.0 3 0.931726901906176 4.69607642282823 17403.0 93.30764178242637 0.0 - - - - - - - 279.5882352941176 34 17 VDAC1 voltage-dependent anion channel 1 1653 213 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22438.[MT7]-WNTDNTLGTEITVEDQLAR.3b4_1.heavy 774.056 / 661.306 14133.0 37.80970001220703 44 14 10 10 10 1.4092877475728522 56.516493197943554 0.0 3 0.931726901906176 4.69607642282823 14133.0 49.432475334770494 0.0 - - - - - - - 353.27777777777777 28 18 VDAC1 voltage-dependent anion channel 1 1655 213 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22438.[MT7]-WNTDNTLGTEITVEDQLAR.3y8_1.heavy 774.056 / 931.484 37090.0 37.80970001220703 44 14 10 10 10 1.4092877475728522 56.516493197943554 0.0 3 0.931726901906176 4.69607642282823 37090.0 70.02645018652686 0.0 - - - - - - - 1728.0 74 7 VDAC1 voltage-dependent anion channel 1 1657 214 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22335.[MT7]-YRWTEYGLTFTEK[MT7].4b7_1.heavy 496.262 / 1100.53 N/A 36.554100036621094 39 9 10 10 10 0.5021454716235166 88.94377503439233 0.0 3 0.811966087049338 2.8002161136934918 0.0 0.0 5.0 - - - - - - - 0.0 0 0 VDAC1 voltage-dependent anion channel 1 1659 214 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22335.[MT7]-YRWTEYGLTFTEK[MT7].4b7_2.heavy 496.262 / 550.768 59398.0 36.554100036621094 39 9 10 10 10 0.5021454716235166 88.94377503439233 0.0 3 0.811966087049338 2.8002161136934918 59398.0 80.5035803360073 0.0 - - - - - - - 686.625 118 8 VDAC1 voltage-dependent anion channel 1 1661 214 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22335.[MT7]-YRWTEYGLTFTEK[MT7].4b5_1.heavy 496.262 / 880.443 4807.0 36.554100036621094 39 9 10 10 10 0.5021454716235166 88.94377503439233 0.0 3 0.811966087049338 2.8002161136934918 4807.0 93.67064720194648 0.0 - - - - - - - 171.75 9 12 VDAC1 voltage-dependent anion channel 1 1663 214 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22335.[MT7]-YRWTEYGLTFTEK[MT7].4y3_1.heavy 496.262 / 521.305 55346.0 36.554100036621094 39 9 10 10 10 0.5021454716235166 88.94377503439233 0.0 3 0.811966087049338 2.8002161136934918 55346.0 81.44261391095304 0.0 - - - - - - - 748.5 110 10 VDAC1 voltage-dependent anion channel 1 1665 215 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22252.[MT7]-SRVTQSNFAVGYK[MT7].3y3_1.heavy 582.324 / 511.3 64401.0 25.7810001373291 42 12 10 10 10 1.585538766557976 39.966192541911234 0.0 3 0.892458435050256 3.729091515151344 64401.0 52.63505504322642 0.0 - - - - - - - 729.5714285714286 128 7 VDAC1 voltage-dependent anion channel 1 1667 215 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22252.[MT7]-SRVTQSNFAVGYK[MT7].3y4_1.heavy 582.324 / 610.368 28236.0 25.7810001373291 42 12 10 10 10 1.585538766557976 39.966192541911234 0.0 3 0.892458435050256 3.729091515151344 28236.0 76.43898768210971 0.0 - - - - - - - 272.53846153846155 56 13 VDAC1 voltage-dependent anion channel 1 1669 215 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22252.[MT7]-SRVTQSNFAVGYK[MT7].3b7_1.heavy 582.324 / 917.492 7930.0 25.7810001373291 42 12 10 10 10 1.585538766557976 39.966192541911234 0.0 3 0.892458435050256 3.729091515151344 7930.0 32.382798964113945 0.0 - - - - - - - 162.85714285714286 15 14 VDAC1 voltage-dependent anion channel 1 1671 215 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22252.[MT7]-SRVTQSNFAVGYK[MT7].3b8_2.heavy 582.324 / 532.784 31960.0 25.7810001373291 42 12 10 10 10 1.585538766557976 39.966192541911234 0.0 3 0.892458435050256 3.729091515151344 31960.0 32.63826781682394 0.0 - - - - - - - 781.0 63 9 VDAC1 voltage-dependent anion channel 1 1673 216 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544124.[MT7]-ISSPQVEEGDSR.3y7_1.heavy 483.243 / 791.353 N/A 22.40059979756673 33 18 2 3 10 4.0967637273296305 24.409511179006266 0.05010032653808594 3 0.9817689377479067 9.12629204283714 6960.0 1.122315286889497 3.0 - - - - - - - 781.2857142857143 65 7 WEE1 WEE1 homolog (S. pombe) 1675 216 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544124.[MT7]-ISSPQVEEGDSR.3y6_1.heavy 483.243 / 692.285 13920.0 22.40059979756673 33 18 2 3 10 4.0967637273296305 24.409511179006266 0.05010032653808594 3 0.9817689377479067 9.12629204283714 13920.0 46.056234550158095 0.0 - - - - - - - 314.0 27 20 WEE1 WEE1 homolog (S. pombe) 1677 216 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544124.[MT7]-ISSPQVEEGDSR.3b5_1.heavy 483.243 / 657.369 15231.0 22.40059979756673 33 18 2 3 10 4.0967637273296305 24.409511179006266 0.05010032653808594 3 0.9817689377479067 9.12629204283714 15231.0 -0.21195379905371553 1.0 - - - - - - - 703.8571428571429 30 7 WEE1 WEE1 homolog (S. pombe) 1679 216 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544124.[MT7]-ISSPQVEEGDSR.3y5_1.heavy 483.243 / 563.242 12971.0 22.40059979756673 33 18 2 3 10 4.0967637273296305 24.409511179006266 0.05010032653808594 3 0.9817689377479067 9.12629204283714 12971.0 29.377717044798132 0.0 - - - - - - - 756.0909090909091 25 11 WEE1 WEE1 homolog (S. pombe) 1681 217 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22062.[MT7]-NYEQWQLQR.3b4_1.heavy 470.241 / 679.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1683 217 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22062.