Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB60048.[MT7]-LYNAEQVLSWEPVALSNSTRPVVYQVQFK[MT7].4b7_1.heavy 914.245 / 962.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 3 1 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB60048.[MT7]-LYNAEQVLSWEPVALSNSTRPVVYQVQFK[MT7].4b4_1.heavy 914.245 / 606.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 5 1 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB60048.[MT7]-LYNAEQVLSWEPVALSNSTRPVVYQVQFK[MT7].4b5_1.heavy 914.245 / 735.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 7 1 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB60048.[MT7]-LYNAEQVLSWEPVALSNSTRPVVYQVQFK[MT7].4b3_1.heavy 914.245 / 535.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 9 2 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541418.[MT7]-NVTVGPPENIEVTPGEGSLIIR.3b4_1.heavy 812.447 / 558.337 16071.0 37.33682632446289 41 15 10 6 10 2.3102497730212526 43.285362980135254 0.038299560546875 3 0.9599096963408564 6.143006812236834 16071.0 34.29119903147211 1.0 - - - - - - - 343.0 32 6 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 11 2 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541418.[MT7]-NVTVGPPENIEVTPGEGSLIIR.3b5_1.heavy 812.447 / 615.358 17290.0 37.33682632446289 41 15 10 6 10 2.3102497730212526 43.285362980135254 0.038299560546875 3 0.9599096963408564 6.143006812236834 17290.0 57.688849845678206 0.0 - - - - - - - 323.625 34 8 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 13 2 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541418.[MT7]-NVTVGPPENIEVTPGEGSLIIR.3y10_1.heavy 812.447 / 1042.59 10206.0 37.33682632446289 41 15 10 6 10 2.3102497730212526 43.285362980135254 0.038299560546875 3 0.9599096963408564 6.143006812236834 10206.0 19.778906925367398 0.0 - - - - - - - 220.7 20 10 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 15 2 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541418.[MT7]-NVTVGPPENIEVTPGEGSLIIR.3y9_1.heavy 812.447 / 941.542 35265.0 37.33682632446289 41 15 10 6 10 2.3102497730212526 43.285362980135254 0.038299560546875 3 0.9599096963408564 6.143006812236834 35265.0 23.541792949679362 0.0 - - - - - - - 190.0 70 4 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 17 3 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47468.[MT7]-NVIQSVLQAIRK[MT7].3y6_1.heavy 553.017 / 872.58 1591.0 43.46149826049805 44 14 10 10 10 1.6677842502071254 47.89329458896933 0.0 3 0.9300028279414437 4.63719852801052 1591.0 3.27878381348674 0.0 - - - - - - - 184.94736842105263 3 19 CYFIP1 cytoplasmic FMR1 interacting protein 1 19 3 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47468.[MT7]-NVIQSVLQAIRK[MT7].3b4_1.heavy 553.017 / 599.363 994.0 43.46149826049805 44 14 10 10 10 1.6677842502071254 47.89329458896933 0.0 3 0.9300028279414437 4.63719852801052 994.0 3.171065041281673 4.0 - - - - - - - 0.0 1 0 CYFIP1 cytoplasmic FMR1 interacting protein 1 21 3 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47468.[MT7]-NVIQSVLQAIRK[MT7].3y8_1.heavy 553.017 / 1058.68 994.0 43.46149826049805 44 14 10 10 10 1.6677842502071254 47.89329458896933 0.0 3 0.9300028279414437 4.63719852801052 994.0 7.473684210526317 0.0 - - - - - - - 0.0 1 0 CYFIP1 cytoplasmic FMR1 interacting protein 1 23 3 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47468.[MT7]-NVIQSVLQAIRK[MT7].3y9_1.heavy 553.017 / 1186.74 N/A 43.46149826049805 44 14 10 10 10 1.6677842502071254 47.89329458896933 0.0 3 0.9300028279414437 4.63719852801052 0.0 0.0 4.0 - - - - - - - 0.0 0 0 CYFIP1 cytoplasmic FMR1 interacting protein 1 25 4 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537668.[MT7]-DSLEK[MT7].2b3_1.heavy 440.255 / 460.252 2735.0 18.030200004577637 44 20 10 6 8 5.9948004936888895 16.681122266750396 0.03399848937988281 4 0.9935809872739033 15.395566207569383 2735.0 13.85848460931334 1.0 - - - - - - - 266.4583333333333 6 24 DENND4A;EXOC7;ABCA12;SCRN1 DENN/MADD domain containing 4A;exocyst complex component 7;ATP-binding cassette, sub-family A (ABC1), member 12;secernin 1 27 4 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537668.[MT7]-DSLEK[MT7].2y4_1.heavy 440.255 / 620.374 8327.0 18.030200004577637 44 20 10 6 8 5.9948004936888895 16.681122266750396 0.03399848937988281 4 0.9935809872739033 15.395566207569383 8327.0 27.071398481119843 0.0 - - - - - - - 245.47368421052633 16 19 DENND4A;EXOC7;ABCA12;SCRN1 DENN/MADD domain containing 4A;exocyst complex component 7;ATP-binding cassette, sub-family A (ABC1), member 12;secernin 1 29 4 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537668.[MT7]-DSLEK[MT7].2b4_1.heavy 440.255 / 589.295 3339.0 18.030200004577637 44 20 10 6 8 5.9948004936888895 16.681122266750396 0.03399848937988281 4 0.9935809872739033 15.395566207569383 3339.0 25.538348546721117 0.0 - - - - - - - 229.2 6 20 DENND4A;EXOC7;ABCA12;SCRN1 DENN/MADD domain containing 4A;exocyst complex component 7;ATP-binding cassette, sub-family A (ABC1), member 12;secernin 1 31 4 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537668.[MT7]-DSLEK[MT7].2y3_1.heavy 440.255 / 533.341 2574.0 18.030200004577637 44 20 10 6 8 5.9948004936888895 16.681122266750396 0.03399848937988281 4 0.9935809872739033 15.395566207569383 2574.0 9.924626865671641 1.0 - - - - - - - 699.9 5 10 DENND4A;EXOC7;ABCA12;SCRN1 DENN/MADD domain containing 4A;exocyst complex component 7;ATP-binding cassette, sub-family A (ABC1), member 12;secernin 1 33 5 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57699.[MT7]-AEVWLFLK[MT7].3y3_1.heavy 431.932 / 551.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 35 5 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57699.[MT7]-AEVWLFLK[MT7].3b4_1.heavy 431.932 / 630.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 37 5 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57699.[MT7]-AEVWLFLK[MT7].3b5_1.heavy 431.932 / 743.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 39 5 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57699.[MT7]-AEVWLFLK[MT7].3b3_1.heavy 431.932 / 444.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 41 6 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541412.[MT7]-VYIGSFWSHPLLIPDNRK[MT7].4y5_1.heavy 608.344 / 773.439 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 43 6 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541412.[MT7]-VYIGSFWSHPLLIPDNRK[MT7].4y9_2.heavy 608.344 / 605.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 45 6 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541412.[MT7]-VYIGSFWSHPLLIPDNRK[MT7].4y9_1.heavy 608.344 / 1209.74 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 47 6 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541412.[MT7]-VYIGSFWSHPLLIPDNRK[MT7].4y3_1.heavy 608.344 / 561.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 49 7 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537767.[MT7]-LDYSK[MT7].2b3_1.heavy 457.265 / 536.284 N/A 22.088600158691406 48 20 10 10 8 11.582889092805376 8.633424631693508 0.0 4 0.9949205295436108 17.308887165248105 3727.0 2.592639152307934 9.0 - - - - - - - 2246.3 20 10 NR4A1 nuclear receptor subfamily 4, group A, member 1 51 7 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537767.[MT7]-LDYSK[MT7].2y4_1.heavy 457.265 / 656.337 9268.0 22.088600158691406 48 20 10 10 8 11.582889092805376 8.633424631693508 0.0 4 0.9949205295436108 17.308887165248105 9268.0 18.984300828074787 0.0 - - - - - - - 209.31578947368422 18 19 NR4A1 nuclear receptor subfamily 4, group A, member 1 53 7 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537767.[MT7]-LDYSK[MT7].2b4_1.heavy 457.265 / 623.316 1007.0 22.088600158691406 48 20 10 10 8 11.582889092805376 8.633424631693508 0.0 4 0.9949205295436108 17.308887165248105 1007.0 1.9155406853987331 2.0 - - - - - - - 662.0 8 7 NR4A1 nuclear receptor subfamily 4, group A, member 1 55 7 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537767.[MT7]-LDYSK[MT7].2y3_1.heavy 457.265 / 541.31 10376.0 22.088600158691406 48 20 10 10 8 11.582889092805376 8.633424631693508 0.0 4 0.9949205295436108 17.308887165248105 10376.0 24.390164546046496 0.0 - - - - - - - 685.1 20 10 NR4A1 nuclear receptor subfamily 4, group A, member 1 57 8 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB60041.[MT7]-SIAPITDFEYSQEFFDHVK[MT7]K[MT7].4y5_1.heavy 709.125 / 914.566 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 59 8 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB60041.[MT7]-SIAPITDFEYSQEFFDHVK[MT7]K[MT7].4y4_1.heavy 709.125 / 799.539 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 61 8 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB60041.[MT7]-SIAPITDFEYSQEFFDHVK[MT7]K[MT7].4b7_1.heavy 709.125 / 842.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 63 8 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB60041.[MT7]-SIAPITDFEYSQEFFDHVK[MT7]K[MT7].4y3_1.heavy 709.125 / 662.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 65 9 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57798.[MT7]-HILNMLHLK[MT7].3y3_1.heavy 469.623 / 541.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 67 9 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57798.[MT7]-HILNMLHLK[MT7].3b4_1.heavy 469.623 / 622.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 69 9 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57798.[MT7]-HILNMLHLK[MT7].3b5_1.heavy 469.623 / 753.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 71 9 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57798.[MT7]-HILNMLHLK[MT7].3b3_1.heavy 469.623 / 508.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 73 10 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541046.[MT7]-FFSQLSSEHGGDVQK[MT7].4b4_1.heavy 489.253 / 654.337 13127.0 30.512500762939453 41 17 6 10 8 2.7406704539025353 28.803496824446583 0.0 4 0.9713571143045707 7.274646215814125 13127.0 15.494431799418273 0.0 - - - - - - - 264.0 26 7 IL2RB interleukin 2 receptor, beta 75 10 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541046.[MT7]-FFSQLSSEHGGDVQK[MT7].4y3_1.heavy 489.253 / 518.342 5454.0 30.512500762939453 41 17 6 10 8 2.7406704539025353 28.803496824446583 0.0 4 0.9713571143045707 7.274646215814125 5454.0 7.647676564699859 1.0 - - - - - - - 813.4 17 10 IL2RB interleukin 2 receptor, beta 77 10 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541046.[MT7]-FFSQLSSEHGGDVQK[MT7].4y6_1.heavy 489.253 / 747.412 9244.0 30.512500762939453 41 17 6 10 8 2.7406704539025353 28.803496824446583 0.0 4 0.9713571143045707 7.274646215814125 9244.0 30.98854428454429 0.0 - - - - - - - 277.2857142857143 18 14 IL2RB interleukin 2 receptor, beta 79 10 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541046.[MT7]-FFSQLSSEHGGDVQK[MT7].4b3_1.heavy 489.253 / 526.278 6101.0 30.512500762939453 41 17 6 10 8 2.7406704539025353 28.803496824446583 0.0 4 0.9713571143045707 7.274646215814125 6101.0 7.117149556565611 1.0 - - - - - - - 716.5 39 8 IL2RB interleukin 2 receptor, beta 81 11 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537765.[MT7]-GIPNVLR.2y5_1.heavy 456.791 / 598.367 78670.0 30.555700302124023 48 18 10 10 10 1.2587277947616786 46.97292752249084 0.0 3 0.9837773845671908 9.676383297871265 78670.0 253.9908380977131 0.0 - - - - - - - 300.5 157 8 UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 83 11 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537765.[MT7]-GIPNVLR.2b4_1.heavy 456.791 / 526.311 12942.0 30.555700302124023 48 18 10 10 10 1.2587277947616786 46.97292752249084 0.0 3 0.9837773845671908 9.676383297871265 12942.0 16.950836518588858 0.0 - - - - - - - 765.8571428571429 25 7 UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 85 11 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537765.[MT7]-GIPNVLR.2y6_1.heavy 456.791 / 711.451 N/A 30.555700302124023 48 18 10 10 10 1.2587277947616786 46.97292752249084 0.0 3 0.9837773845671908 9.676383297871265 14606.0 19.56846080173903 1.0 - - - - - - - 262.0 125 6 UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 87 11 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537765.[MT7]-GIPNVLR.2b5_1.heavy 456.791 / 625.379 21355.0 30.555700302124023 48 18 10 10 10 1.2587277947616786 46.97292752249084 0.0 3 0.9837773845671908 9.676383297871265 21355.0 70.57618872118871 0.0 - - - - - - - 635.75 42 8 UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 89 12 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47706.[MT7]-ALMLQGVDLLADAVAVTM[OXI]GPK[MT7].3b6_1.heavy 806.451 / 758.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 91 12 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47706.[MT7]-ALMLQGVDLLADAVAVTM[OXI]GPK[MT7].3b8_1.heavy 806.451 / 972.531 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 93 12 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47706.[MT7]-ALMLQGVDLLADAVAVTM[OXI]GPK[MT7].3b7_1.heavy 806.451 / 857.503 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 95 12 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47706.[MT7]-ALMLQGVDLLADAVAVTM[OXI]GPK[MT7].3b13_2.heavy 806.451 / 728.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 97 13 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59751.[MT7]-RLHAVPAANTVK[MT7].2y4_1.heavy 782.98 / 605.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 99 13 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59751.[MT7]-RLHAVPAANTVK[MT7].2b4_1.heavy 782.98 / 622.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 101 13 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59751.[MT7]-RLHAVPAANTVK[MT7].2b5_1.heavy 782.98 / 721.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 103 13 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59751.[MT7]-RLHAVPAANTVK[MT7].2y7_1.heavy 782.98 / 844.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 105 14 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57495.[MT7]-LFQQQK[MT7].2y4_1.heavy 540.326 / 675.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 107 14 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57495.[MT7]-LFQQQK[MT7].2b3_1.heavy 540.326 / 533.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 109 14 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57495.[MT7]-LFQQQK[MT7].2y5_1.heavy 540.326 / 822.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 111 14 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57495.[MT7]-LFQQQK[MT7].2y3_1.heavy 540.326 / 547.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 113 15 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539655.[MT7]-LAQGEYIAPEK[MT7].3b6_1.heavy 502.952 / 806.417 62121.0 27.149849891662598 41 14 10 7 10 2.061026185706664 38.472834944221226 0.028598785400390625 3 0.9470032569950487 5.337044832335841 62121.0 135.87895874301137 0.0 - - - - - - - 204.5 124 22 ACSL1;ACSL5 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 5 115 15 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539655.[MT7]-LAQGEYIAPEK[MT7].3y3_1.heavy 502.952 / 517.31 140620.0 27.149849891662598 41 14 10 7 10 2.061026185706664 38.472834944221226 0.028598785400390625 3 0.9470032569950487 5.337044832335841 140620.0 169.5106489535061 0.0 - - - - - - - 1254.8181818181818 281 11 ACSL1;ACSL5 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 5 117 15 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539655.[MT7]-LAQGEYIAPEK[MT7].3b5_1.heavy 502.952 / 643.353 81073.0 27.149849891662598 41 14 10 7 10 2.061026185706664 38.472834944221226 0.028598785400390625 3 0.9470032569950487 5.337044832335841 81073.0 102.3998955365622 0.0 - - - - - - - 722.5714285714286 162 14 ACSL1;ACSL5 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 5 119 15 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539655.[MT7]-LAQGEYIAPEK[MT7].3y4_1.heavy 502.952 / 588.347 45976.0 27.149849891662598 41 14 10 7 10 2.061026185706664 38.472834944221226 0.028598785400390625 3 0.9470032569950487 5.337044832335841 45976.0 45.609216306246005 0.0 - - - - - - - 801.3 91 10 ACSL1;ACSL5 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 5 121 16 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541426.[MT7]-RIQEIIEQLDVTTSEYEK[MT7].4b4_1.heavy 621.337 / 671.396 5162.0 41.64039897918701 34 8 10 6 10 0.605772084685355 91.00909618488487 0.034397125244140625 3 0.7547178642784473 2.439067429606309 5162.0 12.112868153041564 0.0 - - - - - - - 252.0 10 19 HSPD1 heat shock 60kDa protein 1 (chaperonin) 123 16 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541426.[MT7]-RIQEIIEQLDVTTSEYEK[MT7].4b5_1.heavy 621.337 / 784.48 6107.0 41.64039897918701 34 8 10 6 10 0.605772084685355 91.00909618488487 0.034397125244140625 3 0.7547178642784473 2.439067429606309 6107.0 73.67174603174603 0.0 - - - - - - - 132.6315789473684 12 19 HSPD1 heat shock 60kDa protein 1 (chaperonin) 125 16 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541426.[MT7]-RIQEIIEQLDVTTSEYEK[MT7].4y3_1.heavy 621.337 / 583.321 22286.0 41.64039897918701 34 8 10 6 10 0.605772084685355 91.00909618488487 0.034397125244140625 3 0.7547178642784473 2.439067429606309 22286.0 134.1657962787764 0.0 - - - - - - - 255.0 44 21 HSPD1 heat shock 60kDa protein 1 (chaperonin) 127 16 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541426.[MT7]-RIQEIIEQLDVTTSEYEK[MT7].4b10_2.heavy 621.337 / 691.892 35632.0 41.64039897918701 34 8 10 6 10 0.605772084685355 91.00909618488487 0.034397125244140625 3 0.7547178642784473 2.439067429606309 35632.0 150.58761904761906 0.0 - - - - - - - 220.5 71 20 HSPD1 heat shock 60kDa protein 1 (chaperonin) 129 17 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57995.[MT7]-LEDLVPPPPIIDK[MT7].2b3_1.heavy 867.518 / 502.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 131 17 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57995.[MT7]-LEDLVPPPPIIDK[MT7].2y8_1.heavy 867.518 / 1020.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 133 17 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57995.[MT7]-LEDLVPPPPIIDK[MT7].2b4_1.heavy 867.518 / 615.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 135 17 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57995.[MT7]-LEDLVPPPPIIDK[MT7].2y6_1.heavy 867.518 / 826.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 137 18 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58108.[MT7]-IDSVSLVDYTPTDQDLLR.3b4_1.heavy 732.05 / 559.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 139 18 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58108.[MT7]-IDSVSLVDYTPTDQDLLR.3b5_1.heavy 732.05 / 646.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 141 18 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58108.[MT7]-IDSVSLVDYTPTDQDLLR.3y8_1.heavy 732.05 / 957.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 143 18 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58108.[MT7]-IDSVSLVDYTPTDQDLLR.3y5_1.heavy 732.05 / 644.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 145 19 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541326.[MT7]-ELTDTLQAETDQLEDEK[MT7].4y4_1.heavy 567.285 / 664.327 13114.0 36.372798919677734 36 10 10 6 10 1.6119612476744385 42.299857017493515 0.03759765625 3 0.8356226127773675 3.001265752674535 13114.0 5.08666737588547 0.0 - - - - - - - 747.0 26 5 FOS FBJ murine osteosarcoma viral oncogene homolog 147 19 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541326.[MT7]-ELTDTLQAETDQLEDEK[MT7].4b4_1.heavy 567.285 / 603.311 9299.0 36.372798919677734 36 10 10 6 10 1.6119612476744385 42.299857017493515 0.03759765625 3 0.8356226127773675 3.001265752674535 9299.0 5.238253133021136 0.0 - - - - - - - 1748.5714285714287 18 7 FOS FBJ murine osteosarcoma viral oncogene homolog 149 19 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541326.[MT7]-ELTDTLQAETDQLEDEK[MT7].4b5_1.heavy 567.285 / 704.358 11127.0 36.372798919677734 36 10 10 6 10 1.6119612476744385 42.299857017493515 0.03759765625 3 0.8356226127773675 3.001265752674535 11127.0 6.589686214847594 0.0 - - - - - - - 477.0 22 1 FOS FBJ murine osteosarcoma viral oncogene homolog 151 19 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541326.[MT7]-ELTDTLQAETDQLEDEK[MT7].4y3_1.heavy 567.285 / 535.284 16293.0 36.372798919677734 36 10 10 6 10 1.6119612476744385 42.299857017493515 0.03759765625 3 0.8356226127773675 3.001265752674535 16293.0 10.826374290517448 0.0 - - - - - - - 556.0 32 1 FOS FBJ murine osteosarcoma viral oncogene homolog 153 20 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57891.[MT7]-GTQLSQVEILQR.2y4_1.heavy 758.434 / 529.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 155 20 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57891.[MT7]-GTQLSQVEILQR.2y8_1.heavy 758.434 / 972.547 N/A N/A - - - - - - - - - 0.0 - - - - - - - ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 157 20 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57891.[MT7]-GTQLSQVEILQR.2b4_1.heavy 758.434 / 544.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 159 20 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57891.[MT7]-GTQLSQVEILQR.2y9_1.heavy 758.434 / 1085.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 161 21 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537651.[MT7]-NLLTK[MT7].2b3_1.heavy 438.791 / 485.32 5303.0 24.85920000076294 43 17 10 6 10 3.7032193560486544 27.003531356214417 0.03520011901855469 3 0.9723682036901931 7.407176229708246 5303.0 8.249960315446527 0.0 - - - - - - - 735.2307692307693 10 13 XPO7;ATP10B;COL6A5;C12orf40;COMMD9;ASAH1 exportin 7;ATPase, class V, type 10B;collagen, type VI, alpha 5;chromosome 12 open reading frame 40;COMM domain containing 9;N-acylsphingosine amidohydrolase (acid ceramidase) 1 163 21 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537651.[MT7]-NLLTK[MT7].2y4_1.heavy 438.791 / 618.431 26866.0 24.85920000076294 43 17 10 6 10 3.7032193560486544 27.003531356214417 0.03520011901855469 3 0.9723682036901931 7.407176229708246 26866.0 77.46411551577151 0.0 - - - - - - - 692.6666666666666 53 9 XPO7;ATP10B;COL6A5;C12orf40;COMMD9;ASAH1 exportin 7;ATPase, class V, type 10B;collagen, type VI, alpha 5;chromosome 12 open reading frame 40;COMM domain containing 9;N-acylsphingosine amidohydrolase (acid ceramidase) 1 165 21 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537651.[MT7]-NLLTK[MT7].2b4_1.heavy 438.791 / 586.368 2331.0 24.85920000076294 43 17 10 6 10 3.7032193560486544 27.003531356214417 0.03520011901855469 3 0.9723682036901931 7.407176229708246 2331.0 1.7992281303602058 3.0 - - - - - - - 672.9090909090909 7 11 XPO7;ATP10B;COL6A5;C12orf40;COMMD9;ASAH1 exportin 7;ATPase, class V, type 10B;collagen, type VI, alpha 5;chromosome 12 open reading frame 40;COMM domain containing 9;N-acylsphingosine amidohydrolase (acid ceramidase) 1 167 21 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537651.[MT7]-NLLTK[MT7].2y3_1.heavy 438.791 / 505.347 27390.0 24.85920000076294 43 17 10 6 10 3.7032193560486544 27.003531356214417 0.03520011901855469 3 0.9723682036901931 7.407176229708246 27390.0 38.66837064728861 0.0 - - - - - - - 699.1428571428571 54 7 XPO7;ATP10B;COL6A5;C12orf40;COMMD9;ASAH1 exportin 7;ATPase, class V, type 10B;collagen, type VI, alpha 5;chromosome 12 open reading frame 40;COMM domain containing 9;N-acylsphingosine amidohydrolase (acid ceramidase) 1 169 22 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537753.[MT7]-GVITVK[MT7].2y4_1.heavy 452.807 / 604.415 12927.0 24.11520004272461 48 18 10 10 10 4.07769515301377 24.52365766629007 0.0 3 0.9835188123425342 9.599969052452584 12927.0 43.63544303797468 0.0 - - - - - - - 263.75 25 20 HSPD1 heat shock 60kDa protein 1 (chaperonin) 171 22 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537753.[MT7]-GVITVK[MT7].2y5_1.heavy 452.807 / 703.483 5752.0 24.11520004272461 48 18 10 10 10 4.07769515301377 24.52365766629007 0.0 3 0.9835188123425342 9.599969052452584 5752.0 26.524178560583056 2.0 - - - - - - - 241.42857142857142 11 14 HSPD1 heat shock 60kDa protein 1 (chaperonin) 173 22 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537753.[MT7]-GVITVK[MT7].2b4_1.heavy 452.807 / 515.331 3854.0 24.11520004272461 48 18 10 10 10 4.07769515301377 24.52365766629007 0.0 3 0.9835188123425342 9.599969052452584 3854.0 4.134156052552888 1.0 - - - - - - - 711.6 32 10 HSPD1 heat shock 60kDa protein 1 (chaperonin) 175 22 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537753.[MT7]-GVITVK[MT7].2y3_1.heavy 452.807 / 491.331 17433.0 24.11520004272461 48 18 10 10 10 4.07769515301377 24.52365766629007 0.0 3 0.9835188123425342 9.599969052452584 17433.0 8.146900449160194 1.0 - - - - - - - 669.2857142857143 34 7 HSPD1 heat shock 60kDa protein 1 (chaperonin) 177 23 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57893.[MT7]-K[MT7]LWDDEGVK[MT7].3y6_1.heavy 507.959 / 806.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 179 23 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57893.[MT7]-K[MT7]LWDDEGVK[MT7].3y4_1.heavy 507.959 / 576.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 181 23 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57893.[MT7]-K[MT7]LWDDEGVK[MT7].3b4_2.heavy 507.959 / 416.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 183 23 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57893.[MT7]-K[MT7]LWDDEGVK[MT7].3y5_1.heavy 507.959 / 691.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 185 24 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541074.[MT7]-DDVWDSVSIISFPEK[MT7].3b6_1.heavy 675.685 / 862.37 6252.0 43.71985054016113 42 16 10 6 10 1.4073786016157324 54.36340495003468 0.03659820556640625 3 0.9615705455739797 6.27522855257234 6252.0 17.166563528257228 0.0 - - - - - - - 249.33333333333334 12 15 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 187 24 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541074.[MT7]-DDVWDSVSIISFPEK[MT7].3y3_1.heavy 675.685 / 517.31 30034.0 43.71985054016113 42 16 10 6 10 1.4073786016157324 54.36340495003468 0.03659820556640625 3 0.9615705455739797 6.27522855257234 30034.0 80.15078818444795 0.0 - - - - - - - 266.7692307692308 60 13 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 189 24 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541074.[MT7]-DDVWDSVSIISFPEK[MT7].3b5_1.heavy 675.685 / 775.338 6387.0 43.71985054016113 42 16 10 6 10 1.4073786016157324 54.36340495003468 0.03659820556640625 3 0.9615705455739797 6.27522855257234 6387.0 25.12533088235294 0.0 - - - - - - - 204.0 12 14 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 191 24 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541074.[MT7]-DDVWDSVSIISFPEK[MT7].3y5_1.heavy 675.685 / 751.411 11280.0 43.71985054016113 42 16 10 6 10 1.4073786016157324 54.36340495003468 0.03659820556640625 3 0.9615705455739797 6.27522855257234 11280.0 54.74117647058824 0.0 - - - - - - - 195.5 22 16 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 193 25 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541320.[MT7]-ELTDTLQAETDQLEDEK[MT7].3b6_1.heavy 756.044 / 817.442 N/A 36.382198333740234 33 13 0 10 10 1.0389087809291433 58.77925371078359 0.0 3 0.9268986633205334 4.536468469824582 8823.0 7.919110745721294 2.0 - - - - - - - 1158.142857142857 173 7 FOS FBJ murine osteosarcoma viral oncogene homolog 195 25 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541320.[MT7]-ELTDTLQAETDQLEDEK[MT7].3b4_1.heavy 756.044 / 603.311 11367.0 36.382198333740234 33 13 0 10 10 1.0389087809291433 58.77925371078359 0.0 3 0.9268986633205334 4.536468469824582 11367.0 11.789585233086399 0.0 - - - - - - - 477.0 22 1 FOS FBJ murine osteosarcoma viral oncogene homolog 197 25 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541320.[MT7]-ELTDTLQAETDQLEDEK[MT7].3b5_1.heavy 756.044 / 704.358 19236.0 36.382198333740234 33 13 0 10 10 1.0389087809291433 58.77925371078359 0.0 3 0.9268986633205334 4.536468469824582 19236.0 17.534500655836947 0.0 - - - - - - - 794.75 38 4 FOS FBJ murine osteosarcoma viral oncogene homolog 199 25 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541320.[MT7]-ELTDTLQAETDQLEDEK[MT7].3y4_1.heavy 756.044 / 664.327 16693.0 36.382198333740234 33 13 0 10 10 1.0389087809291433 58.77925371078359 0.0 3 0.9268986633205334 4.536468469824582 16693.0 17.833098503339023 0.0 - - - - - - - 795.0 33 1 FOS FBJ murine osteosarcoma viral oncogene homolog 201 26 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538275.[MT7]-EALESEFR.2y4_1.heavy 562.789 / 538.262 12697.0 28.48977518081665 44 20 10 6 8 7.652270338214899 13.068017147879242 0.03130149841308594 4 0.9976888321255198 25.666280974521896 12697.0 20.179447890036034 0.0 - - - - - - - 729.8666666666667 25 15 EXOC7 exocyst complex component 7 203 26 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538275.[MT7]-EALESEFR.2y5_1.heavy 562.789 / 667.305 8940.0 28.48977518081665 44 20 10 6 8 7.652270338214899 13.068017147879242 0.03130149841308594 4 0.9976888321255198 25.666280974521896 8940.0 17.581109052724255 0.0 - - - - - - - 719.0 17 10 EXOC7 exocyst complex component 7 205 26 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538275.[MT7]-EALESEFR.2b4_1.heavy 562.789 / 587.316 9134.0 28.48977518081665 44 20 10 6 8 7.652270338214899 13.068017147879242 0.03130149841308594 4 0.9976888321255198 25.666280974521896 9134.0 11.529593267882188 1.0 - - - - - - - 707.25 23 12 EXOC7 exocyst complex component 7 207 26 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538275.[MT7]-EALESEFR.2y7_1.heavy 562.789 / 851.426 27920.0 28.48977518081665 44 20 10 6 8 7.652270338214899 13.068017147879242 0.03130149841308594 4 0.9976888321255198 25.666280974521896 27920.0 163.70261539685606 0.0 - - - - - - - 217.23529411764707 55 17 EXOC7 exocyst complex component 7 209 27 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539918.[MT7]-RLHAVPAANTVK[MT7].3b4_1.heavy 522.322 / 622.391 10961.0 19.5314998626709 44 14 10 10 10 2.4231462218925093 35.00881503259872 0.0 3 0.9443418922199112 5.20670463203038 10961.0 50.25535426049978 0.0 - - - - - - - 177.7 21 20 FGFR2 fibroblast growth factor receptor 2 211 27 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539918.[MT7]-RLHAVPAANTVK[MT7].3b5_1.heavy 522.322 / 721.459 31355.0 19.5314998626709 44 14 10 10 10 2.4231462218925093 35.00881503259872 0.0 3 0.9443418922199112 5.20670463203038 31355.0 271.077634274948 0.0 - - - - - - - 167.125 62 16 FGFR2 fibroblast growth factor receptor 2 213 27 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539918.[MT7]-RLHAVPAANTVK[MT7].3b3_1.heavy 522.322 / 551.353 4163.0 19.5314998626709 44 14 10 10 10 2.4231462218925093 35.00881503259872 0.0 3 0.9443418922199112 5.20670463203038 4163.0 18.915445299615172 0.0 - - - - - - - 200.58333333333334 8 24 FGFR2 fibroblast growth factor receptor 2 215 27 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539918.[MT7]-RLHAVPAANTVK[MT7].3y4_1.heavy 522.322 / 605.374 12717.0 19.5314998626709 44 14 10 10 10 2.4231462218925093 35.00881503259872 0.0 3 0.9443418922199112 5.20670463203038 12717.0 53.575196779964216 0.0 - - - - - - - 265.1666666666667 25 18 FGFR2 fibroblast growth factor receptor 2 217 28 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538278.[MT7]-QLVEDLDR.2y4_1.heavy 566.31 / 518.257 3789.0 29.000900268554688 40 18 4 10 8 3.69080817690202 22.44331702683539 0.0 4 0.984717125382285 9.970230131018083 3789.0 4.705575109371489 1.0 - - - - - - - 692.2 11 10 FGFR1;FGFR3;FGFR2 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2 219 28 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538278.[MT7]-QLVEDLDR.2y6_1.heavy 566.31 / 746.368 N/A 29.000900268554688 40 18 4 10 8 3.69080817690202 22.44331702683539 0.0 4 0.984717125382285 9.970230131018083 6485.0 28.19109566903684 2.0 - - - - - - - 218.6 42 15 FGFR1;FGFR3;FGFR2 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2 221 28 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538278.[MT7]-QLVEDLDR.2b5_1.heavy 566.31 / 729.39 12168.0 29.000900268554688 40 18 4 10 8 3.69080817690202 22.44331702683539 0.0 4 0.984717125382285 9.970230131018083 12168.0 16.20076668869795 0.0 - - - - - - - 615.3333333333334 24 9 FGFR1;FGFR3;FGFR2 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2 223 28 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538278.[MT7]-QLVEDLDR.2y7_1.heavy 566.31 / 859.452 11949.0 29.000900268554688 40 18 4 10 8 3.69080817690202 22.44331702683539 0.0 4 0.984717125382285 9.970230131018083 11949.0 52.22441628959277 0.0 - - - - - - - 269.88235294117646 23 17 FGFR1;FGFR3;FGFR2 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2 225 29 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539660.[MT7]-NMVSILSSFESR.3y6_1.heavy 505.265 / 712.326 37696.0 44.22999954223633 50 20 10 10 10 9.52470667409622 10.499010984974904 0.0 3 0.9976634217102129 25.526284267587553 37696.0 251.0001951219512 0.0 - - - - - - - 175.57142857142858 75 14 EXOC7 exocyst complex component 7 227 29 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539660.[MT7]-NMVSILSSFESR.3b4_1.heavy 505.265 / 576.293 23833.0 44.22999954223633 50 20 10 10 10 9.52470667409622 10.499010984974904 0.0 3 0.9976634217102129 25.526284267587553 23833.0 139.32073822925042 0.0 - - - - - - - 212.8235294117647 47 17 EXOC7 exocyst complex component 7 229 29 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539660.[MT7]-NMVSILSSFESR.3y4_1.heavy 505.265 / 538.262 11951.0 44.22999954223633 50 20 10 10 10 9.52470667409622 10.499010984974904 0.0 3 0.9976634217102129 25.526284267587553 11951.0 61.68685465989557 0.0 - - - - - - - 227.5 23 12 EXOC7 exocyst complex component 7 231 29 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539660.[MT7]-NMVSILSSFESR.3y5_1.heavy 505.265 / 625.294 14409.0 44.22999954223633 50 20 10 10 10 9.52470667409622 10.499010984974904 0.0 3 0.9976634217102129 25.526284267587553 14409.0 94.88853658536586 0.0 - - - - - - - 194.10526315789474 28 19 EXOC7 exocyst complex component 7 233 30 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1204790.0 29.330299377441406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1204790.0 2648.488285961695 0.0 - - - - - - - 293.3333333333333 2409 3 235 30 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 389354.0 29.330299377441406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 389354.0 691.10335 0.0 - - - - - - - 1268.5714285714287 778 7 237 30 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 278613.0 29.330299377441406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 278613.0 192.72529877615406 0.0 - - - - - - - 1208.0 557 10 239 31 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46829.[MT7]-GFLPDR.2y4_1.heavy 424.741 / 500.283 1951.0 27.866299629211426 33 13 6 6 8 1.3492951952428778 60.95967985056253 0.031200408935546875 4 0.912873755931394 4.150334094381451 1951.0 1.6916184971098267 6.0 - - - - - - - 674.5 4 18 IL10RB interleukin 10 receptor, beta 241 31 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46829.[MT7]-GFLPDR.2b3_1.heavy 424.741 / 462.283 5789.0 27.866299629211426 33 13 6 6 8 1.3492951952428778 60.95967985056253 0.031200408935546875 4 0.912873755931394 4.150334094381451 5789.0 8.091921778453258 0.0 - - - - - - - 237.88888888888889 11 18 IL10RB interleukin 10 receptor, beta 243 31 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46829.