[MT7]-NYEQWQLQR.3b3_1.heavy 470.241 / 551.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1685 217 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22062.[MT7]-NYEQWQLQR.3y4_1.heavy 470.241 / 544.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1687 217 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22062.[MT7]-NYEQWQLQR.3y5_1.heavy 470.241 / 730.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1689 218 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22331.[MT7]-FLGDSANLSILSGGTPK[MT7].4b7_1.heavy 492.028 / 849.422 6310.0 38.850799560546875 50 20 10 10 10 6.7024010672803795 14.920026270611825 0.0 3 0.9922437426998612 14.004098527377936 6310.0 23.50428041317311 0.0 - - - - - - - 178.66666666666666 12 15 CDC25C cell division cycle 25 homolog C (S. pombe) 1691 218 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22331.[MT7]-FLGDSANLSILSGGTPK[MT7].4b4_1.heavy 492.028 / 577.31 8691.0 38.850799560546875 50 20 10 10 10 6.7024010672803795 14.920026270611825 0.0 3 0.9922437426998612 14.004098527377936 8691.0 33.55134792171903 0.0 - - - - - - - 259.29411764705884 17 17 CDC25C cell division cycle 25 homolog C (S. pombe) 1693 218 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22331.[MT7]-FLGDSANLSILSGGTPK[MT7].4b5_1.heavy 492.028 / 664.342 N/A 38.850799560546875 50 20 10 10 10 6.7024010672803795 14.920026270611825 0.0 3 0.9922437426998612 14.004098527377936 7917.0 31.446698723742728 0.0 - - - - - - - 256.2 15 10 CDC25C cell division cycle 25 homolog C (S. pombe) 1695 218 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22331.[MT7]-FLGDSANLSILSGGTPK[MT7].4b6_1.heavy 492.028 / 735.379 4464.0 38.850799560546875 50 20 10 10 10 6.7024010672803795 14.920026270611825 0.0 3 0.9922437426998612 14.004098527377936 4464.0 19.238847216739046 0.0 - - - - - - - 189.8125 8 16 CDC25C cell division cycle 25 homolog C (S. pombe) 1697 219 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543495.[MT7]-LWLLDDSK[MT7].2y4_1.heavy 639.371 / 608.301 4753.0 40.65622520446777 43 20 10 3 10 3.7992683674116874 21.075470874429918 0.061397552490234375 3 0.9905209320738833 12.665895349985277 4753.0 8.801851851851852 1.0 - - - - - - - 201.27272727272728 9 22 NCK1;NCK2 NCK adaptor protein 1;NCK adaptor protein 2 1699 219 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543495.[MT7]-LWLLDDSK[MT7].2y5_1.heavy 639.371 / 721.385 4429.0 40.65622520446777 43 20 10 3 10 3.7992683674116874 21.075470874429918 0.061397552490234375 3 0.9905209320738833 12.665895349985277 4429.0 10.935802469135803 1.0 - - - - - - - 218.57142857142858 8 21 NCK1;NCK2 NCK adaptor protein 1;NCK adaptor protein 2 1701 219 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543495.[MT7]-LWLLDDSK[MT7].2y6_1.heavy 639.371 / 834.469 3781.0 40.65622520446777 43 20 10 3 10 3.7992683674116874 21.075470874429918 0.061397552490234375 3 0.9905209320738833 12.665895349985277 3781.0 52.980679012345675 0.0 - - - - - - - 201.0 7 18 NCK1;NCK2 NCK adaptor protein 1;NCK adaptor protein 2 1703 219 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543495.[MT7]-LWLLDDSK[MT7].2y7_1.heavy 639.371 / 1020.55 4483.0 40.65622520446777 43 20 10 3 10 3.7992683674116874 21.075470874429918 0.061397552490234375 3 0.9905209320738833 12.665895349985277 4483.0 80.11287037037036 0.0 - - - - - - - 100.8 8 15 NCK1;NCK2 NCK adaptor protein 1;NCK adaptor protein 2 1705 220 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544121.[MT7]-ITHPPPQAALTR.3y7_1.heavy 482.616 / 756.436 54654.0 23.21619987487793 45 15 10 10 10 3.03713088582226 32.925811813647414 0.0 3 0.95311989570049 5.677493740645558 54654.0 21.62168531100885 0.0 - - - - - - - 739.0 109 2 INHBE inhibin, beta E 1707 220 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544121.[MT7]-ITHPPPQAALTR.3b3_1.heavy 482.616 / 496.3 51203.0 23.21619987487793 45 15 10 10 10 3.03713088582226 32.925811813647414 0.0 3 0.95311989570049 5.677493740645558 51203.0 29.000519035596533 0.0 - - - - - - - 931.0 102 1 INHBE inhibin, beta E 1709 220 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544121.[MT7]-ITHPPPQAALTR.3y8_1.heavy 482.616 / 853.489 15936.0 23.21619987487793 45 15 10 10 10 3.03713088582226 32.925811813647414 0.0 3 0.95311989570049 5.677493740645558 15936.0 20.008301553289588 0.0 - - - - - - - 800.75 31 8 INHBE inhibin, beta E 1711 220 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544121.[MT7]-ITHPPPQAALTR.3y5_1.heavy 482.616 / 531.325 20755.0 23.21619987487793 45 15 10 10 10 3.03713088582226 32.925811813647414 0.0 3 0.95311989570049 5.677493740645558 20755.0 16.86882078993166 0.0 - - - - - - - 410.5 41 2 INHBE inhibin, beta E 1713 221 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22061.[MT7]-NYEQWQLQR.2b3_1.heavy 704.858 / 551.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1715 221 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22061.[MT7]-NYEQWQLQR.2y8_1.heavy 704.858 / 1150.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1717 221 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22061.[MT7]-NYEQWQLQR.2y5_1.heavy 704.858 / 730.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1719 221 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22061.[MT7]-NYEQWQLQR.2b4_1.heavy 704.858 / 679.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITCH itchy E3 ubiquitin protein ligase homolog (mouse) 1721 222 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21670.[MT7]-NVVGARR.2b3_1.heavy 458.284 / 457.289 N/A 14.71090030670166 43 17 10 10 6 2.214956713789916 35.26721298679197 0.0 5 0.9712980900612115 7.267126242634436 1256.0 3.956626865843082 1.0 - - - - - - - 268.0869565217391 4 23 YWHAB;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1723 222 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21670.[MT7]-NVVGARR.2y5_1.heavy 458.284 / 558.347 533.0 14.71090030670166 43 17 10 10 6 2.214956713789916 35.26721298679197 0.0 5 0.9712980900612115 7.267126242634436 533.0 2.1039473684210526 5.0 - - - - - - - 0.0 1 0 YWHAB;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1725 222 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21670.[MT7]-NVVGARR.2b4_1.heavy 458.284 / 514.311 723.0 14.71090030670166 43 17 10 10 6 2.214956713789916 35.26721298679197 0.0 5 0.9712980900612115 7.267126242634436 723.0 2.1947527910685802 1.0 - - - - - - - 0.0 1 0 YWHAB;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1727 222 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21670.[MT7]-NVVGARR.2b6_1.heavy 458.284 / 741.449 2055.0 14.71090030670166 43 17 10 10 6 2.214956713789916 35.26721298679197 0.0 5 0.9712980900612115 7.267126242634436 2055.0 14.446804511278195 1.0 - - - - - - - 159.0 4 22 YWHAB;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1729 223 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22256.[MT7]-YVNPETVAALLSGK[MT7].2y4_1.heavy 875.503 / 548.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1731 223 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22256.[MT7]-YVNPETVAALLSGK[MT7].2b3_1.heavy 875.503 / 521.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1733 223 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22256.[MT7]-YVNPETVAALLSGK[MT7].2y9_1.heavy 875.503 / 1003.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1735 223 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22256.[MT7]-YVNPETVAALLSGK[MT7].2y11_1.heavy 875.503 / 1229.72 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1737 224 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB545049.[MT7]-AIYDFEAAEDNELTFK[MT7].3y3_1.heavy 722.028 / 539.331 12879.0 39.775901794433594 44 14 10 10 10 1.8178146375852968 46.01411365837201 0.0 3 0.9435214115677487 5.168385795052348 12879.0 47.298998839149675 0.0 - - - - - - - 254.73684210526315 25 19 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1739 224 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB545049.[MT7]-AIYDFEAAEDNELTFK[MT7].3b6_1.heavy 722.028 / 883.432 8476.0 39.775901794433594 44 14 10 10 10 1.8178146375852968 46.01411365837201 0.0 3 0.9435214115677487 5.168385795052348 8476.0 58.56145454545454 0.0 - - - - - - - 209.0 16 15 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1741 224 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB545049.[MT7]-AIYDFEAAEDNELTFK[MT7].3b4_1.heavy 722.028 / 607.321 13319.0 39.775901794433594 44 14 10 10 10 1.8178146375852968 46.01411365837201 0.0 3 0.9435214115677487 5.168385795052348 13319.0 63.76975757575757 0.0 - - - - - - - 308.6111111111111 26 18 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1743 224 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB545049.[MT7]-AIYDFEAAEDNELTFK[MT7].3b5_1.heavy 722.028 / 754.389 5724.0 39.775901794433594 44 14 10 10 10 1.8178146375852968 46.01411365837201 0.0 3 0.9435214115677487 5.168385795052348 5724.0 26.53854545454545 0.0 - - - - - - - 242.0 11 20 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1745 225 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543391.[MT7]-HFFTLSVK[MT7].3y3_1.heavy 422.92 / 477.315 44622.0 33.36349868774414 50 20 10 10 10 14.425413980238536 6.932210065998148 0.0 3 0.9985750222011479 32.68938390765761 44622.0 140.54947136563877 0.0 - - - - - - - 328.1111111111111 89 9 SOCS3 suppressor of cytokine signaling 3 1747 225 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543391.[MT7]-HFFTLSVK[MT7].3b4_1.heavy 422.92 / 677.353 3974.0 33.36349868774414 50 20 10 10 10 14.425413980238536 6.932210065998148 0.0 3 0.9985750222011479 32.68938390765761 3974.0 43.246542854934695 0.0 - - - - - - - 265.0 7 9 SOCS3 suppressor of cytokine signaling 3 1749 225 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543391.[MT7]-HFFTLSVK[MT7].3y4_1.heavy 422.92 / 590.399 6018.0 33.36349868774414 50 20 10 10 10 14.425413980238536 6.932210065998148 0.0 3 0.9985750222011479 32.68938390765761 6018.0 58.62605633802817 0.0 - - - - - - - 227.4 12 5 SOCS3 suppressor of cytokine signaling 3 1751 225 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543391.[MT7]-HFFTLSVK[MT7].3b3_1.heavy 422.92 / 576.305 6585.0 33.36349868774414 50 20 10 10 10 14.425413980238536 6.932210065998148 0.0 3 0.9985750222011479 32.68938390765761 6585.0 61.83202527243218 0.0 - - - - - - - 193.4 13 10 SOCS3 suppressor of cytokine signaling 3 1753 226 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22058.