[MT7]-GFLPDR.2y5_1.heavy 424.741 / 647.351 2517.0 27.866299629211426 33 13 6 6 8 1.3492951952428778 60.95967985056253 0.031200408935546875 4 0.912873755931394 4.150334094381451 2517.0 7.897459426968544 1.0 - - - - - - - 674.0 5 7 IL10RB interleukin 10 receptor, beta 245 31 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46829.[MT7]-GFLPDR.2b5_1.heavy 424.741 / 674.363 3901.0 27.866299629211426 33 13 6 6 8 1.3492951952428778 60.95967985056253 0.031200408935546875 4 0.912873755931394 4.150334094381451 3901.0 15.795912961210975 1.0 - - - - - - - 192.7058823529412 17 17 IL10RB interleukin 10 receptor, beta 247 32 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57671.[MT7]-AWTEQLPK[MT7].2b3_1.heavy 630.863 / 503.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 249 32 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57671.[MT7]-AWTEQLPK[MT7].2y3_1.heavy 630.863 / 501.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 251 32 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57671.[MT7]-AWTEQLPK[MT7].2y6_1.heavy 630.863 / 859.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 253 32 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57671.[MT7]-AWTEQLPK[MT7].2b5_1.heavy 630.863 / 760.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 255 33 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 377966.0 15.166900316874186 24 -3 10 7 10 null 0.0 0.027899742126464844 3 0.0 0.0 377966.0 1355.1277907190845 0.0 - - - - - - - 751.7 755 10 257 33 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 744715.0 15.166900316874186 24 -3 10 7 10 null 0.0 0.027899742126464844 3 0.0 0.0 744715.0 1965.002385964912 0.0 - - - - - - - 1258.0 1489 7 259 33 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 268807.0 15.166900316874186 24 -3 10 7 10 null 0.0 0.027899742126464844 3 0.0 0.0 268807.0 865.3694567569454 0.0 - - - - - - - 720.5 537 8 261 34 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47036.[MT7]-IFMDTLPF.2b3_1.heavy 564.3 / 536.302 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 263 34 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47036.[MT7]-IFMDTLPF.2b4_1.heavy 564.3 / 651.329 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 265 34 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47036.[MT7]-IFMDTLPF.2b5_1.heavy 564.3 / 752.377 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 267 35 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540591.[MT7]-DFVSEAYLITLGK[MT7].3b6_1.heavy 581.997 / 793.385 19630.0 43.995723724365234 39 13 10 6 10 1.5491362626072835 56.41136968540622 0.0363006591796875 3 0.9194380670901883 4.318548011904897 19630.0 59.746583376385246 0.0 - - - - - - - 173.5 39 16 CYFIP1 cytoplasmic FMR1 interacting protein 1 269 35 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540591.[MT7]-DFVSEAYLITLGK[MT7].3b5_1.heavy 581.997 / 722.348 6634.0 43.995723724365234 39 13 10 6 10 1.5491362626072835 56.41136968540622 0.0363006591796875 3 0.9194380670901883 4.318548011904897 6634.0 21.753281442357334 0.0 - - - - - - - 228.0 13 19 CYFIP1 cytoplasmic FMR1 interacting protein 1 271 35 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540591.[MT7]-DFVSEAYLITLGK[MT7].3b3_1.heavy 581.997 / 506.273 5618.0 43.995723724365234 39 13 10 6 10 1.5491362626072835 56.41136968540622 0.0363006591796875 3 0.9194380670901883 4.318548011904897 5618.0 19.562167695537404 0.0 - - - - - - - 236.875 11 16 CYFIP1 cytoplasmic FMR1 interacting protein 1 273 35 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540591.[MT7]-DFVSEAYLITLGK[MT7].3y4_1.heavy 581.997 / 562.368 25452.0 43.995723724365234 39 13 10 6 10 1.5491362626072835 56.41136968540622 0.0363006591796875 3 0.9194380670901883 4.318548011904897 25452.0 92.4684272969312 0.0 - - - - - - - 270.5 50 14 CYFIP1 cytoplasmic FMR1 interacting protein 1 275 36 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540314.[MT7]-TVIIEQSWGSPK[MT7].3b4_1.heavy 544.978 / 571.394 60139.0 32.39324951171875 43 17 10 6 10 3.2580939018947954 30.692792476559205 0.03910064697265625 3 0.9731175452122401 7.510176928933309 60139.0 197.69503015873016 0.0 - - - - - - - 742.5 120 8 HSPD1 heat shock 60kDa protein 1 (chaperonin) 277 36 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540314.[MT7]-TVIIEQSWGSPK[MT7].3b5_1.heavy 544.978 / 700.436 39793.0 32.39324951171875 43 17 10 6 10 3.2580939018947954 30.692792476559205 0.03910064697265625 3 0.9731175452122401 7.510176928933309 39793.0 89.18685079365079 0.0 - - - - - - - 270.0 79 6 HSPD1 heat shock 60kDa protein 1 (chaperonin) 279 36 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540314.[MT7]-TVIIEQSWGSPK[MT7].3y4_1.heavy 544.978 / 532.321 99391.0 32.39324951171875 43 17 10 6 10 3.2580939018947954 30.692792476559205 0.03910064697265625 3 0.9731175452122401 7.510176928933309 99391.0 127.03921013691823 0.0 - - - - - - - 822.8571428571429 198 7 HSPD1 heat shock 60kDa protein 1 (chaperonin) 281 36 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540314.[MT7]-TVIIEQSWGSPK[MT7].3y5_1.heavy 544.978 / 718.4 24398.0 32.39324951171875 43 17 10 6 10 3.2580939018947954 30.692792476559205 0.03910064697265625 3 0.9731175452122401 7.510176928933309 24398.0 62.35044444444445 0.0 - - - - - - - 345.0 48 12 HSPD1 heat shock 60kDa protein 1 (chaperonin) 283 37 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47300.[MT7]-ALEDFADNIK[MT7].2b4_1.heavy 712.387 / 573.3 4785.0 35.09605026245117 40 14 10 6 10 1.8931659378069552 45.364850789859496 0.0337982177734375 3 0.9474650935377111 5.360662980678059 4785.0 14.146130952380952 0.0 - - - - - - - 232.23529411764707 9 17 EXOC7 exocyst complex component 7 285 37 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47300.[MT7]-ALEDFADNIK[MT7].2y3_1.heavy 712.387 / 518.342 3526.0 35.09605026245117 40 14 10 6 10 1.8931659378069552 45.364850789859496 0.0337982177734375 3 0.9474650935377111 5.360662980678059 3526.0 16.090873015873015 0.0 - - - - - - - 213.23076923076923 7 13 EXOC7 exocyst complex component 7 287 37 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47300.[MT7]-ALEDFADNIK[MT7].2y6_1.heavy 712.387 / 851.474 3946.0 35.09605026245117 40 14 10 6 10 1.8931659378069552 45.364850789859496 0.0337982177734375 3 0.9474650935377111 5.360662980678059 3946.0 44.15761904761904 0.0 - - - - - - - 140.0 7 12 EXOC7 exocyst complex component 7 289 37 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47300.[MT7]-ALEDFADNIK[MT7].2b5_1.heavy 712.387 / 720.369 1343.0 35.09605026245117 40 14 10 6 10 1.8931659378069552 45.364850789859496 0.0337982177734375 3 0.9474650935377111 5.360662980678059 1343.0 10.392261904761906 0.0 - - - - - - - 182.8235294117647 2 17 EXOC7 exocyst complex component 7 291 38 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57287.[MT7]-DIGAGK[MT7].2b3_1.heavy 424.758 / 430.242 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC1;HDAC2 histone deacetylase 1;histone deacetylase 2 293 38 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57287.[MT7]-DIGAGK[MT7].2y4_1.heavy 424.758 / 476.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC1;HDAC2 histone deacetylase 1;histone deacetylase 2 295 38 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57287.[MT7]-DIGAGK[MT7].2y5_1.heavy 424.758 / 589.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC1;HDAC2 histone deacetylase 1;histone deacetylase 2 297 38 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57287.[MT7]-DIGAGK[MT7].2b4_1.heavy 424.758 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC1;HDAC2 histone deacetylase 1;histone deacetylase 2 299 39 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539673.[MT7]-GTQLSQVEILQR.3y6_1.heavy 505.959 / 757.457 136683.0 31.73200035095215 48 18 10 10 10 9.634893089088955 10.378942358296129 0.0 3 0.9898298304798786 12.227270353277174 136683.0 216.0156469439904 0.0 - - - - - - - 691.0 273 8 ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 301 39 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539673.[MT7]-GTQLSQVEILQR.3b4_1.heavy 505.959 / 544.321 172075.0 31.73200035095215 48 18 10 10 10 9.634893089088955 10.378942358296129 0.0 3 0.9898298304798786 12.227270353277174 172075.0 170.06153506131 0.0 - - - - - - - 313.4 344 5 ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 303 39 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539673.[MT7]-GTQLSQVEILQR.3y4_1.heavy 505.959 / 529.346 189587.0 31.73200035095215 48 18 10 10 10 9.634893089088955 10.378942358296129 0.0 3 0.9898298304798786 12.227270353277174 189587.0 204.141283565013 0.0 - - - - - - - 461.0 379 2 ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 305 39 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539673.[MT7]-GTQLSQVEILQR.3y5_1.heavy 505.959 / 658.388 333274.0 31.73200035095215 48 18 10 10 10 9.634893089088955 10.378942358296129 0.0 3 0.9898298304798786 12.227270353277174 333274.0 157.9028473840841 0.0 - - - - - - - 763.4285714285714 666 7 ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 307 40 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538629.[MT7]-LWDDEGVK[MT7].2y4_1.heavy 625.337 / 576.347 2387.0 30.883499145507812 36 16 0 10 10 2.7635903698330333 36.184812731867225 0.0 3 0.9685766743489259 6.943723832351841 2387.0 4.833240789055333 0.0 - - - - - - - 723.0 4 8 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 309 40 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538629.[MT7]-LWDDEGVK[MT7].2y5_1.heavy 625.337 / 691.374 N/A 30.883499145507812 36 16 0 10 10 2.7635903698330333 36.184812731867225 0.0 3 0.9685766743489259 6.943723832351841 2937.0 9.015589630341994 2.0 - - - - - - - 244.77777777777777 30 9 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 311 40 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538629.[MT7]-LWDDEGVK[MT7].2b4_1.heavy 625.337 / 674.327 1469.0 30.883499145507812 36 16 0 10 10 2.7635903698330333 36.184812731867225 0.0 3 0.9685766743489259 6.943723832351841 1469.0 4.8056974096683716 1.0 - - - - - - - 238.73333333333332 2 15 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 313 40 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538629.[MT7]-LWDDEGVK[MT7].2y7_1.heavy 625.337 / 992.481 3304.0 30.883499145507812 36 16 0 10 10 2.7635903698330333 36.184812731867225 0.0 3 0.9685766743489259 6.943723832351841 3304.0 14.712089175130046 0.0 - - - - - - - 190.84615384615384 6 13 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 315 41 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59632.[MT7]-RPDVTQPVPK[MT7].2b8_1.heavy 712.927 / 1037.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 317 41 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59632.[MT7]-RPDVTQPVPK[MT7].2b3_1.heavy 712.927 / 513.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 319 41 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59632.[MT7]-RPDVTQPVPK[MT7].2y5_1.heavy 712.927 / 712.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 321 41 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59632.[MT7]-RPDVTQPVPK[MT7].2b6_1.heavy 712.927 / 841.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 323 42 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538247.[MT7]-EAVTVAVK[MT7].2y4_1.heavy 552.847 / 560.389 5071.0 24.02274990081787 43 17 10 6 10 3.113927427007895 25.421865694669872 0.039798736572265625 3 0.9762692566703295 7.995471753693044 5071.0 14.125426957223567 1.0 - - - - - - - 261.8125 10 16 FGFR2 fibroblast growth factor receptor 2 325 42 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538247.[MT7]-EAVTVAVK[MT7].2y5_1.heavy 552.847 / 661.437 9375.0 24.02274990081787 43 17 10 6 10 3.113927427007895 25.421865694669872 0.039798736572265625 3 0.9762692566703295 7.995471753693044 9375.0 54.11370056497175 0.0 - - - - - - - 257.07142857142856 18 14 FGFR2 fibroblast growth factor receptor 2 327 42 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538247.[MT7]-EAVTVAVK[MT7].2y3_1.heavy 552.847 / 461.32 7311.0 24.02274990081787 43 17 10 6 10 3.113927427007895 25.421865694669872 0.039798736572265625 3 0.9762692566703295 7.995471753693044 7311.0 33.8626594761171 0.0 - - - - - - - 643.5454545454545 14 11 FGFR2 fibroblast growth factor receptor 2 329 42 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538247.[MT7]-EAVTVAVK[MT7].2y7_1.heavy 552.847 / 831.542 5601.0 24.02274990081787 43 17 10 6 10 3.113927427007895 25.421865694669872 0.039798736572265625 3 0.9762692566703295 7.995471753693044 5601.0 37.6564406779661 0.0 - - - - - - - 177.0 11 15 FGFR2 fibroblast growth factor receptor 2 331 43 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58897.[MT7]-VYSDAQPHIQWIK[MT7].4y4_1.heavy 469.011 / 718.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 333 43 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58897.[MT7]-VYSDAQPHIQWIK[MT7].4b4_1.heavy 469.011 / 609.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 335 43 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58897.[MT7]-VYSDAQPHIQWIK[MT7].4b6_1.heavy 469.011 / 808.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 337 43 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58897.[MT7]-VYSDAQPHIQWIK[MT7].4b3_1.heavy 469.011 / 494.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 339 44 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57476.[MT7]-VLAPHLTR.2b3_1.heavy 525.831 / 428.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 341 44 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57476.[MT7]-VLAPHLTR.2y5_1.heavy 525.831 / 623.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 343 44 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57476.[MT7]-VLAPHLTR.2y6_1.heavy 525.831 / 694.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 345 44 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57476.[MT7]-VLAPHLTR.2y7_1.heavy 525.831 / 807.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 347 45 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541446.[MT7]-SIAPITDFEYSQEFFDHVK[MT7].4b7_1.heavy 641.076 / 842.474 16704.0 42.76319885253906 48 18 10 10 10 2.803953582103417 23.89950841227781 0.0 3 0.9812454004582725 8.997614346373268 16704.0 159.56030534351146 0.0 - - - - - - - 195.9 33 20 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 349 45 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541446.[MT7]-SIAPITDFEYSQEFFDHVK[MT7].4b5_1.heavy 641.076 / 626.399 19314.0 42.76319885253906 48 18 10 10 10 2.803953582103417 23.89950841227781 0.0 3 0.9812454004582725 8.997614346373268 19314.0 49.65162909491249 0.0 - - - - - - - 223.42105263157896 38 19 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 351 45 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541446.[MT7]-SIAPITDFEYSQEFFDHVK[MT7].4y6_1.heavy 641.076 / 936.506 9070.0 42.76319885253906 48 18 10 10 10 2.803953582103417 23.89950841227781 0.0 3 0.9812454004582725 8.997614346373268 9070.0 80.39096145740645 0.0 - - - - - - - 145.94117647058823 18 17 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 353 45 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541446.[MT7]-SIAPITDFEYSQEFFDHVK[MT7].4y3_1.heavy 641.076 / 527.342 18727.0 42.76319885253906 48 18 10 10 10 2.803953582103417 23.89950841227781 0.0 3 0.9812454004582725 8.997614346373268 18727.0 61.67102069268877 0.0 - - - - - - - 251.0 37 19 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 355 46 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537633.[MT7]-LSLDER.2b3_1.heavy 438.749 / 458.31 19096.0 25.949199676513672 43 13 10 10 10 3.621541593648212 27.612550460662682 0.0 3 0.9253718678318452 4.489236336252677 19096.0 13.697644382721961 0.0 - - - - - - - 728.1538461538462 38 13 LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) 357 46 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537633.[MT7]-LSLDER.2y5_1.heavy 438.749 / 619.305 63581.0 25.949199676513672 43 13 10 10 10 3.621541593648212 27.612550460662682 0.0 3 0.9253718678318452 4.489236336252677 63581.0 120.06477001514659 0.0 - - - - - - - 784.1111111111111 127 9 LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) 359 46 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537633.[MT7]-LSLDER.2b4_1.heavy 438.749 / 573.336 278620.0 25.949199676513672 43 13 10 10 10 3.621541593648212 27.612550460662682 0.0 3 0.9253718678318452 4.489236336252677 278620.0 271.75208231561805 0.0 - - - - - - - 335.0 557 8 LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) 361 46 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537633.[MT7]-LSLDER.2b4_2.heavy 438.749 / 287.172 9028.0 25.949199676513672 43 13 10 10 10 3.621541593648212 27.612550460662682 0.0 3 0.9253718678318452 4.489236336252677 9028.0 20.504022032610045 0.0 - - - - - - - 738.75 18 8 LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) 363 47 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57490.[MT7]-WLVEYGR.2b3_1.heavy 533.794 / 543.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 365 47 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57490.[MT7]-WLVEYGR.2y4_1.heavy 533.794 / 524.246 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 367 47 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57490.[MT7]-WLVEYGR.2y5_1.heavy 533.794 / 623.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 369 47 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57490.[MT7]-WLVEYGR.2y6_1.heavy 533.794 / 736.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 371 48 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47434.[MT7]-VLGNLQLNLLSK[MT7].2b4_1.heavy 800.505 / 528.326 2834.0 41.06992435455322 36 13 10 3 10 2.7613014111221355 36.214807842857724 0.06259918212890625 3 0.9148495132645146 4.198922258100146 2834.0 9.746560846560847 0.0 - - - - - - - 258.0 5 21 EXOC7 exocyst complex component 7 373 48 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47434.[MT7]-VLGNLQLNLLSK[MT7].2b6_1.heavy 800.505 / 769.469 1763.0 41.06992435455322 36 13 10 3 10 2.7613014111221355 36.214807842857724 0.06259918212890625 3 0.9148495132645146 4.198922258100146 1763.0 0.0 1.0 - - - - - - - 693.0 3 8 EXOC7 exocyst complex component 7 375 48 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47434.[MT7]-VLGNLQLNLLSK[MT7].2b5_1.heavy 800.505 / 641.41 1952.0 41.06992435455322 36 13 10 3 10 2.7613014111221355 36.214807842857724 0.06259918212890625 3 0.9148495132645146 4.198922258100146 1952.0 4.957460317460318 0.0 - - - - - - - 614.25 3 8 EXOC7 exocyst complex component 7 377 48 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47434.[MT7]-VLGNLQLNLLSK[MT7].2y7_1.heavy 800.505 / 959.601 1575.0 41.06992435455322 36 13 10 3 10 2.7613014111221355 36.214807842857724 0.06259918212890625 3 0.9148495132645146 4.198922258100146 1575.0 6.267045454545454 2.0 - - - - - - - 621.0 4 7 EXOC7 exocyst complex component 7 379 49 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58399.[MT7]-VTDALNATR.2y8_1.heavy 552.81 / 861.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 381 49 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58399.[MT7]-VTDALNATR.2b4_1.heavy 552.81 / 531.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 383 49 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58399.[MT7]-VTDALNATR.2y6_1.heavy 552.81 / 645.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 385 49 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58399.[MT7]-VTDALNATR.2b5_1.heavy 552.81 / 644.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 387 50 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537630.[MT7]-NDPDK[MT7].2y4_1.heavy 438.737 / 618.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 389 50 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537630.[MT7]-NDPDK[MT7].2b4_1.heavy 438.737 / 586.259 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 391 50 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537630.[MT7]-NDPDK[MT7].2y3_1.heavy 438.737 / 503.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 393 51 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541053.[MT7]-K[MT7]K[MT7]GGGEGGAGADEEK[MT7].4y4_1.heavy 492.273 / 664.327 4139.0 13.378700256347656 44 14 10 10 10 2.08221989768788 38.034763128392456 0.0 3 0.9402927511463124 5.025322194297003 4139.0 35.92477112676056 0.0 - - - - - - - 115.6 8 15 INHBA inhibin, beta A 395 51 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541053.[MT7]-K[MT7]K[MT7]GGGEGGAGADEEK[MT7].4b8_2.heavy 492.273 / 552.33 7146.0 13.378700256347656 44 14 10 10 10 2.08221989768788 38.034763128392456 0.0 3 0.9402927511463124 5.025322194297003 7146.0 46.461625441696114 0.0 - - - - - - - 203.4 14 20 INHBA inhibin, beta A 397 51 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541053.[MT7]-K[MT7]K[MT7]GGGEGGAGADEEK[MT7].4b9_2.heavy 492.273 / 587.849 5660.0 13.378700256347656 44 14 10 10 10 2.08221989768788 38.034763128392456 0.0 3 0.9402927511463124 5.025322194297003 5660.0 53.87588743204349 0.0 - - - - - - - 112.6875 11 16 INHBA inhibin, beta A 399 51 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541053.[MT7]-K[MT7]K[MT7]GGGEGGAGADEEK[MT7].4b10_2.heavy 492.273 / 616.36 12488.0 13.378700256347656 44 14 10 10 10 2.08221989768788 38.034763128392456 0.0 3 0.9402927511463124 5.025322194297003 12488.0 52.890352941176474 0.0 - - - - - - - 147.76470588235293 24 17 INHBA inhibin, beta A 401 52 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46832.[MT7]-VVLNK[MT7].2b3_1.heavy 430.794 / 456.33 2532.0 23.277700424194336 37 13 10 10 4 2.094568131537914 35.60548283552502 0.0 8 0.913496852985628 4.165478485677223 2532.0 8.897043936487393 4.0 - - - - - - - 235.66666666666666 14 6 EHD1;EHD4;EHD3;EHD2 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3;EH-domain containing 2 403 52 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46832.[MT7]-VVLNK[MT7].2y4_1.heavy 430.794 / 617.41 14366.0 23.277700424194336 37 13 10 10 4 2.094568131537914 35.60548283552502 0.0 8 0.913496852985628 4.165478485677223 14366.0 35.80877511473738 0.0 - - - - - - - 706.5 28 8 EHD1;EHD4;EHD3;EHD2 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3;EH-domain containing 2 405 52 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46832.[MT7]-VVLNK[MT7].2y3_1.heavy 430.794 / 518.342 7595.0 23.277700424194336 37 13 10 10 4 2.094568131537914 35.60548283552502 0.0 8 0.913496852985628 4.165478485677223 7595.0 13.553962325770552 1.0 - - - - - - - 694.7 27 10 EHD1;EHD4;EHD3;EHD2 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3;EH-domain containing 2 407 53 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540587.[MT7]-LEDLVPPPPIIDK[MT7].3b4_1.heavy 578.681 / 615.347 53205.0 39.272650718688965 40 14 10 6 10 1.2158636967926522 48.95130033877023 0.037799835205078125 3 0.94061131250512 5.038918861117517 53205.0 75.81667130340239 0.0 - - - - - - - 1294.25 106 8 NR4A1 nuclear receptor subfamily 4, group A, member 1 409 53 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540587.[MT7]-LEDLVPPPPIIDK[MT7].3b5_1.heavy 578.681 / 714.415 44566.0 39.272650718688965 40 14 10 6 10 1.2158636967926522 48.95130033877023 0.037799835205078125 3 0.94061131250512 5.038918861117517 44566.0 65.63743532888942 0.0 - - - - - - - 1293.0 89 7 NR4A1 nuclear receptor subfamily 4, group A, member 1 411 53 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540587.[MT7]-LEDLVPPPPIIDK[MT7].3b3_1.heavy 578.681 / 502.263 37572.0 39.272650718688965 40 14 10 6 10 1.2158636967926522 48.95130033877023 0.037799835205078125 3 0.94061131250512 5.038918861117517 37572.0 42.25138515706615 0.0 - - - - - - - 397.6 75 5 NR4A1 nuclear receptor subfamily 4, group A, member 1 413 53 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540587.[MT7]-LEDLVPPPPIIDK[MT7].3y5_1.heavy 578.681 / 729.463 25917.0 39.272650718688965 40 14 10 6 10 1.2158636967926522 48.95130033877023 0.037799835205078125 3 0.94061131250512 5.038918861117517 25917.0 54.05829733550063 0.0 - - - - - - - 251.33333333333334 51 3 NR4A1 nuclear receptor subfamily 4, group A, member 1 415 54 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537774.[MT7]-ALQAESR.2y5_1.heavy 459.76 / 590.289 21933.0 16.763599395751953 45 15 10 10 10 2.042697915473626 40.05412633291053 0.0 3 0.952362733568108 5.631831409228855 21933.0 35.74062649606606 0.0 - - - - - - - 712.1428571428571 43 7 IL12RB2 interleukin 12 receptor, beta 2 417 54 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537774.[MT7]-ALQAESR.2b4_1.heavy 459.76 / 528.326 15934.0 16.763599395751953 45 15 10 10 10 2.042697915473626 40.05412633291053 0.0 3 0.952362733568108 5.631831409228855 15934.0 47.07847085741104 0.0 - - - - - - - 213.42105263157896 31 19 IL12RB2 interleukin 12 receptor, beta 2 419 54 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537774.[MT7]-ALQAESR.2y6_1.heavy 459.76 / 703.373 44957.0 16.763599395751953 45 15 10 10 10 2.042697915473626 40.05412633291053 0.0 3 0.952362733568108 5.631831409228855 44957.0 128.71453312911277 0.0 - - - - - - - 208.0 89 18 IL12RB2 interleukin 12 receptor, beta 2 421 54 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537774.[MT7]-ALQAESR.2b5_1.heavy 459.76 / 657.369 38841.0 16.763599395751953 45 15 10 10 10 2.042697915473626 40.05412633291053 0.0 3 0.952362733568108 5.631831409228855 38841.0 101.26459951190367 0.0 - - - - - - - 679.3333333333334 77 9 IL12RB2 interleukin 12 receptor, beta 2 423 55 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538821.[MT7]-LTTVDIVTLR.2y5_1.heavy 637.894 / 601.403 8252.0 37.269798278808594 48 18 10 10 10 4.940571033632775 20.240575293676233 0.0 3 0.9894326113404385 11.99486431874806 8252.0 12.703460559796437 0.0 - - - - - - - 723.0 16 10 IL2RB interleukin 2 receptor, beta 425 55 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538821.[MT7]-LTTVDIVTLR.2y9_1.heavy 637.894 / 1017.59 11239.0 37.269798278808594 48 18 10 10 10 4.940571033632775 20.240575293676233 0.0 3 0.9894326113404385 11.99486431874806 11239.0 153.72468814729575 0.0 - - - - - - - 147.5 22 8 IL2RB interleukin 2 receptor, beta 427 55 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538821.[MT7]-LTTVDIVTLR.2b5_1.heavy 637.894 / 674.384 7545.0 37.269798278808594 48 18 10 10 10 4.940571033632775 20.240575293676233 0.0 3 0.9894326113404385 11.99486431874806 7545.0 36.76588983050847 0.0 - - - - - - - 249.76470588235293 15 17 IL2RB interleukin 2 receptor, beta 429 55 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538821.[MT7]-LTTVDIVTLR.2y7_1.heavy 637.894 / 815.498 4480.0 37.269798278808594 48 18 10 10 10 4.940571033632775 20.240575293676233 0.0 3 0.9894326113404385 11.99486431874806 4480.0 2.4615384615384612 0.0 - - - - - - - 269.42857142857144 8 14 IL2RB interleukin 2 receptor, beta 431 56 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 732417.0 17.741300582885742 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 732417.0 9330.830586047716 0.0 - - - - - - - 786.2857142857143 1464 7 433 56 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 454560.0 17.741300582885742 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 454560.0 2239.9589092118395 0.0 - - - - - - - 281.90909090909093 909 11 435 56 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 471029.0 17.741300582885742 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 471029.0 5957.928269200688 0.0 - - - - - - - 304.0 942 13 437 57 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58507.[MT7]-EGSDLSVVER.2y9_1.heavy 617.823 / 961.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 439 57 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58507.[MT7]-EGSDLSVVER.2b4_1.heavy 617.823 / 533.232 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 441 57 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58507.[MT7]-EGSDLSVVER.2b6_1.heavy 617.823 / 733.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 443 57 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58507.[MT7]-EGSDLSVVER.2y6_1.heavy 617.823 / 702.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 445 58 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540058.[MT7]-VLGNLQLNLLSK[MT7].3b6_1.heavy 534.006 / 769.469 49142.0 41.06209945678711 47 17 10 10 10 5.5278759508009605 18.090130981595294 0.0 3 0.9798149493294244 8.671898937269113 49142.0 565.4962052388012 0.0 - - - - - - - 239.44444444444446 98 9 EXOC7 exocyst complex component 7 447 58 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540058.[MT7]-VLGNLQLNLLSK[MT7].3b4_1.heavy 534.006 / 528.326 103928.0 41.06209945678711 47 17 10 10 10 5.5278759508009605 18.090130981595294 0.0 3 0.9798149493294244 8.671898937269113 103928.0 85.78704521556256 0.0 - - - - - - - 634.3333333333334 207 3 EXOC7 exocyst complex component 7 449 58 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540058.[MT7]-VLGNLQLNLLSK[MT7].3b5_1.heavy 534.006 / 641.41 43118.0 41.06209945678711 47 17 10 10 10 5.5278759508009605 18.090130981595294 0.0 3 0.9798149493294244 8.671898937269113 43118.0 64.27041528397996 0.0 - - - - - - - 1212.75 86 8 EXOC7 exocyst complex component 7 451 58 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540058.[MT7]-VLGNLQLNLLSK[MT7].3y5_1.heavy 534.006 / 718.458 33480.0 41.06209945678711 47 17 10 10 10 5.5278759508009605 18.090130981595294 0.0 3 0.9798149493294244 8.671898937269113 33480.0 49.99632063074901 0.0 - - - - - - - 697.6 66 10 EXOC7 exocyst complex component 7 453 59 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59220.[MT7]-GLQVLMGR.2b4_1.heavy 509.303 / 542.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 455 59 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59220.[MT7]-GLQVLMGR.2y6_1.heavy 509.303 / 703.392 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 457 59 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59220.[MT7]-GLQVLMGR.2b5_1.heavy 509.303 / 655.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 459 59 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59220.[MT7]-GLQVLMGR.2y7_1.heavy 509.303 / 816.476 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 461 60 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57690.[MT7]-LRELVPGVPR.2b3_1.heavy 640.402 / 543.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 463 60 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57690.[MT7]-LRELVPGVPR.2y5_1.heavy 640.402 / 525.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 465 60 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57690.[MT7]-LRELVPGVPR.2b7_1.heavy 640.402 / 909.564 N/A N/A - - - - - - - - - 0.0 - - - - - - - ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 467 60 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57690.[MT7]-LRELVPGVPR.2y7_1.heavy 640.402 / 737.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 469 61 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59363.[MT7]-FGSVPFTK[MT7].2y4_1.heavy 585.842 / 636.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 471 61 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59363.[MT7]-FGSVPFTK[MT7].2y5_1.heavy 585.842 / 735.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 473 61 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59363.[MT7]-FGSVPFTK[MT7].2b4_1.heavy 585.842 / 535.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 475 61 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59363.[MT7]-FGSVPFTK[MT7].2y3_1.heavy 585.842 / 539.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 477 62 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541440.[MT7]-HPQGSLDTGEEAEEVGLK[MT7]GER.4y8_1.heavy 632.322 / 1031.6 1305.0 25.209800720214844 30 8 4 10 8 0.9390397141752811 69.11521115568502 0.0 4 0.784105186912609 2.6067458902617187 1305.0 2.3395579698197686 0.0 - - - - - - - 123.45454545454545 2 11 INHBA inhibin, beta A 479 62 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541440.[MT7]-HPQGSLDTGEEAEEVGLK[MT7]GER.4y10_2.heavy 632.322 / 616.342 8697.0 25.209800720214844 30 8 4 10 8 0.9390397141752811 69.11521115568502 0.0 4 0.784105186912609 2.6067458902617187 8697.0 43.040452884157 0.0 - - - - - - - 260.9 17 20 INHBA inhibin, beta A 481 62 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541440.[MT7]-HPQGSLDTGEEAEEVGLK[MT7]GER.4y7_1.heavy 632.322 / 902.554 1903.0 25.209800720214844 30 8 4 10 8 0.9390397141752811 69.11521115568502 0.0 4 0.784105186912609 2.6067458902617187 1903.0 34.05163599182004 1.0 - - - - - - - 167.15384615384616 29 13 INHBA inhibin, beta A 483 62 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541440.[MT7]-HPQGSLDTGEEAEEVGLK[MT7]GER.4y6_1.heavy 632.322 / 803.486 2772.0 25.209800720214844 30 8 4 10 8 0.9390397141752811 69.11521115568502 0.0 4 0.784105186912609 2.6067458902617187 2772.0 22.4480981595092 0.0 - - - - - - - 114.61111111111111 5 18 INHBA inhibin, beta A 485 63 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58886.[MT7]-DVPNSQPEMVEAVK[MT7].3y6_1.heavy 610.989 / 820.472 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 487 63 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58886.[MT7]-DVPNSQPEMVEAVK[MT7].3b6_1.heavy 610.989 / 785.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 489 63 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58886.[MT7]-DVPNSQPEMVEAVK[MT7].3b4_1.heavy 610.989 / 570.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 491 63 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58886.[MT7]-DVPNSQPEMVEAVK[MT7].3y5_1.heavy 610.989 / 689.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 493 64 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541443.[MT7]-TEPFDDFLFPASSRPSGSETAR.3y17_2.heavy 853.414 / 912.947 7838.0 39.76800060272217 37 16 10 3 8 5.876511443001916 17.01689871106874 0.06979751586914062 4 0.9657302036459058 6.647501987734052 7838.0 8.761225961538461 1.0 - - - - - - - 743.1428571428571 17 7 FOS FBJ murine osteosarcoma viral oncogene homolog 495 64 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541443.[MT7]-TEPFDDFLFPASSRPSGSETAR.3y20_2.heavy 853.414 / 1092.52 24208.0 39.76800060272217 37 16 10 3 8 5.876511443001916 17.01689871106874 0.06979751586914062 4 0.9657302036459058 6.647501987734052 24208.0 19.653193464388764 0.0 - - - - - - - 265.8333333333333 48 6 FOS FBJ murine osteosarcoma viral oncogene homolog 497 64 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541443.[MT7]-TEPFDDFLFPASSRPSGSETAR.3y8_1.heavy 853.414 / 804.385 6381.0 39.76800060272217 37 16 10 3 8 5.876511443001916 17.01689871106874 0.06979751586914062 4 0.9657302036459058 6.647501987734052 6381.0 11.09466956452982 0.0 - - - - - - - 728.4166666666666 12 12 FOS FBJ murine osteosarcoma viral oncogene homolog 499 64 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541443.[MT7]-TEPFDDFLFPASSRPSGSETAR.3y16_2.heavy 853.414 / 855.434 11306.0 39.76800060272217 37 16 10 3 8 5.876511443001916 17.01689871106874 0.06979751586914062 4 0.9657302036459058 6.647501987734052 11306.0 15.637001236580605 0.0 - - - - - - - 246.55555555555554 22 9 FOS FBJ murine osteosarcoma viral oncogene homolog 501 65 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537639.[MT7]-AQIEK[MT7].2b3_1.heavy 438.773 / 457.289 2292.0 17.639400482177734 33 15 0 10 8 2.7987667999351555 35.730022237764466 0.0 4 0.9563082258921081 5.882588248719669 2292.0 10.640686072400428 0.0 - - - - - - - 195.7391304347826 4 23 MACF1;HSPD1 microtubule-actin crosslinking factor 1;heat shock 60kDa protein 1 (chaperonin) 503 65 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537639.[MT7]-AQIEK[MT7].2y4_1.heavy 438.773 / 661.4 4302.0 17.639400482177734 33 15 0 10 8 2.7987667999351555 35.730022237764466 0.0 4 0.9563082258921081 5.882588248719669 4302.0 34.12626372270877 0.0 - - - - - - - 159.16666666666666 8 24 MACF1;HSPD1 microtubule-actin crosslinking factor 1;heat shock 60kDa protein 1 (chaperonin) 505 65 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537639.[MT7]-AQIEK[MT7].2b4_1.heavy 438.773 / 586.332 N/A 17.639400482177734 33 15 0 10 8 2.7987667999351555 35.730022237764466 0.0 4 0.9563082258921081 5.882588248719669 2211.0 3.379249299719888 2.0 - - - - - - - 677.8571428571429 9 7 MACF1;HSPD1 microtubule-actin crosslinking factor 1;heat shock 60kDa protein 1 (chaperonin) 507 65 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537639.[MT7]-AQIEK[MT7].2y3_1.heavy 438.773 / 533.341 4744.0 17.639400482177734 33 15 0 10 8 2.7987667999351555 35.730022237764466 0.0 4 0.9563082258921081 5.882588248719669 4744.0 21.209935581485983 1.0 - - - - - - - 618.125 32 8 MACF1;HSPD1 microtubule-actin crosslinking factor 1;heat shock 60kDa protein 1 (chaperonin) 509 66 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538020.[MT7]-EFGNLTR.2y5_1.heavy 490.768 / 560.315 22145.0 26.412200927734375 44 14 10 10 10 2.5376660028581046 39.40628904173075 0.0 3 0.9492941088828285 5.4573367213679775 22145.0 26.325616163205762 0.0 - - - - - - - 659.9090909090909 44 11 UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 511 66 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538020.[MT7]-EFGNLTR.2b4_1.heavy 490.768 / 592.285 23274.0 26.412200927734375 44 14 10 10 10 2.5376660028581046 39.40628904173075 0.0 3 0.9492941088828285 5.4573367213679775 23274.0 52.0024464458448 0.0 - - - - - - - 694.25 46 12 UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 513 66 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538020.[MT7]-EFGNLTR.2y6_1.heavy 490.768 / 707.383 68209.0 26.412200927734375 44 14 10 10 10 2.5376660028581046 39.40628904173075 0.0 3 0.9492941088828285 5.4573367213679775 68209.0 148.98146700778412 0.0 - - - - - - - 1074.857142857143 136 7 UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 515 66 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538020.[MT7]-EFGNLTR.2b5_1.heavy 490.768 / 705.369 17308.0 26.412200927734375 44 14 10 10 10 2.5376660028581046 39.40628904173075 0.0 3 0.9492941088828285 5.4573367213679775 17308.0 82.19783230560603 0.0 - - - - - - - 301.1 34 20 UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 517 67 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539288.[MT7]-EAGEEVPDAGPR.3y6_1.heavy 457.56 / 612.31 74689.0 20.68910026550293 47 17 10 10 10 3.1169911213215484 32.08222163866857 0.0 3 0.9750454837074544 7.796155577315293 74689.0 101.7719036819841 0.0 - - - - - - - 700.2857142857143 149 14 IL2RB interleukin 2 receptor, beta 519 67 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539288.[MT7]-EAGEEVPDAGPR.3b4_1.heavy 457.56 / 531.253 38054.0 20.68910026550293 47 17 10 10 10 3.1169911213215484 32.08222163866857 0.0 3 0.9750454837074544 7.796155577315293 38054.0 89.4087753124954 0.0 - - - - - - - 663.3157894736842 76 19 IL2RB interleukin 2 receptor, beta 521 67 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539288.[MT7]-EAGEEVPDAGPR.3b5_1.heavy 457.56 / 660.296 82742.0 20.68910026550293 47 17 10 10 10 3.1169911213215484 32.08222163866857 0.0 3 0.9750454837074544 7.796155577315293 82742.0 147.950311982538 0.0 - - - - - - - 737.1666666666666 165 12 IL2RB interleukin 2 receptor, beta 523 67 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539288.[MT7]-EAGEEVPDAGPR.3y5_1.heavy 457.56 / 515.257 36927.0 20.68910026550293 47 17 10 10 10 3.1169911213215484 32.08222163866857 0.0 3 0.9750454837074544 7.796155577315293 36927.0 65.1010068045483 0.0 - - - - - - - 674.6666666666666 73 18 IL2RB interleukin 2 receptor, beta 525 68 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47521.[MT7]-ESLDLFESIWNNR.3y7_1.heavy 589.633 / 918.443 3098.0 46.50400034586588 32 17 0 5 10 4.626530714272526 21.614467983862497 0.041698455810546875 3 0.9739683005665377 7.632458679031454 3098.0 59.4481081081081 0.0 - - - - - - - 209.25 6 12 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 527 68 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47521.[MT7]-ESLDLFESIWNNR.3y6_1.heavy 589.633 / 789.4 3688.0 46.50400034586588 32 17 0 5 10 4.626530714272526 21.614467983862497 0.041698455810546875 3 0.9739683005665377 7.632458679031454 3688.0 9.995711826146842 0.0 - - - - - - - 181.27272727272728 7 11 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 529 68 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47521.[MT7]-ESLDLFESIWNNR.3b6_1.heavy 589.633 / 849.447 N/A 46.50400034586588 32 17 0 5 10 4.626530714272526 21.614467983862497 0.041698455810546875 3 0.9739683005665377 7.632458679031454 1844.0 16.189309743151732 1.0 - - - - - - - 201.45454545454547 32 11 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 531 68 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47521.[MT7]-ESLDLFESIWNNR.3b7_1.heavy 589.633 / 978.49 443.0 46.50400034586588 32 17 0 5 10 4.626530714272526 21.614467983862497 0.041698455810546875 3 0.9739683005665377 7.632458679031454 443.0 4.98918918918919 1.0 - - - - - - - 0.0 0 0 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 533 69 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540536.[MT7]-K[MT7]RPDVTQPVPK[MT7].3b4_1.heavy 566.353 / 785.487 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 535 69 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540536.[MT7]-K[MT7]RPDVTQPVPK[MT7].3y4_1.heavy 566.353 / 584.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 537 69 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540536.[MT7]-K[MT7]RPDVTQPVPK[MT7].3b7_1.heavy 566.353 / 1113.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 539 69 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540536.[MT7]-K[MT7]RPDVTQPVPK[MT7].3b7_2.heavy 566.353 / 557.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 541 70 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540710.[MT7]-FQITPQYDFEVLR.3y7_1.heavy 600.653 / 941.473 34503.0 40.57452583312988 43 17 10 6 10 2.810296230619235 23.925175205429944 0.03350067138671875 3 0.9778668122339454 8.28010965883485 34503.0 78.435938697318 0.0 - - - - - - - 745.4285714285714 69 7 IL10RB interleukin 10 receptor, beta 543 70 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540710.[MT7]-FQITPQYDFEVLR.3y6_1.heavy 600.653 / 778.409 40764.0 40.57452583312988 43 17 10 6 10 2.810296230619235 23.925175205429944 0.03350067138671875 3 0.9778668122339454 8.28010965883485 40764.0 141.72657749556595 0.0 - - - - - - - 774.5 81 8 IL10RB interleukin 10 receptor, beta 545 70 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540710.[MT7]-FQITPQYDFEVLR.3b3_1.heavy 600.653 / 533.32 47548.0 40.57452583312988 43 17 10 6 10 2.810296230619235 23.925175205429944 0.03350067138671875 3 0.9778668122339454 8.28010965883485 47548.0 75.34948089979551 0.0 - - - - - - - 717.5 95 12 IL10RB interleukin 10 receptor, beta 547 70 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540710.[MT7]-FQITPQYDFEVLR.3y5_1.heavy 600.653 / 663.382 42069.0 40.57452583312988 43 17 10 6 10 2.810296230619235 23.925175205429944 0.03350067138671875 3 0.9778668122339454 8.28010965883485 42069.0 99.64935394734658 0.0 - - - - - - - 681.8181818181819 84 11 IL10RB interleukin 10 receptor, beta 549 71 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47600.[MT7]-TFNLPLLMLGGGGYTIR.3b6_1.heavy 656.368 / 830.489 4916.0 49.29992485046387 32 9 10 3 10 1.8155009355078995 43.63560976844079 0.0720977783203125 3 0.8113143849120176 2.7952129083626813 4916.0 62.86492639654759 0.0 - - - - - - - 161.6 9 10 HDAC2 histone deacetylase 2 551 71 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47600.[MT7]-TFNLPLLMLGGGGYTIR.3b4_1.heavy 656.368 / 620.352 7698.0 49.29992485046387 32 9 10 3 10 1.8155009355078995 43.63560976844079 0.0720977783203125 3 0.8113143849120176 2.7952129083626813 7698.0 35.31556701030928 0.0 - - - - - - - 165.33333333333334 15 18 HDAC2 histone deacetylase 2 553 71 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47600.[MT7]-TFNLPLLMLGGGGYTIR.3b3_1.heavy 656.368 / 507.268 2005.0 49.29992485046387 32 9 10 3 10 1.8155009355078995 43.63560976844079 0.0720977783203125 3 0.8113143849120176 2.7952129083626813 2005.0 10.879844961240309 1.0 - - - - - - - 155.2 5 15 HDAC2 histone deacetylase 2 555 71 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47600.[MT7]-TFNLPLLMLGGGGYTIR.3y8_1.heavy 656.368 / 780.4 11191.0 49.29992485046387 32 9 10 3 10 1.8155009355078995 43.63560976844079 0.0720977783203125 3 0.8113143849120176 2.7952129083626813 11191.0 74.91657279127867 0.0 - - - - - - - 140.25 22 12 HDAC2 histone deacetylase 2 557 72 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46885.[MT7]-NHEDK[MT7].2y4_1.heavy 465.748 / 672.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 559 72 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46885.[MT7]-NHEDK[MT7].2y4_2.heavy 465.748 / 336.675 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 561 72 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46885.[MT7]-NHEDK[MT7].2b4_1.heavy 465.748 / 640.281 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 563 72 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46885.[MT7]-NHEDK[MT7].2y3_1.heavy 465.748 / 535.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 565 73 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 2109100.0 36.670501708984375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2109100.0 2023.5822211941368 0.0 - - - - - - - 228.25 4218 8 567 73 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 1056590.0 36.670501708984375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1056590.0 1840.4622245764 0.0 - - - - - - - 168.625 2113 8 569 73 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1496100.0 36.670501708984375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1496100.0 822.2753259126662 0.0 - - - - - - - 238.375 2992 8 571 74 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59591.[MT7]-HRTPSSPWK[MT7].3y7_1.heavy 461.929 / 946.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 573 74 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59591.[MT7]-HRTPSSPWK[MT7].3y6_1.heavy 461.929 / 845.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 575 74 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59591.[MT7]-HRTPSSPWK[MT7].3y3_1.heavy 461.929 / 574.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 577 74 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59591.[MT7]-HRTPSSPWK[MT7].3y4_1.heavy 461.929 / 661.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 579 75 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46888.[MT7]-DSPASASR.2y5_1.heavy 467.739 / 491.257 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 581 75 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46888.[MT7]-DSPASASR.2y6_1.heavy 467.739 / 588.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 583 75 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46888.[MT7]-DSPASASR.2b7_1.heavy 467.739 / 760.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 585 75 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46888.[MT7]-DSPASASR.2y7_1.heavy 467.739 / 675.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 587 76 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47608.[MT7]-GVMLAVDAVIAELK[MT7]K[MT7].3b4_1.heavy 663.743 / 545.324 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 589 76 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47608.[MT7]-GVMLAVDAVIAELK[MT7]K[MT7].3b5_1.heavy 663.743 / 616.361 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 591 76 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47608.[MT7]-GVMLAVDAVIAELK[MT7]K[MT7].3y5_1.heavy 663.743 / 876.576 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 593 76 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47608.[MT7]-GVMLAVDAVIAELK[MT7]K[MT7].3b7_1.heavy 663.743 / 830.456 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 595 77 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59588.[MT7]-LNAFGNAFLNR.2y5_1.heavy 690.879 / 620.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 597 77 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59588.[MT7]-LNAFGNAFLNR.2b4_1.heavy 690.879 / 590.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 599 77 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59588.[MT7]-LNAFGNAFLNR.2y9_1.heavy 690.879 / 1009.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 601 77 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59588.[MT7]-LNAFGNAFLNR.2y7_1.heavy 690.879 / 791.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 603 78 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47227.[MT7]-GIQGHQASEK[MT7].3y3_1.heavy 448.249 / 507.289 46745.0 14.586199760437012 44 14 10 10 10 1.5230810605146805 52.34549266661068 0.0 3 0.943327059561682 5.159430714357181 46745.0 161.71559196858288 0.0 - - - - - - - 225.375 93 16 IL12RB2 interleukin 12 receptor, beta 2 605 78 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47227.[MT7]-GIQGHQASEK[MT7].3b4_1.heavy 448.249 / 500.295 28683.0 14.586199760437012 44 14 10 10 10 1.5230810605146805 52.34549266661068 0.0 3 0.943327059561682 5.159430714357181 28683.0 166.7978804347826 0.0 - - - - - - - 203.14285714285714 57 21 IL12RB2 interleukin 12 receptor, beta 2 607 78 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47227.[MT7]-GIQGHQASEK[MT7].3b5_1.heavy 448.249 / 637.354 20117.0 14.586199760437012 44 14 10 10 10 1.5230810605146805 52.34549266661068 0.0 3 0.943327059561682 5.159430714357181 20117.0 186.98002238521624 0.0 - - - - - - - 193.89473684210526 40 19 IL12RB2 interleukin 12 receptor, beta 2 609 78 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47227.[MT7]-GIQGHQASEK[MT7].3y4_1.heavy 448.249 / 578.327 55737.0 14.586199760437012 44 14 10 10 10 1.5230810605146805 52.34549266661068 0.0 3 0.943327059561682 5.159430714357181 55737.0 310.6259742120344 0.0 - - - - - - - 275.6666666666667 111 18 IL12RB2 interleukin 12 receptor, beta 2 611 79 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540237.[MT7]-K[MT7]K[MT7]EEEGEGK[MT7].3y6_1.heavy 537.313 / 792.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 613 79 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540237.[MT7]-K[MT7]K[MT7]EEEGEGK[MT7].3b5_2.heavy 537.313 / 538.819 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 615 79 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540237.[MT7]-K[MT7]K[MT7]EEEGEGK[MT7].3y4_1.heavy 537.313 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 617 79 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540237.[MT7]-K[MT7]K[MT7]EEEGEGK[MT7].3y5_1.heavy 537.313 / 663.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 619 80 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47225.[MT7]-GDGVVLVAPPLR.2y8_1.heavy 668.907 / 864.567 20308.0 34.5605993270874 41 15 10 6 10 1.9079609087317317 46.25535573731103 0.034801483154296875 3 0.9546677989452473 5.774368978174891 20308.0 83.1407945736434 0.0 - - - - - - - 152.15384615384616 40 13 LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) 621 80 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47225.[MT7]-GDGVVLVAPPLR.2y5_1.heavy 668.907 / 553.346 20308.0 34.5605993270874 41 15 10 6 10 1.9079609087317317 46.25535573731103 0.034801483154296875 3 0.9546677989452473 5.774368978174891 20308.0 53.20681738378845 0.0 - - - - - - - 656.0 40 8 LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) 623 80 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47225.[MT7]-GDGVVLVAPPLR.2b6_1.heavy 668.907 / 685.4 18845.0 34.5605993270874 41 15 10 6 10 1.9079609087317317 46.25535573731103 0.034801483154296875 3 0.9546677989452473 5.774368978174891 18845.0 95.86845930232559 0.0 - - - - - - - 284.875 37 16 LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) 625 80 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47225.[MT7]-GDGVVLVAPPLR.2y7_1.heavy 668.907 / 765.498 17468.0 34.5605993270874 41 15 10 6 10 1.9079609087317317 46.25535573731103 0.034801483154296875 3 0.9546677989452473 5.774368978174891 17468.0 66.39731977419441 0.0 - - - - - - - 198.875 34 16 LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) 627 81 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59396.[MT7]-C[CAM]DVDIRK[MT7].2b3_1.heavy 597.331 / 519.235 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACTBL2;ACTB;ACTG1 actin, beta-like 2;actin, beta;actin, gamma 1 629 81 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59396.[MT7]-C[CAM]DVDIRK[MT7].2y5_1.heavy 597.331 / 774.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACTBL2;ACTB;ACTG1 actin, beta-like 2;actin, beta;actin, gamma 1 631 81 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59396.[MT7]-C[CAM]DVDIRK[MT7].2b4_1.heavy 597.331 / 634.262 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACTBL2;ACTB;ACTG1 actin, beta-like 2;actin, beta;actin, gamma 1 633 81 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59396.[MT7]-C[CAM]DVDIRK[MT7].2y3_1.heavy 597.331 / 560.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACTBL2;ACTB;ACTG1 actin, beta-like 2;actin, beta;actin, gamma 1 635 82 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57456.[MT7]-GIIDPTK[MT7].2b3_1.heavy 516.321 / 428.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 637 82 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57456.[MT7]-GIIDPTK[MT7].2y4_1.heavy 516.321 / 604.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 639 82 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57456.[MT7]-GIIDPTK[MT7].2b4_1.heavy 516.321 / 543.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 641 82 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57456.[MT7]-GIIDPTK[MT7].2y3_1.heavy 516.321 / 489.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 643 83 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46947.[MT7]-IADFGLAR.2y5_1.heavy 503.794 / 563.33 83466.0 33.69160079956055 47 17 10 10 10 3.6365853232843084 27.498323594862615 0.0 3 0.970827244490096 7.20795644631017 83466.0 43.075170486633695 0.0 - - - - - - - 437.0 166 1 FGFR1;FGFR3;FGFR2;FGFR4;FGR;ICK;CDK20;FYN;HCK;LCK;LYN;MAK;BLK;YES1 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4;Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;intestinal cell (MAK-like) kinase;cyclin-dependent kinase 20;FYN oncogene related to SRC, FGR, YES;hemopoietic cell kinase;lymphocyte-specific protein tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral related oncogene homolog;male germ cell-associated kinase;B lymphoid tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 645 83 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46947.[MT7]-IADFGLAR.2b4_1.heavy 503.794 / 591.326 4287.0 33.69160079956055 47 17 10 10 10 3.6365853232843084 27.498323594862615 0.0 3 0.970827244490096 7.20795644631017 4287.0 6.153956995100708 1.0 - - - - - - - 1199.7142857142858 40 7 FGFR1;FGFR3;FGFR2;FGFR4;FGR;ICK;CDK20;FYN;HCK;LCK;LYN;MAK;BLK;YES1 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4;Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;intestinal cell (MAK-like) kinase;cyclin-dependent kinase 20;FYN oncogene related to SRC, FGR, YES;hemopoietic cell kinase;lymphocyte-specific protein tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral related oncogene homolog;male germ cell-associated kinase;B lymphoid tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 647 83 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46947.[MT7]-IADFGLAR.2b5_1.heavy 503.794 / 648.347 16011.0 33.69160079956055 47 17 10 10 10 3.6365853232843084 27.498323594862615 0.0 3 0.970827244490096 7.20795644631017 16011.0 25.468267541141103 0.0 - - - - - - - 719.2222222222222 32 9 FGFR1;FGFR3;FGFR2;FGFR4;FGR;ICK;CDK20;FYN;HCK;LCK;LYN;MAK;BLK;YES1 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4;Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;intestinal cell (MAK-like) kinase;cyclin-dependent kinase 20;FYN oncogene related to SRC, FGR, YES;hemopoietic cell kinase;lymphocyte-specific protein tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral related oncogene homolog;male germ cell-associated kinase;B lymphoid tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 649 83 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46947.[MT7]-IADFGLAR.2y7_1.heavy 503.794 / 749.394 80316.0 33.69160079956055 47 17 10 10 10 3.6365853232843084 27.498323594862615 0.0 3 0.970827244490096 7.20795644631017 80316.0 82.54477899452465 0.0 - - - - - - - 1162.4285714285713 160 7 FGFR1;FGFR3;FGFR2;FGFR4;FGR;ICK;CDK20;FYN;HCK;LCK;LYN;MAK;BLK;YES1 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4;Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;intestinal cell (MAK-like) kinase;cyclin-dependent kinase 20;FYN oncogene related to SRC, FGR, YES;hemopoietic cell kinase;lymphocyte-specific protein tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral related oncogene homolog;male germ cell-associated kinase;B lymphoid tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 651 84 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539292.[MT7]-AHLDSGPSTAK[MT7].3b6_1.heavy 457.921 / 725.37 6547.0 16.920700073242188 48 18 10 10 10 4.547414964964917 21.990515660092502 0.0 3 0.9882768237129408 11.387136618071388 6547.0 64.69838063527298 0.0 - - - - - - - 190.4 13 20 NR4A1 nuclear receptor subfamily 4, group A, member 1 653 84 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539292.[MT7]-AHLDSGPSTAK[MT7].3y3_1.heavy 457.921 / 463.3 14205.0 16.920700073242188 48 18 10 10 10 4.547414964964917 21.990515660092502 0.0 3 0.9882768237129408 11.387136618071388 14205.0 27.740507992333686 0.0 - - - - - - - 731.4285714285714 28 7 NR4A1 nuclear receptor subfamily 4, group A, member 1 655 84 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539292.[MT7]-AHLDSGPSTAK[MT7].3b4_1.heavy 457.921 / 581.316 5634.0 16.920700073242188 48 18 10 10 10 4.547414964964917 21.990515660092502 0.0 3 0.9882768237129408 11.387136618071388 5634.0 8.810121164744968 0.0 - - - - - - - 207.76470588235293 11 17 NR4A1 nuclear receptor subfamily 4, group A, member 1 657 84 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539292.[MT7]-AHLDSGPSTAK[MT7].3y4_1.heavy 457.921 / 550.332 16269.0 16.920700073242188 48 18 10 10 10 4.547414964964917 21.990515660092502 0.0 3 0.9882768237129408 11.387136618071388 16269.0 32.38154360140075 0.0 - - - - - - - 843.25 32 8 NR4A1 nuclear receptor subfamily 4, group A, member 1 659 85 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57556.[MT7]-LQENVEK[MT7].2y4_1.heavy 574.332 / 633.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 661 85 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57556.[MT7]-LQENVEK[MT7].2b4_1.heavy 574.332 / 629.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 663 85 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57556.[MT7]-LQENVEK[MT7].2y3_1.heavy 574.332 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 665 85 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57556.[MT7]-LQENVEK[MT7].2y6_1.heavy 574.332 / 890.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 667 86 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59293.[MT7]-K[MT7]QEEK[MT7].2b3_1.heavy 547.333 / 674.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100132202;TMEM131;GOLGA6L1;AGFG1;HSP90AA1;LOC440233;LOC440243;PARN;LOC645202;GOLGA6L6 hypothetical protein LOC100132202;transmembrane protein 131;golgin A6 family-like 1;ArfGAP with FG repeats 1;heat shock protein 90kDa alpha (cytosolic), class A member 1;hypothetical protein LOC440233;Putative golgin subfamily A member 6-like protein 6;poly(A)-specific ribonuclease (deadenylation nuclease);golgin A6 family-like;golgin A6 family-like 6 669 86 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59293.[MT7]-K[MT7]QEEK[MT7].2y4_1.heavy 547.333 / 677.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100132202;TMEM131;GOLGA6L1;AGFG1;HSP90AA1;LOC440233;LOC440243;PARN;LOC645202;GOLGA6L6 hypothetical protein LOC100132202;transmembrane protein 131;golgin A6 family-like 1;ArfGAP with FG repeats 1;heat shock protein 90kDa alpha (cytosolic), class A member 1;hypothetical protein LOC440233;Putative golgin subfamily A member 6-like protein 6;poly(A)-specific ribonuclease (deadenylation nuclease);golgin A6 family-like;golgin A6 family-like 6 671 86 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59293.[MT7]-K[MT7]QEEK[MT7].2b4_1.heavy 547.333 / 803.45 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100132202;TMEM131;GOLGA6L1;AGFG1;HSP90AA1;LOC440233;LOC440243;PARN;LOC645202;GOLGA6L6 hypothetical protein LOC100132202;transmembrane protein 131;golgin A6 family-like 1;ArfGAP with FG repeats 1;heat shock protein 90kDa alpha (cytosolic), class A member 1;hypothetical protein LOC440233;Putative golgin subfamily A member 6-like protein 6;poly(A)-specific ribonuclease (deadenylation nuclease);golgin A6 family-like;golgin A6 family-like 6 673 86 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59293.[MT7]-K[MT7]QEEK[MT7].2y3_1.heavy 547.333 / 549.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100132202;TMEM131;GOLGA6L1;AGFG1;HSP90AA1;LOC440233;LOC440243;PARN;LOC645202;GOLGA6L6 hypothetical protein LOC100132202;transmembrane protein 131;golgin A6 family-like 1;ArfGAP with FG repeats 1;heat shock protein 90kDa alpha (cytosolic), class A member 1;hypothetical protein LOC440233;Putative golgin subfamily A member 6-like protein 6;poly(A)-specific ribonuclease (deadenylation nuclease);golgin A6 family-like;golgin A6 family-like 6 675 87 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59796.[MT7]-SYGIPYIETSAK[MT7].2y4_1.heavy 808.942 / 550.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 677 87 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59796.[MT7]-SYGIPYIETSAK[MT7].2y8_1.heavy 808.942 / 1052.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 679 87 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59796.[MT7]-SYGIPYIETSAK[MT7].2y5_1.heavy 808.942 / 679.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 681 87 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59796.[MT7]-SYGIPYIETSAK[MT7].2b4_1.heavy 808.942 / 565.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 683 88 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540999.[MT7]-GK[MT7]VEQLSPEEEEK[MT7].4b7_2.heavy 484.267 / 515.81 47835.0 21.875499725341797 34 8 10 6 10 0.8228623111781428 88.16475091905122 0.030200958251953125 3 0.7669574576908962 2.5051011290351592 47835.0 121.87648810621428 0.0 - - - - - - - 721.2857142857143 95 7 FOS FBJ murine osteosarcoma viral oncogene homolog 685 88 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540999.[MT7]-GK[MT7]VEQLSPEEEEK[MT7].4b4_1.heavy 484.267 / 702.439 4465.0 21.875499725341797 34 8 10 6 10 0.8228623111781428 88.16475091905122 0.030200958251953125 3 0.7669574576908962 2.5051011290351592 4465.0 13.436990595611285 0.0 - - - - - - - 182.47826086956522 8 23 FOS FBJ murine osteosarcoma viral oncogene homolog 687 88 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540999.[MT7]-GK[MT7]VEQLSPEEEEK[MT7].4b5_1.heavy 484.267 / 830.497 5634.0 21.875499725341797 34 8 10 6 10 0.8228623111781428 88.16475091905122 0.030200958251953125 3 0.7669574576908962 2.5051011290351592 5634.0 120.25700666761243 0.0 - - - - - - - 126.83333333333333 11 18 FOS FBJ murine osteosarcoma viral oncogene homolog 689 88 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540999.[MT7]-GK[MT7]VEQLSPEEEEK[MT7].4y3_1.heavy 484.267 / 549.3 20888.0 21.875499725341797 34 8 10 6 10 0.8228623111781428 88.16475091905122 0.030200958251953125 3 0.7669574576908962 2.5051011290351592 20888.0 69.23673940564316 0.0 - - - - - - - 295.1666666666667 41 18 FOS FBJ murine osteosarcoma viral oncogene homolog 691 89 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47324.[MT7]-TISIILFLNK[MT7].2y4_1.heavy 725.468 / 665.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 693 89 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47324.[MT7]-TISIILFLNK[MT7].2y5_1.heavy 725.468 / 778.494 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 695 89 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47324.[MT7]-TISIILFLNK[MT7].2b4_1.heavy 725.468 / 559.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 697 89 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47324.[MT7]-TISIILFLNK[MT7].2y6_1.heavy 725.468 / 891.578 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 699 90 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538557.[MT7]-SELLLSEK[MT7].3y3_1.heavy 402.911 / 507.289 87822.0 29.74329948425293 50 20 10 10 10 6.037838007544144 16.56221976724984 0.0 3 0.991748902089823 13.577112904066983 87822.0 541.2532274795742 0.0 - - - - - - - 212.0 175 5 INHBA inhibin, beta A 701 90 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538557.[MT7]-SELLLSEK[MT7].3b4_1.heavy 402.911 / 587.352 57133.0 29.74329948425293 50 20 10 10 10 6.037838007544144 16.56221976724984 0.0 3 0.991748902089823 13.577112904066983 57133.0 670.9373081946779 0.0 - - - - - - - 281.1111111111111 114 9 INHBA inhibin, beta A 703 90 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538557.[MT7]-SELLLSEK[MT7].3y4_1.heavy 402.911 / 620.374 12406.0 29.74329948425293 50 20 10 10 10 6.037838007544144 16.56221976724984 0.0 3 0.991748902089823 13.577112904066983 12406.0 217.56444710459374 0.0 - - - - - - - 181.44444444444446 24 9 INHBA inhibin, beta A 705 90 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538557.[MT7]-SELLLSEK[MT7].3b3_1.heavy 402.911 / 474.268 93780.0 29.74329948425293 50 20 10 10 10 6.037838007544144 16.56221976724984 0.0 3 0.991748902089823 13.577112904066983 93780.0 304.2778239251937 0.0 - - - - - - - 303.0 187 7 INHBA inhibin, beta A 707 91 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47738.[MT7]-AEMNELMEQTSEIITFAESGTAR.3b6_1.heavy 901.43 / 832.399 22421.0 49.948001861572266 41 11 10 10 10 1.205482937456415 68.79023876389071 0.0 3 0.86717312722906 3.348040385230543 22421.0 295.1140170940171 0.0 - - - - - - - 97.25 44 12 INHBA inhibin, beta A 709 91 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47738.[MT7]-AEMNELMEQTSEIITFAESGTAR.3b4_1.heavy 901.43 / 590.273 8466.0 49.948001861572266 41 11 10 10 10 1.205482937456415 68.79023876389071 0.0 3 0.86717312722906 3.348040385230543 8466.0 19.350857142857144 0.0 - - - - - - - 116.7 16 10 INHBA inhibin, beta A 711 91 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47738.[MT7]-AEMNELMEQTSEIITFAESGTAR.3b5_1.heavy 901.43 / 719.315 14538.0 49.948001861572266 41 11 10 10 10 1.205482937456415 68.79023876389071 0.0 3 0.86717312722906 3.348040385230543 14538.0 340.89103448275864 0.0 - - - - - - - 106.91666666666667 29 12 INHBA inhibin, beta A 713 91 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47738.[MT7]-AEMNELMEQTSEIITFAESGTAR.3y10_1.heavy 901.43 / 1052.54 12145.0 49.948001861572266 41 11 10 10 10 1.205482937456415 68.79023876389071 0.0 3 0.86717312722906 3.348040385230543 12145.0 209.39655172413794 0.0 - - - - - - - 109.25 24 8 INHBA inhibin, beta A 715 92 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538036.[MT7]-AALLNAIR.2y5_1.heavy 493.317 / 586.367 21952.0 33.395976066589355 41 18 9 6 8 6.032044305416453 16.578127569488398 0.036502838134765625 4 0.9888108104142896 11.656207499901516 21952.0 41.57695871992888 0.0 - - - - - - - 790.2857142857143 43 7 INHBA inhibin, beta A 717 92 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538036.[MT7]-AALLNAIR.2y6_1.heavy 493.317 / 699.451 13610.0 33.395976066589355 41 18 9 6 8 6.032044305416453 16.578127569488398 0.036502838134765625 4 0.9888108104142896 11.656207499901516 13610.0 57.1958571329303 1.0 - - - - - - - 677.5714285714286 91 7 INHBA inhibin, beta A 719 92 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538036.[MT7]-AALLNAIR.2b5_1.heavy 493.317 / 627.395 11151.0 33.395976066589355 41 18 9 6 8 6.032044305416453 16.578127569488398 0.036502838134765625 4 0.9888108104142896 11.656207499901516 11151.0 20.91022597369929 0.0 - - - - - - - 746.3 22 10 INHBA inhibin, beta A 721 92 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538036.[MT7]-AALLNAIR.2y7_1.heavy 493.317 / 770.488 37055.0 33.395976066589355 41 18 9 6 8 6.032044305416453 16.578127569488398 0.036502838134765625 4 0.9888108104142896 11.656207499901516 37055.0 88.37841301430092 0.0 - - - - - - - 658.625 74 8 INHBA inhibin, beta A 723 93 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59376.[MT7]-SISSMELK[MT7].2y4_1.heavy 591.836 / 664.382 N/A 33.18040084838867 47 17 10 10 10 7.42125750799361 13.474805299814442 0.0 2 0.9724724776801509 7.421257271791803 877.0 0.2498575498575498 24.0 - - - - - - - 708.3076923076923 4 13 FOS FBJ murine osteosarcoma viral oncogene homolog 725 93 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59376.[MT7]-SISSMELK[MT7].2y5_1.heavy 591.836 / 751.414 1754.0 33.18040084838867 47 17 10 10 10 7.42125750799361 13.474805299814442 0.0 2 0.9724724776801509 7.421257271791803 1754.0 5.06365296803653 0.0 - - - - - - - 300.64285714285717 3 14 FOS FBJ murine osteosarcoma viral oncogene homolog 727 93 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59376.[MT7]-SISSMELK[MT7].2y6_1.heavy 591.836 / 838.446 2806.0 33.18040084838867 47 17 10 10 10 7.42125750799361 13.474805299814442 0.0 2 0.9724724776801509 7.421257271791803 2806.0 18.48576338946225 1.0 - - - - - - - 157.86666666666667 5 15 FOS FBJ murine osteosarcoma viral oncogene homolog 729 93 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59376.[MT7]-SISSMELK[MT7].2y7_1.heavy 591.836 / 951.53 N/A 33.18040084838867 47 17 10 10 10 7.42125750799361 13.474805299814442 0.0 2 0.9724724776801509 7.421257271791803 526.0 0.3999999999999999 5.0 - - - - - - - 0.0 1 0 FOS FBJ murine osteosarcoma viral oncogene homolog 731 94 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57856.[MT7]-ADQIETQQLMR.2y8_1.heavy 738.883 / 1018.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 733 94 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57856.[MT7]-ADQIETQQLMR.2y9_1.heavy 738.883 / 1146.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 735 94 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57856.[MT7]-ADQIETQQLMR.2y6_1.heavy 738.883 / 776.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 737 94 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57856.[MT7]-ADQIETQQLMR.2y7_1.heavy 738.883 / 905.