[MT7]-GLQEEPVEGFR.2y9_1.heavy 702.866 / 1090.52 2342.0 30.029325008392334 44 18 10 6 10 3.127298383540048 25.422709066365773 0.03890037536621094 3 0.9883112655353664 11.403933719721836 2342.0 15.313076923076922 0.0 - - - - - - - 257.4 4 5 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1755 226 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22058.[MT7]-GLQEEPVEGFR.2b4_1.heavy 702.866 / 572.316 3630.0 30.029325008392334 44 18 10 6 10 3.127298383540048 25.422709066365773 0.03890037536621094 3 0.9883112655353664 11.403933719721836 3630.0 28.388461538461538 0.0 - - - - - - - 279.0 7 13 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1757 226 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22058.[MT7]-GLQEEPVEGFR.2b5_1.heavy 702.866 / 701.359 4450.0 30.029325008392334 44 18 10 6 10 3.127298383540048 25.422709066365773 0.03890037536621094 3 0.9883112655353664 11.403933719721836 4450.0 42.97863247863248 0.0 - - - - - - - 273.0 8 9 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1759 226 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22058.[MT7]-GLQEEPVEGFR.2y7_1.heavy 702.866 / 833.415 2576.0 30.029325008392334 44 18 10 6 10 3.127298383540048 25.422709066365773 0.03890037536621094 3 0.9883112655353664 11.403933719721836 2576.0 30.934017094017094 0.0 - - - - - - - 156.0 5 3 CDC34 cell division cycle 34 homolog (S. cerevisiae) 1761 227 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542925.[MT7]-LTLDTIFVPNTGK[MT7].3b4_1.heavy 569.669 / 587.352 11110.0 40.95069885253906 43 13 10 10 10 3.5383683120485347 28.261614162519194 0.0 3 0.906432402894208 4.002705818927003 11110.0 38.7968253968254 0.0 - - - - - - - 232.10526315789474 22 19 VDAC3 voltage-dependent anion channel 3 1763 227 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542925.[MT7]-LTLDTIFVPNTGK[MT7].3b5_1.heavy 569.669 / 688.4 16328.0 40.95069885253906 43 13 10 10 10 3.5383683120485347 28.261614162519194 0.0 3 0.906432402894208 4.002705818927003 16328.0 94.49506031746031 0.0 - - - - - - - 700.7142857142857 32 7 VDAC3 voltage-dependent anion channel 3 1765 227 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542925.[MT7]-LTLDTIFVPNTGK[MT7].3y4_1.heavy 569.669 / 563.327 11965.0 40.95069885253906 43 13 10 10 10 3.5383683120485347 28.261614162519194 0.0 3 0.906432402894208 4.002705818927003 11965.0 55.86588522588522 0.0 - - - - - - - 304.4117647058824 23 17 VDAC3 voltage-dependent anion channel 3 1767 227 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542925.[MT7]-LTLDTIFVPNTGK[MT7].3y5_1.heavy 569.669 / 660.38 50424.0 40.95069885253906 43 13 10 10 10 3.5383683120485347 28.261614162519194 0.0 3 0.906432402894208 4.002705818927003 50424.0 159.52856140350877 0.0 - - - - - - - 331.3636363636364 100 11 VDAC3 voltage-dependent anion channel 3 1769 228 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39180.[MT7]-NDPQLSLISAMIK[MT7].2y8_1.heavy 859.492 / 1006.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1771 228 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39180.[MT7]-NDPQLSLISAMIK[MT7].2y5_1.heavy 859.492 / 693.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1773 228 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39180.[MT7]-NDPQLSLISAMIK[MT7].2y3_1.heavy 859.492 / 535.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1775 228 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB39180.[MT7]-NDPQLSLISAMIK[MT7].2b5_1.heavy 859.492 / 712.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1777 229 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21895.[MT7]-QAQAQLEK[MT7].2y5_1.heavy 602.35 / 732.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNB2 calcium channel, voltage-dependent, beta 2 subunit 1779 229 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21895.[MT7]-QAQAQLEK[MT7].2y3_1.heavy 602.35 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNB2 calcium channel, voltage-dependent, beta 2 subunit 1781 229 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21895.[MT7]-QAQAQLEK[MT7].2b5_1.heavy 602.35 / 671.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNB2 calcium channel, voltage-dependent, beta 2 subunit 1783 229 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21895.[MT7]-QAQAQLEK[MT7].2y7_1.heavy 602.35 / 931.533 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNB2 calcium channel, voltage-dependent, beta 2 subunit 1785 230 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22329.[MT7]-FLGDSANLSILSGGTPK[MT7].2b8_1.heavy 983.048 / 962.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1787 230 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22329.[MT7]-FLGDSANLSILSGGTPK[MT7].2b4_1.heavy 983.048 / 577.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1789 230 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22329.[MT7]-FLGDSANLSILSGGTPK[MT7].2y10_1.heavy 983.048 / 1116.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1791 230 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22329.[MT7]-FLGDSANLSILSGGTPK[MT7].2b7_1.heavy 983.048 / 849.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25C cell division cycle 25 homolog C (S. pombe) 1793 231 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22103.