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 739 95 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47733.[MT7]-K[MT7]PLVIIAEDVDGEALSTLVLNR.3b4_1.heavy 885.184 / 726.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 741 95 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47733.[MT7]-K[MT7]PLVIIAEDVDGEALSTLVLNR.3b5_1.heavy 885.184 / 839.596 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 743 95 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47733.[MT7]-K[MT7]PLVIIAEDVDGEALSTLVLNR.3b3_1.heavy 885.184 / 627.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 745 95 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47733.[MT7]-K[MT7]PLVIIAEDVDGEALSTLVLNR.3y8_1.heavy 885.184 / 915.562 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 747 96 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59574.[MT7]-K[MT7]AILEDMVR.2y4_1.heavy 681.904 / 520.255 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL1;ACSL6 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 6 749 96 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59574.[MT7]-K[MT7]AILEDMVR.2b3_1.heavy 681.904 / 601.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL1;ACSL6 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 6 751 96 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59574.[MT7]-K[MT7]AILEDMVR.2y8_1.heavy 681.904 / 946.503 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL1;ACSL6 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 6 753 96 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59574.[MT7]-K[MT7]AILEDMVR.2b6_1.heavy 681.904 / 958.581 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL1;ACSL6 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 6 755 97 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538235.[MT7]-AILEDMVR.2y5_1.heavy 545.806 / 649.297 10863.0 35.176700592041016 50 20 10 10 10 7.143567176288215 13.998608472799415 0.0 3 0.9956698808063946 18.748028600444485 10863.0 18.341537775396535 0.0 - - - - - - - 695.0 21 14 ACSL1;ACSL6 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 6 757 97 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538235.[MT7]-AILEDMVR.2y6_1.heavy 545.806 / 762.381 17120.0 35.176700592041016 50 20 10 10 10 7.143567176288215 13.998608472799415 0.0 3 0.9956698808063946 18.748028600444485 17120.0 83.23862068965516 0.0 - - - - - - - 266.4375 34 16 ACSL1;ACSL6 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 6 759 97 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538235.[MT7]-AILEDMVR.2b5_1.heavy 545.806 / 686.384 23117.0 35.176700592041016 50 20 10 10 10 7.143567176288215 13.998608472799415 0.0 3 0.9956698808063946 18.748028600444485 23117.0 36.25074023183655 0.0 - - - - - - - 365.4 46 5 ACSL1;ACSL6 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 6 761 97 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538235.[MT7]-AILEDMVR.2y7_1.heavy 545.806 / 875.466 22595.0 35.176700592041016 50 20 10 10 10 7.143567176288215 13.998608472799415 0.0 3 0.9956698808063946 18.748028600444485 22595.0 89.48240830565109 0.0 - - - - - - - 255.5625 45 16 ACSL1;ACSL6 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 6 763 98 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540229.[MT7]-K[MT7]K[MT7]EEEGEGK[MT7].2b3_1.heavy 805.466 / 818.546 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 765 98 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540229.[MT7]-K[MT7]K[MT7]EEEGEGK[MT7].2y4_1.heavy 805.466 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 767 98 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540229.[MT7]-K[MT7]K[MT7]EEEGEGK[MT7].2y8_1.heavy 805.466 / 1193.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 769 98 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540229.[MT7]-K[MT7]K[MT7]EEEGEGK[MT7].2y6_1.heavy 805.466 / 792.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 771 99 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57466.[MT7]-HLEFEAR.2y4_1.heavy 523.281 / 522.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 773 99 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57466.[MT7]-HLEFEAR.2y5_1.heavy 523.281 / 651.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 775 99 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57466.[MT7]-HLEFEAR.2y3_1.heavy 523.281 / 375.199 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 777 99 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57466.[MT7]-HLEFEAR.2y6_1.heavy 523.281 / 764.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 779 100 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 819566.0 33.80110168457031 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 819566.0 218.62226675306567 0.0 - - - - - - - 437.0 1639 1 781 100 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 208115.0 33.80110168457031 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 208115.0 339.20414725571925 0.0 - - - - - - - 1237.2857142857142 416 7 783 100 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 275475.0 33.80110168457031 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 275475.0 85.10124136153125 0.0 - - - - - - - 262.0 550 1 785 101 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539280.[MT7]-K[MT7]AILEDMVR.3y6_1.heavy 454.939 / 762.381 7798.0 30.942899703979492 40 20 4 6 10 5.846064243052678 17.105525331651563 0.039600372314453125 2 0.9988294433970328 36.06814336472754 7798.0 51.01882978723404 0.0 - - - - - - - 170.375 15 16 ACSL1;ACSL6 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 6 787 101 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539280.[MT7]-K[MT7]AILEDMVR.3y4_1.heavy 454.939 / 520.255 N/A 30.942899703979492 40 20 4 6 10 5.846064243052678 17.105525331651563 0.039600372314453125 2 0.9988294433970328 36.06814336472754 5355.0 9.863270427100215 2.0 - - - - - - - 338.4 28 10 ACSL1;ACSL6 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 6 789 101 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539280.[MT7]-K[MT7]AILEDMVR.3y8_1.heavy 454.939 / 946.503 N/A 30.942899703979492 40 20 4 6 10 5.846064243052678 17.105525331651563 0.039600372314453125 2 0.9988294433970328 36.06814336472754 0.0 0.0 2.0 - - - - - - - 0.0 0 0 ACSL1;ACSL6 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 6 791 101 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539280.[MT7]-K[MT7]AILEDMVR.3y5_1.heavy 454.939 / 649.297 6764.0 30.942899703979492 40 20 4 6 10 5.846064243052678 17.105525331651563 0.039600372314453125 2 0.9988294433970328 36.06814336472754 6764.0 25.17071489361702 0.0 - - - - - - - 244.4 13 15 ACSL1;ACSL6 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 6 793 102 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46959.[MT7]-SGAPGGSEGR.2y5_1.heavy 509.755 / 505.237 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 795 102 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46959.[MT7]-SGAPGGSEGR.2y6_1.heavy 509.755 / 562.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 797 102 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46959.[MT7]-SGAPGGSEGR.2b5_1.heavy 509.755 / 514.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 799 102 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46959.[MT7]-SGAPGGSEGR.2y7_1.heavy 509.755 / 659.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 801 103 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46863.[MT7]-ETEDK[MT7].2y4_1.heavy 455.242 / 636.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 803 103 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46863.[MT7]-ETEDK[MT7].2b4_1.heavy 455.242 / 619.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 805 103 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46863.[MT7]-ETEDK[MT7].2y3_1.heavy 455.242 / 535.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 807 104 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59970.[MT7]-TLSPGHTWEEAPLLTLK[MT7].3y3_1.heavy 727.743 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 809 104 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59970.[MT7]-TLSPGHTWEEAPLLTLK[MT7].3y6_1.heavy 727.743 / 828.568 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 811 104 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59970.[MT7]-TLSPGHTWEEAPLLTLK[MT7].3b5_1.heavy 727.743 / 600.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 813 104 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59970.[MT7]-TLSPGHTWEEAPLLTLK[MT7].3y4_1.heavy 727.743 / 618.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 815 105 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47547.[MT7]-GYDFAAVLEWFAER.2y5_1.heavy 909.453 / 708.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 817 105 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47547.[MT7]-GYDFAAVLEWFAER.2y9_1.heavy 909.453 / 1120.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 819 105 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47547.[MT7]-GYDFAAVLEWFAER.2b4_1.heavy 909.453 / 627.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 821 105 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47547.[MT7]-GYDFAAVLEWFAER.2b5_1.heavy 909.453 / 698.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 823 106 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59973.[MT7]-HPQGSLDTGEEAEEVGLK[MT7].3y6_1.heavy 728.706 / 818.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 825 106 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59973.[MT7]-HPQGSLDTGEEAEEVGLK[MT7].3y4_1.heavy 728.706 / 560.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 827 106 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59973.[MT7]-HPQGSLDTGEEAEEVGLK[MT7].3y5_1.heavy 728.706 / 689.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 829 106 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59973.[MT7]-HPQGSLDTGEEAEEVGLK[MT7].3b7_1.heavy 728.706 / 879.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 831 107 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47545.[MT7]-DLSDLVSEMEMMK[MT7].3y3_1.heavy 605.964 / 553.296 2833.0 46.136199951171875 40 14 10 6 10 1.759014254820138 56.850022520269555 0.0391998291015625 3 0.9349033488559142 4.81059159163686 2833.0 6.758124206083277 0.0 - - - - - - - 234.35714285714286 5 14 FGFR3;FGFR2 fibroblast growth factor receptor 3;fibroblast growth factor receptor 2 833 107 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47545.[MT7]-DLSDLVSEMEMMK[MT7].3b4_1.heavy 605.964 / 575.279 4995.0 46.136199951171875 40 14 10 6 10 1.759014254820138 56.850022520269555 0.0391998291015625 3 0.9349033488559142 4.81059159163686 4995.0 28.823011317631394 0.0 - - - - - - - 197.52941176470588 9 17 FGFR3;FGFR2 fibroblast growth factor receptor 3;fibroblast growth factor receptor 2 835 107 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47545.[MT7]-DLSDLVSEMEMMK[MT7].3b5_1.heavy 605.964 / 688.363 2908.0 46.136199951171875 40 14 10 6 10 1.759014254820138 56.850022520269555 0.0391998291015625 3 0.9349033488559142 4.81059159163686 2908.0 27.713825503355704 0.0 - - - - - - - 149.28571428571428 5 14 FGFR3;FGFR2 fibroblast growth factor receptor 3;fibroblast growth factor receptor 2 837 107 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47545.[MT7]-DLSDLVSEMEMMK[MT7].3y4_1.heavy 605.964 / 682.338 746.0 46.136199951171875 40 14 10 6 10 1.759014254820138 56.850022520269555 0.0391998291015625 3 0.9349033488559142 4.81059159163686 746.0 2.4473939527300734 1.0 - - - - - - - 0.0 1 0 FGFR3;FGFR2 fibroblast growth factor receptor 3;fibroblast growth factor receptor 2 839 108 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47000.[MT7]-EEEGEGK[MT7].2b3_1.heavy 533.269 / 532.237 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 841 108 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47000.[MT7]-EEEGEGK[MT7].2y5_1.heavy 533.269 / 663.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 843 108 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47000.[MT7]-EEEGEGK[MT7].2b4_1.heavy 533.269 / 589.259 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 845 108 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47000.[MT7]-EEEGEGK[MT7].2y6_1.heavy 533.269 / 792.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 847 109 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539265.[MT7]-IILLFDAHK[MT7].3y3_1.heavy 453.286 / 499.311 6545.0 38.95819854736328 48 20 10 10 8 9.083130059808243 11.009420688853501 0.0 4 0.9972048493307307 23.33772653069916 6545.0 26.976073219538065 0.0 - - - - - - - 203.26666666666668 13 15 EHD1;EHD4;EHD3 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3 849 109 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539265.[MT7]-IILLFDAHK[MT7].3b4_1.heavy 453.286 / 597.446 8553.0 38.95819854736328 48 20 10 10 8 9.083130059808243 11.009420688853501 0.0 4 0.9972048493307307 23.33772653069916 8553.0 53.38913004484306 1.0 - - - - - - - 211.6153846153846 23 13 EHD1;EHD4;EHD3 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3 851 109 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539265.[MT7]-IILLFDAHK[MT7].3y4_1.heavy 453.286 / 614.338 5355.0 38.95819854736328 48 20 10 10 8 9.083130059808243 11.009420688853501 0.0 4 0.9972048493307307 23.33772653069916 5355.0 67.10208675526356 1.0 - - - - - - - 255.75 10 16 EHD1;EHD4;EHD3 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3 853 109 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539265.[MT7]-IILLFDAHK[MT7].3b3_1.heavy 453.286 / 484.362 21867.0 38.95819854736328 48 20 10 10 8 9.083130059808243 11.009420688853501 0.0 4 0.9972048493307307 23.33772653069916 21867.0 232.07568784422307 0.0 - - - - - - - 206.55555555555554 43 18 EHD1;EHD4;EHD3 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3 855 110 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57847.[MT7]-VTQLLLQQDK[MT7].3y3_1.heavy 491.967 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 857 110 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57847.[MT7]-VTQLLLQQDK[MT7].3b4_1.heavy 491.967 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 859 110 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57847.[MT7]-VTQLLLQQDK[MT7].3b5_1.heavy 491.967 / 699.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 861 110 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57847.[MT7]-VTQLLLQQDK[MT7].3y4_1.heavy 491.967 / 662.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 863 111 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57986.[MT7]-HVISYSLSPFEQR.3y6_1.heavy 569.638 / 763.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 865 111 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57986.[MT7]-HVISYSLSPFEQR.3b4_1.heavy 569.638 / 581.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 867 111 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57986.[MT7]-HVISYSLSPFEQR.3y4_1.heavy 569.638 / 579.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 869 111 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57986.[MT7]-HVISYSLSPFEQR.3y5_1.heavy 569.638 / 676.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 871 112 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47143.[MT7]-NVADHK[MT7]K[MT7].2y4_1.heavy 622.378 / 815.498 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 873 112 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47143.[MT7]-NVADHK[MT7]K[MT7].2y5_1.heavy 622.378 / 886.535 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 875 112 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47143.[MT7]-NVADHK[MT7]K[MT7].2b4_1.heavy 622.378 / 544.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 877 112 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47143.[MT7]-NVADHK[MT7]K[MT7].2y3_1.heavy 622.378 / 700.471 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 879 113 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537912.[MT7]-ITGANAK[MT7].2y4_1.heavy 481.797 / 547.332 1041.0 17.448749542236328 42 20 10 6 6 8.858740337200585 11.288286617914416 0.03549957275390625 5 0.9945603139513118 16.725472160773474 1041.0 2.038625 2.0 - - - - - - - 259.1304347826087 2 23 EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 881 113 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537912.[MT7]-ITGANAK[MT7].2y5_1.heavy 481.797 / 604.354 2522.0 17.448749542236328 42 20 10 6 6 8.858740337200585 11.288286617914416 0.03549957275390625 5 0.9945603139513118 16.725472160773474 2522.0 11.821874999999999 1.0 - - - - - - - 201.66666666666666 6 24 EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 883 113 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537912.[MT7]-ITGANAK[MT7].2y6_1.heavy 481.797 / 705.401 8286.0 17.448749542236328 42 20 10 6 6 8.858740337200585 11.288286617914416 0.03549957275390625 5 0.9945603139513118 16.725472160773474 8286.0 18.32700647511575 0.0 - - - - - - - 277.89473684210526 16 19 EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 885 113 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537912.[MT7]-ITGANAK[MT7].2b5_1.heavy 481.797 / 601.343 1041.0 17.448749542236328 42 20 10 6 6 8.858740337200585 11.288286617914416 0.03549957275390625 5 0.9945603139513118 16.725472160773474 1041.0 4.539916666666667 2.0 - - - - - - - 240.0 3 25 EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 887 114 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537910.[MT7]-LLDQGK[MT7].2b3_1.heavy 481.3 / 486.304 27533.0 23.973750114440918 43 17 10 6 10 2.185449392597757 32.03931886596266 0.03830146789550781 3 0.9747009898911351 7.7426696004991165 27533.0 49.12115962958828 0.0 - - - - - - - 1268.4285714285713 55 7 INHBA inhibin, beta A 889 114 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537910.[MT7]-LLDQGK[MT7].2y4_1.heavy 481.3 / 591.322 17223.0 23.973750114440918 43 17 10 6 10 2.185449392597757 32.03931886596266 0.03830146789550781 3 0.9747009898911351 7.7426696004991165 17223.0 24.81454821765669 0.0 - - - - - - - 794.6666666666666 34 9 INHBA inhibin, beta A 891 114 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537910.[MT7]-LLDQGK[MT7].2y5_1.heavy 481.3 / 704.406 26758.0 23.973750114440918 43 17 10 6 10 2.185449392597757 32.03931886596266 0.03830146789550781 3 0.9747009898911351 7.7426696004991165 26758.0 42.20221476510067 1.0 - - - - - - - 668.8888888888889 53 9 INHBA inhibin, beta A 893 114 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537910.[MT7]-LLDQGK[MT7].2b4_1.heavy 481.3 / 614.363 5185.0 23.973750114440918 43 17 10 6 10 2.185449392597757 32.03931886596266 0.03830146789550781 3 0.9747009898911351 7.7426696004991165 5185.0 8.348382950391608 0.0 - - - - - - - 721.3 10 10 INHBA inhibin, beta A 895 115 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59682.[MT7]-EIGNIISDAMK[MT7].2y5_1.heavy 739.91 / 695.351 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 897 115 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59682.[MT7]-EIGNIISDAMK[MT7].2b4_1.heavy 739.91 / 558.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 899 115 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59682.[MT7]-EIGNIISDAMK[MT7].2y6_1.heavy 739.91 / 808.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 901 115 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59682.[MT7]-EIGNIISDAMK[MT7].2b5_1.heavy 739.91 / 671.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 903 116 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57982.[MT7]-K[MT7]RPDVTQPVPK[MT7].2b4_1.heavy 849.025 / 785.487 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 905 116 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57982.[MT7]-K[MT7]RPDVTQPVPK[MT7].2b6_1.heavy 849.025 / 985.603 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 907 116 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57982.[MT7]-K[MT7]RPDVTQPVPK[MT7].2b7_2.heavy 849.025 / 557.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 909 116 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57982.[MT7]-K[MT7]RPDVTQPVPK[MT7].2b7_1.heavy 849.025 / 1113.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 911 117 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46963.[MT7]-C[CAM]VEVVK[MT7].2y4_1.heavy 511.301 / 618.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 913 117 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46963.[MT7]-C[CAM]VEVVK[MT7].2b3_1.heavy 511.301 / 533.251 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 915 117 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46963.[MT7]-C[CAM]VEVVK[MT7].2y5_1.heavy 511.301 / 717.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 917 117 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46963.[MT7]-C[CAM]VEVVK[MT7].2b4_1.heavy 511.301 / 632.319 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 919 118 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47208.[MT7]-GMEYLASQK[MT7].3y3_1.heavy 438.904 / 506.306 14467.0 27.50143305460612 38 11 10 7 10 1.0059031661021811 62.5209599824679 0.02809906005859375 3 0.8785634990915862 3.5050285273465116 14467.0 31.81031896495408 0.0 - - - - - - - 672.5384615384615 28 13 FGFR3;FGFR2 fibroblast growth factor receptor 3;fibroblast growth factor receptor 2 921 118 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47208.[MT7]-GMEYLASQK[MT7].3b4_1.heavy 438.904 / 625.277 20736.0 27.50143305460612 38 11 10 7 10 1.0059031661021811 62.5209599824679 0.02809906005859375 3 0.8785634990915862 3.5050285273465116 20736.0 81.84378407151117 0.0 - - - - - - - 209.26315789473685 41 19 FGFR3;FGFR2 fibroblast growth factor receptor 3;fibroblast growth factor receptor 2 923 118 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47208.[MT7]-GMEYLASQK[MT7].3y4_1.heavy 438.904 / 577.343 N/A 27.50143305460612 38 11 10 7 10 1.0059031661021811 62.5209599824679 0.02809906005859375 3 0.8785634990915862 3.5050285273465116 11212.0 22.984543264851737 1.0 - - - - - - - 768.5833333333334 41 12 FGFR3;FGFR2 fibroblast growth factor receptor 3;fibroblast growth factor receptor 2 925 118 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47208.[MT7]-GMEYLASQK[MT7].3b3_1.heavy 438.904 / 462.214 14587.0 27.50143305460612 38 11 10 7 10 1.0059031661021811 62.5209599824679 0.02809906005859375 3 0.8785634990915862 3.5050285273465116 14587.0 50.86765796476202 0.0 - - - - - - - 718.4166666666666 29 12 FGFR3;FGFR2 fibroblast growth factor receptor 3;fibroblast growth factor receptor 2 927 119 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 203360.0 22.05419921875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 203360.0 610.6401875512836 0.0 - - - - - - - 343.1666666666667 406 6 929 119 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 416067.0 22.05419921875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 416067.0 2013.9329123201378 0.0 - - - - - - - 281.55555555555554 832 9 931 119 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 1239350.0 22.05419921875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1239350.0 8383.06117039728 0.0 - - - - - - - 1184.4285714285713 2478 7 933 120 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57577.[MT7]-EFC[CAM]LQGK[MT7].2y4_1.heavy 585.315 / 589.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 935 120 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57577.[MT7]-EFC[CAM]LQGK[MT7].2b3_1.heavy 585.315 / 581.251 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 937 120 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57577.[MT7]-EFC[CAM]LQGK[MT7].2y5_1.heavy 585.315 / 749.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 939 120 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57577.[MT7]-EFC[CAM]LQGK[MT7].2y6_1.heavy 585.315 / 896.478 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 941 121 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59276.[MT7]-GIPNVLRR.2b4_1.heavy 534.842 / 526.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 943 121 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59276.[MT7]-GIPNVLRR.2b6_1.heavy 534.842 / 738.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 945 121 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59276.[MT7]-GIPNVLRR.2y6_1.heavy 534.842 / 754.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 947 121 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59276.[MT7]-GIPNVLRR.2b7_1.heavy 534.842 / 894.564 N/A N/A - - - - - - - - - 0.0 - - - - - - - UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 949 122 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57576.[MT7]-ATAEEMTK[MT7].2y4_1.heavy 584.81 / 652.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 951 122 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57576.[MT7]-ATAEEMTK[MT7].2b4_1.heavy 584.81 / 517.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 953 122 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57576.[MT7]-ATAEEMTK[MT7].2y3_1.heavy 584.81 / 523.303 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 955 122 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57576.[MT7]-ATAEEMTK[MT7].2y7_1.heavy 584.81 / 953.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 957 123 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58093.[MT7]-NK[MT7]LPGLITSMETIGAK[MT7].3y6_1.heavy 702.417 / 762.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 959 123 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58093.[MT7]-NK[MT7]LPGLITSMETIGAK[MT7].3b6_1.heavy 702.417 / 911.592 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 961 123 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58093.[MT7]-NK[MT7]LPGLITSMETIGAK[MT7].3b3_1.heavy 702.417 / 644.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 963 123 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58093.[MT7]-NK[MT7]LPGLITSMETIGAK[MT7].3y5_1.heavy 702.417 / 633.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 965 124 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59779.[MT7]-SALQTEIANLLK[MT7].2y5_1.heavy 794.979 / 702.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 967 124 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59779.[MT7]-SALQTEIANLLK[MT7].2b4_1.heavy 794.979 / 544.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 969 124 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59779.[MT7]-SALQTEIANLLK[MT7].2b6_1.heavy 794.979 / 774.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 971 124 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59779.[MT7]-SALQTEIANLLK[MT7].2y7_1.heavy 794.979 / 944.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 973 125 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47533.[MT7]-HDFSTVLTVFPILR.3y7_1.heavy 597.009 / 845.524 19191.0 45.93470001220703 45 15 10 10 10 4.587328951419284 21.799177922276705 0.0 3 0.959484909995278 6.11049877300975 19191.0 83.5692089802646 0.0 - - - - - - - 229.21428571428572 38 14 EXOC7 exocyst complex component 7 975 125 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47533.[MT7]-HDFSTVLTVFPILR.3y6_1.heavy 597.009 / 744.477 13484.0 45.93470001220703 45 15 10 10 10 4.587328951419284 21.799177922276705 0.0 3 0.959484909995278 6.11049877300975 13484.0 150.69368015162408 0.0 - - - - - - - 170.15384615384616 26 13 EXOC7 exocyst complex component 7 977 125 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47533.[MT7]-HDFSTVLTVFPILR.3b3_1.heavy 597.009 / 544.264 7205.0 45.93470001220703 45 15 10 10 10 4.587328951419284 21.799177922276705 0.0 3 0.959484909995278 6.11049877300975 7205.0 25.90638301360879 0.0 - - - - - - - 253.44444444444446 14 9 EXOC7 exocyst complex component 7 979 125 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47533.[MT7]-HDFSTVLTVFPILR.3y5_1.heavy 597.009 / 645.408 42591.0 45.93470001220703 45 15 10 10 10 4.587328951419284 21.799177922276705 0.0 3 0.959484909995278 6.11049877300975 42591.0 125.71102862067609 0.0 - - - - - - - 261.55555555555554 85 9 EXOC7 exocyst complex component 7 981 126 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59079.[MT7]-LPTVFR.2b3_1.heavy 438.775 / 456.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 983 126 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59079.[MT7]-LPTVFR.2y4_1.heavy 438.775 / 522.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 985 126 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59079.[MT7]-LPTVFR.2y5_1.heavy 438.775 / 619.356 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 987 126 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59079.[MT7]-LPTVFR.2y3_1.heavy 438.775 / 421.256 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 989 127 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47536.[MT7]-TLNDELEIIEGMK[MT7].2y4_1.heavy 896.984 / 608.319 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 991 127 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47536.[MT7]-TLNDELEIIEGMK[MT7].2b4_1.heavy 896.984 / 588.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 993 127 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47536.[MT7]-TLNDELEIIEGMK[MT7].2y6_1.heavy 896.984 / 834.487 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 995 127 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47536.[MT7]-TLNDELEIIEGMK[MT7].2b7_1.heavy 896.984 / 959.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 997 128 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57977.[MT7]-ILHVNGFNPEEK[MT7].3y3_1.heavy 562.314 / 549.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 999 128 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57977.[MT7]-ILHVNGFNPEEK[MT7].3b4_1.heavy 562.314 / 607.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1001 128 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57977.[MT7]-ILHVNGFNPEEK[MT7].3b3_1.heavy 562.314 / 508.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1003 128 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57977.[MT7]-ILHVNGFNPEEK[MT7].3y4_1.heavy 562.314 / 646.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1005 129 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59791.[MT7]-VEQLSPEEEEK[MT7].2y4_1.heavy 802.917 / 678.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1007 129 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59791.[MT7]-VEQLSPEEEEK[MT7].2b3_1.heavy 802.917 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1009 129 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59791.[MT7]-VEQLSPEEEEK[MT7].2y6_1.heavy 802.917 / 904.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1011 129 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59791.[MT7]-VEQLSPEEEEK[MT7].2y7_1.heavy 802.917 / 991.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1013 130 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47532.[MT7]-HDFSTVLTVFPILR.2y8_1.heavy 895.01 / 958.608 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1015 130 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47532.[MT7]-HDFSTVLTVFPILR.2y5_1.heavy 895.01 / 645.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1017 130 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47532.[MT7]-HDFSTVLTVFPILR.2y9_1.heavy 895.01 / 1057.68 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1019 130 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47532.[MT7]-HDFSTVLTVFPILR.2b4_1.heavy 895.01 / 631.296 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1021 131 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59886.[MT7]-NLEPWTTYC[CAM]VQVR.2y8_1.heavy 905.457 / 1026.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL10RB interleukin 10 receptor, beta 1023 131 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59886.[MT7]-NLEPWTTYC[CAM]VQVR.2y5_1.heavy 905.457 / 661.345 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL10RB interleukin 10 receptor, beta 1025 131 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59886.[MT7]-NLEPWTTYC[CAM]VQVR.2y9_1.heavy 905.457 / 1212.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL10RB interleukin 10 receptor, beta 1027 131 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59886.[MT7]-NLEPWTTYC[CAM]VQVR.2y7_1.heavy 905.457 / 925.456 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL10RB interleukin 10 receptor, beta 1029 132 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537923.[MT7]-EYIQK[MT7].2b3_1.heavy 484.786 / 550.299 14748.0 21.14352560043335 47 20 10 7 10 5.613659925689393 17.813690412983 0.024900436401367188 3 0.9934212160638837 15.207267181993059 14748.0 28.067940754897275 0.0 - - - - - - - 660.5454545454545 29 11 FGD2;UBE2H FYVE, RhoGEF and PH domain containing 2;ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) 1031 132 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537923.[MT7]-EYIQK[MT7].2y4_1.heavy 484.786 / 695.421 33739.0 21.14352560043335 47 20 10 7 10 5.613659925689393 17.813690412983 0.024900436401367188 3 0.9934212160638837 15.207267181993059 33739.0 129.85830648048693 0.0 - - - - - - - 732.6666666666666 67 9 FGD2;UBE2H FYVE, RhoGEF and PH domain containing 2;ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) 1033 132 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537923.[MT7]-EYIQK[MT7].2b4_1.heavy 484.786 / 678.358 6681.0 21.14352560043335 47 20 10 7 10 5.613659925689393 17.813690412983 0.024900436401367188 3 0.9934212160638837 15.207267181993059 6681.0 29.42821428571429 1.0 - - - - - - - 290.8888888888889 22 27 FGD2;UBE2H FYVE, RhoGEF and PH domain containing 2;ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) 1035 132 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537923.[MT7]-EYIQK[MT7].2y3_1.heavy 484.786 / 532.357 16513.0 21.14352560043335 47 20 10 7 10 5.613659925689393 17.813690412983 0.024900436401367188 3 0.9934212160638837 15.207267181993059 16513.0 34.19515350877193 0.0 - - - - - - - 646.1538461538462 33 13 FGD2;UBE2H FYVE, RhoGEF and PH domain containing 2;ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) 1037 133 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538018.[MT7]-SDQLTK[MT7].2y4_1.heavy 490.287 / 633.405 7477.0 17.571399688720703 48 18 10 10 10 4.173851567125748 23.95868621386153 0.0 3 0.9807897239848193 8.889920201368282 7477.0 51.71591666666667 0.0 - - - - - - - 180.0 14 20 EXOC7 exocyst complex component 7 1039 133 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538018.[MT7]-SDQLTK[MT7].2y5_1.heavy 490.287 / 748.432 5158.0 17.571399688720703 48 18 10 10 10 4.173851567125748 23.95868621386153 0.0 3 0.9807897239848193 8.889920201368282 5158.0 69.98468181818181 0.0 - - - - - - - 130.0 10 20 EXOC7 exocyst complex component 7 1041 133 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538018.[MT7]-SDQLTK[MT7].2b4_1.heavy 490.287 / 588.311 3119.0 17.571399688720703 48 18 10 10 10 4.173851567125748 23.95868621386153 0.0 3 0.9807897239848193 8.889920201368282 3119.0 15.595000000000002 0.0 - - - - - - - 180.0 6 22 EXOC7 exocyst complex component 7 1043 133 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538018.[MT7]-SDQLTK[MT7].2y3_1.heavy 490.287 / 505.347 4518.0 17.571399688720703 48 18 10 10 10 4.173851567125748 23.95868621386153 0.0 3 0.9807897239848193 8.889920201368282 4518.0 13.553999999999998 0.0 - - - - - - - 206.95652173913044 9 23 EXOC7 exocyst complex component 7 1045 134 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537929.[MT7]-DIQSLPR.2b3_1.heavy 486.783 / 501.279 9273.0 24.68079948425293 47 20 9 10 8 8.006309545729904 12.49014910413177 0.0 4 0.9961064543483202 19.771914391126995 9273.0 10.44222079915118 1.0 - - - - - - - 322.6 18 5 EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 1047 134 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537929.[MT7]-DIQSLPR.2y5_1.heavy 486.783 / 600.346 12095.0 24.68079948425293 47 20 9 10 8 8.006309545729904 12.49014910413177 0.0 4 0.9961064543483202 19.771914391126995 12095.0 1.5426183594627805 1.0 - - - - - - - 668.2 41 5 EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 1049 134 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537929.[MT7]-DIQSLPR.2b4_1.heavy 486.783 / 588.311 7315.0 24.68079948425293 47 20 9 10 8 8.006309545729904 12.49014910413177 0.0 4 0.9961064543483202 19.771914391126995 7315.0 8.507100181387312 1.0 - - - - - - - 739.3333333333334 14 12 EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 1051 134 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537929.[MT7]-DIQSLPR.2y6_1.heavy 486.783 / 713.43 18086.0 24.68079948425293 47 20 9 10 8 8.006309545729904 12.49014910413177 0.0 4 0.9961064543483202 19.771914391126995 18086.0 51.31724923137753 0.0 - - - - - - - 655.125 36 8 EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 1053 135 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538113.[MT7]-ELVPGVPR.2y5_1.heavy 505.809 / 525.314 90472.0 29.01735019683838 46 20 10 6 10 7.0402984782457025 14.203943243173114 0.03289985656738281 3 0.9927239592775285 14.459428516333794 90472.0 149.9406131904891 0.0 - - - - - - - 268.75 180 4 ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 1055 135 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538113.[MT7]-ELVPGVPR.2y6_1.heavy 505.809 / 624.383 17203.0 29.01735019683838 46 20 10 6 10 7.0402984782457025 14.203943243173114 0.03289985656738281 3 0.9927239592775285 14.459428516333794 17203.0 16.751251447998772 0.0 - - - - - - - 647.2857142857143 34 7 ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 1057 135 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538113.[MT7]-ELVPGVPR.2b5_1.heavy 505.809 / 640.379 3610.0 29.01735019683838 46 20 10 6 10 7.0402984782457025 14.203943243173114 0.03289985656738281 3 0.9927239592775285 14.459428516333794 3610.0 4.910853835021707 1.0 - - - - - - - 276.53333333333336 24 15 ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 1059 135 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538113.[MT7]-ELVPGVPR.2y7_1.heavy 505.809 / 737.467 27572.0 29.01735019683838 46 20 10 6 10 7.0402984782457025 14.203943243173114 0.03289985656738281 3 0.9927239592775285 14.459428516333794 27572.0 43.55837133550489 1.0 - - - - - - - 296.2857142857143 55 7 ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 1061 136 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57586.[MT7]-SPEVTLQLYNSVK[MT7].3b4_1.heavy 589.336 / 557.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1063 136 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57586.[MT7]-SPEVTLQLYNSVK[MT7].3b5_1.heavy 589.336 / 658.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1065 136 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57586.[MT7]-SPEVTLQLYNSVK[MT7].3y4_1.heavy 589.336 / 591.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1067 136 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57586.[MT7]-SPEVTLQLYNSVK[MT7].3y5_1.heavy 589.336 / 754.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1069 137 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 567420.0 31.19930076599121 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 567420.0 1407.7127739672594 0.0 - - - - - - - 251.15384615384616 1134 13 1071 137 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 599395.0 31.19930076599121 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 599395.0 1048.9661998418246 0.0 - - - - - - - 263.4117647058824 1198 17 1073 137 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1034890.0 31.19930076599121 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1034890.0 822.0679407199995 0.0 - - - - - - - 1225.5714285714287 2069 7 1075 138 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541298.[MT7]-AVEYFQDNSPDSPELNK[MT7].3y3_1.heavy 747.702 / 518.342 6450.0 30.725000381469727 50 20 10 10 10 13.569901103168196 7.369250463929525 0.0 3 0.9976736403468922 25.58230730222468 6450.0 7.227560129780621 0.0 - - - - - - - 614.4285714285714 12 7 EXOC7 exocyst complex component 7 1077 138 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541298.[MT7]-AVEYFQDNSPDSPELNK[MT7].3b4_1.heavy 747.702 / 607.321 17388.0 30.725000381469727 50 20 10 10 10 13.569901103168196 7.369250463929525 0.0 3 0.9976736403468922 25.58230730222468 17388.0 57.650053475935835 0.0 - - - - - - - 667.7142857142857 34 7 EXOC7 exocyst complex component 7 1079 138 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541298.[MT7]-AVEYFQDNSPDSPELNK[MT7].3b5_1.heavy 747.702 / 754.389 6544.0 30.725000381469727 50 20 10 10 10 13.569901103168196 7.369250463929525 0.0 3 0.9976736403468922 25.58230730222468 6544.0 26.24598930481283 0.0 - - - - - - - 204.3125 13 16 EXOC7 exocyst complex component 7 1081 138 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541298.[MT7]-AVEYFQDNSPDSPELNK[MT7].3y8_1.heavy 747.702 / 1043.55 8320.0 30.725000381469727 50 20 10 10 10 13.569901103168196 7.369250463929525 0.0 3 0.9976736403468922 25.58230730222468 8320.0 50.401466768525594 0.0 - - - - - - - 179.53846153846155 16 13 EXOC7 exocyst complex component 7 1083 139 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59698.[MT7]-TVLPFSQEFQR.2b3_1.heavy 748.405 / 458.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1 cytoplasmic FMR1 interacting protein 1 1085 139 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59698.[MT7]-TVLPFSQEFQR.2y8_1.heavy 748.405 / 1038.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1 cytoplasmic FMR1 interacting protein 1 1087 139 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59698.[MT7]-TVLPFSQEFQR.2y9_1.heavy 748.405 / 1151.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1 cytoplasmic FMR1 interacting protein 1 1089 139 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59698.[MT7]-TVLPFSQEFQR.2y7_1.heavy 748.405 / 941.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1 cytoplasmic FMR1 interacting protein 1 1091 140 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538995.[MT7]-LLPLEEHYR.3y3_1.heavy 438.583 / 475.241 52420.0 32.14970016479492 48 18 10 10 10 3.6404535911412483 21.984260299644923 0.0 3 0.9850629412964985 10.085275100859418 52420.0 179.59998779937936 0.0 - - - - - - - 674.8571428571429 104 7 EHD1;EHD3;EHD2 EH-domain containing 1;EH-domain containing 3;EH-domain containing 2 1093 140 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538995.[MT7]-LLPLEEHYR.3b4_1.heavy 438.583 / 581.414 33434.0 32.14970016479492 48 18 10 10 10 3.6404535911412483 21.984260299644923 0.0 3 0.9850629412964985 10.085275100859418 33434.0 60.4405304302877 0.0 - - - - - - - 671.625 66 8 EHD1;EHD3;EHD2 EH-domain containing 1;EH-domain containing 3;EH-domain containing 2 1095 140 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538995.[MT7]-LLPLEEHYR.3y4_1.heavy 438.583 / 604.284 58069.0 32.14970016479492 48 18 10 10 10 3.6404535911412483 21.984260299644923 0.0 3 0.9850629412964985 10.085275100859418 58069.0 130.20267386091126 0.0 - - - - - - - 246.83333333333334 116 12 EHD1;EHD3;EHD2 EH-domain containing 1;EH-domain containing 3;EH-domain containing 2 1097 140 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538995.[MT7]-LLPLEEHYR.3y5_1.heavy 438.583 / 733.326 45844.0 32.14970016479492 48 18 10 10 10 3.6404535911412483 21.984260299644923 0.0 3 0.9850629412964985 10.085275100859418 45844.0 209.2938763644854 0.0 - - - - - - - 256.46153846153845 91 13 EHD1;EHD3;EHD2 EH-domain containing 1;EH-domain containing 3;EH-domain containing 2 1099 141 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 290219.0 25.794300079345703 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 290219.0 681.9053151276909 0.0 - - - - - - - 1862.142857142857 580 7 1101 141 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 360404.0 25.794300079345703 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 360404.0 1026.2852651191458 0.0 - - - - - - - 2801.0 720 7 1103 141 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 475781.0 25.794300079345703 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 475781.0 2757.5071420870786 0.0 - - - - - - - 2793.285714285714 951 7 1105 142 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57526.[MT7]-LTLDQLK[MT7].2y4_1.heavy 559.855 / 647.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 1107 142 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57526.[MT7]-LTLDQLK[MT7].2y5_1.heavy 559.855 / 760.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 1109 142 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57526.[MT7]-LTLDQLK[MT7].2b4_1.heavy 559.855 / 587.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 1111 142 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57526.[MT7]-LTLDQLK[MT7].2y6_1.heavy 559.855 / 861.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 1113 143 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59042.[MT7]-QQAPGR.2y4_1.heavy 400.728 / 400.23 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 1115 143 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59042.[MT7]-QQAPGR.2b3_1.heavy 400.728 / 472.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 1117 143 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59042.[MT7]-QQAPGR.2y5_1.heavy 400.728 / 528.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 1119 143 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59042.[MT7]-QQAPGR.2y3_1.heavy 400.728 / 329.193 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 1121 144 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59544.[MT7]-YHSDEYIK[MT7].2y3_1.heavy 671.848 / 567.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 1123 144 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59544.[MT7]-YHSDEYIK[MT7].2y6_1.heavy 671.848 / 898.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 1125 144 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59544.[MT7]-YHSDEYIK[MT7].2b5_1.heavy 671.848 / 776.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 1127 144 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59544.[MT7]-YHSDEYIK[MT7].2y7_1.heavy 671.848 / 1035.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC2 histone deacetylase 2 1129 145 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58018.[MT7]-STWHVFPVSSSIQR.3y6_1.heavy 592.317 / 677.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1131 145 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58018.[MT7]-STWHVFPVSSSIQR.3b4_1.heavy 592.317 / 656.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1133 145 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58018.[MT7]-STWHVFPVSSSIQR.3b3_1.heavy 592.317 / 519.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1135 145 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58018.[MT7]-STWHVFPVSSSIQR.3y8_1.heavy 592.317 / 873.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1137 146 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59545.[MT7]-GIQGHQASEK[MT7].2y4_1.heavy 671.87 / 578.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 1139 146 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59545.[MT7]-GIQGHQASEK[MT7].2b4_1.heavy 671.87 / 500.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 1141 146 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59545.[MT7]-GIQGHQASEK[MT7].2b6_1.heavy 671.87 / 765.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 1143 146 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59545.[MT7]-GIQGHQASEK[MT7].2y3_1.heavy 671.87 / 507.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 1145 147 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57724.[MT7]-YEPPLGDIK[MT7].2y4_1.heavy 660.376 / 576.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1147 147 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57724.[MT7]-YEPPLGDIK[MT7].2y5_1.heavy 660.376 / 689.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1149 147 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57724.[MT7]-YEPPLGDIK[MT7].2y6_1.heavy 660.376 / 786.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1151 147 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57724.[MT7]-YEPPLGDIK[MT7].2y7_1.heavy 660.376 / 883.537 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1153 148 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47778.[MT7]-WLSSPFPSSSFSPGGLAPEISPLEVLER.3y7_1.heavy 1044.21 / 855.493 3225.0 49.53897476196289 39 13 10 6 10 1.5280217888235315 44.71761670775481 0.0345001220703125 3 0.9197766235202934 4.327776746324748 3225.0 3.7829912023460412 0.0 - - - - - - - 143.375 6 16 IL2RB interleukin 2 receptor, beta 1155 148 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47778.[MT7]-WLSSPFPSSSFSPGGLAPEISPLEVLER.3b6_1.heavy 1044.21 / 862.458 5395.0 49.53897476196289 39 13 10 6 10 1.5280217888235315 44.71761670775481 0.0345001220703125 3 0.9197766235202934 4.327776746324748 5395.0 8.618740399385562 0.0 - - - - - - - 239.73333333333332 10 15 IL2RB interleukin 2 receptor, beta 1157 148 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47778.[MT7]-WLSSPFPSSSFSPGGLAPEISPLEVLER.3y8_1.heavy 1044.21 / 942.526 3349.0 49.53897476196289 39 13 10 6 10 1.5280217888235315 44.71761670775481 0.0345001220703125 3 0.9197766235202934 4.327776746324748 3349.0 6.83268956849602 0.0 - - - - - - - 217.0 6 14 IL2RB interleukin 2 receptor, beta 1159 148 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47778.[MT7]-WLSSPFPSSSFSPGGLAPEISPLEVLER.3y9_1.heavy 1044.21 / 1055.61 1426.0 49.53897476196289 39 13 10 6 10 1.5280217888235315 44.71761670775481 0.0345001220703125 3 0.9197766235202934 4.327776746324748 1426.0 10.004999999999999 0.0 - - - - - - - 205.375 2 16 IL2RB interleukin 2 receptor, beta 1161 149 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47777.[MT7]-WLSSPFPSSSFSPGGLAPEISPLEVLER.4y8_1.heavy 783.411 / 942.526 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1163 149 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47777.[MT7]-WLSSPFPSSSFSPGGLAPEISPLEVLER.4b4_1.heavy 783.411 / 618.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1165 149 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47777.[MT7]-WLSSPFPSSSFSPGGLAPEISPLEVLER.4y7_1.heavy 783.411 / 855.493 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1167 149 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47777.[MT7]-WLSSPFPSSSFSPGGLAPEISPLEVLER.4b6_1.heavy 783.411 / 862.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1169 150 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57623.[MT7]-SELLLSEK[MT7].2y4_1.heavy 603.863 / 620.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1171 150 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57623.[MT7]-SELLLSEK[MT7].2y5_1.heavy 603.863 / 733.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1173 150 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57623.[MT7]-SELLLSEK[MT7].2b4_1.heavy 603.863 / 587.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1175 150 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57623.[MT7]-SELLLSEK[MT7].2y3_1.heavy 603.863 / 507.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1177 151 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47637.[MT7]-QLQVVPLFGDMQIELAR.3b4_1.heavy 701.058 / 613.379 3580.0 47.39472579956055 40 14 10 6 10 1.14581014775218 54.26903465089803 0.0363006591796875 3 0.943237535537165 5.15532118097133 3580.0 22.31906976744186 0.0 - - - - - - - 176.23076923076923 7 13 CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1179 151 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47637.[MT7]-QLQVVPLFGDMQIELAR.3b5_1.heavy 701.058 / 712.447 2792.0 47.39472579956055 40 14 10 6 10 1.14581014775218 54.26903465089803 0.0363006591796875 3 0.943237535537165 5.15532118097133 2792.0 26.943776223776222 0.0 - - - - - - - 170.76923076923077 5 13 CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1181 151 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47637.[MT7]-QLQVVPLFGDMQIELAR.3b3_1.heavy 701.058 / 514.311 2506.0 47.39472579956055 40 14 10 6 10 1.14581014775218 54.26903465089803 0.0363006591796875 3 0.943237535537165 5.15532118097133 2506.0 18.882418604651164 0.0 - - - - - - - 203.84615384615384 5 13 CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1183 151 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47637.[MT7]-QLQVVPLFGDMQIELAR.3y9_1.heavy 701.058 / 1032.51 1360.0 47.39472579956055 40 14 10 6 10 1.14581014775218 54.26903465089803 0.0363006591796875 3 0.943237535537165 5.15532118097133 1360.0 34.0 0.0 - - - - - - - 102.57142857142857 2 7 CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1185 152 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47774.[MT7]-DAIVTIVSAMSTIIPPVPLANPENQFR.4b5_1.heavy 760.168 / 644.374 3122.0 49.98630142211914 48 18 10 10 10 3.867105513802169 25.85913408441737 0.0 3 0.9850008486255818 10.064325850398147 3122.0 12.00769230769231 0.0 - - - - - - - 141.8181818181818 6 11 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1187 152 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47774.[MT7]-DAIVTIVSAMSTIIPPVPLANPENQFR.4y10_1.heavy 760.168 / 1185.6 N/A 49.98630142211914 48 18 10 10 10 3.867105513802169 25.85913408441737 0.0 3 0.9850008486255818 10.064325850398147 104.0 2.0 6.0 - - - - - - - 0.0 0 0 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1189 152 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47774.[MT7]-DAIVTIVSAMSTIIPPVPLANPENQFR.4b6_1.heavy 760.168 / 757.458 1457.0 49.98630142211914 48 18 10 10 10 3.867105513802169 25.85913408441737 0.0 3 0.9850008486255818 10.064325850398147 1457.0 32.222115384615385 0.0 - - - - - - - 69.33333333333333 2 9 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1191 152 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47774.[MT7]-DAIVTIVSAMSTIIPPVPLANPENQFR.4b4_1.heavy 760.168 / 543.326 4735.0 49.98630142211914 48 18 10 10 10 3.867105513802169 25.85913408441737 0.0 3 0.9850008486255818 10.064325850398147 4735.0 37.940705128205124 0.0 - - - - - - - 113.45454545454545 9 11 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1193 153 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47773.[MT7]-DAIVTIVSAMSTIIPPVPLANPENQFR.3b6_1.heavy 1013.22 / 757.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1195 153 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47773.[MT7]-DAIVTIVSAMSTIIPPVPLANPENQFR.3b4_1.heavy 1013.22 / 543.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1197 153 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47773.[MT7]-DAIVTIVSAMSTIIPPVPLANPENQFR.3b5_1.heavy 1013.22 / 644.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1199 153 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47773.[MT7]-DAIVTIVSAMSTIIPPVPLANPENQFR.3y10_1.heavy 1013.22 / 1185.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1201 154 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57824.[MT7]-LENSIIPVHK[MT7].2b3_1.heavy 719.437 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1203 154 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57824.[MT7]-LENSIIPVHK[MT7].2y4_1.heavy 719.437 / 624.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1205 154 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57824.[MT7]-LENSIIPVHK[MT7].2b4_1.heavy 719.437 / 588.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1207 154 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57824.[MT7]-LENSIIPVHK[MT7].2b6_1.heavy 719.437 / 814.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1209 155 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538591.[MT7]-VMTVSFHK[MT7].3y6_1.heavy 412.905 / 862.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC1;HDAC2;HDAC3 histone deacetylase 1;histone deacetylase 2;histone deacetylase 3 1211 155 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538591.[MT7]-VMTVSFHK[MT7].3b3_1.heavy 412.905 / 476.266 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC1;HDAC2;HDAC3 histone deacetylase 1;histone deacetylase 2;histone deacetylase 3 1213 156 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538895.[MT7]-AEVWLFLK[MT7].2y4_1.heavy 647.394 / 664.451 2156.0 44.11667537689209 41 18 10 3 10 4.4693209269663186 17.747547271675725 0.07590103149414062 3 0.9893107729721311 11.926186673363926 2156.0 7.44550847457627 0.0 - - - - - - - 229.06666666666666 4 15 INHBA inhibin, beta A 1215 156 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538895.[MT7]-AEVWLFLK[MT7].2y5_1.heavy 647.394 / 850.531 2762.0 44.11667537689209 41 18 10 3 10 4.4693209269663186 17.747547271675725 0.07590103149414062 3 0.9893107729721311 11.926186673363926 2762.0 20.489644297763114 0.0 - - - - - - - 112.0 5 12 INHBA inhibin, beta A 1217 156 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538895.[MT7]-AEVWLFLK[MT7].2b4_1.heavy 647.394 / 630.337 1684.0 44.11667537689209 41 18 10 3 10 4.4693209269663186 17.747547271675725 0.07590103149414062 3 0.9893107729721311 11.926186673363926 1684.0 5.8356435643564355 1.0 - - - - - - - 241.0 3 19 INHBA inhibin, beta A 1219 156 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538895.[MT7]-AEVWLFLK[MT7].2y3_1.heavy 647.394 / 551.367 3637.0 44.11667537689209 41 18 10 3 10 4.4693209269663186 17.747547271675725 0.07590103149414062 3 0.9893107729721311 11.926186673363926 3637.0 22.20522641280487 0.0 - - - - - - - 209.94117647058823 7 17 INHBA inhibin, beta A 1221 157 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58960.[MT7]-NK[MT7]LPGLITSMETIGAK[MT7].4y4_1.heavy 527.065 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1223 157 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58960.[MT7]-NK[MT7]LPGLITSMETIGAK[MT7].4b5_1.heavy 527.065 / 798.508 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1225 157 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58960.[MT7]-NK[MT7]LPGLITSMETIGAK[MT7].4y3_1.heavy 527.065 / 419.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1227 157 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58960.[MT7]-NK[MT7]LPGLITSMETIGAK[MT7].4b3_1.heavy 527.065 / 644.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1229 158 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59827.[MT7]-GYISPYFINTSK[MT7].2y8_1.heavy 839.458 / 1113.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1231 158 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59827.[MT7]-GYISPYFINTSK[MT7].2y9_1.heavy 839.458 / 1200.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1233 158 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59827.[MT7]-GYISPYFINTSK[MT7].2b4_1.heavy 839.458 / 565.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1235 158 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59827.[MT7]-GYISPYFINTSK[MT7].2y6_1.heavy 839.458 / 853.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1237 159 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58834.[MT7]-EHIEQQIQTYQR.3y6_1.heavy 572.964 / 808.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1239 159 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58834.[MT7]-EHIEQQIQTYQR.3b4_1.heavy 572.964 / 653.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1241 159 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58834.[MT7]-EHIEQQIQTYQR.3y4_1.heavy 572.964 / 567.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1243 159 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58834.[MT7]-EHIEQQIQTYQR.3y5_1.heavy 572.964 / 695.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1245 160 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 126714.0 35.806800842285156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 126714.0 104.66835593861069 0.0 - - - - - - - 243.0 253 13 1247 160 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 326555.0 35.806800842285156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 326555.0 230.73929836712318 0.0 - - - - - - - 270.0 653 15 1249 160 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 276940.0 35.806800842285156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 276940.0 283.78999527864227 0.0 - - - - - - - 223.94117647058823 553 17 1251 161 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59532.[MT7]-AWAIPDTEQR.2y4_1.heavy 665.847 / 533.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1253 161 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59532.[MT7]-AWAIPDTEQR.2y8_1.heavy 665.847 / 929.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1255 161 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59532.[MT7]-AWAIPDTEQR.2y9_1.heavy 665.847 / 1115.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1257 161 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59532.[MT7]-AWAIPDTEQR.2y6_1.heavy 665.847 / 745.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1259 162 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47787.[MT7]-LLIDWPTPEDPEPLVISEVLHQVTPVFR.4y4_1.heavy 846.715 / 518.308 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 1261 162 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47787.[MT7]-LLIDWPTPEDPEPLVISEVLHQVTPVFR.4y9_1.heavy 846.715 / 1096.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 1263 162 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47787.[MT7]-LLIDWPTPEDPEPLVISEVLHQVTPVFR.4b4_1.heavy 846.715 / 599.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 1265 162 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47787.[MT7]-LLIDWPTPEDPEPLVISEVLHQVTPVFR.4y6_1.heavy 846.715 / 718.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 1267 163 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57815.[MT7]-LEEYLGSMAK[MT7].2b3_1.heavy 714.886 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1269 163 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57815.[MT7]-LEEYLGSMAK[MT7].2y5_1.heavy 714.886 / 637.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1271 163 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57815.[MT7]-LEEYLGSMAK[MT7].2b4_1.heavy 714.886 / 679.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1273 163 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57815.[MT7]-LEEYLGSMAK[MT7].2y6_1.heavy 714.886 / 750.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1275 164 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57814.[MT7]-RPDVTQPVPK[MT7].3y6_1.heavy 475.62 / 813.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1277 164 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57814.[MT7]-RPDVTQPVPK[MT7].3b6_1.heavy 475.62 / 841.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1279 164 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57814.[MT7]-RPDVTQPVPK[MT7].3b5_1.heavy 475.62 / 713.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1281 164 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57814.[MT7]-RPDVTQPVPK[MT7].3b3_1.heavy 475.62 / 513.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1283 165 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47785.[MT7]-LLIDWPTPEDPEPLVISEVLHQVTPVFR.3b4_1.heavy 1128.62 / 599.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 1285 165 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47785.[MT7]-LLIDWPTPEDPEPLVISEVLHQVTPVFR.3b5_1.heavy 1128.62 / 785.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 1287 165 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47785.[MT7]-LLIDWPTPEDPEPLVISEVLHQVTPVFR.3b3_1.heavy 1128.62 / 484.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 1289 165 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47785.[MT7]-LLIDWPTPEDPEPLVISEVLHQVTPVFR.3y4_1.heavy 1128.62 / 518.308 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB2 interleukin 12 receptor, beta 2 1291 166 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539859.[MT7]-TVEVLEPEVTK[MT7].3b4_1.heavy 511.299 / 573.336 69411.0 30.512500762939453 48 18 10 10 10 7.211808772261921 13.866146920675472 0.0 3 0.9874144404249261 10.989288212984867 69411.0 72.6414947188636 0.0 - - - - - - - 791.0 138 9 CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1293 166 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539859.[MT7]-TVEVLEPEVTK[MT7].3b5_1.heavy 511.299 / 686.42 26696.0 30.512500762939453 48 18 10 10 10 7.211808772261921 13.866146920675472 0.0 3 0.9874144404249261 10.989288212984867 26696.0 53.52557170077903 0.0 - - - - - - - 655.75 53 8 CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1295 166 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539859.[MT7]-TVEVLEPEVTK[MT7].3y4_1.heavy 511.299 / 620.374 15362.0 30.512500762939453 48 18 10 10 10 7.211808772261921 13.866146920675472 0.0 3 0.9874144404249261 10.989288212984867 15362.0 19.215062202931122 0.0 - - - - - - - 721.3 30 10 CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1297 166 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539859.[MT7]-TVEVLEPEVTK[MT7].3y5_1.heavy 511.299 / 717.426 36719.0 30.512500762939453 48 18 10 10 10 7.211808772261921 13.866146920675472 0.0 3 0.9874144404249261 10.989288212984867 36719.0 73.62172112979118 0.0 - - - - - - - 203.08333333333334 73 12 CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1299 167 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47784.[MT7]-DWDPQPLGPPTPGVPDLVDFQPPPELVLR.3b5_1.heavy 1112.59 / 786.354 8034.0 47.57254981994629 41 15 10 6 10 1.904094400437478 45.68606623219043 0.035503387451171875 3 0.9543566448486164 5.754501421650766 8034.0 16.783973521477414 0.0 - - - - - - - 211.23529411764707 16 17 IL2RB interleukin 2 receptor, beta 1301 167 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47784.[MT7]-DWDPQPLGPPTPGVPDLVDFQPPPELVLR.3b3_1.heavy 1112.59 / 561.242 11557.0 47.57254981994629 41 15 10 6 10 1.904094400437478 45.68606623219043 0.035503387451171875 3 0.9543566448486164 5.754501421650766 11557.0 85.85280024773805 0.0 - - - - - - - 248.86666666666667 23 15 IL2RB interleukin 2 receptor, beta 1303 167 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47784.[MT7]-DWDPQPLGPPTPGVPDLVDFQPPPELVLR.3y8_1.heavy 1112.59 / 920.556 16843.0 47.57254981994629 41 15 10 6 10 1.904094400437478 45.68606623219043 0.035503387451171875 3 0.9543566448486164 5.754501421650766 16843.0 41.729229314420806 0.0 - - - - - - - 238.30769230769232 33 13 IL2RB interleukin 2 receptor, beta 1305 167 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47784.[MT7]-DWDPQPLGPPTPGVPDLVDFQPPPELVLR.3y10_1.heavy 1112.59 / 1195.68 1339.0 47.57254981994629 41 15 10 6 10 1.904094400437478 45.68606623219043 0.035503387451171875 3 0.9543566448486164 5.754501421650766 1339.0 1.266193853427896 0.0 - - - - - - - 187.58333333333334 2 12 IL2RB interleukin 2 receptor, beta 1307 168 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541616.[MT7]-EQPTQLELPEGC[CAM]QGLAPGTEVTYR.3b5_1.heavy 939.8 / 728.37 10531.0 33.84409999847412 43 17 10 6 10 2.7726522765349904 28.148901601256444 0.035198211669921875 3 0.9783158253977485 8.365713878829453 10531.0 25.217911877394634 0.0 - - - - - - - 229.92857142857142 21 14 IL12RB1 interleukin 12 receptor, beta 1 1309 168 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541616.[MT7]-EQPTQLELPEGC[CAM]QGLAPGTEVTYR.3b8_1.heavy 939.8 / 1083.58 25588.0 33.84409999847412 43 17 10 6 10 2.7726522765349904 28.148901601256444 0.035198211669921875 3 0.9783158253977485 8.365713878829453 25588.0 92.72790549169859 0.0 - - - - - - - 229.92857142857142 51 14 IL12RB1 interleukin 12 receptor, beta 1 1311 168 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541616.[MT7]-EQPTQLELPEGC[CAM]QGLAPGTEVTYR.3y8_1.heavy 939.8 / 922.463 46215.0 33.84409999847412 43 17 10 6 10 2.7726522765349904 28.148901601256444 0.035198211669921875 3 0.9783158253977485 8.365713878829453 46215.0 43.960438114318464 0.0 - - - - - - - 758.1428571428571 92 7 IL12RB1 interleukin 12 receptor, beta 1 1313 168 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541616.[MT7]-EQPTQLELPEGC[CAM]QGLAPGTEVTYR.3b7_1.heavy 939.8 / 970.496 22890.0 33.84409999847412 43 17 10 6 10 2.7726522765349904 28.148901601256444 0.035198211669921875 3 0.9783158253977485 8.365713878829453 22890.0 56.70216622458001 0.0 - - - - - - - 165.3 45 10 IL12RB1 interleukin 12 receptor, beta 1 1315 169 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57913.[MT7]-RAPYWTNTEK[MT7].3y3_1.heavy 518.615 / 521.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 1317 169 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57913.[MT7]-RAPYWTNTEK[MT7].3b5_1.heavy 518.615 / 818.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 1319 169 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57913.[MT7]-RAPYWTNTEK[MT7].3y4_1.heavy 518.615 / 635.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 1321 169 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57913.[MT7]-RAPYWTNTEK[MT7].3y5_1.heavy 518.615 / 736.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 1323 170 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538074.[MT7]-GANPVEIR.2y5_1.heavy 500.289 / 613.367 17133.0 22.833599090576172 44 14 10 10 10 2.1869633721592683 35.520829470325765 0.0 3 0.936670184585766 4.8779707398810634 17133.0 11.830367316404551 1.0 - - - - - - - 364.0 34 2 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1325 170 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538074.[MT7]-GANPVEIR.2b6_1.heavy 500.289 / 712.375 22620.0 22.833599090576172 44 14 10 10 10 2.1869633721592683 35.520829470325765 0.0 3 0.936670184585766 4.8779707398810634 22620.0 55.794982079932176 1.0 - - - - - - - 609.0 50 8 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1327 170 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538074.[MT7]-GANPVEIR.2y6_1.heavy 500.289 / 727.41 7279.0 22.833599090576172 44 14 10 10 10 2.1869633721592683 35.520829470325765 0.0 3 0.936670184585766 4.8779707398810634 7279.0 23.444051948051946 0.0 - - - - - - - 566.2222222222222 14 9 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1329 170 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538074.[MT7]-GANPVEIR.2b5_1.heavy 500.289 / 583.332 5991.0 22.833599090576172 44 14 10 10 10 2.1869633721592683 35.520829470325765 0.0 3 0.936670184585766 4.8779707398810634 5991.0 25.541986607142857 1.0 - - - - - - - 280.0 32 14 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1331 171 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57911.[MT7]-VNFHMFDVGGQR.3y7_1.heavy 517.593 / 778.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL;GNAS guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;GNAS complex locus 1333 171 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57911.[MT7]-VNFHMFDVGGQR.3y6_1.heavy 517.593 / 631.