[MT7]-DLLAGGVAAAVSK[MT7].2y9_1.heavy 730.44 / 903.538 4550.0 34.611000061035156 44 14 10 10 10 2.1398953113096173 39.720760056531425 0.0 3 0.9401358727605379 5.018666174754478 4550.0 12.221671300313437 0.0 - - - - - - - 203.28571428571428 9 7 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1795 231 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22103.[MT7]-DLLAGGVAAAVSK[MT7].2y6_1.heavy 730.44 / 690.427 2559.0 34.611000061035156 44 14 10 10 10 2.1398953113096173 39.720760056531425 0.0 3 0.9401358727605379 5.018666174754478 2559.0 5.0367721518987345 1.0 - - - - - - - 245.35294117647058 5 17 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1797 231 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22103.[MT7]-DLLAGGVAAAVSK[MT7].2b7_1.heavy 730.44 / 770.453 2654.0 34.611000061035156 44 14 10 10 10 2.1398953113096173 39.720760056531425 0.0 3 0.9401358727605379 5.018666174754478 2654.0 21.79073684210526 0.0 - - - - - - - 208.7 5 10 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1799 231 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22103.[MT7]-DLLAGGVAAAVSK[MT7].2y10_1.heavy 730.44 / 974.575 2843.0 34.611000061035156 44 14 10 10 10 2.1398953113096173 39.720760056531425 0.0 3 0.9401358727605379 5.018666174754478 2843.0 20.96421330370782 0.0 - - - - - - - 237.1 5 10 SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1801 232 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22327.[MT7]-LTFDSSFSPNTGK[MT7]K[MT7].4y5_1.heavy 491.023 / 835.524 1873.0 31.09239959716797 46 18 10 10 8 2.6837923684246348 37.26070659434031 0.0 4 0.9854726896386217 10.226866705684186 1873.0 2.1240825782161323 2.0 - - - - - - - 299.7 8 10 VDAC1 voltage-dependent anion channel 1 1803 232 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22327.[MT7]-LTFDSSFSPNTGK[MT7]K[MT7].4y4_1.heavy 491.023 / 721.481 N/A 31.09239959716797 46 18 10 10 8 2.6837923684246348 37.26070659434031 0.0 4 0.9854726896386217 10.226866705684186 2497.0 0.5758613425482615 2.0 - - - - - - - 717.75 37 8 VDAC1 voltage-dependent anion channel 1 1805 232 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22327.[MT7]-LTFDSSFSPNTGK[MT7]K[MT7].4b4_1.heavy 491.023 / 621.336 20349.0 31.09239959716797 46 18 10 10 8 2.6837923684246348 37.26070659434031 0.0 4 0.9854726896386217 10.226866705684186 20349.0 35.16140186915888 0.0 - - - - - - - 374.5 40 4 VDAC1 voltage-dependent anion channel 1 1807 232 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22327.[MT7]-LTFDSSFSPNTGK[MT7]K[MT7].4b3_1.heavy 491.023 / 506.31 9238.0 31.09239959716797 46 18 10 10 8 2.6837923684246348 37.26070659434031 0.0 4 0.9854726896386217 10.226866705684186 9238.0 11.672465462055378 0.0 - - - - - - - 802.5714285714286 18 7 VDAC1 voltage-dependent anion channel 1 1809 233 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22241.[MT7]-NDPQLSLISAMIK[MT7].3y3_1.heavy 573.33 / 535.339 7218.0 42.73615074157715 41 14 10 7 10 1.2580294913097287 48.20316274978963 0.029499053955078125 3 0.9415267737740286 5.078606522865456 7218.0 38.085228178998676 0.0 - - - - - - - 214.83333333333334 14 24 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1811 233 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22241.[MT7]-NDPQLSLISAMIK[MT7].3b4_1.heavy 573.33 / 599.291 5821.0 42.73615074157715 41 14 10 7 10 1.2580294913097287 48.20316274978963 0.029499053955078125 3 0.9415267737740286 5.078606522865456 5821.0 24.772187919382308 0.0 - - - - - - - 188.70833333333334 11 24 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1813 233 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22241.[MT7]-NDPQLSLISAMIK[MT7].3y4_1.heavy 573.33 / 606.377 5389.0 42.73615074157715 41 14 10 7 10 1.2580294913097287 48.20316274978963 0.029499053955078125 3 0.9415267737740286 5.078606522865456 5389.0 30.777250784619202 0.0 - - - - - - - 184.23076923076923 10 26 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1815 233 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22241.[MT7]-NDPQLSLISAMIK[MT7].3y5_1.heavy 573.33 / 693.409 11742.0 42.73615074157715 41 14 10 7 10 1.2580294913097287 48.20316274978963 0.029499053955078125 3 0.9415267737740286 5.078606522865456 11742.0 146.50403076923075 0.0 - - - - - - - 172.76190476190476 23 21 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1817 234 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22426.[MT7]-GNIITWNELC[CAM]HVAETMSR.3y7_1.heavy 759.041 / 793.387 881.0 42.98099899291992 42 16 10 6 10 2.3870908139018856 33.31995280407838 0.0319976806640625 3 0.9634084729451454 6.431893379851135 881.0 1.122292993630573 1.0 - - - - - - - 0.0 1 0 ACVR2B activin A receptor, type IIB 1819 234 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22426.[MT7]-GNIITWNELC[CAM]HVAETMSR.3y6_1.heavy 759.041 / 694.319 1793.0 42.98099899291992 42 16 10 6 10 2.3870908139018856 33.31995280407838 0.0319976806640625 3 0.9634084729451454 6.431893379851135 1793.0 10.607248554913294 0.0 - - - - - - - 193.14285714285714 3 28 ACVR2B activin A receptor, type IIB 1821 234 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22426.