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL;GNAS guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;GNAS complex locus 1335 171 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57911.[MT7]-VNFHMFDVGGQR.3b3_1.heavy 517.593 / 505.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL;GNAS guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;GNAS complex locus 1337 171 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57911.[MT7]-VNFHMFDVGGQR.3y8_1.heavy 517.593 / 909.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL;GNAS guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;GNAS complex locus 1339 172 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57916.[MT7]-YAPLHLVPLIER.3b4_1.heavy 522.316 / 589.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1341 172 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57916.[MT7]-YAPLHLVPLIER.3b3_1.heavy 522.316 / 476.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1343 172 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57916.[MT7]-YAPLHLVPLIER.3y4_1.heavy 522.316 / 530.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1345 172 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57916.[MT7]-YAPLHLVPLIER.3y5_1.heavy 522.316 / 627.382 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1347 173 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46918.[MT7]-FISELAR.2y5_1.heavy 490.288 / 575.315 N/A 32.854634602864586 33 20 0 5 8 7.061781176734819 14.160733318875986 0.044200897216796875 4 0.9976702676566487 25.563775998787694 10455.0 8.631053721962244 4.0 - - - - - - - 357.0 235 1 CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1349 173 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46918.[MT7]-FISELAR.2b4_1.heavy 490.288 / 621.336 5719.0 32.854634602864586 33 20 0 5 8 7.061781176734819 14.160733318875986 0.044200897216796875 4 0.9976702676566487 25.563775998787694 5719.0 17.252118418137247 0.0 - - - - - - - 255.21428571428572 11 14 CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1351 173 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46918.[MT7]-FISELAR.2y6_1.heavy 490.288 / 688.399 18319.0 32.854634602864586 33 20 0 5 8 7.061781176734819 14.160733318875986 0.044200897216796875 4 0.9976702676566487 25.563775998787694 18319.0 80.70327882645594 0.0 - - - - - - - 277.0 36 10 CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1353 173 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB46918.[MT7]-FISELAR.2b5_1.heavy 490.288 / 734.42 3843.0 32.854634602864586 33 20 0 5 8 7.061781176734819 14.160733318875986 0.044200897216796875 4 0.9976702676566487 25.563775998787694 3843.0 17.24228076868056 1.0 - - - - - - - 273.625 31 16 CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1355 174 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58970.[MT7]-EK[MT7]LEFILAAHRPAC[CAM]K[MT7].4y4_1.heavy 554.574 / 619.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1357 174 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58970.[MT7]-EK[MT7]LEFILAAHRPAC[CAM]K[MT7].4y8_2.heavy 554.574 / 527.789 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1359 174 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58970.[MT7]-EK[MT7]LEFILAAHRPAC[CAM]K[MT7].4y9_2.heavy 554.574 / 584.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1361 174 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58970.[MT7]-EK[MT7]LEFILAAHRPAC[CAM]K[MT7].4b4_1.heavy 554.574 / 788.476 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1363 175 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59164.[MT7]-DDATEK[MT7].2y4_1.heavy 483.753 / 592.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 1365 175 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59164.[MT7]-DDATEK[MT7].2y5_1.heavy 483.753 / 707.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 1367 175 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59164.[MT7]-DDATEK[MT7].2y3_1.heavy 483.753 / 521.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 1369 175 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59164.[MT7]-DDATEK[MT7].2b5_1.heavy 483.753 / 676.291 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 1371 176 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57401.[MT7]-EHFHK[MT7].2y4_1.heavy 493.277 / 712.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1373 176 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57401.[MT7]-EHFHK[MT7].2b3_1.heavy 493.277 / 558.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1375 176 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57401.[MT7]-EHFHK[MT7].2b4_1.heavy 493.277 / 695.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1377 176 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57401.[MT7]-EHFHK[MT7].2y3_1.heavy 493.277 / 575.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1379 177 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 350441.0 38.68920135498047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 350441.0 220.09248695944552 0.0 - - - - - - - 278.2142857142857 700 14 1381 177 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 650499.0 38.68920135498047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 650499.0 291.5065920123488 0.0 - - - - - - - 243.5 1300 8 1383 177 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 760175.0 38.68920135498047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 760175.0 258.0282960390381 0.0 - - - - - - - 288.7142857142857 1520 7 1385 178 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58035.[MT7]-AAVEEGIVLGGGC[CAM]ALLR.3b6_1.heavy 610.341 / 701.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1387 178 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58035.[MT7]-AAVEEGIVLGGGC[CAM]ALLR.3b4_1.heavy 610.341 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1389 178 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58035.[MT7]-AAVEEGIVLGGGC[CAM]ALLR.3y8_1.heavy 610.341 / 803.419 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1391 178 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58035.[MT7]-AAVEEGIVLGGGC[CAM]ALLR.3b7_1.heavy 610.341 / 814.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1393 179 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57800.[MT7]-TMLESLIADK[MT7].3y3_1.heavy 470.27 / 477.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1395 179 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57800.[MT7]-TMLESLIADK[MT7].3b4_1.heavy 470.27 / 619.324 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1397 179 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57800.[MT7]-TMLESLIADK[MT7].3b5_1.heavy 470.27 / 706.356 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1399 179 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57800.[MT7]-TMLESLIADK[MT7].3b3_1.heavy 470.27 / 490.282 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1401 180 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57801.[MT7]-TTEDQGVDEK[MT7].2b4_1.heavy 705.354 / 591.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1403 180 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57801.[MT7]-TTEDQGVDEK[MT7].2b6_1.heavy 705.354 / 776.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1405 180 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57801.[MT7]-TTEDQGVDEK[MT7].2y3_1.heavy 705.354 / 535.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1407 180 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57801.[MT7]-TTEDQGVDEK[MT7].2y6_1.heavy 705.354 / 819.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1409 181 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59016.[MT7]-TEPFDDFLFPASSRPSGSETAR.4y8_1.heavy 640.312 / 804.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1411 181 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59016.[MT7]-TEPFDDFLFPASSRPSGSETAR.4b5_1.heavy 640.312 / 734.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1413 181 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59016.[MT7]-TEPFDDFLFPASSRPSGSETAR.4y7_1.heavy 640.312 / 707.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1415 181 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59016.[MT7]-TEPFDDFLFPASSRPSGSETAR.4b6_1.heavy 640.312 / 849.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1417 182 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57745.[MT7]-LLLLGAGESGK[MT7].2y8_1.heavy 673.418 / 862.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 1419 182 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57745.[MT7]-LLLLGAGESGK[MT7].2y5_1.heavy 673.418 / 621.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 1421 182 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57745.[MT7]-LLLLGAGESGK[MT7].2y9_1.heavy 673.418 / 975.559 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 1423 182 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57745.[MT7]-LLLLGAGESGK[MT7].2y7_1.heavy 673.418 / 749.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 1425 183 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538575.[MT7]-EQEDVLQTL.2b3_1.heavy 609.82 / 531.253 7710.0 37.082000732421875 38 8 10 10 10 0.6095577802844111 87.86946685741563 0.0 3 0.7710966977912785 2.5286031640968556 7710.0 13.214696400558411 0.0 - - - - - - - 812.4444444444445 15 9 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 1427 183 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538575.[MT7]-EQEDVLQTL.2b4_1.heavy 609.82 / 646.28 56278.0 37.082000732421875 38 8 10 10 10 0.6095577802844111 87.86946685741563 0.0 3 0.7710966977912785 2.5286031640968556 56278.0 48.95217956898411 0.0 - - - - - - - 477.0 112 1 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 1429 183 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538575.[MT7]-EQEDVLQTL.2b6_1.heavy 609.82 / 858.432 59935.0 37.082000732421875 38 8 10 10 10 0.6095577802844111 87.86946685741563 0.0 3 0.7710966977912785 2.5286031640968556 59935.0 74.9979557414322 0.0 - - - - - - - 397.25 119 4 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 1431 183 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538575.[MT7]-EQEDVLQTL.2b5_1.heavy 609.82 / 745.349 106436.0 37.082000732421875 38 8 10 10 10 0.6095577802844111 87.86946685741563 0.0 3 0.7710966977912785 2.5286031640968556 106436.0 105.08990322454483 0.0 - - - - - - - 894.25 212 4 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 1433 184 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59947.[MT7]-VMAIQDFK[MT7]PFENLR.3b6_1.heavy 666.036 / 802.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1435 184 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59947.[MT7]-VMAIQDFK[MT7]PFENLR.3y6_1.heavy 666.036 / 775.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1437 184 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59947.[MT7]-VMAIQDFK[MT7]PFENLR.3y11_2.heavy 666.036 / 775.926 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1439 184 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59947.[MT7]-VMAIQDFK[MT7]PFENLR.3y8_2.heavy 666.036 / 597.841 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1441 185 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538776.[MT7]-VLTSGIFETR.2y8_1.heavy 633.862 / 910.463 15438.0 35.8838005065918 48 18 10 10 10 4.684305659539416 21.347881045369803 0.0 3 0.9876027605984582 11.072614539847418 15438.0 112.27636363636364 0.0 - - - - - - - 247.78571428571428 30 14 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1443 185 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538776.[MT7]-VLTSGIFETR.2y9_1.heavy 633.862 / 1023.55 19484.0 35.8838005065918 48 18 10 10 10 4.684305659539416 21.347881045369803 0.0 3 0.9876027605984582 11.072614539847418 19484.0 157.0013829334507 0.0 - - - - - - - 223.52941176470588 38 17 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1445 185 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538776.[MT7]-VLTSGIFETR.2b5_1.heavy 633.862 / 602.363 3715.0 35.8838005065918 48 18 10 10 10 4.684305659539416 21.347881045369803 0.0 3 0.9876027605984582 11.072614539847418 3715.0 5.214329962796621 1.0 - - - - - - - 825.7142857142857 7 7 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1447 185 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538776.[MT7]-VLTSGIFETR.2y7_1.heavy 633.862 / 809.415 10815.0 35.8838005065918 48 18 10 10 10 4.684305659539416 21.347881045369803 0.0 3 0.9876027605984582 11.072614539847418 10815.0 84.60120967741935 0.0 - - - - - - - 235.92857142857142 21 14 GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1449 186 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47753.[MT7]-TFDSLIQDALDGLMLEGENIVSAAR.3b5_1.heavy 941.484 / 708.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1451 186 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47753.[MT7]-TFDSLIQDALDGLMLEGENIVSAAR.3b3_1.heavy 941.484 / 508.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1453 186 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47753.[MT7]-TFDSLIQDALDGLMLEGENIVSAAR.3b8_1.heavy 941.484 / 1064.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1455 186 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47753.[MT7]-TFDSLIQDALDGLMLEGENIVSAAR.3y9_1.heavy 941.484 / 916.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1457 187 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57600.[MT7]-RVEELQNR.2b3_1.heavy 594.334 / 529.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 1459 187 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57600.[MT7]-RVEELQNR.2y4_1.heavy 594.334 / 530.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 1461 187 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57600.[MT7]-RVEELQNR.2b4_1.heavy 594.334 / 658.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 1463 187 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57600.[MT7]-RVEELQNR.2y7_1.heavy 594.334 / 887.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 1465 188 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59941.[MT7]-K[MT7]K[MT7]GGGEGGAGADEEK[MT7].3b10_2.heavy 656.028 / 616.36 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1467 188 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59941.[MT7]-K[MT7]K[MT7]GGGEGGAGADEEK[MT7].3b7_2.heavy 656.028 / 523.82 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1469 188 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59941.[MT7]-K[MT7]K[MT7]GGGEGGAGADEEK[MT7].3b8_2.heavy 656.028 / 552.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1471 188 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59941.[MT7]-K[MT7]K[MT7]GGGEGGAGADEEK[MT7].3b12_2.heavy 656.028 / 709.392 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1473 189 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57947.[MT7]-SYGIPYIETSAK[MT7].3b6_1.heavy 539.631 / 825.426 2288.0 38.745500564575195 33 7 10 6 10 0.835109892613986 76.10955936097643 0.036800384521484375 3 0.739032855388892 2.3612246153286836 2288.0 3.8499999999999996 0.0 - - - - - - - 171.2941176470588 4 17 HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 1475 189 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57947.[MT7]-SYGIPYIETSAK[MT7].3b4_1.heavy 539.631 / 565.31 4853.0 38.745500564575195 33 7 10 6 10 0.835109892613986 76.10955936097643 0.036800384521484375 3 0.739032855388892 2.3612246153286836 4853.0 10.61904714188957 0.0 - - - - - - - 287.9230769230769 9 13 HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 1477 189 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57947.[MT7]-SYGIPYIETSAK[MT7].3y4_1.heavy 539.631 / 550.332 2080.0 38.745500564575195 33 7 10 6 10 0.835109892613986 76.10955936097643 0.036800384521484375 3 0.739032855388892 2.3612246153286836 2080.0 8.458483754512635 1.0 - - - - - - - 1149.0 4 7 HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 1479 189 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57947.[MT7]-SYGIPYIETSAK[MT7].3y5_1.heavy 539.631 / 679.374 6932.0 38.745500564575195 33 7 10 6 10 0.835109892613986 76.10955936097643 0.036800384521484375 3 0.739032855388892 2.3612246153286836 6932.0 12.001058663558663 0.0 - - - - - - - 184.83333333333334 13 6 HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 1481 190 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 720194.0 33.907901763916016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 720194.0 1023.2373829276501 0.0 - - - - - - - 874.75 1440 4 1483 190 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 125581.0 33.907901763916016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 125581.0 169.09714335294734 0.0 - - - - - - - 806.5555555555555 251 9 1485 190 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 91300.0 33.907901763916016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 91300.0 124.02924364691725 0.0 - - - - - - - 1199.142857142857 182 7 1487 191 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47656.[MT7]-MEWETPDNQVGAEVQFR.2y4_1.heavy 1090.51 / 549.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1489 191 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47656.[MT7]-MEWETPDNQVGAEVQFR.2b3_1.heavy 1090.51 / 591.272 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1491 191 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47656.[MT7]-MEWETPDNQVGAEVQFR.2y8_1.heavy 1090.51 / 905.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1493 191 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47656.[MT7]-MEWETPDNQVGAEVQFR.2b4_1.heavy 1090.51 / 720.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1495 192 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59847.[MT7]-NQDFMNVYYQIR.2b3_1.heavy 867.923 / 502.238 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1497 192 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59847.[MT7]-NQDFMNVYYQIR.2y8_1.heavy 867.923 / 1086.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1499 192 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59847.[MT7]-NQDFMNVYYQIR.2b4_1.heavy 867.923 / 649.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1501 192 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59847.[MT7]-NQDFMNVYYQIR.2y9_1.heavy 867.923 / 1233.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1503 193 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57602.[MT7]-LSDGVAVLK[MT7].2y4_1.heavy 595.373 / 574.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1505 193 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57602.[MT7]-LSDGVAVLK[MT7].2b4_1.heavy 595.373 / 517.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1507 193 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57602.[MT7]-LSDGVAVLK[MT7].2y3_1.heavy 595.373 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1509 193 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57602.[MT7]-LSDGVAVLK[MT7].2b6_1.heavy 595.373 / 687.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1511 194 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57949.[MT7]-SELIQLVAVTQK[MT7].3y3_1.heavy 539.666 / 520.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1513 194 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57949.[MT7]-SELIQLVAVTQK[MT7].3b4_1.heavy 539.666 / 587.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1515 194 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57949.[MT7]-SELIQLVAVTQK[MT7].3b5_1.heavy 539.666 / 715.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1517 194 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57949.[MT7]-SELIQLVAVTQK[MT7].3y5_1.heavy 539.666 / 690.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1519 195 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537506.[MT7]-STIVK[MT7].2b3_1.heavy 418.278 / 446.273 6095.0 18.521099090576172 50 20 10 10 10 6.373138567414848 15.690856073848595 0.0 3 0.990494139687914 12.648004924993865 6095.0 32.45092087953392 0.0 - - - - - - - 247.52380952380952 12 21 C2CD4C;GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAZ;GNAT3 C2 calcium-dependent domain containing 4C;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha z polypeptide;guanine nucleotide binding protein, alpha transducing 3 1521 195 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537506.[MT7]-STIVK[MT7].2y4_1.heavy 418.278 / 604.415 15785.0 18.521099090576172 50 20 10 10 10 6.373138567414848 15.690856073848595 0.0 3 0.990494139687914 12.648004924993865 15785.0 61.002515917632785 0.0 - - - - - - - 202.76190476190476 31 21 C2CD4C;GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAZ;GNAT3 C2 calcium-dependent domain containing 4C;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha z polypeptide;guanine nucleotide binding protein, alpha transducing 3 1523 195 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537506.[MT7]-STIVK[MT7].2b4_1.heavy 418.278 / 545.341 3790.0 18.521099090576172 50 20 10 10 10 6.373138567414848 15.690856073848595 0.0 3 0.990494139687914 12.648004924993865 3790.0 11.009957930442061 0.0 - - - - - - - 664.2666666666667 7 15 C2CD4C;GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAZ;GNAT3 C2 calcium-dependent domain containing 4C;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha z polypeptide;guanine nucleotide binding protein, alpha transducing 3 1525 195 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537506.[MT7]-STIVK[MT7].2y3_1.heavy 418.278 / 503.367 N/A 18.521099090576172 50 20 10 10 10 6.373138567414848 15.690856073848595 0.0 3 0.990494139687914 12.648004924993865 9416.0 3.5657015973390553 1.0 - - - - - - - 1188.857142857143 18 7 C2CD4C;GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAZ;GNAT3 C2 calcium-dependent domain containing 4C;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha z polypeptide;guanine nucleotide binding protein, alpha transducing 3 1527 196 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58177.[MT7]-DFLNR.2b3_1.heavy 404.725 / 520.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCA4;PAK1;PAK2;PAK3;TRIM26 ATP-binding cassette, sub-family A (ABC1), member 4;p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3;tripartite motif-containing 26 1529 196 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58177.[MT7]-DFLNR.2y4_1.heavy 404.725 / 549.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCA4;PAK1;PAK2;PAK3;TRIM26 ATP-binding cassette, sub-family A (ABC1), member 4;p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3;tripartite motif-containing 26 1531 196 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58177.[MT7]-DFLNR.2b4_1.heavy 404.725 / 634.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCA4;PAK1;PAK2;PAK3;TRIM26 ATP-binding cassette, sub-family A (ABC1), member 4;p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3;tripartite motif-containing 26 1533 196 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58177.[MT7]-DFLNR.2y3_1.heavy 404.725 / 402.246 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCA4;PAK1;PAK2;PAK3;TRIM26 ATP-binding cassette, sub-family A (ABC1), member 4;p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3;tripartite motif-containing 26 1535 197 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47757.[MT7]-RAEMNELMEQTSEIITFAESGTAR.4b7_1.heavy 715.35 / 988.5 928.0 47.440101623535156 39 9 10 10 10 1.4884299529309695 52.89454358984864 0.0 3 0.8146886236761132 2.8213985851924046 928.0 25.55267605633803 0.0 - - - - - - - 0.0 1 0 INHBA inhibin, beta A 1537 197 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47757.[MT7]-RAEMNELMEQTSEIITFAESGTAR.4y9_1.heavy 715.35 / 939.453 2212.0 47.440101623535156 39 9 10 10 10 1.4884299529309695 52.89454358984864 0.0 3 0.8146886236761132 2.8213985851924046 2212.0 43.20295479168718 0.0 - - - - - - - 193.5 4 14 INHBA inhibin, beta A 1539 197 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47757.[MT7]-RAEMNELMEQTSEIITFAESGTAR.4b13_2.heavy 715.35 / 847.386 3212.0 47.440101623535156 39 9 10 10 10 1.4884299529309695 52.89454358984864 0.0 3 0.8146886236761132 2.8213985851924046 3212.0 25.00241023118544 0.0 - - - - - - - 197.46153846153845 6 13 INHBA inhibin, beta A 1541 197 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47757.[MT7]-RAEMNELMEQTSEIITFAESGTAR.4b6_1.heavy 715.35 / 875.416 928.0 47.440101623535156 39 9 10 10 10 1.4884299529309695 52.89454358984864 0.0 3 0.8146886236761132 2.8213985851924046 928.0 7.473183658446816 0.0 - - - - - - - 0.0 1 0 INHBA inhibin, beta A 1543 198 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57943.[MT7]-FQELVLPHFGK[MT7].3b4_1.heavy 534.98 / 662.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 1545 198 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57943.[MT7]-FQELVLPHFGK[MT7].3b5_1.heavy 534.98 / 761.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 1547 198 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57943.[MT7]-FQELVLPHFGK[MT7].3b3_1.heavy 534.98 / 549.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 1549 198 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57943.[MT7]-FQELVLPHFGK[MT7].3y5_1.heavy 534.98 / 729.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 1551 199 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47390.[MT7]-TVEVLEPEVTK[MT7].2y5_1.heavy 766.445 / 717.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1553 199 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47390.[MT7]-TVEVLEPEVTK[MT7].2b4_1.heavy 766.445 / 573.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1555 199 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47390.[MT7]-TVEVLEPEVTK[MT7].2b6_1.heavy 766.445 / 815.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1557 199 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47390.[MT7]-TVEVLEPEVTK[MT7].2y7_1.heavy 766.445 / 959.553 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1559 200 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539880.[MT7]-FSVEQLGQDGRR.3y11_2.heavy 512.606 / 622.821 26534.0 28.085500717163086 42 12 10 10 10 0.9378331303577034 63.941238990145564 0.0 3 0.8921510086092185 3.7236734438268564 26534.0 49.610028699129614 0.0 - - - - - - - 747.6666666666666 53 9 IL12RB1 interleukin 12 receptor, beta 1 1561 200 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539880.[MT7]-FSVEQLGQDGRR.3b4_1.heavy 512.606 / 607.321 20445.0 28.085500717163086 42 12 10 10 10 0.9378331303577034 63.941238990145564 0.0 3 0.8921510086092185 3.7236734438268564 20445.0 30.16927290809506 0.0 - - - - - - - 794.6 40 10 IL12RB1 interleukin 12 receptor, beta 1 1563 200 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539880.[MT7]-FSVEQLGQDGRR.3b5_1.heavy 512.606 / 735.379 17240.0 28.085500717163086 42 12 10 10 10 0.9378331303577034 63.941238990145564 0.0 3 0.8921510086092185 3.7236734438268564 17240.0 29.22693512421225 0.0 - - - - - - - 626.7777777777778 34 9 IL12RB1 interleukin 12 receptor, beta 1 1565 200 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539880.[MT7]-FSVEQLGQDGRR.3b3_1.heavy 512.606 / 478.278 12690.0 28.085500717163086 42 12 10 10 10 0.9378331303577034 63.941238990145564 0.0 3 0.8921510086092185 3.7236734438268564 12690.0 11.382729938503465 0.0 - - - - - - - 1773.3333333333333 25 9 IL12RB1 interleukin 12 receptor, beta 1 1567 201 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538040.[MT7]-TQLPLDR.2y4_1.heavy 493.791 / 500.283 53669.0 25.72960090637207 44 14 10 10 10 2.105662230644686 47.490997627564994 0.0 3 0.9451917431715332 5.247295959367822 53669.0 78.19055384978743 0.0 - - - - - - - 689.25 107 12 IL12RB2 interleukin 12 receptor, beta 2 1569 201 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538040.[MT7]-TQLPLDR.2y5_1.heavy 493.791 / 613.367 25137.0 25.72960090637207 44 14 10 10 10 2.105662230644686 47.490997627564994 0.0 3 0.9451917431715332 5.247295959367822 25137.0 84.12120183330504 0.0 - - - - - - - 657.2 50 10 IL12RB2 interleukin 12 receptor, beta 2 1571 201 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538040.[MT7]-TQLPLDR.2b6_1.heavy 493.791 / 812.463 25246.0 25.72960090637207 44 14 10 10 10 2.105662230644686 47.490997627564994 0.0 3 0.9451917431715332 5.247295959367822 25246.0 62.47890128981789 0.0 - - - - - - - 294.9230769230769 50 13 IL12RB2 interleukin 12 receptor, beta 2 1573 201 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538040.[MT7]-TQLPLDR.2y6_1.heavy 493.791 / 741.425 47809.0 25.72960090637207 44 14 10 10 10 2.105662230644686 47.490997627564994 0.0 3 0.9451917431715332 5.247295959367822 47809.0 143.05445354652426 0.0 - - - - - - - 273.8 95 15 IL12RB2 interleukin 12 receptor, beta 2 1575 202 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58693.[MT7]-EIGNIISDAMK[MT7].3y3_1.heavy 493.609 / 493.293 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1577 202 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58693.[MT7]-EIGNIISDAMK[MT7].3b4_1.heavy 493.609 / 558.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1579 202 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58693.[MT7]-EIGNIISDAMK[MT7].3b5_1.heavy 493.609 / 671.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1581 202 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58693.[MT7]-EIGNIISDAMK[MT7].3y5_1.heavy 493.609 / 695.351 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1583 203 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57740.[MT7]-ETYGAFLQK[MT7].2y8_1.heavy 672.874 / 1071.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1585 203 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57740.[MT7]-ETYGAFLQK[MT7].2b4_1.heavy 672.874 / 595.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1587 203 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57740.[MT7]-ETYGAFLQK[MT7].2y6_1.heavy 672.874 / 807.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1589 203 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57740.[MT7]-ETYGAFLQK[MT7].2b5_1.heavy 672.874 / 666.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1591 204 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58029.[MT7]-FQITPQYDFEVLR.2y4_1.heavy 900.476 / 516.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL10RB interleukin 10 receptor, beta 1593 204 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58029.[MT7]-FQITPQYDFEVLR.2b3_1.heavy 900.476 / 533.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL10RB interleukin 10 receptor, beta 1595 204 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58029.[MT7]-FQITPQYDFEVLR.2y5_1.heavy 900.476 / 663.382 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL10RB interleukin 10 receptor, beta 1597 204 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58029.[MT7]-FQITPQYDFEVLR.2y9_1.heavy 900.476 / 1166.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL10RB interleukin 10 receptor, beta 1599 205 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57333.[MT7]-SLISVVR.2b3_1.heavy 459.299 / 458.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR1 interferon gamma receptor 1 1601 205 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57333.[MT7]-SLISVVR.2y5_1.heavy 459.299 / 573.372 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR1 interferon gamma receptor 1 1603 205 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57333.[MT7]-SLISVVR.2b4_1.heavy 459.299 / 545.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR1 interferon gamma receptor 1 1605 205 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57333.[MT7]-SLISVVR.2y6_1.heavy 459.299 / 686.456 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR1 interferon gamma receptor 1 1607 206 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57538.[MT7]-DNVEMIK[MT7].2y4_1.heavy 568.815 / 664.382 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPGRIP1L;PLA2G6 RPGRIP1-like;phospholipase A2, group VI (cytosolic, calcium-independent) 1609 206 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57538.[MT7]-DNVEMIK[MT7].2b4_1.heavy 568.815 / 602.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPGRIP1L;PLA2G6 RPGRIP1-like;phospholipase A2, group VI (cytosolic, calcium-independent) 1611 206 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57538.[MT7]-DNVEMIK[MT7].2y3_1.heavy 568.815 / 535.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPGRIP1L;PLA2G6 RPGRIP1-like;phospholipase A2, group VI (cytosolic, calcium-independent) 1613 206 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57538.[MT7]-DNVEMIK[MT7].2b5_1.heavy 568.815 / 733.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPGRIP1L;PLA2G6 RPGRIP1-like;phospholipase A2, group VI (cytosolic, calcium-independent) 1615 207 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57539.[MT7]-ISTATGDGK[MT7].2y4_1.heavy 569.321 / 520.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1617 207 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57539.[MT7]-ISTATGDGK[MT7].2y8_1.heavy 569.321 / 880.449 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1619 207 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57539.[MT7]-ISTATGDGK[MT7].2y5_1.heavy 569.321 / 621.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1621 207 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57539.[MT7]-ISTATGDGK[MT7].2y6_1.heavy 569.321 / 692.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1623 208 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58033.[MT7]-QPPDASPANLLTSLVR.3b6_1.heavy 608.343 / 740.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 1625 208 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58033.[MT7]-QPPDASPANLLTSLVR.3y6_1.heavy 608.343 / 688.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 1627 208 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58033.[MT7]-QPPDASPANLLTSLVR.3y8_1.heavy 608.343 / 915.562 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 1629 208 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58033.[MT7]-QPPDASPANLLTSLVR.3y5_1.heavy 608.343 / 575.351 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 1631 209 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47506.[MT7]-FINMFAVLDELK[MT7].3b6_1.heavy 576.66 / 868.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1633 209 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47506.[MT7]-FINMFAVLDELK[MT7].3b4_1.heavy 576.66 / 650.345 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1635 209 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47506.[MT7]-FINMFAVLDELK[MT7].3b5_1.heavy 576.66 / 797.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1637 209 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47506.[MT7]-FINMFAVLDELK[MT7].3b3_1.heavy 576.66 / 519.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1;CYFIP2 cytoplasmic FMR1 interacting protein 1;cytoplasmic FMR1 interacting protein 2 1639 210 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59936.[MT7]-FFSQLSSEHGGDVQK[MT7].3y3_1.heavy 652.002 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1641 210 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59936.[MT7]-FFSQLSSEHGGDVQK[MT7].3y6_1.heavy 652.002 / 747.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1643 210 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59936.[MT7]-FFSQLSSEHGGDVQK[MT7].3b4_1.heavy 652.002 / 654.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1645 210 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59936.