[MT7]-GNIITWNELC[CAM]HVAETMSR.3b4_1.heavy 759.041 / 542.342 1447.0 42.98099899291992 42 16 10 6 10 2.3870908139018856 33.31995280407838 0.0319976806640625 3 0.9634084729451454 6.431893379851135 1447.0 8.216673706262988 0.0 - - - - - - - 172.41379310344828 2 29 ACVR2B activin A receptor, type IIB 1823 234 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22426.[MT7]-GNIITWNELC[CAM]HVAETMSR.3y8_1.heavy 759.041 / 930.446 881.0 42.98099899291992 42 16 10 6 10 2.3870908139018856 33.31995280407838 0.0319976806640625 3 0.9634084729451454 6.431893379851135 881.0 4.728934568616097 0.0 - - - - - - - 0.0 1 0 ACVR2B activin A receptor, type IIB 1825 235 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21684.[MT7]-STQPVPR.2y4_1.heavy 464.77 / 468.293 30961.0 16.000374794006348 45 18 10 7 10 4.555341535692421 21.952250828279507 0.029499053955078125 3 0.9885571150727926 11.526026164568915 30961.0 198.90926051513904 0.0 - - - - - - - 235.76470588235293 61 17 SOCS3 suppressor of cytokine signaling 3 1827 235 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21684.[MT7]-STQPVPR.2y5_1.heavy 464.77 / 596.352 5994.0 16.000374794006348 45 18 10 7 10 4.555341535692421 21.952250828279507 0.029499053955078125 3 0.9885571150727926 11.526026164568915 5994.0 28.023366085578445 0.0 - - - - - - - 155.45454545454547 11 22 SOCS3 suppressor of cytokine signaling 3 1829 235 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21684.[MT7]-STQPVPR.2y6_1.heavy 464.77 / 697.399 21632.0 16.000374794006348 45 18 10 7 10 4.555341535692421 21.952250828279507 0.029499053955078125 3 0.9885571150727926 11.526026164568915 21632.0 145.37716023391812 0.0 - - - - - - - 220.47368421052633 43 19 SOCS3 suppressor of cytokine signaling 3 1831 235 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21684.[MT7]-STQPVPR.2b5_1.heavy 464.77 / 657.369 10771.0 16.000374794006348 45 18 10 7 10 4.555341535692421 21.952250828279507 0.029499053955078125 3 0.9885571150727926 11.526026164568915 10771.0 47.56067558088827 0.0 - - - - - - - 230.875 21 24 SOCS3 suppressor of cytokine signaling 3 1833 236 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21899.[MT7]-EVC[CAM]IDVGK[MT7].2y4_1.heavy 604.333 / 562.332 2559.0 27.286699295043945 43 13 10 10 10 1.2021387477936123 59.86154290929265 0.0 3 0.9124403251194706 4.139894525366011 2559.0 12.418308625023274 0.0 - - - - - - - 203.0952380952381 5 21 VEGFC vascular endothelial growth factor C 1835 236 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21899.[MT7]-EVC[CAM]IDVGK[MT7].2y6_1.heavy 604.333 / 835.446 2690.0 27.286699295043945 43 13 10 10 10 1.2021387477936123 59.86154290929265 0.0 3 0.9124403251194706 4.139894525366011 2690.0 52.984848484848484 0.0 - - - - - - - 142.88235294117646 5 17 VEGFC vascular endothelial growth factor C 1837 236 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21899.[MT7]-EVC[CAM]IDVGK[MT7].2b5_1.heavy 604.333 / 761.362 4397.0 27.286699295043945 43 13 10 10 10 1.2021387477936123 59.86154290929265 0.0 3 0.9124403251194706 4.139894525366011 4397.0 23.495419847328243 0.0 - - - - - - - 187.0 8 20 VEGFC vascular endothelial growth factor C 1839 236 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21899.[MT7]-EVC[CAM]IDVGK[MT7].2y7_1.heavy 604.333 / 934.515 2559.0 27.286699295043945 43 13 10 10 10 1.2021387477936123 59.86154290929265 0.0 3 0.9124403251194706 4.139894525366011 2559.0 29.857809509047932 0.0 - - - - - - - 158.89473684210526 5 19 VEGFC vascular endothelial growth factor C 1841 237 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22105.[MT7]-YLGSPITTVPK[MT7].2y5_1.heavy 732.439 / 689.431 1035.0 32.38595008850098 31 10 10 3 8 1.0497975411717222 59.988888137711825 0.050098419189453125 4 0.8242105758232109 2.8992681679024255 1035.0 0.9667525773195875 3.0 - - - - - - - 273.0 2 9 CDC25C cell division cycle 25 homolog C (S. pombe) 1843 237 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22105.[MT7]-YLGSPITTVPK[MT7].2b4_1.heavy 732.439 / 565.31 2977.0 32.38595008850098 31 10 10 3 8 1.0497975411717222 59.988888137711825 0.050098419189453125 4 0.8242105758232109 2.8992681679024255 2977.0 45.1165503875969 0.0 - - - - - - - 207.0 5 5 CDC25C cell division cycle 25 homolog C (S. pombe) 1845 237 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22105.[MT7]-YLGSPITTVPK[MT7].2y9_1.heavy 732.439 / 1043.62 1035.0 32.38595008850098 31 10 10 3 8 1.0497975411717222 59.988888137711825 0.050098419189453125 4 0.8242105758232109 2.8992681679024255 1035.0 11.217069228697136 1.0 - - - - - - - 129.0 2 2 CDC25C cell division cycle 25 homolog C (S. pombe) 1847 237 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22105.[MT7]-YLGSPITTVPK[MT7].2y7_1.heavy 732.439 / 899.568 3753.0 32.38595008850098 31 10 10 3 8 1.0497975411717222 59.988888137711825 0.050098419189453125 4 0.8242105758232109 2.8992681679024255 3753.0 35.8564013426037 0.0 - - - - - - - 226.25 7 4 CDC25C cell division cycle 25 homolog C (S. pombe) 1849 238 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22050.[MT7]-VVSELLQGGTSR.3y6_1.heavy 463.932 / 605.3 91633.0 34.65409851074219 47 17 10 10 10 2.5841601839838937 30.762897486690704 0.0 3 0.9705560114772585 7.174516471713008 91633.0 176.62240495137047 1.0 - - - - - - - 424.0 253 2 BHLHE40 basic helix-loop-helix family, member e40 1851 238 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22050.[MT7]-VVSELLQGGTSR.3b4_1.heavy 463.932 / 559.321 113316.0 34.65409851074219 47 17 10 10 10 2.5841601839838937 30.762897486690704 0.0 3 0.9705560114772585 7.174516471713008 113316.0 194.8907586562343 0.0 - - - - - - - 754.1111111111111 226 9 BHLHE40 basic helix-loop-helix family, member e40 1853 238 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22050.[MT7]-VVSELLQGGTSR.3b5_1.heavy 463.932 / 672.405 96913.0 34.65409851074219 47 17 10 10 10 2.5841601839838937 30.762897486690704 0.0 3 0.9705560114772585 7.174516471713008 96913.0 1083.529114206547 0.0 - - - - - - - 341.75 193 8 BHLHE40 basic helix-loop-helix family, member e40 1855 238 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22050.[MT7]-VVSELLQGGTSR.3y5_1.heavy 463.932 / 477.242 146500.0 34.65409851074219 47 17 10 10 10 2.5841601839838937 30.762897486690704 0.0 3 0.9705560114772585 7.174516471713008 146500.0 204.6850389450099 0.0 - - - - - - - 766.0 293 8 BHLHE40 basic helix-loop-helix family, member e40 1857 239 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21897.[MT7]-VTADISLAK[MT7].2y4_1.heavy 603.371 / 562.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1859 239 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21897.[MT7]-VTADISLAK[MT7].2y8_1.heavy 603.371 / 962.564 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1861 239 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21897.[MT7]-VTADISLAK[MT7].2y5_1.heavy 603.371 / 675.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1863 239 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB21897.[MT7]-VTADISLAK[MT7].2b4_1.heavy 603.371 / 531.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1865 240 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22052.[MT7]-K[MT7]EEEDLAK[MT7].3y3_1.heavy 465.268 / 475.336 4578.0 18.385700225830078 46 16 10 10 10 4.02350042376064 24.853980233095918 0.0 3 0.9631729356219204 6.411164380545794 4578.0 32.28076923076923 0.0 - - - - - - - 216.66666666666666 9 18 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1867 240 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22052.[MT7]-K[MT7]EEEDLAK[MT7].3b4_1.heavy 465.268 / 804.434 364.0 18.385700225830078 46 16 10 10 10 4.02350042376064 24.853980233095918 0.0 3 0.9631729356219204 6.411164380545794 364.0 10.08 1.0 - - - - - - - 0.0 0 0 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1869 240 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22052.[MT7]-K[MT7]EEEDLAK[MT7].3b5_1.heavy 465.268 / 919.461 312.0 18.385700225830078 46 16 10 10 10 4.02350042376064 24.853980233095918 0.0 3 0.9631729356219204 6.411164380545794 312.0 9.6 0.0 - - - - - - - 0.0 0 0 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1871 240 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22052.[MT7]-K[MT7]EEEDLAK[MT7].3y4_1.heavy 465.268 / 590.363 1977.0 18.385700225830078 46 16 10 10 10 4.02350042376064 24.853980233095918 0.0 3 0.9631729356219204 6.411164380545794 1977.0 7.7245421245421255 0.0 - - - - - - - 216.66666666666666 3 18 STAM signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 1873 241 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543199.[MT7]-VTADISLAK[MT7].3y3_1.heavy 402.583 / 475.336 9408.0 29.658299446105957 42 18 10 6 8 4.607429839028293 21.704074395865355 0.036800384521484375 4 0.9885087481854319 11.501697405567489 9408.0 8.547064198637045 1.0 - - - - - - - 271.09090909090907 53 11 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1875 241 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543199.[MT7]-VTADISLAK[MT7].3b4_1.heavy 402.583 / 531.289 26963.0 29.658299446105957 42 18 10 6 8 4.607429839028293 21.704074395865355 0.036800384521484375 4 0.9885087481854319 11.501697405567489 26963.0 24.470742921354493 0.0 - - - - - - - 401.5 53 2 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1877 241 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543199.[MT7]-VTADISLAK[MT7].3y4_1.heavy 402.583 / 562.368 4245.0 29.658299446105957 42 18 10 6 8 4.607429839028293 21.704074395865355 0.036800384521484375 4 0.9885087481854319 11.501697405567489 4245.0 14.154032717738257 0.0 - - - - - - - 260.72727272727275 8 11 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1879 241 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB543199.[MT7]-VTADISLAK[MT7].3b3_1.heavy 402.583 / 416.263 3327.0 29.658299446105957 42 18 10 6 8 4.607429839028293 21.704074395865355 0.036800384521484375 4 0.9885087481854319 11.501697405567489 3327.0 8.398265572729715 1.0 - - - - - - - 770.1428571428571 7 7 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1881 242 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22522.[MT7]-VTLVDEGDLYNWEVAIFGPPNTYYEGGYFK[MT7].4y5_1.heavy 936.964 / 715.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC34 cell division cycle 34 homolog (S. cerevisiae) 1883 242 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22522.[MT7]-VTLVDEGDLYNWEVAIFGPPNTYYEGGYFK[MT7].4b8_1.heavy 936.964 / 973.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC34 cell division cycle 34 homolog (S. cerevisiae) 1885 242 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22522.[MT7]-VTLVDEGDLYNWEVAIFGPPNTYYEGGYFK[MT7].4b5_1.heavy 936.964 / 672.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC34 cell division cycle 34 homolog (S. cerevisiae) 1887 242 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22522.[MT7]-VTLVDEGDLYNWEVAIFGPPNTYYEGGYFK[MT7].4y6_1.heavy 936.964 / 844.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC34 cell division cycle 34 homolog (S. cerevisiae) 1889 243 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22049.[MT7]-VVSELLQGGTSR.2y8_1.heavy 695.395 / 831.468 9050.0 34.65409851074219 45 15 10 10 10 2.2994090980955373 34.41586344491041 0.0 3 0.9590772937589549 6.079780723026668 9050.0 53.646549628881786 0.0 - - - - - - - 154.27272727272728 18 11 BHLHE40 basic helix-loop-helix family, member e40 1891 243 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22049.[MT7]-VVSELLQGGTSR.2b4_1.heavy 695.395 / 559.321 10936.0 34.65409851074219 45 15 10 10 10 2.2994090980955373 34.41586344491041 0.0 3 0.9590772937589549 6.079780723026668 10936.0 66.46614840989399 0.0 - - - - - - - 259.1666666666667 21 12 BHLHE40 basic helix-loop-helix family, member e40 1893 243 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22049.[MT7]-VVSELLQGGTSR.2y10_1.heavy 695.395 / 1047.54 13764.0 34.65409851074219 45 15 10 10 10 2.2994090980955373 34.41586344491041 0.0 3 0.9590772937589549 6.079780723026668 13764.0 100.58790619342344 0.0 - - - - - - - 188.4 27 10 BHLHE40 basic helix-loop-helix family, member e40 1895 243 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB22049.[MT7]-VVSELLQGGTSR.2y11_1.heavy 695.395 / 1146.61 17912.0 34.65409851074219 45 15 10 10 10 2.2994090980955373 34.41586344491041 0.0 3 0.9590772937589549 6.079780723026668 17912.0 235.02385845702352 0.0 - - - - - - - 220.0 35 9 BHLHE40 basic helix-loop-helix family, member e40 1897 244 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544650.[MT7]-FAAAHYNTEILK[MT7].3y6_1.heavy 555.978 / 861.516 9463.0 29.982999801635742 45 15 10 10 10 3.4123869037369348 29.305000523384123 0.0 3 0.9564269780982186 5.890658125719069 9463.0 49.84735211267605 0.0 - - - - - - - 236.64285714285714 18 14 VEGFC vascular endothelial growth factor C 1899 244 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544650.[MT7]-FAAAHYNTEILK[MT7].3y3_1.heavy 555.978 / 517.383 21529.0 29.982999801635742 45 15 10 10 10 3.4123869037369348 29.305000523384123 0.0 3 0.9564269780982186 5.890658125719069 21529.0 24.42577402339954 0.0 - - - - - - - 760.1428571428571 43 7 VEGFC vascular endothelial growth factor C 1901 244 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544650.[MT7]-FAAAHYNTEILK[MT7].3b4_1.heavy 555.978 / 505.289 37025.0 29.982999801635742 45 15 10 10 10 3.4123869037369348 29.305000523384123 0.0 3 0.9564269780982186 5.890658125719069 37025.0 106.95278116904386 0.0 - - - - - - - 368.0 74 9 VEGFC vascular endothelial growth factor C 1903 244 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB544650.[MT7]-FAAAHYNTEILK[MT7].3y5_1.heavy 555.978 / 747.473 12184.0 29.982999801635742 45 15 10 10 10 3.4123869037369348 29.305000523384123 0.0 3 0.9564269780982186 5.890658125719069 12184.0 64.29964407097171 0.0 - - - - - - - 236.63636363636363 24 11 VEGFC vascular endothelial growth factor C 1905 245 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542930.[MT7]-ALFDFLK[MT7].2y4_1.heavy 571.347 / 666.394 3877.0 43.936750411987305 46 20 10 6 10 6.230455096605417 16.050191912061724 0.030300140380859375 3 0.9907146210847111 12.797523380302193 3877.0 16.961512780905878 0.0 - - - - - - - 170.4814814814815 7 27 CACNB1;CACNB2;CACNB3;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 3 subunit;calcium channel, voltage-dependent, beta 4 subunit 1907 245 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542930.[MT7]-ALFDFLK[MT7].2y5_1.heavy 571.347 / 813.463 4370.0 43.936750411987305 46 20 10 6 10 6.230455096605417 16.050191912061724 0.030300140380859375 3 0.9907146210847111 12.797523380302193 4370.0 66.89039172209903 0.0 - - - - - - - 121.38461538461539 8 26 CACNB1;CACNB2;CACNB3;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 3 subunit;calcium channel, voltage-dependent, beta 4 subunit 1909 245 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542930.[MT7]-ALFDFLK[MT7].2b4_1.heavy 571.347 / 591.326 8575.0 43.936750411987305 46 20 10 6 10 6.230455096605417 16.050191912061724 0.030300140380859375 3 0.9907146210847111 12.797523380302193 8575.0 58.71916243654822 0.0 - - - - - - - 209.0 17 22 CACNB1;CACNB2;CACNB3;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 3 subunit;calcium channel, voltage-dependent, beta 4 subunit 1911 245 B20140227_KEGG1700_set06_05 B20140227_KEGG1700_set06_05 TB542930.[MT7]-ALFDFLK[MT7].2y3_1.heavy 571.347 / 551.367 9922.0 43.936750411987305 46 20 10 6 10 6.230455096605417 16.050191912061724 0.030300140380859375 3 0.9907146210847111 12.797523380302193 9922.0 25.58311020378136 0.0 - - - - - - - 241.34782608695653 19 23 CACNB1;CACNB2;CACNB3;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 3 subunit;calcium channel, voltage-dependent, beta 4 subunit