[MT7]-FFSQLSSEHGGDVQK[MT7].3y5_1.heavy 652.002 / 690.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1647 211 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47767.[MT7]-NIINLLGAC[CAM]TQDGPLYVIVEYASK[MT7].3b4_1.heavy 980.531 / 599.363 2831.0 49.98630142211914 46 16 10 10 10 3.3169746571888474 30.14795418568271 0.0 3 0.9674734593592029 6.824316704747767 2831.0 24.688953488372086 0.0 - - - - - - - 70.36363636363636 5 11 FGFR1;FGFR2 fibroblast growth factor receptor 1;fibroblast growth factor receptor 2 1649 211 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47767.[MT7]-NIINLLGAC[CAM]TQDGPLYVIVEYASK[MT7].3y4_1.heavy 980.531 / 612.347 3303.0 49.98630142211914 46 16 10 10 10 3.3169746571888474 30.14795418568271 0.0 3 0.9674734593592029 6.824316704747767 3303.0 15.36279069767442 0.0 - - - - - - - 93.08333333333333 6 12 FGFR1;FGFR2 fibroblast growth factor receptor 1;fibroblast growth factor receptor 2 1651 211 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47767.[MT7]-NIINLLGAC[CAM]TQDGPLYVIVEYASK[MT7].3b7_1.heavy 980.531 / 882.553 1673.0 49.98630142211914 46 16 10 10 10 3.3169746571888474 30.14795418568271 0.0 3 0.9674734593592029 6.824316704747767 1673.0 10.375193798449612 0.0 - - - - - - - 74.27272727272727 3 11 FGFR1;FGFR2 fibroblast growth factor receptor 1;fibroblast growth factor receptor 2 1653 211 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47767.[MT7]-NIINLLGAC[CAM]TQDGPLYVIVEYASK[MT7].3y19_2.heavy 980.531 / 1114.57 1115.0 49.98630142211914 46 16 10 10 10 3.3169746571888474 30.14795418568271 0.0 3 0.9674734593592029 6.824316704747767 1115.0 13.310852713178294 0.0 - - - - - - - 75.25 2 4 FGFR1;FGFR2 fibroblast growth factor receptor 1;fibroblast growth factor receptor 2 1655 212 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539026.[MT7]-YEPPLGDIK[MT7].3y3_1.heavy 440.586 / 519.326 8073.0 31.67484951019287 44 18 10 6 10 6.283890379680467 15.913708540072424 0.03890037536621094 3 0.9820021404841721 9.1854072611781 8073.0 0.8184135985450132 1.0 - - - - - - - 340.3333333333333 16 3 IL12RB1 interleukin 12 receptor, beta 1 1657 212 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539026.[MT7]-YEPPLGDIK[MT7].3y4_1.heavy 440.586 / 576.347 37394.0 31.67484951019287 44 18 10 6 10 6.283890379680467 15.913708540072424 0.03890037536621094 3 0.9820021404841721 9.1854072611781 37394.0 0.5696180357210862 2.0 - - - - - - - 440.75 74 4 IL12RB1 interleukin 12 receptor, beta 1 1659 212 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539026.[MT7]-YEPPLGDIK[MT7].3b3_1.heavy 440.586 / 534.268 59199.0 31.67484951019287 44 18 10 6 10 6.283890379680467 15.913708540072424 0.03890037536621094 3 0.9820021404841721 9.1854072611781 59199.0 51.089176408248164 0.0 - - - - - - - 371.0 118 2 IL12RB1 interleukin 12 receptor, beta 1 1661 212 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539026.[MT7]-YEPPLGDIK[MT7].3y5_1.heavy 440.586 / 689.431 3804.0 31.67484951019287 44 18 10 6 10 6.283890379680467 15.913708540072424 0.03890037536621094 3 0.9820021404841721 9.1854072611781 3804.0 0.8342742790061888 2.0 - - - - - - - 212.14285714285714 11 7 IL12RB1 interleukin 12 receptor, beta 1 1663 213 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57936.[MT7]-SALQTEIANLLK[MT7].3b6_1.heavy 530.322 / 774.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1665 213 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57936.[MT7]-SALQTEIANLLK[MT7].3b4_1.heavy 530.322 / 544.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1667 213 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57936.[MT7]-SALQTEIANLLK[MT7].3y4_1.heavy 530.322 / 631.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1669 213 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57936.[MT7]-SALQTEIANLLK[MT7].3y5_1.heavy 530.322 / 702.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1671 214 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538760.[MT7]-TLHFEISK[MT7].3y3_1.heavy 421.583 / 491.331 147200.0 29.657899856567383 48 18 10 10 10 6.150332324676715 16.259284006292518 0.0 3 0.9883303150251415 11.413255960216244 147200.0 82.94356982756861 0.0 - - - - - - - 208.25 294 4 INHBA inhibin, beta A 1673 214 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538760.[MT7]-TLHFEISK[MT7].3y4_1.heavy 421.583 / 620.374 60833.0 29.657899856567383 48 18 10 10 10 6.150332324676715 16.259284006292518 0.0 3 0.9883303150251415 11.413255960216244 60833.0 821.4312419541178 0.0 - - - - - - - 175.88888888888889 121 9 INHBA inhibin, beta A 1675 214 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538760.[MT7]-TLHFEISK[MT7].3b3_1.heavy 421.583 / 496.3 126589.0 29.657899856567383 48 18 10 10 10 6.150332324676715 16.259284006292518 0.0 3 0.9883303150251415 11.413255960216244 126589.0 121.22829736211031 1.0 - - - - - - - 667.75 253 8 INHBA inhibin, beta A 1677 214 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538760.[MT7]-TLHFEISK[MT7].3y5_1.heavy 421.583 / 767.442 14186.0 29.657899856567383 48 18 10 10 10 6.150332324676715 16.259284006292518 0.0 3 0.9883303150251415 11.413255960216244 14186.0 160.5481437125748 0.0 - - - - - - - 158.4 28 10 INHBA inhibin, beta A 1679 215 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57670.[MT7]-GHSPFANLK[MT7].3y3_1.heavy 420.243 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1681 215 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57670.[MT7]-GHSPFANLK[MT7].3y4_1.heavy 420.243 / 589.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1683 215 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57670.[MT7]-GHSPFANLK[MT7].3b3_1.heavy 420.243 / 426.222 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1685 215 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57670.[MT7]-GHSPFANLK[MT7].3y5_1.heavy 420.243 / 736.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1687 216 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538351.[MT7]-ILTLTTNEI.2b3_1.heavy 581.346 / 472.325 26740.0 41.06209945678711 38 8 10 10 10 0.5964502796492469 91.46406726590175 0.0 3 0.7752378145225035 2.552752544191437 26740.0 43.60829431562736 0.0 - - - - - - - 1251.5714285714287 53 7 FGFR2 fibroblast growth factor receptor 2 1689 216 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538351.[MT7]-ILTLTTNEI.2b4_1.heavy 581.346 / 585.409 40370.0 41.06209945678711 38 8 10 10 10 0.5964502796492469 91.46406726590175 0.0 3 0.7752378145225035 2.552752544191437 40370.0 109.51505875478804 0.0 - - - - - - - 676.0833333333334 80 12 FGFR2 fibroblast growth factor receptor 2 1691 216 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538351.[MT7]-ILTLTTNEI.2b7_1.heavy 581.346 / 901.547 11034.0 41.06209945678711 38 8 10 10 10 0.5964502796492469 91.46406726590175 0.0 3 0.7752378145225035 2.552752544191437 11034.0 42.87973437345709 0.0 - - - - - - - 238.0952380952381 22 21 FGFR2 fibroblast growth factor receptor 2 1693 216 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538351.[MT7]-ILTLTTNEI.2b5_1.heavy 581.346 / 686.457 29336.0 41.06209945678711 38 8 10 10 10 0.5964502796492469 91.46406726590175 0.0 3 0.7752378145225035 2.552752544191437 29336.0 80.01291774973987 0.0 - - - - - - - 694.5 58 10 FGFR2 fibroblast growth factor receptor 2 1695 217 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539489.[MT7]-RLLSTYIC[CAM]K[MT7].3b6_1.heavy 481.286 / 878.522 821.0 28.344425678253174 36 10 10 6 10 6.1433136036752805 16.27786019912353 0.03289985656738281 3 0.8279795903543241 2.9318419199123578 821.0 0.9 2.0 - - - - - - - 173.22222222222223 15 9 EXOC7 exocyst complex component 7 1697 217 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539489.[MT7]-RLLSTYIC[CAM]K[MT7].3y3_1.heavy 481.286 / 564.33 253564.0 28.344425678253174 36 10 10 6 10 6.1433136036752805 16.27786019912353 0.03289985656738281 3 0.8279795903543241 2.9318419199123578 253564.0 191.0413698630137 0.0 - - - - - - - 1174.6 507 10 EXOC7 exocyst complex component 7 1699 217 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539489.[MT7]-RLLSTYIC[CAM]K[MT7].3b5_1.heavy 481.286 / 715.458 162882.0 28.344425678253174 36 10 10 6 10 6.1433136036752805 16.27786019912353 0.03289985656738281 3 0.8279795903543241 2.9318419199123578 162882.0 120.24013698630137 0.0 - - - - - - - 830.6666666666666 325 9 EXOC7 exocyst complex component 7 1701 217 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539489.[MT7]-RLLSTYIC[CAM]K[MT7].3y4_1.heavy 481.286 / 727.393 74336.0 28.344425678253174 36 10 10 6 10 6.1433136036752805 16.27786019912353 0.03289985656738281 3 0.8279795903543241 2.9318419199123578 74336.0 94.55458728010825 0.0 - - - - - - - 739.125 148 8 EXOC7 exocyst complex component 7 1703 218 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538164.[MT7]-LWFTYR.2b3_1.heavy 515.286 / 591.341 26742.0 39.282100677490234 50 20 10 10 10 9.443438103600924 10.589363630378273 0.0 3 0.9970826555270857 22.843512045399308 26742.0 55.5084288104343 0.0 - - - - - - - 679.1818181818181 53 11 ATG4A;ATG4B ATG4 autophagy related 4 homolog A (S. cerevisiae);ATG4 autophagy related 4 homolog B (S. cerevisiae) 1705 218 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538164.[MT7]-LWFTYR.2y4_1.heavy 515.286 / 586.298 60206.0 39.282100677490234 50 20 10 10 10 9.443438103600924 10.589363630378273 0.0 3 0.9970826555270857 22.843512045399308 60206.0 105.63661142383502 0.0 - - - - - - - 657.4 120 10 ATG4A;ATG4B ATG4 autophagy related 4 homolog A (S. cerevisiae);ATG4 autophagy related 4 homolog B (S. cerevisiae) 1707 218 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538164.[MT7]-LWFTYR.2y5_1.heavy 515.286 / 772.378 228351.0 39.282100677490234 50 20 10 10 10 9.443438103600924 10.589363630378273 0.0 3 0.9970826555270857 22.843512045399308 228351.0 531.7544265734265 0.0 - - - - - - - 298.6 456 10 ATG4A;ATG4B ATG4 autophagy related 4 homolog A (S. cerevisiae);ATG4 autophagy related 4 homolog B (S. cerevisiae) 1709 218 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538164.[MT7]-LWFTYR.2y3_1.heavy 515.286 / 439.23 30327.0 39.282100677490234 50 20 10 10 10 9.443438103600924 10.589363630378273 0.0 3 0.9970826555270857 22.843512045399308 30327.0 61.4874127346194 0.0 - - - - - - - 290.3333333333333 60 9 ATG4A;ATG4B ATG4 autophagy related 4 homolog A (S. cerevisiae);ATG4 autophagy related 4 homolog B (S. cerevisiae) 1711 219 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57364.[MT7]-LIFHK[MT7].2b3_1.heavy 473.31 / 518.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL1;AFAP1 acyl-CoA synthetase long-chain family member 1;actin filament associated protein 1 1713 219 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57364.[MT7]-LIFHK[MT7].2y4_1.heavy 473.31 / 688.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL1;AFAP1 acyl-CoA synthetase long-chain family member 1;actin filament associated protein 1 1715 219 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57364.[MT7]-LIFHK[MT7].2y3_1.heavy 473.31 / 575.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL1;AFAP1 acyl-CoA synthetase long-chain family member 1;actin filament associated protein 1 1717 220 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57363.[MT7]-QAQDLAR.2y5_1.heavy 473.265 / 602.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - HRAS;KRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog 1719 220 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57363.[MT7]-QAQDLAR.2b4_1.heavy 473.265 / 587.291 N/A N/A - - - - - - - - - 0.0 - - - - - - - HRAS;KRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog 1721 220 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57363.[MT7]-QAQDLAR.2y6_1.heavy 473.265 / 673.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - HRAS;KRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog 1723 220 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57363.[MT7]-QAQDLAR.2b5_1.heavy 473.265 / 700.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - HRAS;KRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog 1725 221 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59100.[MT7]-YTDSK[MT7].2b3_1.heavy 451.247 / 524.247 5390.0 15.85830020904541 44 14 10 10 10 1.140626638463161 57.33008105234128 0.0 3 0.9386648572943869 4.957497401128778 5390.0 20.086956521739133 0.0 - - - - - - - 215.08695652173913 10 23 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 1727 221 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59100.[MT7]-YTDSK[MT7].2y4_1.heavy 451.247 / 594.321 6476.0 15.85830020904541 44 14 10 10 10 1.140626638463161 57.33008105234128 0.0 3 0.9386648572943869 4.957497401128778 6476.0 18.711015061554463 0.0 - - - - - - - 215.1 12 20 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 1729 221 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59100.[MT7]-YTDSK[MT7].2y3_1.heavy 451.247 / 493.274 1850.0 15.85830020904541 44 14 10 10 10 1.140626638463161 57.33008105234128 0.0 3 0.9386648572943869 4.957497401128778 1850.0 9.485555016504476 0.0 - - - - - - - 177.92307692307693 3 26 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 1731 222 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57760.[MT7]-EAGEEVPDAGPR.2b4_1.heavy 685.837 / 531.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1733 222 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57760.[MT7]-EAGEEVPDAGPR.2b6_1.heavy 685.837 / 759.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1735 222 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57760.[MT7]-EAGEEVPDAGPR.2b5_1.heavy 685.837 / 660.296 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1737 222 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57760.[MT7]-EAGEEVPDAGPR.2y11_1.heavy 685.837 / 1097.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1739 223 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537878.[MT7]-AQSIGRR.2b4_1.heavy 466.281 / 544.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1741 223 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537878.[MT7]-AQSIGRR.2b6_1.heavy 466.281 / 757.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1743 223 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537878.[MT7]-AQSIGRR.2y6_1.heavy 466.281 / 716.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1745 223 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537878.[MT7]-AQSIGRR.2b5_1.heavy 466.281 / 601.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1747 224 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57764.[MT7]-DRVTDALNATR.2y8_1.heavy 688.374 / 861.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1749 224 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57764.[MT7]-DRVTDALNATR.2y9_1.heavy 688.374 / 960.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1751 224 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57764.[MT7]-DRVTDALNATR.2y6_1.heavy 688.374 / 645.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1753 224 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57764.[MT7]-DRVTDALNATR.2b5_1.heavy 688.374 / 731.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1755 225 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539308.[MT7]-FSVEQLGQDGR.2y8_1.heavy 690.355 / 902.433 3722.0 30.512500762939453 48 18 10 10 10 6.525764957058431 15.32387400680705 0.0 3 0.9899371087651235 12.292383996080671 3722.0 39.54124731182796 0.0 - - - - - - - 236.07692307692307 7 13 IL12RB1 interleukin 12 receptor, beta 1 1757 225 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539308.[MT7]-FSVEQLGQDGR.2b4_1.heavy 690.355 / 607.321 3815.0 30.512500762939453 48 18 10 10 10 6.525764957058431 15.32387400680705 0.0 3 0.9899371087651235 12.292383996080671 3815.0 22.97204301075269 0.0 - - - - - - - 178.84615384615384 7 13 IL12RB1 interleukin 12 receptor, beta 1 1759 225 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539308.[MT7]-FSVEQLGQDGR.2y10_1.heavy 690.355 / 1088.53 5303.0 30.512500762939453 48 18 10 10 10 6.525764957058431 15.32387400680705 0.0 3 0.9899371087651235 12.292383996080671 5303.0 35.92354838709678 0.0 - - - - - - - 220.875 10 8 IL12RB1 interleukin 12 receptor, beta 1 1761 225 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539308.[MT7]-FSVEQLGQDGR.2y7_1.heavy 690.355 / 773.39 3443.0 30.512500762939453 48 18 10 10 10 6.525764957058431 15.32387400680705 0.0 3 0.9899371087651235 12.292383996080671 3443.0 16.906487455197134 0.0 - - - - - - - 248.0 6 12 IL12RB1 interleukin 12 receptor, beta 1 1763 226 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58155.[MT7]-VK[MT7]PLQGEFTTWSPWSQPLAFR.3y7_1.heavy 921.834 / 818.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1765 226 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58155.[MT7]-VK[MT7]PLQGEFTTWSPWSQPLAFR.3b7_1.heavy 921.834 / 1040.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1767 226 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58155.[MT7]-VK[MT7]PLQGEFTTWSPWSQPLAFR.3y5_1.heavy 921.834 / 603.361 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1769 226 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58155.[MT7]-VK[MT7]PLQGEFTTWSPWSQPLAFR.3y9_1.heavy 921.834 / 1101.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL2RB interleukin 2 receptor, beta 1771 227 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57272.[MT7]-SSLDVR.2b3_1.heavy 410.736 / 432.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1773 227 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57272.[MT7]-SSLDVR.2y5_1.heavy 410.736 / 589.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1775 227 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57272.[MT7]-SSLDVR.2b4_1.heavy 410.736 / 547.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 1777 228 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57767.[MT7]-WMAPEALFDR.2b3_1.heavy 690.349 / 533.266 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR1;FGFR3;FGFR2;FGFR4 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4 1779 228 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57767.[MT7]-WMAPEALFDR.2y8_1.heavy 690.349 / 918.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR1;FGFR3;FGFR2;FGFR4 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4 1781 228 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57767.[MT7]-WMAPEALFDR.2y9_1.heavy 690.349 / 1049.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR1;FGFR3;FGFR2;FGFR4 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4 1783 228 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57767.[MT7]-WMAPEALFDR.2y7_1.heavy 690.349 / 847.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR1;FGFR3;FGFR2;FGFR4 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4 1785 229 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57664.[MT7]-AYPHVFTK[MT7].3y3_1.heavy 417.576 / 539.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 1787 229 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57664.[MT7]-AYPHVFTK[MT7].3b4_1.heavy 417.576 / 613.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 1789 229 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57664.[MT7]-AYPHVFTK[MT7].3y4_1.heavy 417.576 / 638.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 1791 229 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57664.[MT7]-AYPHVFTK[MT7].3b4_2.heavy 417.576 / 307.164 N/A N/A - - - - - - - - - 0.0 - - - - - - - UQCRQ ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa 1793 230 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57373.[MT7]-TLHLGK[MT7].2b3_1.heavy 478.81 / 496.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1795 230 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57373.[MT7]-TLHLGK[MT7].2y4_1.heavy 478.81 / 598.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1797 230 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57373.[MT7]-TLHLGK[MT7].2y5_1.heavy 478.81 / 711.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1799 230 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57373.[MT7]-TLHLGK[MT7].2b4_1.heavy 478.81 / 609.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1801 231 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59928.[MT7]-GK[MT7]VEQLSPEEEEK[MT7].3y6_1.heavy 645.353 / 904.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1803 231 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59928.[MT7]-GK[MT7]VEQLSPEEEEK[MT7].3b4_1.heavy 645.353 / 702.439 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1805 231 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59928.[MT7]-GK[MT7]VEQLSPEEEEK[MT7].3b5_1.heavy 645.353 / 830.497 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1807 231 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59928.[MT7]-GK[MT7]VEQLSPEEEEK[MT7].3y4_1.heavy 645.353 / 678.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - FOS FBJ murine osteosarcoma viral oncogene homolog 1809 232 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537624.[MT7]-SIDLK[MT7].2y4_1.heavy 432.276 / 632.41 7200.0 24.52899932861328 45 17 10 10 8 2.2355319007535446 34.471407245811314 0.0 4 0.9799087465316472 8.692186449717394 7200.0 26.91719128329298 2.0 - - - - - - - 274.1764705882353 17 17 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1811 232 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537624.[MT7]-SIDLK[MT7].2b3_1.heavy 432.276 / 460.252 19595.0 24.52899932861328 45 17 10 10 8 2.2355319007535446 34.471407245811314 0.0 4 0.9799087465316472 8.692186449717394 19595.0 31.424144432730515 0.0 - - - - - - - 336.3 39 10 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1813 232 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537624.[MT7]-SIDLK[MT7].2b4_1.heavy 432.276 / 573.336 1712.0 24.52899932861328 45 17 10 10 8 2.2355319007535446 34.471407245811314 0.0 4 0.9799087465316472 8.692186449717394 1712.0 4.545988700564972 3.0 - - - - - - - 722.75 6 8 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1815 232 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537624.[MT7]-SIDLK[MT7].2y3_1.heavy 432.276 / 519.326 5607.0 24.52899932861328 45 17 10 10 8 2.2355319007535446 34.471407245811314 0.0 4 0.9799087465316472 8.692186449717394 5607.0 11.922434514637903 0.0 - - - - - - - 658.8333333333334 11 12 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1817 233 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539203.[MT7]-LLLLGAGESGK[MT7].3b5_1.heavy 449.281 / 654.467 157902.0 36.97119903564453 50 20 10 10 10 5.622281669744484 17.786373197582027 0.0 3 0.9932400690808064 15.00190071878754 157902.0 243.30166450878585 0.0 - - - - - - - 229.11111111111111 315 9 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 1819 233 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539203.[MT7]-LLLLGAGESGK[MT7].3b3_1.heavy 449.281 / 484.362 209505.0 36.97119903564453 50 20 10 10 10 5.622281669744484 17.786373197582027 0.0 3 0.9932400690808064 15.00190071878754 209505.0 996.2166510428872 0.0 - - - - - - - 802.5 419 8 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 1821 233 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539203.[MT7]-LLLLGAGESGK[MT7].3y5_1.heavy 449.281 / 621.332 84420.0 36.97119903564453 50 20 10 10 10 5.622281669744484 17.786373197582027 0.0 3 0.9932400690808064 15.00190071878754 84420.0 159.33749226097467 0.0 - - - - - - - 267.5 168 8 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 1823 233 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539203.[MT7]-LLLLGAGESGK[MT7].3b8_2.heavy 449.281 / 456.288 49384.0 36.97119903564453 50 20 10 10 10 5.622281669744484 17.786373197582027 0.0 3 0.9932400690808064 15.00190071878754 49384.0 165.50313513513512 0.0 - - - - - - - 302.6363636363636 98 11 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 1825 234 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57357.[MT7]-LFENLR.2b3_1.heavy 468.275 / 534.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC1;HDAC2;PGM2 histone deacetylase 1;histone deacetylase 2;phosphoglucomutase 2 1827 234 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57357.[MT7]-LFENLR.2y4_1.heavy 468.275 / 531.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC1;HDAC2;PGM2 histone deacetylase 1;histone deacetylase 2;phosphoglucomutase 2 1829 234 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57357.[MT7]-LFENLR.2y5_1.heavy 468.275 / 678.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC1;HDAC2;PGM2 histone deacetylase 1;histone deacetylase 2;phosphoglucomutase 2 1831 234 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57357.[MT7]-LFENLR.2b4_1.heavy 468.275 / 648.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - HDAC1;HDAC2;PGM2 histone deacetylase 1;histone deacetylase 2;phosphoglucomutase 2 1833 235 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58046.[MT7]-VYSDAQPHIQWIK[MT7].3y3_1.heavy 625.012 / 590.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 1835 235 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58046.[MT7]-VYSDAQPHIQWIK[MT7].3b6_1.heavy 625.012 / 808.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 1837 235 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58046.[MT7]-VYSDAQPHIQWIK[MT7].3b4_1.heavy 625.012 / 609.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 1839 235 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58046.[MT7]-VYSDAQPHIQWIK[MT7].3b5_1.heavy 625.012 / 680.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR2 fibroblast growth factor receptor 2 1841 236 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59717.[MT7]-NMVSILSSFESR.2b4_1.heavy 757.394 / 576.293 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1843 236 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59717.[MT7]-NMVSILSSFESR.2y9_1.heavy 757.394 / 1025.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1845 236 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59717.[MT7]-NMVSILSSFESR.2y10_1.heavy 757.394 / 1124.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1847 236 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59717.[MT7]-NMVSILSSFESR.2y7_1.heavy 757.394 / 825.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1849 237 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59714.[MT7]-LAQGEYIAPEK[MT7].2y4_1.heavy 753.924 / 588.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL1;ACSL5 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 5 1851 237 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59714.[MT7]-LAQGEYIAPEK[MT7].2b6_1.heavy 753.924 / 806.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL1;ACSL5 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 5 1853 237 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59714.[MT7]-LAQGEYIAPEK[MT7].2y3_1.heavy 753.924 / 517.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL1;ACSL5 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 5 1855 237 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59714.[MT7]-LAQGEYIAPEK[MT7].2b5_1.heavy 753.924 / 643.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL1;ACSL5 acyl-CoA synthetase long-chain family member 1;acyl-CoA synthetase long-chain family member 5 1857 238 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 267689.0 42.162498474121094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 267689.0 418.3873245212163 0.0 - - - - - - - 702.1 535 10 1859 238 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 488976.0 42.162498474121094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 488976.0 487.31548918096763 0.0 - - - - - - - 1244.5 977 10 1861 238 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 411873.0 42.162498474121094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 411873.0 713.974718621505 0.0 - - - - - - - 711.2857142857143 823 7 1863 239 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539479.[MT7]-LENSIIPVHK[MT7].3b4_1.heavy 479.96 / 588.311 62022.0 29.615800857543945 44 14 10 10 10 2.0123523270056616 40.952834761722485 0.0 3 0.9464391264438656 5.308609634119325 62022.0 79.49380098137615 0.0 - - - - - - - 338.0 124 1 EXOC7 exocyst complex component 7 1865 239 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539479.[MT7]-LENSIIPVHK[MT7].3b5_1.heavy 479.96 / 701.395 N/A 29.615800857543945 44 14 10 10 10 2.0123523270056616 40.952834761722485 0.0 3 0.9464391264438656 5.308609634119325 32532.0 34.64173792075588 1.0 - - - - - - - 696.75 150 4 EXOC7 exocyst complex component 7 1867 239 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539479.[MT7]-LENSIIPVHK[MT7].3b3_1.heavy 479.96 / 501.279 14111.0 29.615800857543945 44 14 10 10 10 2.0123523270056616 40.952834761722485 0.0 3 0.9464391264438656 5.308609634119325 14111.0 9.262561257768784 0.0 - - - - - - - 394.0 28 3 EXOC7 exocyst complex component 7 1869 239 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539479.[MT7]-LENSIIPVHK[MT7].3y4_1.heavy 479.96 / 624.395 76556.0 29.615800857543945 44 14 10 10 10 2.0123523270056616 40.952834761722485 0.0 3 0.9464391264438656 5.308609634119325 76556.0 28.51018311557039 0.0 - - - - - - - 211.0 153 2 EXOC7 exocyst complex component 7 1871 240 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538843.[MT7]-LRELVPGVPR.3y5_1.heavy 427.27 / 525.314 54686.0 30.64144992828369 42 20 10 2 10 24.85696334026187 4.023017559752594 0.0858001708984375 3 0.9973867688324914 24.136752311503017 54686.0 217.43502659574472 0.0 - - - - - - - 305.5 109 4 ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 1873 240 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538843.[MT7]-LRELVPGVPR.3b4_1.heavy 427.27 / 656.421 11369.0 30.64144992828369 42 20 10 2 10 24.85696334026187 4.023017559752594 0.0858001708984375 3 0.9973867688324914 24.136752311503017 11369.0 33.827323480217075 0.0 - - - - - - - 211.5 22 8 ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 1875 240 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538843.[MT7]-LRELVPGVPR.3b5_1.heavy 427.27 / 755.49 7235.0 30.64144992828369 42 20 10 2 10 24.85696334026187 4.023017559752594 0.0858001708984375 3 0.9973867688324914 24.136752311503017 7235.0 34.011341607565015 0.0 - - - - - - - 172.33333333333334 14 6 ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 1877 240 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538843.[MT7]-LRELVPGVPR.3b3_1.heavy 427.27 / 543.337 3852.0 30.64144992828369 42 20 10 2 10 24.85696334026187 4.023017559752594 0.0858001708984375 3 0.9973867688324914 24.136752311503017 3852.0 3.092949747526505 0.0 - - - - - - - 323.77777777777777 7 9 ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein 1879 241 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58144.[MT7]-SIAPITDFEYSQEFFDHVK[MT7].3b9_1.heavy 854.432 / 1118.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1881 241 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58144.[MT7]-SIAPITDFEYSQEFFDHVK[MT7].3y6_1.heavy 854.432 / 936.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1883 241 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58144.[MT7]-SIAPITDFEYSQEFFDHVK[MT7].3y3_1.heavy 854.432 / 527.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1885 241 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58144.[MT7]-SIAPITDFEYSQEFFDHVK[MT7].3b7_1.heavy 854.432 / 842.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type 1887 242 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57263.[MT7]-LAGQLR.2y4_1.heavy 401.257 / 473.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1889 242 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57263.[MT7]-LAGQLR.2y5_1.heavy 401.257 / 544.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1891 242 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57263.[MT7]-LAGQLR.2b4_1.heavy 401.257 / 514.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1893 242 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57263.[MT7]-LAGQLR.2b5_1.heavy 401.257 / 627.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL12RB1 interleukin 12 receptor, beta 1 1895 243 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539811.[MT7]-TVESRQAQDLAR.3b9_2.heavy 506.61 / 580.295 12021.0 18.755300521850586 41 11 10 10 10 2.1379495633687258 46.77378817226723 0.0 3 0.866112861273768 3.334447417640308 12021.0 29.418294654419515 0.0 - - - - - - - 303.35 24 20 HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 1897 243 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539811.[MT7]-TVESRQAQDLAR.3y7_1.heavy 506.61 / 801.421 1755.0 18.755300521850586 41 11 10 10 10 2.1379495633687258 46.77378817226723 0.0 3 0.866112861273768 3.334447417640308 1755.0 14.646235637111989 0.0 - - - - - - - 181.05 3 20 HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 1899 243 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539811.[MT7]-TVESRQAQDLAR.3y6_1.heavy 506.61 / 673.363 2595.0 18.755300521850586 41 11 10 10 10 2.1379495633687258 46.77378817226723 0.0 3 0.866112861273768 3.334447417640308 2595.0 8.073124320405945 0.0 - - - - - - - 212.73076923076923 5 26 HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 1901 243 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539811.[MT7]-TVESRQAQDLAR.3y5_1.heavy 506.61 / 602.326 1984.0 18.755300521850586 41 11 10 10 10 2.1379495633687258 46.77378817226723 0.0 3 0.866112861273768 3.334447417640308 1984.0 8.916853932584269 0.0 - - - - - - - 241.16 3 25 HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 1903 244 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538748.[MT7]-AALLNAIRK[MT7].3y6_1.heavy 419.946 / 858.564 439.0 30.00950050354004 39 9 10 10 10 2.37063522935392 42.18278660578813 0.0 3 0.8141232064059942 2.816961600812052 439.0 4.988636363636363 0.0 - - - - - - - 0.0 0 0 INHBA inhibin, beta A 1905 244 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538748.[MT7]-AALLNAIRK[MT7].3y8_2.heavy 419.946 / 521.846 29691.0 30.00950050354004 39 9 10 10 10 2.37063522935392 42.18278660578813 0.0 3 0.8141232064059942 2.816961600812052 29691.0 195.74587490301303 0.0 - - - - - - - 219.8 59 10 INHBA inhibin, beta A 1907 244 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538748.[MT7]-AALLNAIRK[MT7].3y5_1.heavy 419.946 / 745.48 9487.0 30.00950050354004 39 9 10 10 10 2.37063522935392 42.18278660578813 0.0 3 0.8141232064059942 2.816961600812052 9487.0 203.7548863636364 0.0 - - - - - - - 215.72727272727272 18 11 INHBA inhibin, beta A 1909 244 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538748.[MT7]-AALLNAIRK[MT7].3b5_1.heavy 419.946 / 627.395 7379.0 30.00950050354004 39 9 10 10 10 2.37063522935392 42.18278660578813 0.0 3 0.8141232064059942 2.816961600812052 7379.0 52.71316640072451 0.0 - - - - - - - 263.54545454545456 14 11 INHBA inhibin, beta A 1911 245 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537614.[MT7]-C[CAM]DLAAR.2b3_1.heavy 425.222 / 533.251 1935.0 17.333524703979492 37 17 9 3 8 2.7349611414391988 30.988187411111156 0.07089996337890625 4 0.9767216103647657 8.073090323506506 1935.0 2.930743252662689 0.0 - - - - - - - 671.125 3 8 HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 1913 245 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537614.[MT7]-C[CAM]DLAAR.2y4_1.heavy 425.222 / 430.277 3909.0 17.333524703979492 37 17 9 3 8 2.7349611414391988 30.988187411111156 0.07089996337890625 4 0.9767216103647657 8.073090323506506 3909.0 2.0999999999999996 2.0 - - - - - - - 236.75 8 16 HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 1915 245 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537614.[MT7]-C[CAM]DLAAR.2y5_1.heavy 425.222 / 545.304 2922.0 17.333524703979492 37 17 9 3 8 2.7349611414391988 30.988187411111156 0.07089996337890625 4 0.9767216103647657 8.073090323506506 2922.0 11.854130548912092 0.0 - - - - - - - 197.22222222222223 5 18 HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 1917 245 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537614.[MT7]-C[CAM]DLAAR.2b4_1.heavy 425.222 / 604.288 2567.0 17.333524703979492 37 17 9 3 8 2.7349611414391988 30.988187411111156 0.07089996337890625 4 0.9767216103647657 8.073090323506506 2567.0 4.1965682137834035 0.0 - - - - - - - 241.6875 5 16 HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 1919 246 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58840.[MT7]-NQDFMNVYYQIR.3b6_1.heavy 578.951 / 894.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1921 246 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58840.[MT7]-NQDFMNVYYQIR.3b4_1.heavy 578.951 / 649.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1923 246 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58840.[MT7]-NQDFMNVYYQIR.3b3_1.heavy 578.951 / 502.238 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1925 246 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58840.[MT7]-NQDFMNVYYQIR.3y5_1.heavy 578.951 / 742.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1927 247 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57506.[MT7]-DDAMLLK[MT7].2y5_1.heavy 547.312 / 719.461 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1929 247 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57506.[MT7]-DDAMLLK[MT7].2b4_1.heavy 547.312 / 577.241 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1931 247 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57506.[MT7]-DDAMLLK[MT7].2y3_1.heavy 547.312 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1933 247 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57506.[MT7]-DDAMLLK[MT7].2b5_1.heavy 547.312 / 690.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1935 248 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59603.[MT7]-LMNFMYFQR.2y8_1.heavy 697.347 / 1136.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1 cytoplasmic FMR1 interacting protein 1 1937 248 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59603.[MT7]-LMNFMYFQR.2b4_1.heavy 697.347 / 650.345 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1 cytoplasmic FMR1 interacting protein 1 1939 248 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59603.[MT7]-LMNFMYFQR.2y6_1.heavy 697.347 / 891.418 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1 cytoplasmic FMR1 interacting protein 1 1941 248 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59603.[MT7]-LMNFMYFQR.2y7_1.heavy 697.347 / 1005.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYFIP1 cytoplasmic FMR1 interacting protein 1 1943 249 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59120.[MT7]-C[CAM]DVDIR.2y4_1.heavy 461.233 / 502.298 N/A 25.53580093383789 44 14 10 10 10 5.110533839884944 19.56742742207365 0.0 2 0.9422480005750606 5.1105336718222985 1239.0 0.5478260869565217 14.0 - - - - - - - 345.57142857142856 2 7 ACTBL2;ACTB;ACTG1 actin, beta-like 2;actin, beta;actin, gamma 1 1945 249 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59120.[MT7]-C[CAM]DVDIR.2b3_1.heavy 461.233 / 519.235 13747.0 25.53580093383789 44 14 10 10 10 5.110533839884944 19.56742742207365 0.0 2 0.9422480005750606 5.1105336718222985 13747.0 18.16029411764706 0.0 - - - - - - - 730.125 27 8 ACTBL2;ACTB;ACTG1 actin, beta-like 2;actin, beta;actin, gamma 1 1947 249 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59120.[MT7]-C[CAM]DVDIR.2y5_1.heavy 461.233 / 617.325 12862.0 25.53580093383789 44 14 10 10 10 5.110533839884944 19.56742742207365 0.0 2 0.9422480005750606 5.1105336718222985 12862.0 -1.362499999999999 0.0 - - - - - - - 272.3076923076923 25 13 ACTBL2;ACTB;ACTG1 actin, beta-like 2;actin, beta;actin, gamma 1 1949 249 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59120.[MT7]-C[CAM]DVDIR.2b4_1.heavy 461.233 / 634.262 N/A 25.53580093383789 44 14 10 10 10 5.110533839884944 19.56742742207365 0.0 2 0.9422480005750606 5.1105336718222985 826.0 1.1666666666666667 7.0 - - - - - - - 268.77777777777777 14 18 ACTBL2;ACTB;ACTG1 actin, beta-like 2;actin, beta;actin, gamma 1 1951 250 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58142.[MT7]-LAQSEYQLLADIIPEHHQK[MT7].4b7_1.heavy 631.097 / 964.486 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1953 250 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58142.[MT7]-LAQSEYQLLADIIPEHHQK[MT7].4b5_1.heavy 631.097 / 673.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1955 250 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58142.[MT7]-LAQSEYQLLADIIPEHHQK[MT7].4y3_1.heavy 631.097 / 556.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1957 250 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58142.[MT7]-LAQSEYQLLADIIPEHHQK[MT7].4y6_1.heavy 631.097 / 919.487 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 1959 251 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540760.[MT7]-APHPFGVPAPSAGAYSR.3y7_1.heavy 609.32 / 711.342 16464.0 28.630849361419678 44 18 10 6 10 4.4106420849796955 17.791122309008944 0.03140068054199219 3 0.9862270609802176 10.503869918060126 16464.0 6.8220994475138115 1.0 - - - - - - - 213.26666666666668 32 15 FOS FBJ murine osteosarcoma viral oncogene homolog 1961 251 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540760.[MT7]-APHPFGVPAPSAGAYSR.3y6_1.heavy 609.32 / 624.31 8842.0 28.630849361419678 44 18 10 6 10 4.4106420849796955 17.791122309008944 0.03140068054199219 3 0.9862270609802176 10.503869918060126 8842.0 63.54542658744362 0.0 - - - - - - - 213.33333333333334 17 15 FOS FBJ murine osteosarcoma viral oncogene homolog 1963 251 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540760.[MT7]-APHPFGVPAPSAGAYSR.3y8_1.heavy 609.32 / 808.395 38493.0 28.630849361419678 44 18 10 6 10 4.4106420849796955 17.791122309008944 0.03140068054199219 3 0.9862270609802176 10.503869918060126 38493.0 154.2866882664257 0.0 - - - - - - - 223.8125 76 16 FOS FBJ murine osteosarcoma viral oncogene homolog 1965 251 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540760.[MT7]-APHPFGVPAPSAGAYSR.3y10_1.heavy 609.32 / 976.485 27288.0 28.630849361419678 44 18 10 6 10 4.4106420849796955 17.791122309008944 0.03140068054199219 3 0.9862270609802176 10.503869918060126 27288.0 228.47375331106758 0.0 - - - - - - - 253.86666666666667 54 15 FOS FBJ murine osteosarcoma viral oncogene homolog 1967 252 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59803.[MT7]-DPTQPILEALDK[MT7].2y4_1.heavy 814.461 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 1969 252 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59803.[MT7]-DPTQPILEALDK[MT7].2y8_1.heavy 814.461 / 1042.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 1971 252 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59803.[MT7]-DPTQPILEALDK[MT7].2y3_1.heavy 814.461 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 1973 252 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59803.[MT7]-DPTQPILEALDK[MT7].2y6_1.heavy 814.461 / 832.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 1975 253 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58133.[MT7]-VSNYIGQANQSAWLTVLPK[MT7].3y3_1.heavy 793.109 / 501.352 1845.0 49.98630142211914 38 10 10 10 8 0.7049710214116001 76.79346809869247 0.0 4 0.8253746219436016 2.90921706458345 1845.0 -2.80253164556962 0.0 - - - - - - - 205.11111111111111 3 9 FGFR2 fibroblast growth factor receptor 2 1977 253 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58133.[MT7]-VSNYIGQANQSAWLTVLPK[MT7].3b4_1.heavy 793.109 / 608.316 1384.0 49.98630142211914 38 10 10 10 8 0.7049710214116001 76.79346809869247 0.0 4 0.8253746219436016 2.90921706458345 1384.0 -4.193939393939392 0.0 - - - - - - - 173.25 2 8 FGFR2 fibroblast growth factor receptor 2 1979 253 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58133.[MT7]-VSNYIGQANQSAWLTVLPK[MT7].3b5_1.heavy 793.109 / 721.4 857.0 49.98630142211914 38 10 10 10 8 0.7049710214116001 76.79346809869247 0.0 4 0.8253746219436016 2.90921706458345 857.0 -1.9477272727272732 1.0 - - - - - - - 0.0 1 0 FGFR2 fibroblast growth factor receptor 2 1981 253 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58133.[MT7]-VSNYIGQANQSAWLTVLPK[MT7].3b7_1.heavy 793.109 / 906.48 659.0 49.98630142211914 38 10 10 10 8 0.7049710214116001 76.79346809869247 0.0 4 0.8253746219436016 2.90921706458345 659.0 -1.4977272727272726 0.0 - - - - - - - 0.0 1 0 FGFR2 fibroblast growth factor receptor 2 1983 254 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537897.[MT7]-LEEYLGSMAK[MT7].3b4_1.heavy 476.926 / 679.342 72555.0 35.922298431396484 48 18 10 10 10 4.199708096679333 23.811178705269775 0.0 3 0.9857254986295397 10.317249371093592 72555.0 268.871087614201 0.0 - - - - - - - 225.76923076923077 145 13 EXOC7 exocyst complex component 7 1985 254 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537897.[MT7]-LEEYLGSMAK[MT7].3y4_1.heavy 476.926 / 580.325 17935.0 35.922298431396484 48 18 10 10 10 4.199708096679333 23.811178705269775 0.0 3 0.9857254986295397 10.317249371093592 17935.0 105.11746838612746 0.0 - - - - - - - 788.1111111111111 35 9 EXOC7 exocyst complex component 7 1987 254 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537897.[MT7]-LEEYLGSMAK[MT7].3b3_1.heavy 476.926 / 516.279 71333.0 35.922298431396484 48 18 10 10 10 4.199708096679333 23.811178705269775 0.0 3 0.9857254986295397 10.317249371093592 71333.0 120.72632223471632 0.0 - - - - - - - 697.5555555555555 142 9 EXOC7 exocyst complex component 7 1989 254 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB537897.[MT7]-LEEYLGSMAK[MT7].3y5_1.heavy 476.926 / 637.346 39702.0 35.922298431396484 48 18 10 10 10 4.199708096679333 23.811178705269775 0.0 3 0.9857254986295397 10.317249371093592 39702.0 117.5162679366473 0.0 - - - - - - - 304.4 79 15 EXOC7 exocyst complex component 7 1991 255 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58138.[MT7]-RIQEIIEQLDVTTSEYEK[MT7].3b4_1.heavy 828.114 / 671.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1993 255 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58138.[MT7]-RIQEIIEQLDVTTSEYEK[MT7].3b5_1.heavy 828.114 / 784.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1995 255 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58138.[MT7]-RIQEIIEQLDVTTSEYEK[MT7].3y5_1.heavy 828.114 / 799.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1997 255 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58138.[MT7]-RIQEIIEQLDVTTSEYEK[MT7].3b7_1.heavy 828.114 / 1026.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1999 256 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47695.[MT7]-IQEIIEQLDVTTSEYEK[MT7].3y7_1.heavy 776.08 / 1001.49 896.0 46.04132556915283 36 10 10 6 10 0.7214099072322353 79.62758832499443 0.037899017333984375 3 0.839951822035725 3.0427536552726684 896.0 5.893154362416108 1.0 - - - - - - - 0.0 1 0 HSPD1 heat shock 60kDa protein 1 (chaperonin) 2001 256 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47695.[MT7]-IQEIIEQLDVTTSEYEK[MT7].3b4_1.heavy 776.08 / 628.379 2315.0 46.04132556915283 36 10 10 6 10 0.7214099072322353 79.62758832499443 0.037899017333984375 3 0.839951822035725 3.0427536552726684 2315.0 10.069756530702564 0.0 - - - - - - - 206.76923076923077 4 13 HSPD1 heat shock 60kDa protein 1 (chaperonin) 2003 256 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47695.[MT7]-IQEIIEQLDVTTSEYEK[MT7].3b5_1.heavy 776.08 / 741.463 3137.0 46.04132556915283 36 10 10 6 10 0.7214099072322353 79.62758832499443 0.037899017333984375 3 0.839951822035725 3.0427536552726684 3137.0 4.563692657846309 0.0 - - - - - - - 184.2 6 15 HSPD1 heat shock 60kDa protein 1 (chaperonin) 2005 256 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47695.[MT7]-IQEIIEQLDVTTSEYEK[MT7].3b3_1.heavy 776.08 / 515.295 1867.0 46.04132556915283 36 10 10 6 10 0.7214099072322353 79.62758832499443 0.037899017333984375 3 0.839951822035725 3.0427536552726684 1867.0 7.704831581462017 0.0 - - - - - - - 227.89473684210526 3 19 HSPD1 heat shock 60kDa protein 1 (chaperonin) 2007 257 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57390.[MT7]-DGVTVAK[MT7].2b3_1.heavy 489.297 / 416.226 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 2009 257 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57390.[MT7]-DGVTVAK[MT7].2y4_1.heavy 489.297 / 562.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 2011 257 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57390.[MT7]-DGVTVAK[MT7].2b4_1.heavy 489.297 / 517.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 2013 257 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57390.[MT7]-DGVTVAK[MT7].2y6_1.heavy 489.297 / 718.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 2015 258 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539055.[MT7]-GDGVVLVAPPLR.3y6_1.heavy 446.274 / 652.414 132429.0 34.57800006866455 42 16 10 6 10 3.7409519653768113 26.731163865646533 0.034801483154296875 3 0.9656076290984136 6.635576907105483 132429.0 789.8898172145628 0.0 - - - - - - - 284.0 264 9 LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) 2017 258 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539055.[MT7]-GDGVVLVAPPLR.3b6_1.heavy 446.274 / 685.4 159103.0 34.57800006866455 42 16 10 6 10 3.7409519653768113 26.731163865646533 0.034801483154296875 3 0.9656076290984136 6.635576907105483 159103.0 512.5126169922762 0.0 - - - - - - - 221.4 318 10 LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) 2019 258 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539055.[MT7]-GDGVVLVAPPLR.3b4_1.heavy 446.274 / 473.248 293321.0 34.57800006866455 42 16 10 6 10 3.7409519653768113 26.731163865646533 0.034801483154296875 3 0.9656076290984136 6.635576907105483 293321.0 264.2301444043321 1.0 - - - - - - - 255.5 586 4 LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) 2021 258 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539055.[MT7]-GDGVVLVAPPLR.3y5_1.heavy 446.274 / 553.346 237418.0 34.57800006866455 42 16 10 6 10 3.7409519653768113 26.731163865646533 0.034801483154296875 3 0.9656076290984136 6.635576907105483 237418.0 386.26601842585285 0.0 - - - - - - - 241.16666666666666 474 6 LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) 2023 259 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58945.[MT7]-DDVWDSVSIISFPEK[MT7].2b3_1.heavy 1013.02 / 474.232 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 2025 259 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58945.[MT7]-DDVWDSVSIISFPEK[MT7].2y5_1.heavy 1013.02 / 751.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 2027 259 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58945.[MT7]-DDVWDSVSIISFPEK[MT7].2y3_1.heavy 1013.02 / 517.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 2029 259 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58945.[MT7]-DDVWDSVSIISFPEK[MT7].2b5_1.heavy 1013.02 / 775.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 2031 260 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539059.[MT7]-SFEDIHQYR.3y3_1.heavy 446.89 / 466.241 148102.0 24.90329933166504 50 20 10 10 10 8.712500760875013 11.477760834072722 0.0 3 0.9954230156155617 18.235046227922687 148102.0 429.643448820452 0.0 - - - - - - - 1201.0 296 8 HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2033 260 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539059.[MT7]-SFEDIHQYR.3b4_1.heavy 446.89 / 623.279 202738.0 24.90329933166504 50 20 10 10 10 8.712500760875013 11.477760834072722 0.0 3 0.9954230156155617 18.235046227922687 202738.0 288.17470299376066 0.0 - - - - - - - 284.2 405 5 HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2035 260 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539059.[MT7]-SFEDIHQYR.3b3_1.heavy 446.89 / 508.252 37637.0 24.90329933166504 50 20 10 10 10 8.712500760875013 11.477760834072722 0.0 3 0.9954230156155617 18.235046227922687 37637.0 144.62235016632457 0.0 - - - - - - - 268.72727272727275 75 11 HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2037 260 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539059.[MT7]-SFEDIHQYR.3y4_1.heavy 446.89 / 603.3 72772.0 24.90329933166504 50 20 10 10 10 8.712500760875013 11.477760834072722 0.0 3 0.9954230156155617 18.235046227922687 72772.0 111.38528218404728 0.0 - - - - - - - 739.1428571428571 145 7 HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2039 261 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47489.[MT7]-LDISDEFSEVIK[MT7].3y3_1.heavy 561.641 / 503.367 24829.0 39.77672576904297 37 11 10 6 10 0.9343913572226402 71.34769189734897 0.0348968505859375 3 0.8615196240144282 3.277360038203753 24829.0 66.569093803018 0.0 - - - - - - - 752.0 49 12 EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 2041 261 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47489.[MT7]-LDISDEFSEVIK[MT7].3b6_1.heavy 561.641 / 817.406 22129.0 39.77672576904297 37 11 10 6 10 0.9343913572226402 71.34769189734897 0.0348968505859375 3 0.8615196240144282 3.277360038203753 22129.0 89.3889117365531 0.0 - - - - - - - 204.94444444444446 44 18 EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 2043 261 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47489.[MT7]-LDISDEFSEVIK[MT7].3b4_1.heavy 561.641 / 573.336 4149.0 39.77672576904297 37 11 10 6 10 0.9343913572226402 71.34769189734897 0.0348968505859375 3 0.8615196240144282 3.277360038203753 4149.0 7.907703984819735 0.0 - - - - - - - 697.0 8 12 EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 2045 261 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47489.[MT7]-LDISDEFSEVIK[MT7].3b5_1.heavy 561.641 / 688.363 16004.0 39.77672576904297 37 11 10 6 10 0.9343913572226402 71.34769189734897 0.0348968505859375 3 0.8615196240144282 3.277360038203753 16004.0 43.98547362067086 0.0 - - - - - - - 639.8571428571429 32 7 EHD1;EHD3 EH-domain containing 1;EH-domain containing 3 2047 262 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57642.[MT7]-VTDYIAEK[MT7].2y4_1.heavy 613.847 / 604.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 2049 262 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57642.[MT7]-VTDYIAEK[MT7].2y5_1.heavy 613.847 / 767.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 2051 262 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57642.[MT7]-VTDYIAEK[MT7].2b4_1.heavy 613.847 / 623.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 2053 262 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB57642.[MT7]-VTDYIAEK[MT7].2y7_1.heavy 613.847 / 983.517 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOC7 exocyst complex component 7 2055 263 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540293.[MT7]-DPTQPILEALDK[MT7].3y3_1.heavy 543.31 / 519.326 24880.0 37.853400230407715 46 20 10 6 10 8.599315008228668 11.628833215704994 0.037601470947265625 3 0.9943038980939295 16.34433029313639 24880.0 22.004475592599032 0.0 - - - - - - - 1717.0 49 7 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 2057 263 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540293.[MT7]-DPTQPILEALDK[MT7].3y6_1.heavy 543.31 / 832.49 17794.0 37.853400230407715 46 20 10 6 10 8.599315008228668 11.628833215704994 0.037601470947265625 3 0.9943038980939295 16.34433029313639 17794.0 128.25545454545454 0.0 - - - - - - - 256.6666666666667 35 12 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 2059 263 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540293.[MT7]-DPTQPILEALDK[MT7].3b4_1.heavy 543.31 / 586.295 74872.0 37.853400230407715 46 20 10 6 10 8.599315008228668 11.628833215704994 0.037601470947265625 3 0.9943038980939295 16.34433029313639 74872.0 93.69890687633149 0.0 - - - - - - - 385.0 149 2 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 2061 263 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540293.[MT7]-DPTQPILEALDK[MT7].3y4_1.heavy 543.31 / 590.363 24418.0 37.853400230407715 46 20 10 6 10 8.599315008228668 11.628833215704994 0.037601470947265625 3 0.9943038980939295 16.34433029313639 24418.0 65.44139315230224 0.0 - - - - - - - 663.3846153846154 48 13 IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) 2063 264 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540665.[MT7]-LK[MT7]QEEETLSFIR.3y7_1.heavy 594.34 / 865.478 18633.0 34.02349853515625 50 20 10 10 10 7.099067403503381 14.086357308095163 0.0 3 0.9901418833629664 12.419610330980948 18633.0 71.09507932944169 0.0 - - - - - - - 192.2 37 15 EXOC7 exocyst complex component 7 2065 264 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540665.[MT7]-LK[MT7]QEEETLSFIR.3y6_1.heavy 594.34 / 736.435 25982.0 34.02349853515625 50 20 10 10 10 7.099067403503381 14.086357308095163 0.0 3 0.9901418833629664 12.419610330980948 25982.0 138.44694285714286 0.0 - - - - - - - 218.4375 51 16 EXOC7 exocyst complex component 7 2067 264 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540665.[MT7]-LK[MT7]QEEETLSFIR.3y8_1.heavy 594.34 / 994.52 12160.0 34.02349853515625 50 20 10 10 10 7.099067403503381 14.086357308095163 0.0 3 0.9901418833629664 12.419610330980948 12160.0 40.53333333333333 0.0 - - - - - - - 161.23076923076923 24 13 EXOC7 exocyst complex component 7 2069 264 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540665.[MT7]-LK[MT7]QEEETLSFIR.3y5_1.heavy 594.34 / 635.388 23182.0 34.02349853515625 50 20 10 10 10 7.099067403503381 14.086357308095163 0.0 3 0.9901418833629664 12.419610330980948 23182.0 77.84852613551446 0.0 - - - - - - - 655.875 46 8 EXOC7 exocyst complex component 7 2071 265 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541277.[MT7]-TLSPGHTWEEAPLLTLK[MT7].4b11_2.heavy 546.059 / 677.331 185599.0 38.366798400878906 43 13 10 10 10 2.156306234435891 36.885879452750956 0.0 3 0.9186725346301714 4.2978921775856085 185599.0 156.13632357654097 0.0 - - - - - - - 296.0 371 2 IL2RB interleukin 2 receptor, beta 2073 265 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541277.[MT7]-TLSPGHTWEEAPLLTLK[MT7].4b5_1.heavy 546.059 / 600.347 29601.0 38.366798400878906 43 13 10 10 10 2.156306234435891 36.885879452750956 0.0 3 0.9186725346301714 4.2978921775856085 29601.0 45.950270270270266 0.0 - - - - - - - 762.7692307692307 59 13 IL2RB interleukin 2 receptor, beta 2075 265 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541277.[MT7]-TLSPGHTWEEAPLLTLK[MT7].4y3_1.heavy 546.059 / 505.347 158958.0 38.366798400878906 43 13 10 10 10 2.156306234435891 36.885879452750956 0.0 3 0.9186725346301714 4.2978921775856085 158958.0 95.21224251278305 0.0 - - - - - - - 407.0 317 2 IL2RB interleukin 2 receptor, beta 2077 265 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541277.[MT7]-TLSPGHTWEEAPLLTLK[MT7].4b10_2.heavy 546.059 / 641.813 106490.0 38.366798400878906 43 13 10 10 10 2.156306234435891 36.885879452750956 0.0 3 0.9186725346301714 4.2978921775856085 106490.0 71.48979020979021 0.0 - - - - - - - 721.5 212 8 IL2RB interleukin 2 receptor, beta 2079 266 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47297.[MT7]-GGGEGGAGADEEK[MT7].2y3_1.heavy 711.341 / 549.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 2081 266 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47297.[MT7]-GGGEGGAGADEEK[MT7].2b6_1.heavy 711.341 / 559.259 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 2083 266 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47297.[MT7]-GGGEGGAGADEEK[MT7].2b5_1.heavy 711.341 / 502.238 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 2085 266 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47297.[MT7]-GGGEGGAGADEEK[MT7].2b10_1.heavy 711.341 / 873.382 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBA inhibin, beta A 2087 267 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539458.[MT7]-ALEDFADNIK[MT7].3y3_1.heavy 475.261 / 518.342 47126.0 35.10449981689453 48 18 10 10 10 4.046839371518471 24.710642261661498 0.0 3 0.989436868649335 11.997285521662613 47126.0 64.06037150662091 0.0 - - - - - - - 672.2222222222222 94 9 EXOC7 exocyst complex component 7 2089 267 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539458.[MT7]-ALEDFADNIK[MT7].3b4_1.heavy 475.261 / 573.3 171800.0 35.10449981689453 48 18 10 10 10 4.046839371518471 24.710642261661498 0.0 3 0.989436868649335 11.997285521662613 171800.0 263.9796536463892 0.0 - - - - - - - 766.8888888888889 343 9 EXOC7 exocyst complex component 7 2091 267 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539458.[MT7]-ALEDFADNIK[MT7].3b5_1.heavy 475.261 / 720.369 53091.0 35.10449981689453 48 18 10 10 10 4.046839371518471 24.710642261661498 0.0 3 0.989436868649335 11.997285521662613 53091.0 354.01330985915496 0.0 - - - - - - - 267.7857142857143 106 14 EXOC7 exocyst complex component 7 2093 267 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539458.[MT7]-ALEDFADNIK[MT7].3y4_1.heavy 475.261 / 633.369 37496.0 35.10449981689453 48 18 10 10 10 4.046839371518471 24.710642261661498 0.0 3 0.989436868649335 11.997285521662613 37496.0 42.56272439235795 0.0 - - - - - - - 608.5714285714286 74 7 EXOC7 exocyst complex component 7 2095 268 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58274.[MT7]-ESAYAK[MT7].2y4_1.heavy 478.768 / 596.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR1 interferon gamma receptor 1 2097 268 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58274.[MT7]-ESAYAK[MT7].2y5_1.heavy 478.768 / 683.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR1 interferon gamma receptor 1 2099 268 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB58274.[MT7]-ESAYAK[MT7].2y3_1.heavy 478.768 / 525.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNGR1 interferon gamma receptor 1 2101 269 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539451.[MT7]-GGGEGGAGADEEK[MT7].3b6_1.heavy 474.563 / 559.259 9728.0 14.234000205993652 43 17 10 6 10 3.9282107041040564 25.45688292522688 0.039600372314453125 3 0.9775568885054798 8.222525521023009 9728.0 21.73190611368829 0.0 - - - - - - - 317.46153846153845 19 13 INHBA inhibin, beta A 2103 269 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539451.[MT7]-GGGEGGAGADEEK[MT7].3b5_1.heavy 474.563 / 502.238 2082.0 14.234000205993652 43 17 10 6 10 3.9282107041040564 25.45688292522688 0.039600372314453125 3 0.9775568885054798 8.222525521023009 2082.0 9.21796361779339 1.0 - - - - - - - 198.7 4 20 INHBA inhibin, beta A 2105 269 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539451.[MT7]-GGGEGGAGADEEK[MT7].3y4_1.heavy 474.563 / 664.327 6057.0 14.234000205993652 43 17 10 6 10 3.9282107041040564 25.45688292522688 0.039600372314453125 3 0.9775568885054798 8.222525521023009 6057.0 41.11836584854206 0.0 - - - - - - - 237.10526315789474 12 19 INHBA inhibin, beta A 2107 269 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539451.[MT7]-GGGEGGAGADEEK[MT7].3b8_1.heavy 474.563 / 687.318 4997.0 14.234000205993652 43 17 10 6 10 3.9282107041040564 25.45688292522688 0.039600372314453125 3 0.9775568885054798 8.222525521023009 4997.0 20.75951104463875 0.0 - - - - - - - 187.3684210526316 9 19 INHBA inhibin, beta A 2109 270 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541281.[MT7]-HPQGSLDTGEEAEEVGLK[MT7].4y4_1.heavy 546.781 / 560.389 21764.0 27.010900497436523 41 11 10 10 10 2.4313353534918174 32.81579383151156 0.0 3 0.852435924732117 3.1723483674078836 21764.0 48.141487785658 0.0 - - - - - - - 709.9333333333333 43 15 INHBA inhibin, beta A 2111 270 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541281.[MT7]-HPQGSLDTGEEAEEVGLK[MT7].4b11_2.heavy 546.781 / 648.303 24137.0 27.010900497436523 41 11 10 10 10 2.4313353534918174 32.81579383151156 0.0 3 0.852435924732117 3.1723483674078836 24137.0 42.97385018477458 0.0 - - - - - - - 682.2857142857143 48 14 INHBA inhibin, beta A 2113 270 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541281.[MT7]-HPQGSLDTGEEAEEVGLK[MT7].4b7_1.heavy 546.781 / 879.444 4862.0 27.010900497436523 41 11 10 10 10 2.4313353534918174 32.81579383151156 0.0 3 0.852435924732117 3.1723483674078836 4862.0 68.73862068965516 0.0 - - - - - - - 156.91666666666666 9 24 INHBA inhibin, beta A 2115 270 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB541281.[MT7]-HPQGSLDTGEEAEEVGLK[MT7].4b10_2.heavy 546.781 / 583.782 19622.0 27.010900497436523 41 11 10 10 10 2.4313353534918174 32.81579383151156 0.0 3 0.852435924732117 3.1723483674078836 19622.0 17.62626886906744 0.0 - - - - - - - 1240.5714285714287 39 7 INHBA inhibin, beta A 2117 271 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59125.[MT7]-FDLLK[MT7].2b3_1.heavy 462.294 / 520.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - FMO2;SEPT11;FASTKD5;CFLAR flavin containing monooxygenase 2 (non-functional);septin 11;FAST kinase domains 5;CASP8 and FADD-like apoptosis regulator 2119 271 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59125.[MT7]-FDLLK[MT7].2y4_1.heavy 462.294 / 632.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - FMO2;SEPT11;FASTKD5;CFLAR flavin containing monooxygenase 2 (non-functional);septin 11;FAST kinase domains 5;CASP8 and FADD-like apoptosis regulator 2121 271 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59125.[MT7]-FDLLK[MT7].2b4_1.heavy 462.294 / 633.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - FMO2;SEPT11;FASTKD5;CFLAR flavin containing monooxygenase 2 (non-functional);septin 11;FAST kinase domains 5;CASP8 and FADD-like apoptosis regulator 2123 271 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB59125.[MT7]-FDLLK[MT7].2y3_1.heavy 462.294 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - FMO2;SEPT11;FASTKD5;CFLAR flavin containing monooxygenase 2 (non-functional);septin 11;FAST kinase domains 5;CASP8 and FADD-like apoptosis regulator 2125 272 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539063.[MT7]-YHSDEYIK[MT7].3y3_1.heavy 448.234 / 567.362 14892.0 21.511850357055664 37 10 10 7 10 1.3518277966624517 63.2341050326441 0.027801513671875 3 0.8488992956704413 3.134025188030656 14892.0 34.128248194856226 0.0 - - - - - - - 687.8333333333334 29 12 HDAC2 histone deacetylase 2 2127 272 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539063.[MT7]-YHSDEYIK[MT7].3b4_1.heavy 448.234 / 647.291 7984.0 21.511850357055664 37 10 10 7 10 1.3518277966624517 63.2341050326441 0.027801513671875 3 0.8488992956704413 3.134025188030656 7984.0 102.31348148148147 0.0 - - - - - - - 165.22727272727272 15 22 HDAC2 histone deacetylase 2 2129 272 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539063.[MT7]-YHSDEYIK[MT7].3b5_1.heavy 448.234 / 776.333 8836.0 21.511850357055664 37 10 10 7 10 1.3518277966624517 63.2341050326441 0.027801513671875 3 0.8488992956704413 3.134025188030656 8836.0 139.67022967101178 0.0 - - - - - - - 163.76470588235293 17 17 HDAC2 histone deacetylase 2 2131 272 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB539063.[MT7]-YHSDEYIK[MT7].3b4_2.heavy 448.234 / 324.149 31623.0 21.511850357055664 37 10 10 7 10 1.3518277966624517 63.2341050326441 0.027801513671875 3 0.8488992956704413 3.134025188030656 31623.0 96.21602434077079 0.0 - - - - - - - 730.0 63 11 HDAC2 histone deacetylase 2 2133 273 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540679.[MT7]-TLNDELEIIEGMK[MT7].3b4_1.heavy 598.325 / 588.311 N/A 42.2963981628418 33 13 0 10 10 1.1585906271329418 60.07662213419736 0.0 3 0.9067369445002535 4.009341094548052 10192.0 23.06610526315789 1.0 - - - - - - - 702.7 254 10 HSPD1 heat shock 60kDa protein 1 (chaperonin) 2135 273 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540679.[MT7]-TLNDELEIIEGMK[MT7].3b5_1.heavy 598.325 / 717.354 17725.0 42.2963981628418 33 13 0 10 10 1.1585906271329418 60.07662213419736 0.0 3 0.9067369445002535 4.009341094548052 17725.0 124.36982000712842 0.0 - - - - - - - 238.47058823529412 35 17 HSPD1 heat shock 60kDa protein 1 (chaperonin) 2137 273 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540679.[MT7]-TLNDELEIIEGMK[MT7].3y4_1.heavy 598.325 / 608.319 29562.0 42.2963981628418 33 13 0 10 10 1.1585906271329418 60.07662213419736 0.0 3 0.9067369445002535 4.009341094548052 29562.0 82.48493538053685 0.0 - - - - - - - 585.375 59 8 HSPD1 heat shock 60kDa protein 1 (chaperonin) 2139 273 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB540679.[MT7]-TLNDELEIIEGMK[MT7].3b7_1.heavy 598.325 / 959.48 21903.0 42.2963981628418 33 13 0 10 10 1.1585906271329418 60.07662213419736 0.0 3 0.9067369445002535 4.009341094548052 21903.0 52.668967449796554 0.0 - - - - - - - 661.9090909090909 43 11 HSPD1 heat shock 60kDa protein 1 (chaperonin) 2141 274 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47475.[MT7]-EDAGDVQQFYDLLSGSLEVIR.3y7_1.heavy 833.423 / 773.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 2143 274 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47475.[MT7]-EDAGDVQQFYDLLSGSLEVIR.3b6_1.heavy 833.423 / 731.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 2145 274 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47475.[MT7]-EDAGDVQQFYDLLSGSLEVIR.3b5_1.heavy 833.423 / 632.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 2147 274 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB47475.[MT7]-EDAGDVQQFYDLLSGSLEVIR.3b7_1.heavy 833.423 / 859.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - NR4A1 nuclear receptor subfamily 4, group A, member 1 2149 275 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538861.[MT7]-RNIPMLFVR.3y6_1.heavy 430.593 / 762.433 9181.0 34.863399505615234 48 18 10 10 10 9.088632978276967 11.002754786007223 0.0 3 0.9874524399222878 11.005950831135728 9181.0 82.95739345692476 0.0 - - - - - - - 157.2 18 15 LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) 2151 275 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538861.[MT7]-RNIPMLFVR.3b3_1.heavy 430.593 / 528.337 20636.0 34.863399505615234 48 18 10 10 10 9.088632978276967 11.002754786007223 0.0 3 0.9874524399222878 11.005950831135728 20636.0 85.38548193384224 0.0 - - - - - - - 256.4 41 15 LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) 2153 275 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538861.[MT7]-RNIPMLFVR.3y4_1.heavy 430.593 / 534.34 36200.0 34.863399505615234 48 18 10 10 10 9.088632978276967 11.002754786007223 0.0 3 0.9874524399222878 11.005950831135728 36200.0 105.75385248381437 0.0 - - - - - - - 262.1333333333333 72 15 LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) 2155 275 B20140228_KEGG1700_set09_02 B20140228_KEGG1700_set09_02 TB538861.[MT7]-RNIPMLFVR.3y5_1.heavy 430.593 / 665.38 20986.0 34.863399505615234 48 18 10 10 10 9.088632978276967 11.002754786007223 0.0 3 0.9874524399222878 11.005950831135728 20986.0 44.236830532657926 0.0 - - - - - - - 189.25 41 12 LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae)