Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB543184.[MT7]-LIVLVPPSK[MT7]PTVNIPSSATIGNR.4y8_1.heavy 666.153 / 805.416 5626.0 37.2318000793457 45 15 10 10 10 2.210645550364725 37.634167411455444 0.0 3 0.9592148359577752 6.0900945619264615 5626.0 9.0016 0.0 - - - - - - - 225.1 11 10 F11R F11 receptor 3 1 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB543184.[MT7]-LIVLVPPSK[MT7]PTVNIPSSATIGNR.4y9_1.heavy 666.153 / 902.469 13596.0 37.2318000793457 45 15 10 10 10 2.210645550364725 37.634167411455444 0.0 3 0.9592148359577752 6.0900945619264615 13596.0 20.774821860370928 0.0 - - - - - - - 246.375 27 8 F11R F11 receptor 5 1 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB543184.[MT7]-LIVLVPPSK[MT7]PTVNIPSSATIGNR.4b4_1.heavy 666.153 / 583.43 19503.0 37.2318000793457 45 15 10 10 10 2.210645550364725 37.634167411455444 0.0 3 0.9592148359577752 6.0900945619264615 19503.0 8.423049853372433 0.0 - - - - - - - 337.6 39 5 F11R F11 receptor 7 1 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB543184.[MT7]-LIVLVPPSK[MT7]PTVNIPSSATIGNR.4b5_1.heavy 666.153 / 682.498 8064.0 37.2318000793457 45 15 10 10 10 2.210645550364725 37.634167411455444 0.0 3 0.9592148359577752 6.0900945619264615 8064.0 2.368957808029134 1.0 - - - - - - - 250.0 23 6 F11R F11 receptor 9 2 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541081.[MT7]-FLESPDFQPSVAK[MT7].3b6_1.heavy 584.985 / 833.416 28828.0 34.70272350311279 41 15 10 6 10 2.2631174427133014 35.27821635014214 0.039699554443359375 3 0.9556699759948549 5.839771159149896 28828.0 76.32868181818182 0.0 - - - - - - - 243.57142857142858 57 14 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 11 2 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541081.[MT7]-FLESPDFQPSVAK[MT7].3b4_1.heavy 584.985 / 621.336 31909.0 34.70272350311279 41 15 10 6 10 2.2631174427133014 35.27821635014214 0.039699554443359375 3 0.9556699759948549 5.839771159149896 31909.0 46.2360279811098 0.0 - - - - - - - 770.0 63 10 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 13 2 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541081.[MT7]-FLESPDFQPSVAK[MT7].3b3_1.heavy 584.985 / 534.304 16395.0 34.70272350311279 41 15 10 6 10 2.2631174427133014 35.27821635014214 0.039699554443359375 3 0.9556699759948549 5.839771159149896 16395.0 33.05910984848485 0.0 - - - - - - - 761.5384615384615 32 13 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 15 2 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541081.[MT7]-FLESPDFQPSVAK[MT7].3y5_1.heavy 584.985 / 645.405 62718.0 34.70272350311279 41 15 10 6 10 2.2631174427133014 35.27821635014214 0.039699554443359375 3 0.9556699759948549 5.839771159149896 62718.0 116.28831968031969 0.0 - - - - - - - 693.0 125 10 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 17 3 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542951.[MT7]-TITTLYVGGLGDTITETDLR.2y8_1.heavy 1142.11 / 948.5 618.0 40.966200828552246 37 11 10 6 10 1.7117697121867024 51.14996008047305 0.037197113037109375 3 0.8730592318723575 3.426548228860035 618.0 9.40592375366569 0.0 - - - - - - - 0.0 1 0 RBM22 RNA binding motif protein 22 19 3 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542951.[MT7]-TITTLYVGGLGDTITETDLR.2b4_1.heavy 1142.11 / 561.336 1159.0 40.966200828552246 37 11 10 6 10 1.7117697121867024 51.14996008047305 0.037197113037109375 3 0.8730592318723575 3.426548228860035 1159.0 18.013782991202344 0.0 - - - - - - - 206.16666666666666 2 6 RBM22 RNA binding motif protein 22 21 3 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542951.[MT7]-TITTLYVGGLGDTITETDLR.2b6_1.heavy 1142.11 / 837.484 2704.0 40.966200828552246 37 11 10 6 10 1.7117697121867024 51.14996008047305 0.037197113037109375 3 0.8730592318723575 3.426548228860035 2704.0 24.731523915461622 0.0 - - - - - - - 136.92307692307693 5 13 RBM22 RNA binding motif protein 22 23 3 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542951.[MT7]-TITTLYVGGLGDTITETDLR.2y10_1.heavy 1142.11 / 1120.55 773.0 40.966200828552246 37 11 10 6 10 1.7117697121867024 51.14996008047305 0.037197113037109375 3 0.8730592318723575 3.426548228860035 773.0 9.035064935064936 0.0 - - - - - - - 0.0 1 0 RBM22 RNA binding motif protein 22 25 4 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55666.[MT7]-LDPPEDK[MT7].2y4_1.heavy 551.305 / 632.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 27 4 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55666.[MT7]-LDPPEDK[MT7].2y5_1.heavy 551.305 / 729.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 29 4 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55666.[MT7]-LDPPEDK[MT7].2b6_1.heavy 551.305 / 811.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 31 4 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55666.[MT7]-LDPPEDK[MT7].2y3_1.heavy 551.305 / 535.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 33 5 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541315.[MT7]-FRHENIIGINDIIR.3y7_1.heavy 618.687 / 800.463 43884.0 34.24330139160156 47 17 10 10 10 4.303248345273329 23.238259095559663 0.0 3 0.97555950860074 7.8780527024636395 43884.0 108.66489402238628 0.0 - - - - - - - 221.375 87 8 MAPK1 mitogen-activated protein kinase 1 35 5 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541315.[MT7]-FRHENIIGINDIIR.3b5_1.heavy 618.687 / 828.423 8733.0 34.24330139160156 47 17 10 10 10 4.303248345273329 23.238259095559663 0.0 3 0.97555950860074 7.8780527024636395 8733.0 43.941610859728506 0.0 - - - - - - - 261.45454545454544 17 11 MAPK1 mitogen-activated protein kinase 1 37 5 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541315.[MT7]-FRHENIIGINDIIR.3y8_1.heavy 618.687 / 913.547 18349.0 34.24330139160156 47 17 10 10 10 4.303248345273329 23.238259095559663 0.0 3 0.97555950860074 7.8780527024636395 18349.0 41.658325940700166 0.0 - - - - - - - 212.08333333333334 36 12 MAPK1 mitogen-activated protein kinase 1 39 5 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541315.[MT7]-FRHENIIGINDIIR.3y5_1.heavy 618.687 / 630.357 14259.0 34.24330139160156 47 17 10 10 10 4.303248345273329 23.238259095559663 0.0 3 0.97555950860074 7.8780527024636395 14259.0 45.594389140271495 0.0 - - - - - - - 306.2307692307692 28 13 MAPK1 mitogen-activated protein kinase 1 41 6 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541089.[MT7]-FLESPDFQPSIAK[MT7].3b6_1.heavy 589.657 / 833.416 35715.0 35.880401611328125 50 20 10 10 10 6.693300447737827 14.940312448367319 0.0 3 0.9912137256141129 13.15653391459304 35715.0 94.12101262801164 0.0 - - - - - - - 695.625 71 8 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 43 6 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541089.[MT7]-FLESPDFQPSIAK[MT7].3b4_1.heavy 589.657 / 621.336 28835.0 35.880401611328125 50 20 10 10 10 6.693300447737827 14.940312448367319 0.0 3 0.9912137256141129 13.15653391459304 28835.0 51.13650790691398 0.0 - - - - - - - 693.5714285714286 57 7 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 45 6 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541089.[MT7]-FLESPDFQPSIAK[MT7].3b3_1.heavy 589.657 / 534.304 19325.0 35.880401611328125 50 20 10 10 10 6.693300447737827 14.940312448367319 0.0 3 0.9912137256141129 13.15653391459304 19325.0 40.78628033438051 0.0 - - - - - - - 278.375 38 8 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 47 6 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541089.[MT7]-FLESPDFQPSIAK[MT7].3y5_1.heavy 589.657 / 659.421 61212.0 35.880401611328125 50 20 10 10 10 6.693300447737827 14.940312448367319 0.0 3 0.9912137256141129 13.15653391459304 61212.0 81.0828622699832 1.0 - - - - - - - 674.3333333333334 130 9 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 49 7 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540752.[MT7]-IK[MT7]VPVSQPIVK[MT7].3y6_1.heavy 547.366 / 815.511 1456.0 28.848000526428223 39 17 10 6 6 2.297459410261295 33.01288088731792 0.032001495361328125 5 0.9795741480893955 8.62045640974108 1456.0 3.6460767946577626 0.0 - - - - - - - 232.42857142857142 2 7 PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 51 7 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540752.[MT7]-IK[MT7]VPVSQPIVK[MT7].3y3_1.heavy 547.366 / 503.367 5993.0 28.848000526428223 39 17 10 6 6 2.297459410261295 33.01288088731792 0.032001495361328125 5 0.9795741480893955 8.62045640974108 5993.0 5.159108602569093 3.0 - - - - - - - 1198.625 27 8 PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 53 7 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540752.[MT7]-IK[MT7]VPVSQPIVK[MT7].3b3_1.heavy 547.366 / 629.459 4538.0 28.848000526428223 39 17 10 6 6 2.297459410261295 33.01288088731792 0.032001495361328125 5 0.9795741480893955 8.62045640974108 4538.0 10.037593652517259 1.0 - - - - - - - 637.5555555555555 9 9 PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 55 7 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540752.[MT7]-IK[MT7]VPVSQPIVK[MT7].3y4_1.heavy 547.366 / 600.42 20549.0 28.848000526428223 39 17 10 6 6 2.297459410261295 33.01288088731792 0.032001495361328125 5 0.9795741480893955 8.62045640974108 20549.0 39.056637051808636 0.0 - - - - - - - 695.75 41 8 PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 57 8 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541044.[MT7]-VWEWDIPVDFK[MT7].3y3_1.heavy 574.643 / 553.31 20264.0 45.06119918823242 46 16 10 10 10 2.717352279855707 33.473375627200824 0.0 3 0.9681590462425055 6.897793466888793 20264.0 159.3628374140898 1.0 - - - - - - - 225.75 46 12 CDC40 cell division cycle 40 homolog (S. cerevisiae) 59 8 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541044.[MT7]-VWEWDIPVDFK[MT7].3b5_1.heavy 574.643 / 860.406 20452.0 45.06119918823242 46 16 10 10 10 2.717352279855707 33.473375627200824 0.0 3 0.9681590462425055 6.897793466888793 20452.0 230.49079365079365 0.0 - - - - - - - 240.54545454545453 40 11 CDC40 cell division cycle 40 homolog (S. cerevisiae) 61 8 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541044.[MT7]-VWEWDIPVDFK[MT7].3b3_1.heavy 574.643 / 559.3 12083.0 45.06119918823242 46 16 10 10 10 2.717352279855707 33.473375627200824 0.0 3 0.9681590462425055 6.897793466888793 12083.0 58.76882764036121 0.0 - - - - - - - 202.5 24 14 CDC40 cell division cycle 40 homolog (S. cerevisiae) 63 8 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541044.[MT7]-VWEWDIPVDFK[MT7].3y5_1.heavy 574.643 / 749.431 16110.0 45.06119918823242 46 16 10 10 10 2.717352279855707 33.473375627200824 0.0 3 0.9681590462425055 6.897793466888793 16110.0 55.12687119881065 0.0 - - - - - - - 203.8235294117647 32 17 CDC40 cell division cycle 40 homolog (S. cerevisiae) 65 9 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55511.[MT7]-IENLAK[MT7].2b3_1.heavy 488.307 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 67 9 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55511.[MT7]-IENLAK[MT7].2y4_1.heavy 488.307 / 589.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 69 9 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55511.[MT7]-IENLAK[MT7].2y5_1.heavy 488.307 / 718.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 71 9 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55511.[MT7]-IENLAK[MT7].2b5_1.heavy 488.307 / 685.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 73 10 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56504.[MT7]-DAGLSFK[MT7].2y4_1.heavy 513.297 / 638.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 75 10 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56504.[MT7]-DAGLSFK[MT7].2y5_1.heavy 513.297 / 695.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 77 10 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56504.[MT7]-DAGLSFK[MT7].2y3_1.heavy 513.297 / 525.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 79 10 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56504.[MT7]-DAGLSFK[MT7].2y6_1.heavy 513.297 / 766.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 81 11 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537363.[MT7]-SVLEAQR.2y4_1.heavy 473.776 / 503.257 5618.0 21.083900451660156 50 20 10 10 10 7.895702918927777 12.665116839727784 0.0 3 0.9923184767276881 14.072144903962071 5618.0 20.586062525568444 0.0 - - - - - - - 685.5454545454545 11 11 TOLLIP toll interacting protein 83 11 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537363.[MT7]-SVLEAQR.2y5_1.heavy 473.776 / 616.341 13348.0 21.083900451660156 50 20 10 10 10 7.895702918927777 12.665116839727784 0.0 3 0.9923184767276881 14.072144903962071 13348.0 34.49679636129925 0.0 - - - - - - - 260.05 26 20 TOLLIP toll interacting protein 85 11 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537363.[MT7]-SVLEAQR.2b4_1.heavy 473.776 / 573.336 9238.0 21.083900451660156 50 20 10 10 10 7.895702918927777 12.665116839727784 0.0 3 0.9923184767276881 14.072144903962071 9238.0 19.97579063996365 0.0 - - - - - - - 307.94444444444446 18 18 TOLLIP toll interacting protein 87 11 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537363.[MT7]-SVLEAQR.2y6_1.heavy 473.776 / 715.41 12857.0 21.083900451660156 50 20 10 10 10 7.895702918927777 12.665116839727784 0.0 3 0.9923184767276881 14.072144903962071 12857.0 58.99896551724139 0.0 - - - - - - - 199.9 25 20 TOLLIP toll interacting protein 89 12 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538126.[MT7]-ETEEEK[MT7].2y4_1.heavy 526.771 / 678.343 418.0 13.772000312805176 46 16 10 10 10 1.2521878819547525 50.070077554246474 0.0 3 0.968906838910067 6.980686944314033 418.0 5.977399999999999 0.0 - - - - - - - 0.0 0 0 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 91 12 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538126.[MT7]-ETEEEK[MT7].2b3_1.heavy 526.771 / 504.242 N/A 13.772000312805176 46 16 10 10 10 1.2521878819547525 50.070077554246474 0.0 3 0.968906838910067 6.980686944314033 736.0 6.621693275278181 6.0 - - - - - - - 234.57142857142858 2 28 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 93 12 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538126.[MT7]-ETEEEK[MT7].2y5_1.heavy 526.771 / 779.39 2269.0 13.772000312805176 46 16 10 10 10 1.2521878819547525 50.070077554246474 0.0 3 0.968906838910067 6.980686944314033 2269.0 69.58266666666667 0.0 - - - - - - - 90.19047619047619 4 21 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 95 12 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538126.[MT7]-ETEEEK[MT7].2y3_1.heavy 526.771 / 549.3 1234.0 13.772000312805176 46 16 10 10 10 1.2521878819547525 50.070077554246474 0.0 3 0.968906838910067 6.980686944314033 1234.0 19.744 0.0 - - - - - - - 64.17391304347827 2 23 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 97 13 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55523.[MT7]-SEGEFK[MT7].2y4_1.heavy 492.766 / 624.347 1055.0 22.102699279785156 27 5 10 10 2 0.5322892508617387 95.35360167910511 0.0 13 0.6895359603594375 2.1548653142415004 1055.0 2.784377031419285 5.0 - - - - - - - 252.96666666666667 3 30 F11R F11 receptor 99 13 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55523.[MT7]-SEGEFK[MT7].2y5_1.heavy 492.766 / 753.39 2557.0 22.102699279785156 27 5 10 10 2 0.5322892508617387 95.35360167910511 0.0 13 0.6895359603594375 2.1548653142415004 2557.0 13.772513237388193 0.0 - - - - - - - 736.2857142857143 5 7 F11R F11 receptor 101 13 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55523.[MT7]-SEGEFK[MT7].2b4_1.heavy 492.766 / 547.248 649.0 22.102699279785156 27 5 10 10 2 0.5322892508617387 95.35360167910511 0.0 13 0.6895359603594375 2.1548653142415004 649.0 1.861339078331706 18.0 - - - - - - - 0.0 1 0 F11R F11 receptor 103 13 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55523.[MT7]-SEGEFK[MT7].2b5_1.heavy 492.766 / 694.316 N/A 22.102699279785156 27 5 10 10 2 0.5322892508617387 95.35360167910511 0.0 13 0.6895359603594375 2.1548653142415004 325.0 0.012269684441211431 25.0 - - - - - - - 0.0 1 0 F11R F11 receptor 105 14 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540176.[MT7]-VTFLPTGITFK[MT7].3y6_1.heavy 504.641 / 810.484 24567.0 41.413299560546875 50 20 10 10 10 9.872200093123768 10.1294543320341 0.0 3 0.9914959700648789 13.37339670342956 24567.0 336.667625849197 0.0 - - - - - - - 208.0 49 13 F11R F11 receptor 107 14 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540176.[MT7]-VTFLPTGITFK[MT7].3y3_1.heavy 504.641 / 539.331 359007.0 41.413299560546875 50 20 10 10 10 9.872200093123768 10.1294543320341 0.0 3 0.9914959700648789 13.37339670342956 359007.0 865.2665642785403 0.0 - - - - - - - 322.0 718 6 F11R F11 receptor 109 14 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540176.[MT7]-VTFLPTGITFK[MT7].3b4_1.heavy 504.641 / 605.378 301452.0 41.413299560546875 50 20 10 10 10 9.872200093123768 10.1294543320341 0.0 3 0.9914959700648789 13.37339670342956 301452.0 876.506191195736 0.0 - - - - - - - 283.5 602 6 F11R F11 receptor 111 14 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540176.[MT7]-VTFLPTGITFK[MT7].3y5_1.heavy 504.641 / 709.437 59564.0 41.413299560546875 50 20 10 10 10 9.872200093123768 10.1294543320341 0.0 3 0.9914959700648789 13.37339670342956 59564.0 425.6961092979127 0.0 - - - - - - - 231.91666666666666 119 12 F11R F11 receptor 113 15 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56908.[MT7]-SQWSPALTVSK[MT7].3b6_1.heavy 497.952 / 801.401 23046.0 30.85449981689453 42 12 10 10 10 0.9725082938072727 62.582880168758685 0.0 3 0.8995767462801912 3.861374802931953 23046.0 225.3451287396679 0.0 - - - - - - - 285.5 46 10 UBE2D4;UBE2D1 ubiquitin-conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) 115 15 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56908.[MT7]-SQWSPALTVSK[MT7].3b4_1.heavy 497.952 / 633.311 26197.0 30.85449981689453 42 12 10 10 10 0.9725082938072727 62.582880168758685 0.0 3 0.8995767462801912 3.861374802931953 26197.0 77.01669919616802 0.0 - - - - - - - 324.6 52 10 UBE2D4;UBE2D1 ubiquitin-conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) 117 15 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56908.[MT7]-SQWSPALTVSK[MT7].3b3_1.heavy 497.952 / 546.279 10341.0 30.85449981689453 42 12 10 10 10 0.9725082938072727 62.582880168758685 0.0 3 0.8995767462801912 3.861374802931953 10341.0 21.061829215890732 0.0 - - - - - - - 731.5714285714286 20 7 UBE2D4;UBE2D1 ubiquitin-conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) 119 15 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56908.[MT7]-SQWSPALTVSK[MT7].3y4_1.heavy 497.952 / 578.363 32008.0 30.85449981689453 42 12 10 10 10 0.9725082938072727 62.582880168758685 0.0 3 0.8995767462801912 3.861374802931953 32008.0 56.13769080072308 0.0 - - - - - - - 731.2857142857143 64 7 UBE2D4;UBE2D1 ubiquitin-conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) 121 16 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55795.[MT7]-FFMGTVVK[MT7].2y4_1.heavy 608.854 / 590.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 123 16 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55795.[MT7]-FFMGTVVK[MT7].2y5_1.heavy 608.854 / 647.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 125 16 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55795.[MT7]-FFMGTVVK[MT7].2y6_1.heavy 608.854 / 778.461 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 127 16 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55795.[MT7]-FFMGTVVK[MT7].2y7_1.heavy 608.854 / 925.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 129 17 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57198.[MT7]-LIAEGTVTLQEFEEEIAK[MT7].3b6_1.heavy 770.089 / 729.426 6113.0 46.89060115814209 40 14 10 6 10 1.2502513858518676 52.74722834339992 0.035602569580078125 3 0.930589803414156 4.656998540324128 6113.0 70.23003409090909 0.0 - - - - - - - 119.43478260869566 12 23 OGDHL oxoglutarate dehydrogenase-like 131 17 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57198.[MT7]-LIAEGTVTLQEFEEEIAK[MT7].3b4_1.heavy 770.089 / 571.357 3990.0 46.89060115814209 40 14 10 6 10 1.2502513858518676 52.74722834339992 0.035602569580078125 3 0.930589803414156 4.656998540324128 3990.0 58.24816680096696 0.0 - - - - - - - 172.64285714285714 7 14 OGDHL oxoglutarate dehydrogenase-like 133 17 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57198.[MT7]-LIAEGTVTLQEFEEEIAK[MT7].3b5_1.heavy 770.089 / 628.379 2928.0 46.89060115814209 40 14 10 6 10 1.2502513858518676 52.74722834339992 0.035602569580078125 3 0.930589803414156 4.656998540324128 2928.0 44.332034869240346 0.0 - - - - - - - 128.125 5 24 OGDHL oxoglutarate dehydrogenase-like 135 17 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57198.[MT7]-LIAEGTVTLQEFEEEIAK[MT7].3b8_1.heavy 770.089 / 929.542 4466.0 46.89060115814209 40 14 10 6 10 1.2502513858518676 52.74722834339992 0.035602569580078125 3 0.930589803414156 4.656998540324128 4466.0 57.20150684931507 0.0 - - - - - - - 128.2 8 20 OGDHL oxoglutarate dehydrogenase-like 137 18 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55652.[MT7]-LQGTQGAK[MT7].2y5_1.heavy 545.827 / 648.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 139 18 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55652.[MT7]-LQGTQGAK[MT7].2b4_1.heavy 545.827 / 544.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 141 18 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55652.[MT7]-LQGTQGAK[MT7].2y6_1.heavy 545.827 / 705.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 143 18 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55652.[MT7]-LQGTQGAK[MT7].2y7_1.heavy 545.827 / 833.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 145 19 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56517.[MT7]-FEDFLAR.2y4_1.heavy 521.278 / 506.309 25694.0 36.38309860229492 50 20 10 10 10 11.094190697684416 9.013726438006158 0.0 3 0.9962630373267268 20.18216032585704 25694.0 38.11747252747253 0.0 - - - - - - - 1189.2 51 10 OGDHL oxoglutarate dehydrogenase-like 147 19 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56517.[MT7]-FEDFLAR.2b3_1.heavy 521.278 / 536.247 27712.0 36.38309860229492 50 20 10 10 10 11.094190697684416 9.013726438006158 0.0 3 0.9962630373267268 20.18216032585704 27712.0 31.58660970994987 0.0 - - - - - - - 265.5 55 8 OGDHL oxoglutarate dehydrogenase-like 149 19 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56517.[MT7]-FEDFLAR.2b4_1.heavy 521.278 / 683.316 10405.0 36.38309860229492 50 20 10 10 10 11.094190697684416 9.013726438006158 0.0 3 0.9962630373267268 20.18216032585704 10405.0 31.525353218210356 0.0 - - - - - - - 251.0 20 11 OGDHL oxoglutarate dehydrogenase-like 151 19 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56517.[MT7]-FEDFLAR.2y6_1.heavy 521.278 / 750.378 16776.0 36.38309860229492 50 20 10 10 10 11.094190697684416 9.013726438006158 0.0 3 0.9962630373267268 20.18216032585704 16776.0 103.49220787298954 0.0 - - - - - - - 185.625 33 8 OGDHL oxoglutarate dehydrogenase-like 153 20 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541076.[MT7]-GPVYIGELPQDFLR.2b4_1.heavy 874.479 / 561.315 22736.0 42.28929901123047 46 16 10 10 10 2.5626951799811546 31.462435593566205 0.0 3 0.9651772280257033 6.594202780742304 22736.0 121.37548387096774 0.0 - - - - - - - 239.8125 45 16 TOLLIP toll interacting protein 155 20 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541076.[MT7]-GPVYIGELPQDFLR.2y9_1.heavy 874.479 / 1074.56 17668.0 42.28929901123047 46 16 10 10 10 2.5626951799811546 31.462435593566205 0.0 3 0.9651772280257033 6.594202780742304 17668.0 145.3791726858464 0.0 - - - - - - - 156.83333333333334 35 18 TOLLIP toll interacting protein 157 20 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541076.[MT7]-GPVYIGELPQDFLR.2y6_1.heavy 874.479 / 775.41 15133.0 42.28929901123047 46 16 10 10 10 2.5626951799811546 31.462435593566205 0.0 3 0.9651772280257033 6.594202780742304 15133.0 26.342443762781187 0.0 - - - - - - - 608.3 30 10 TOLLIP toll interacting protein 159 20 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541076.[MT7]-GPVYIGELPQDFLR.2y10_1.heavy 874.479 / 1187.64 12382.0 42.28929901123047 46 16 10 10 10 2.5626951799811546 31.462435593566205 0.0 3 0.9651772280257033 6.594202780742304 12382.0 109.66914285714284 0.0 - - - - - - - 150.15384615384616 24 13 TOLLIP toll interacting protein 161 21 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540747.[MT7]-LVEDHLAVQSLIR.3y7_1.heavy 546.322 / 786.483 97543.0 35.39720153808594 43 17 6 10 10 3.490746165933425 24.042081575421232 0.0 3 0.9767369030912414 8.075753817485676 97543.0 328.70426747903133 0.0 - - - - - - - 243.88235294117646 195 17 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 163 21 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540747.[MT7]-LVEDHLAVQSLIR.3y6_1.heavy 546.322 / 715.446 55207.0 35.39720153808594 43 17 6 10 10 3.490746165933425 24.042081575421232 0.0 3 0.9767369030912414 8.075753817485676 55207.0 38.32439230358736 2.0 - - - - - - - 318.9 110 10 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 165 21 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540747.[MT7]-LVEDHLAVQSLIR.3b4_1.heavy 546.322 / 601.331 92544.0 35.39720153808594 43 17 6 10 10 3.490746165933425 24.042081575421232 0.0 3 0.9767369030912414 8.075753817485676 92544.0 114.35927468099396 0.0 - - - - - - - 744.5714285714286 185 7 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 167 21 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540747.[MT7]-LVEDHLAVQSLIR.3y5_1.heavy 546.322 / 616.378 52016.0 35.39720153808594 43 17 6 10 10 3.490746165933425 24.042081575421232 0.0 3 0.9767369030912414 8.075753817485676 52016.0 41.035642392324554 1.0 - - - - - - - 699.1428571428571 282 7 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 169 22 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539098.[MT7]-LTPQVAASGGQS.2b4_1.heavy 630.339 / 584.352 15231.0 24.867399215698242 41 11 10 10 10 1.6180737603492434 55.22052016667702 0.0 3 0.8608421746953442 3.269178337062893 15231.0 54.106557441043414 0.0 - - - - - - - 651.7142857142857 30 7 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 171 22 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539098.[MT7]-LTPQVAASGGQS.2b6_1.heavy 630.339 / 754.458 14974.0 24.867399215698242 41 11 10 10 10 1.6180737603492434 55.22052016667702 0.0 3 0.8608421746953442 3.269178337062893 14974.0 102.11915241049178 0.0 - - - - - - - 225.0 29 10 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 173 22 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539098.[MT7]-LTPQVAASGGQS.2b7_1.heavy 630.339 / 825.495 13496.0 24.867399215698242 41 11 10 10 10 1.6180737603492434 55.22052016667702 0.0 3 0.8608421746953442 3.269178337062893 13496.0 272.1227150259067 0.0 - - - - - - - 124.26666666666667 26 15 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 175 22 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539098.[MT7]-LTPQVAASGGQS.2b5_1.heavy 630.339 / 683.421 14010.0 24.867399215698242 41 11 10 10 10 1.6180737603492434 55.22052016667702 0.0 3 0.8608421746953442 3.269178337062893 14010.0 123.1103929356263 0.0 - - - - - - - 206.64285714285714 28 14 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 177 23 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542948.[MT7]-TITTLYVGGLGDTITETDLR.3b6_1.heavy 761.745 / 837.484 17391.0 40.947601318359375 40 14 10 6 10 2.196173495574436 45.53374321359969 0.037200927734375 3 0.930718451157664 4.661371567011681 17391.0 38.876675754754615 0.0 - - - - - - - 225.92307692307693 34 13 RBM22 RNA binding motif protein 22 179 23 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542948.[MT7]-TITTLYVGGLGDTITETDLR.3y6_1.heavy 761.745 / 734.368 31072.0 40.947601318359375 40 14 10 6 10 2.196173495574436 45.53374321359969 0.037200927734375 3 0.930718451157664 4.661371567011681 31072.0 45.618023474577 0.0 - - - - - - - 695.625 62 8 RBM22 RNA binding motif protein 22 181 23 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542948.[MT7]-TITTLYVGGLGDTITETDLR.3b4_1.heavy 761.745 / 561.336 11362.0 40.947601318359375 40 14 10 6 10 2.196173495574436 45.53374321359969 0.037200927734375 3 0.930718451157664 4.661371567011681 11362.0 25.064125845955527 0.0 - - - - - - - 695.625 22 8 RBM22 RNA binding motif protein 22 183 23 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542948.[MT7]-TITTLYVGGLGDTITETDLR.3y10_1.heavy 761.745 / 1120.55 12444.0 40.947601318359375 40 14 10 6 10 2.196173495574436 45.53374321359969 0.037200927734375 3 0.930718451157664 4.661371567011681 12444.0 35.082356619617656 0.0 - - - - - - - 214.0 24 13 RBM22 RNA binding motif protein 22 185 24 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539663.[MT7]-NYLLSLPHK[MT7].3y3_1.heavy 458.278 / 525.326 53371.0 32.73660087585449 39 14 10 5 10 2.0767972005922726 37.479928165432895 0.041599273681640625 3 0.938318036523899 4.943394248789812 53371.0 145.89822320830862 0.0 - - - - - - - 727.75 106 8 MAPK1 mitogen-activated protein kinase 1 187 24 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539663.[MT7]-NYLLSLPHK[MT7].3b4_1.heavy 458.278 / 648.384 16604.0 32.73660087585449 39 14 10 5 10 2.0767972005922726 37.479928165432895 0.041599273681640625 3 0.938318036523899 4.943394248789812 16604.0 77.33735843635293 0.0 - - - - - - - 301.8 33 10 MAPK1 mitogen-activated protein kinase 1 189 24 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539663.[MT7]-NYLLSLPHK[MT7].3b5_1.heavy 458.278 / 735.416 12723.0 32.73660087585449 39 14 10 5 10 2.0767972005922726 37.479928165432895 0.041599273681640625 3 0.938318036523899 4.943394248789812 12723.0 127.26497010925583 0.0 - - - - - - - 246.42857142857142 25 7 MAPK1 mitogen-activated protein kinase 1 191 24 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539663.[MT7]-NYLLSLPHK[MT7].3b3_1.heavy 458.278 / 535.3 28357.0 32.73660087585449 39 14 10 5 10 2.0767972005922726 37.479928165432895 0.041599273681640625 3 0.938318036523899 4.943394248789812 28357.0 84.00799139932914 0.0 - - - - - - - 226.5 56 10 MAPK1 mitogen-activated protein kinase 1 193 25 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541321.[MT7]-FRHENIIGINDIIR.4y5_1.heavy 464.267 / 630.357 53528.0 34.24330139160156 39 9 10 10 10 1.3866346354290662 50.314689139579684 0.0 3 0.8145536471377705 2.820337565681959 53528.0 77.97538801925502 0.0 - - - - - - - 379.0 107 7 MAPK1 mitogen-activated protein kinase 1 195 25 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541321.[MT7]-FRHENIIGINDIIR.4b8_2.heavy 464.267 / 556.31 102964.0 34.24330139160156 39 9 10 10 10 1.3866346354290662 50.314689139579684 0.0 3 0.8145536471377705 2.820337565681959 102964.0 125.91437289649248 0.0 - - - - - - - 726.8571428571429 205 7 MAPK1 mitogen-activated protein kinase 1 197 25 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541321.[MT7]-FRHENIIGINDIIR.4b5_1.heavy 464.267 / 828.423 16921.0 34.24330139160156 39 9 10 10 10 1.3866346354290662 50.314689139579684 0.0 3 0.8145536471377705 2.820337565681959 16921.0 50.504158391496816 0.0 - - - - - - - 241.36363636363637 33 11 MAPK1 mitogen-activated protein kinase 1 199 25 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541321.[MT7]-FRHENIIGINDIIR.4b6_2.heavy 464.267 / 471.257 85048.0 34.24330139160156 39 9 10 10 10 1.3866346354290662 50.314689139579684 0.0 3 0.8145536471377705 2.820337565681959 85048.0 62.743931449283295 0.0 - - - - - - - 309.6 170 5 MAPK1 mitogen-activated protein kinase 1 201 26 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538705.[MT7]-LFPNADSK[MT7].2y4_1.heavy 590.334 / 564.311 N/A 28.246932983398438 42 18 10 6 8 3.22302694095087 31.026734132882428 0.03759956359863281 4 0.988840974655229 11.671980421617144 973.0 -0.1748538011695906 25.0 - - - - - - - 758.9285714285714 3 14 MAPK1 mitogen-activated protein kinase 1 203 26 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538705.[MT7]-LFPNADSK[MT7].2y5_1.heavy 590.334 / 678.354 1422.0 28.246932983398438 42 18 10 6 8 3.22302694095087 31.026734132882428 0.03759956359863281 4 0.988840974655229 11.671980421617144 1422.0 19.344834472511145 2.0 - - - - - - - 184.94117647058823 3 17 MAPK1 mitogen-activated protein kinase 1 205 26 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538705.[MT7]-LFPNADSK[MT7].2y6_1.heavy 590.334 / 775.407 9128.0 28.246932983398438 42 18 10 6 8 3.22302694095087 31.026734132882428 0.03759956359863281 4 0.988840974655229 11.671980421617144 9128.0 49.02770362976812 0.0 - - - - - - - 238.0909090909091 18 11 MAPK1 mitogen-activated protein kinase 1 207 26 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538705.[MT7]-LFPNADSK[MT7].2y7_1.heavy 590.334 / 922.475 4340.0 28.246932983398438 42 18 10 6 8 3.22302694095087 31.026734132882428 0.03759956359863281 4 0.988840974655229 11.671980421617144 4340.0 20.53335561497326 0.0 - - - - - - - 170.5 8 18 MAPK1 mitogen-activated protein kinase 1 209 27 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538133.[MT7]-RSPNEEYVEVGR.3b6_1.heavy 526.938 / 857.423 11907.0 22.095749378204346 43 16 10 7 10 3.0631078722670426 32.64658124037558 0.027799606323242188 3 0.9647768860981032 6.556399619775847 11907.0 311.87461440245147 0.0 - - - - - - - 130.66666666666666 23 18 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 211 27 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538133.[MT7]-RSPNEEYVEVGR.3y6_1.heavy 526.938 / 722.383 21193.0 22.095749378204346 43 16 10 7 10 3.0631078722670426 32.64658124037558 0.027799606323242188 3 0.9647768860981032 6.556399619775847 21193.0 163.26558632695046 0.0 - - - - - - - 189.2608695652174 42 23 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 213 27 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538133.[MT7]-RSPNEEYVEVGR.3b4_1.heavy 526.938 / 599.338 6087.0 22.095749378204346 43 16 10 7 10 3.0631078722670426 32.64658124037558 0.027799606323242188 3 0.9647768860981032 6.556399619775847 6087.0 27.40128617363344 0.0 - - - - - - - 197.86363636363637 12 22 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 215 27 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538133.[MT7]-RSPNEEYVEVGR.3y5_1.heavy 526.938 / 559.32 34433.0 22.095749378204346 43 16 10 7 10 3.0631078722670426 32.64658124037558 0.027799606323242188 3 0.9647768860981032 6.556399619775847 34433.0 140.13681880863038 0.0 - - - - - - - 310.9047619047619 68 21 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 217 28 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1011660.0 29.26099967956543 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1011660.0 3962.938020779221 0.0 - - - - - - - 667.5 2023 6 219 28 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 315256.0 29.26099967956543 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 315256.0 763.8480136986301 0.0 - - - - - - - 333.75 630 4 221 28 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 213146.0 29.26099967956543 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 213146.0 399.098124269124 0.0 - - - - - - - 1191.857142857143 426 7 223 29 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541592.[MT7]-SQGSQAELHPLPQLK[MT7].3y6_1.heavy 641.03 / 839.547 7065.0 28.734300136566162 42 16 10 6 10 1.7547453959733437 44.75941313189592 0.03439903259277344 3 0.9634289852721973 6.433708067556331 7065.0 67.20365853658537 0.0 - - - - - - - 170.3846153846154 14 13 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 225 29 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541592.[MT7]-SQGSQAELHPLPQLK[MT7].3y4_1.heavy 641.03 / 629.41 10104.0 28.734300136566162 42 16 10 6 10 1.7547453959733437 44.75941313189592 0.03439903259277344 3 0.9634289852721973 6.433708067556331 10104.0 53.14465334013711 0.0 - - - - - - - 266.9375 20 16 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 227 29 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541592.[MT7]-SQGSQAELHPLPQLK[MT7].3b8_1.heavy 641.03 / 945.476 4190.0 28.734300136566162 42 16 10 6 10 1.7547453959733437 44.75941313189592 0.03439903259277344 3 0.9634289852721973 6.433708067556331 4190.0 47.77621951219512 0.0 - - - - - - - 131.2 8 10 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 229 29 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541592.[MT7]-SQGSQAELHPLPQLK[MT7].3b7_1.heavy 641.03 / 832.392 5011.0 28.734300136566162 42 16 10 6 10 1.7547453959733437 44.75941313189592 0.03439903259277344 3 0.9634289852721973 6.433708067556331 5011.0 30.160861373212274 0.0 - - - - - - - 184.6875 10 16 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 231 30 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55901.[MT7]-MYEEFLSK[MT7].2b3_1.heavy 667.849 / 568.256 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 233 30 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55901.[MT7]-MYEEFLSK[MT7].2y5_1.heavy 667.849 / 767.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 235 30 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55901.[MT7]-MYEEFLSK[MT7].2b4_1.heavy 667.849 / 697.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 237 30 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55901.[MT7]-MYEEFLSK[MT7].2y7_1.heavy 667.849 / 1059.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 239 31 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55689.[MT7]-LQTVLEK[MT7].2y4_1.heavy 559.855 / 632.41 1653.0 34.27510166168213 21 14 0 5 2 2.054232253053145 48.679987304927636 0.042400360107421875 11 0.9378394817827475 4.924127693717216 1653.0 5.708181818181818 8.0 - - - - - - - 619.875 36 8 PARVA parvin, alpha 241 31 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55689.[MT7]-LQTVLEK[MT7].2y5_1.heavy 559.855 / 733.458 1764.0 34.27510166168213 21 14 0 5 2 2.054232253053145 48.679987304927636 0.042400360107421875 11 0.9378394817827475 4.924127693717216 1764.0 5.266336633663366 2.0 - - - - - - - 254.30769230769232 4 13 PARVA parvin, alpha 243 31 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55689.[MT7]-LQTVLEK[MT7].2y3_1.heavy 559.855 / 533.341 2425.0 34.27510166168213 21 14 0 5 2 2.054232253053145 48.679987304927636 0.042400360107421875 11 0.9378394817827475 4.924127693717216 2425.0 0.8997732426303857 8.0 - - - - - - - 1212.25 24 8 PARVA parvin, alpha 245 31 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55689.[MT7]-LQTVLEK[MT7].2y6_1.heavy 559.855 / 861.516 1212.0 34.27510166168213 21 14 0 5 2 2.054232253053145 48.679987304927636 0.042400360107421875 11 0.9378394817827475 4.924127693717216 1212.0 3.955270779302669 3.0 - - - - - - - 249.8 9 15 PARVA parvin, alpha 247 32 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55783.[MT7]-ELDEITAK[MT7].2y4_1.heavy 603.845 / 576.384 1054.0 32.24269994099935 31 13 8 6 4 2.051389346089006 36.84760588904266 0.0381011962890625 8 0.9149765480207086 4.202103844928797 1054.0 1.8898736176935227 12.0 - - - - - - - 650.25 6 12 CDC40 cell division cycle 40 homolog (S. cerevisiae) 249 32 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55783.[MT7]-ELDEITAK[MT7].2b3_1.heavy 603.845 / 502.263 2636.0 32.24269994099935 31 13 8 6 4 2.051389346089006 36.84760588904266 0.0381011962890625 8 0.9149765480207086 4.202103844928797 2636.0 7.998294918028365 1.0 - - - - - - - 632.5714285714286 5 7 CDC40 cell division cycle 40 homolog (S. cerevisiae) 251 32 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55783.[MT7]-ELDEITAK[MT7].2b4_1.heavy 603.845 / 631.305 3269.0 32.24269994099935 31 13 8 6 4 2.051389346089006 36.84760588904266 0.0381011962890625 8 0.9149765480207086 4.202103844928797 3269.0 6.143624051169422 1.0 - - - - - - - 255.92857142857142 6 14 CDC40 cell division cycle 40 homolog (S. cerevisiae) 253 32 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55783.[MT7]-ELDEITAK[MT7].2y7_1.heavy 603.845 / 933.537 N/A 32.24269994099935 31 13 8 6 4 2.051389346089006 36.84760588904266 0.0381011962890625 8 0.9149765480207086 4.202103844928797 738.0 1.6101045891525851 3.0 - - - - - - - 249.0909090909091 8 11 CDC40 cell division cycle 40 homolog (S. cerevisiae) 255 33 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56016.[MT7]-LFDELTASYK[MT7].2b3_1.heavy 737.905 / 520.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 257 33 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56016.[MT7]-LFDELTASYK[MT7].2y9_1.heavy 737.905 / 1217.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 259 33 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56016.[MT7]-LFDELTASYK[MT7].2b4_1.heavy 737.905 / 649.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 261 33 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56016.[MT7]-LFDELTASYK[MT7].2y3_1.heavy 737.905 / 541.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 263 34 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB543162.[MT7]-LEPNSVDPENITEIFIANQK[MT7].3y3_1.heavy 853.79 / 533.316 13711.0 42.6697998046875 46 16 10 10 10 2.9965835842716952 33.37133678662413 0.0 3 0.9663453305464706 6.708325332756154 13711.0 23.818873385992624 0.0 - - - - - - - 311.57142857142856 27 7 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 265 34 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB543162.[MT7]-LEPNSVDPENITEIFIANQK[MT7].3y6_1.heavy 853.79 / 864.506 11602.0 42.6697998046875 46 16 10 10 10 2.9965835842716952 33.37133678662413 0.0 3 0.9663453305464706 6.708325332756154 11602.0 39.7361682657111 0.0 - - - - - - - 320.3333333333333 23 9 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 267 34 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB543162.[MT7]-LEPNSVDPENITEIFIANQK[MT7].3y5_1.heavy 853.79 / 717.438 10618.0 42.6697998046875 46 16 10 10 10 2.9965835842716952 33.37133678662413 0.0 3 0.9663453305464706 6.708325332756154 10618.0 19.04043849591976 0.0 - - - - - - - 320.44444444444446 21 9 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 269 34 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB543162.[MT7]-LEPNSVDPENITEIFIANQK[MT7].3b7_1.heavy 853.79 / 899.459 21235.0 42.6697998046875 46 16 10 10 10 2.9965835842716952 33.37133678662413 0.0 3 0.9663453305464706 6.708325332756154 21235.0 40.843707525868616 0.0 - - - - - - - 1221.625 42 8 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 271 35 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56017.[MT7]-LFDDLTSSYK[MT7].2y4_1.heavy 738.895 / 628.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 273 35 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56017.[MT7]-LFDDLTSSYK[MT7].2y9_1.heavy 738.895 / 1219.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 275 35 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56017.[MT7]-LFDDLTSSYK[MT7].2b4_1.heavy 738.895 / 635.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 277 35 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56017.[MT7]-LFDDLTSSYK[MT7].2y3_1.heavy 738.895 / 541.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 279 36 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 383248.0 15.212800025939941 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 383248.0 1212.4301587582186 0.0 - - - - - - - 354.85714285714283 766 7 281 36 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 647292.0 15.212800025939941 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 647292.0 2582.124956962486 0.0 - - - - - - - 419.0 1294 2 283 36 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 295516.0 15.212800025939941 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 295516.0 1540.4451122835496 0.0 - - - - - - - 723.2857142857143 591 7 285 37 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56524.[MT7]-TQQMAAPR.2b3_1.heavy 523.78 / 502.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 287 37 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56524.[MT7]-TQQMAAPR.2y5_1.heavy 523.78 / 545.286 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 289 37 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56524.[MT7]-TQQMAAPR.2b5_1.heavy 523.78 / 704.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 291 37 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56524.[MT7]-TQQMAAPR.2y7_1.heavy 523.78 / 801.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 293 38 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55384.[MT7]-RDELR.2b3_1.heavy 416.742 / 545.28 N/A N/A - - - - - - - - - 0.0 - - - - - - - URGCP;EXOC4 upregulator of cell proliferation;exocyst complex component 4 295 38 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55384.[MT7]-RDELR.2y4_1.heavy 416.742 / 532.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - URGCP;EXOC4 upregulator of cell proliferation;exocyst complex component 4 297 38 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55384.[MT7]-RDELR.2b3_2.heavy 416.742 / 273.144 N/A N/A - - - - - - - - - 0.0 - - - - - - - URGCP;EXOC4 upregulator of cell proliferation;exocyst complex component 4 299 38 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55384.[MT7]-RDELR.2b4_1.heavy 416.742 / 658.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - URGCP;EXOC4 upregulator of cell proliferation;exocyst complex component 4 301 39 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537448.[MT7]-APEQVQR.2y4_1.heavy 486.273 / 530.305 1622.0 15.674049854278564 42 20 10 6 6 8.196350508148743 12.20055192863956 0.03209972381591797 5 0.9927530299932303 14.488436178412991 1622.0 13.081291704423759 2.0 - - - - - - - 179.54545454545453 8 22 OGDHL oxoglutarate dehydrogenase-like 303 39 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537448.[MT7]-APEQVQR.2y5_1.heavy 486.273 / 659.347 980.0 15.674049854278564 42 20 10 6 6 8.196350508148743 12.20055192863956 0.03209972381591797 5 0.9927530299932303 14.488436178412991 980.0 11.717391304347826 0.0 - - - - - - - 0.0 1 0 OGDHL oxoglutarate dehydrogenase-like 305 39 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537448.[MT7]-APEQVQR.2b4_1.heavy 486.273 / 570.3 1163.0 15.674049854278564 42 20 10 6 6 8.196350508148743 12.20055192863956 0.03209972381591797 5 0.9927530299932303 14.488436178412991 1163.0 7.199707148132115 0.0 - - - - - - - 161.76190476190476 2 21 OGDHL oxoglutarate dehydrogenase-like 307 39 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537448.[MT7]-APEQVQR.2y6_1.heavy 486.273 / 756.4 14755.0 15.674049854278564 42 20 10 6 6 8.196350508148743 12.20055192863956 0.03209972381591797 5 0.9927530299932303 14.488436178412991 14755.0 165.68321556562307 0.0 - - - - - - - 158.52941176470588 29 17 OGDHL oxoglutarate dehydrogenase-like 309 40 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538146.[MT7]-TTPYYK[MT7].2y4_1.heavy 530.799 / 714.394 14313.0 21.127174854278564 44 20 10 6 8 2.253360216846107 33.210306405765515 0.03470039367675781 4 0.9904988637035551 12.651153859776588 14313.0 35.65264765762291 0.0 - - - - - - - 643.8 28 15 RBM22 RNA binding motif protein 22 311 40 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538146.[MT7]-TTPYYK[MT7].2y5_1.heavy 530.799 / 815.442 4694.0 21.127174854278564 44 20 10 6 8 2.253360216846107 33.210306405765515 0.03470039367675781 4 0.9904988637035551 12.651153859776588 4694.0 46.50823221915054 0.0 - - - - - - - 141.95652173913044 9 23 RBM22 RNA binding motif protein 22 313 40 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538146.[MT7]-TTPYYK[MT7].2b4_1.heavy 530.799 / 607.321 885.0 21.127174854278564 44 20 10 6 8 2.253360216846107 33.210306405765515 0.03470039367675781 4 0.9904988637035551 12.651153859776588 885.0 3.7323999699722243 0.0 - - - - - - - 0.0 1 0 RBM22 RNA binding motif protein 22 315 40 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538146.[MT7]-TTPYYK[MT7].2y3_1.heavy 530.799 / 617.341 2385.0 21.127174854278564 44 20 10 6 8 2.253360216846107 33.210306405765515 0.03470039367675781 4 0.9904988637035551 12.651153859776588 2385.0 10.632825485719803 1.0 - - - - - - - 250.8695652173913 10 23 RBM22 RNA binding motif protein 22 317 41 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537446.[MT7]-EYIEK[MT7].2b3_1.heavy 485.278 / 550.299 1934.0 21.922200202941895 45 18 10 7 10 5.370622440376401 18.61981569365198 0.027799606323242188 3 0.9849217849511555 10.037838168670083 1934.0 9.86734693877551 0.0 - - - - - - - 250.3846153846154 3 26 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 319 41 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537446.[MT7]-EYIEK[MT7].2y4_1.heavy 485.278 / 696.405 8408.0 21.922200202941895 45 18 10 7 10 5.370622440376401 18.61981569365198 0.027799606323242188 3 0.9849217849511555 10.037838168670083 8408.0 22.843924620863703 0.0 - - - - - - - 219.54545454545453 16 22 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 321 41 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537446.[MT7]-EYIEK[MT7].2b4_1.heavy 485.278 / 679.342 1429.0 21.922200202941895 45 18 10 7 10 5.370622440376401 18.61981569365198 0.027799606323242188 3 0.9849217849511555 10.037838168670083 1429.0 6.532571428571429 0.0 - - - - - - - 217.5 2 28 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 323 41 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537446.[MT7]-EYIEK[MT7].2y3_1.heavy 485.278 / 533.341 3994.0 21.922200202941895 45 18 10 7 10 5.370622440376401 18.61981569365198 0.027799606323242188 3 0.9849217849511555 10.037838168670083 3994.0 12.65950121938797 0.0 - - - - - - - 665.0625 7 16 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 325 42 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55911.[MT7]-NLTIVDSGLK[MT7].2y4_1.heavy 674.408 / 548.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - NTRK2 neurotrophic tyrosine kinase, receptor, type 2 327 42 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55911.[MT7]-NLTIVDSGLK[MT7].2y5_1.heavy 674.408 / 663.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - NTRK2 neurotrophic tyrosine kinase, receptor, type 2 329 42 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55911.[MT7]-NLTIVDSGLK[MT7].2y6_1.heavy 674.408 / 762.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - NTRK2 neurotrophic tyrosine kinase, receptor, type 2 331 42 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55911.[MT7]-NLTIVDSGLK[MT7].2y7_1.heavy 674.408 / 875.532 N/A N/A - - - - - - - - - 0.0 - - - - - - - NTRK2 neurotrophic tyrosine kinase, receptor, type 2 333 43 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55505.[MT7]-QVPVLK[MT7].2y4_1.heavy 486.328 / 600.42 1738.0 29.08913294474284 19 2 10 3 4 0.4022016635084048 120.54863616522285 0.06949996948242188 10 0.4539660753010059 1.5872620168160785 1738.0 -0.5 11.0 - - - - - - - 1180.1 6 10 OGDHL oxoglutarate dehydrogenase-like 335 43 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55505.[MT7]-QVPVLK[MT7].2y5_1.heavy 486.328 / 699.489 6313.0 29.08913294474284 19 2 10 3 4 0.4022016635084048 120.54863616522285 0.06949996948242188 10 0.4539660753010059 1.5872620168160785 6313.0 3.526387370977535 0.0 - - - - - - - 253.88888888888889 12 9 OGDHL oxoglutarate dehydrogenase-like 337 43 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55505.[MT7]-QVPVLK[MT7].2y3_1.heavy 486.328 / 503.367 1372.0 29.08913294474284 19 2 10 3 4 0.4022016635084048 120.54863616522285 0.06949996948242188 10 0.4539660753010059 1.5872620168160785 1372.0 0.18743169398907106 11.0 - - - - - - - 1202.2857142857142 11 7 OGDHL oxoglutarate dehydrogenase-like 339 44 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56000.[MT7]-NESLAQYNPK[MT7].2b4_1.heavy 726.39 / 588.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 341 44 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56000.[MT7]-NESLAQYNPK[MT7].2y3_1.heavy 726.39 / 502.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 343 44 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56000.[MT7]-NESLAQYNPK[MT7].2b6_1.heavy 726.39 / 787.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 345 44 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56000.[MT7]-NESLAQYNPK[MT7].2b5_1.heavy 726.39 / 659.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 347 45 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55772.[MT7]-LWEVYGER.2b3_1.heavy 598.315 / 573.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 349 45 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55772.[MT7]-LWEVYGER.2y5_1.heavy 598.315 / 623.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 351 45 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55772.[MT7]-LWEVYGER.2y6_1.heavy 598.315 / 752.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 353 45 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55772.[MT7]-LWEVYGER.2y7_1.heavy 598.315 / 938.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 355 46 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56928.[MT7]-ELEREELWK[MT7].3y3_1.heavy 507.283 / 590.378 2287.0 29.528499603271484 50 20 10 10 10 5.075388492545759 19.702925233579727 0.0 3 0.9913506452174732 13.260411024984695 2287.0 2.2017856472649635 0.0 - - - - - - - 749.2307692307693 4 13 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 357 46 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56928.[MT7]-ELEREELWK[MT7].3y4_1.heavy 507.283 / 719.421 1186.0 29.528499603271484 50 20 10 10 10 5.075388492545759 19.702925233579727 0.0 3 0.9913506452174732 13.260411024984695 1186.0 2.566044178106055 4.0 - - - - - - - 214.23529411764707 2 17 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 359 46 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56928.[MT7]-ELEREELWK[MT7].3b3_1.heavy 507.283 / 516.279 N/A 29.528499603271484 50 20 10 10 10 5.075388492545759 19.702925233579727 0.0 3 0.9913506452174732 13.260411024984695 2371.0 2.9980371284061595 2.0 - - - - - - - 1270.5714285714287 4 7 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 361 46 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56928.[MT7]-ELEREELWK[MT7].3y5_1.heavy 507.283 / 848.463 762.0 29.528499603271484 50 20 10 10 10 5.075388492545759 19.702925233579727 0.0 3 0.9913506452174732 13.260411024984695 762.0 7.51422175950026 0.0 - - - - - - - 0.0 1 0 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 363 47 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56001.[MT7]-NHFYQFGEIR.2y8_1.heavy 727.868 / 1059.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 365 47 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56001.[MT7]-NHFYQFGEIR.2y5_1.heavy 727.868 / 621.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 367 47 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56001.[MT7]-NHFYQFGEIR.2y9_1.heavy 727.868 / 1196.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 369 47 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56001.[MT7]-NHFYQFGEIR.2y7_1.heavy 727.868 / 912.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 371 48 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540620.[MT7]-GVLIEPVYPDIIR.3y6_1.heavy 543.323 / 776.43 95794.0 40.546600341796875 50 20 10 10 10 7.253892728316472 13.785701518529159 0.0 3 0.9949239370144515 17.31470069051288 95794.0 310.6246947790434 0.0 - - - - - - - 265.7 191 10 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 373 48 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540620.[MT7]-GVLIEPVYPDIIR.3b4_1.heavy 543.323 / 527.367 92825.0 40.546600341796875 50 20 10 10 10 7.253892728316472 13.785701518529159 0.0 3 0.9949239370144515 17.31470069051288 92825.0 267.9671563562234 0.0 - - - - - - - 1259.875 185 8 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 375 48 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540620.[MT7]-GVLIEPVYPDIIR.3b5_1.heavy 543.323 / 656.41 203855.0 40.546600341796875 50 20 10 10 10 7.253892728316472 13.785701518529159 0.0 3 0.9949239370144515 17.31470069051288 203855.0 913.4794820512819 0.0 - - - - - - - 245.42857142857142 407 7 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 377 48 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540620.[MT7]-GVLIEPVYPDIIR.3y5_1.heavy 543.323 / 613.367 201511.0 40.546600341796875 50 20 10 10 10 7.253892728316472 13.785701518529159 0.0 3 0.9949239370144515 17.31470069051288 201511.0 351.1692826248424 0.0 - - - - - - - 268.0 403 7 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 379 49 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537038.[MT7]-IPLIK[MT7].2b3_1.heavy 436.315 / 468.33 2014.0 32.3607234954834 45 20 10 5 10 16.187370879178566 6.17765545414343 0.04090118408203125 3 0.9992495429691922 45.04766562486816 2014.0 7.4 3.0 - - - - - - - 259.1111111111111 4 9 FLOT2;PRKAB2 flotillin 2;protein kinase, AMP-activated, beta 2 non-catalytic subunit 381 49 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537038.[MT7]-IPLIK[MT7].2y4_1.heavy 436.315 / 614.436 148734.0 32.3607234954834 45 20 10 5 10 16.187370879178566 6.17765545414343 0.04090118408203125 3 0.9992495429691922 45.04766562486816 148734.0 304.2216276176654 0.0 - - - - - - - 651.1428571428571 297 7 FLOT2;PRKAB2 flotillin 2;protein kinase, AMP-activated, beta 2 non-catalytic subunit 383 49 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537038.[MT7]-IPLIK[MT7].2b4_1.heavy 436.315 / 581.414 2120.0 32.3607234954834 45 20 10 5 10 16.187370879178566 6.17765545414343 0.04090118408203125 3 0.9992495429691922 45.04766562486816 2120.0 3.4 0.0 - - - - - - - 270.8888888888889 4 9 FLOT2;PRKAB2 flotillin 2;protein kinase, AMP-activated, beta 2 non-catalytic subunit 385 49 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537038.[MT7]-IPLIK[MT7].2y3_1.heavy 436.315 / 517.383 21414.0 32.3607234954834 45 20 10 5 10 16.187370879178566 6.17765545414343 0.04090118408203125 3 0.9992495429691922 45.04766562486816 21414.0 33.76163807890223 0.0 - - - - - - - 353.3333333333333 42 6 FLOT2;PRKAB2 flotillin 2;protein kinase, AMP-activated, beta 2 non-catalytic subunit 387 50 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55776.[MT7]-IPENNPVK[MT7].2y4_2.heavy 599.855 / 301.193 N/A N/A - - - - - - - - - 0.0 - - - - - - - F11R F11 receptor 389 50 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55776.[MT7]-IPENNPVK[MT7].2y3_1.heavy 599.855 / 487.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - F11R F11 receptor 391 50 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55776.[MT7]-IPENNPVK[MT7].2b5_1.heavy 599.855 / 712.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - F11R F11 receptor 393 50 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55776.[MT7]-IPENNPVK[MT7].2y7_1.heavy 599.855 / 941.517 N/A N/A - - - - - - - - - 0.0 - - - - - - - F11R F11 receptor 395 51 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 619399.0 17.814800262451172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 619399.0 2293.685351566952 0.0 - - - - - - - 683.2857142857143 1238 7 397 51 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 368831.0 17.814800262451172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 368831.0 2266.8987557792952 0.0 - - - - - - - 230.23076923076923 737 13 399 51 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 332048.0 17.814800262451172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 332048.0 2739.1512414470913 0.0 - - - - - - - 1258.2857142857142 664 7 401 52 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537180.[MT7]-LWGIDR.2b3_1.heavy 452.262 / 501.294 3760.0 33.37580108642578 50 20 10 10 10 11.069657886933488 9.03370284984498 0.0 3 0.9974094437477561 24.242201473462227 3760.0 11.494800304112184 0.0 - - - - - - - 263.54545454545456 7 11 PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 403 52 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537180.[MT7]-LWGIDR.2y4_1.heavy 452.262 / 460.251 9455.0 33.37580108642578 50 20 10 10 10 11.069657886933488 9.03370284984498 0.0 3 0.9974094437477561 24.242201473462227 9455.0 9.611393124947341 0.0 - - - - - - - 298.55555555555554 18 9 PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 405 52 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537180.[MT7]-LWGIDR.2y5_1.heavy 452.262 / 646.331 27504.0 33.37580108642578 50 20 10 10 10 11.069657886933488 9.03370284984498 0.0 3 0.9974094437477561 24.242201473462227 27504.0 55.78068532517745 0.0 - - - - - - - 703.2727272727273 55 11 PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 407 52 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537180.[MT7]-LWGIDR.2b5_1.heavy 452.262 / 729.405 5694.0 33.37580108642578 50 20 10 10 10 11.069657886933488 9.03370284984498 0.0 3 0.9974094437477561 24.242201473462227 5694.0 16.65093518060366 0.0 - - - - - - - 259.5833333333333 11 12 PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 409 53 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538432.[MT7]-ITASYEDR.2y5_1.heavy 549.781 / 669.284 8258.0 22.27989959716797 44 20 10 6 8 4.167239517019479 17.720137345485945 0.03079986572265625 4 0.9978180691488412 26.415745997268623 8258.0 62.051813851883686 1.0 - - - - - - - 186.77272727272728 34 22 F11R F11 receptor 411 53 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538432.[MT7]-ITASYEDR.2b4_1.heavy 549.781 / 517.31 4375.0 22.27989959716797 44 20 10 6 8 4.167239517019479 17.720137345485945 0.03079986572265625 4 0.9978180691488412 26.415745997268623 4375.0 5.012453300124533 1.0 - - - - - - - 765.7368421052631 22 19 F11R F11 receptor 413 53 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538432.[MT7]-ITASYEDR.2y6_1.heavy 549.781 / 740.321 7365.0 22.27989959716797 44 20 10 6 8 4.167239517019479 17.720137345485945 0.03079986572265625 4 0.9978180691488412 26.415745997268623 7365.0 65.21534156142366 0.0 - - - - - - - 158.22727272727272 14 22 F11R F11 receptor 415 53 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538432.[MT7]-ITASYEDR.2y7_1.heavy 549.781 / 841.369 36604.0 22.27989959716797 44 20 10 6 8 4.167239517019479 17.720137345485945 0.03079986572265625 4 0.9978180691488412 26.415745997268623 36604.0 132.75779104477613 0.0 - - - - - - - 276.75 73 20 F11R F11 receptor 417 54 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56924.[MT7]-VTFLPTGITFK[MT7].2b4_1.heavy 756.457 / 605.378 23710.0 41.413299560546875 41 11 10 10 10 0.5283659556018262 102.2272103489583 0.0 3 0.8570053148749895 3.223932876968197 23710.0 67.98595352016405 0.0 - - - - - - - 278.6666666666667 47 12 F11R F11 receptor 419 54 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56924.[MT7]-VTFLPTGITFK[MT7].2y3_1.heavy 756.457 / 539.331 3800.0 41.413299560546875 41 11 10 10 10 0.5283659556018262 102.2272103489583 0.0 3 0.8570053148749895 3.223932876968197 3800.0 14.75 0.0 - - - - - - - 169.88235294117646 7 17 F11R F11 receptor 421 54 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56924.[MT7]-VTFLPTGITFK[MT7].2y6_1.heavy 756.457 / 810.484 1596.0 41.413299560546875 41 11 10 10 10 0.5283659556018262 102.2272103489583 0.0 3 0.8570053148749895 3.223932876968197 1596.0 6.800000000000001 0.0 - - - - - - - 169.27272727272728 3 22 F11R F11 receptor 423 54 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56924.[MT7]-VTFLPTGITFK[MT7].2y7_1.heavy 756.457 / 907.537 34350.0 41.413299560546875 41 11 10 10 10 0.5283659556018262 102.2272103489583 0.0 3 0.8570053148749895 3.223932876968197 34350.0 131.50281954887217 0.0 - - - - - - - 218.5 68 16 F11R F11 receptor 425 55 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 1687130.0 36.49869918823242 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1687130.0 199.65500160302162 0.0 - - - - - - - 218.6 3374 5 427 55 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 881194.0 36.49869918823242 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 881194.0 426.27839579940337 0.0 - - - - - - - 242.55555555555554 1762 9 429 55 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1280050.0 36.49869918823242 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1280050.0 901.0966206215869 0.0 - - - - - - - 781.875 2560 8 431 56 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537026.[MT7]-FLLGLR.2b3_1.heavy 431.785 / 518.346 7752.0 38.80832481384277 44 18 10 6 10 5.561821857741388 17.979720055364954 0.03730010986328125 3 0.9852541272097162 10.150606886217929 7752.0 31.113116883116888 0.0 - - - - - - - 245.3125 15 16 FAM8A1;STAT6 family with sequence similarity 8, member A1;signal transducer and activator of transcription 6, interleukin-4 induced 433 56 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537026.[MT7]-FLLGLR.2y4_1.heavy 431.785 / 458.309 15223.0 38.80832481384277 44 18 10 6 10 5.561821857741388 17.979720055364954 0.03730010986328125 3 0.9852541272097162 10.150606886217929 15223.0 64.62942675706645 0.0 - - - - - - - 268.625 30 8 FAM8A1;STAT6 family with sequence similarity 8, member A1;signal transducer and activator of transcription 6, interleukin-4 induced 435 56 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537026.[MT7]-FLLGLR.2y3_1.heavy 431.785 / 345.224 8219.0 38.80832481384277 44 18 10 6 10 5.561821857741388 17.979720055364954 0.03730010986328125 3 0.9852541272097162 10.150606886217929 8219.0 38.315836173001316 0.0 - - - - - - - 236.92307692307693 16 13 FAM8A1;STAT6 family with sequence similarity 8, member A1;signal transducer and activator of transcription 6, interleukin-4 induced 437 56 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537026.[MT7]-FLLGLR.2b5_1.heavy 431.785 / 688.451 4016.0 38.80832481384277 44 18 10 6 10 5.561821857741388 17.979720055364954 0.03730010986328125 3 0.9852541272097162 10.150606886217929 4016.0 56.21582611367127 0.0 - - - - - - - 242.8 8 5 FAM8A1;STAT6 family with sequence similarity 8, member A1;signal transducer and activator of transcription 6, interleukin-4 induced 439 57 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537022.[MT7]-AENLLR.2y4_1.heavy 430.26 / 515.33 2589.0 25.611100673675537 24 10 2 6 6 0.7387409594884347 72.90557967088793 0.03800010681152344 6 0.8371483125356844 3.015699946831244 2589.0 5.065370699143518 2.0 - - - - - - - 710.25 6 8 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 441 57 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537022.[MT7]-AENLLR.2b3_1.heavy 430.26 / 459.232 3599.0 25.611100673675537 24 10 2 6 6 0.7387409594884347 72.90557967088793 0.03800010681152344 6 0.8371483125356844 3.015699946831244 3599.0 5.133280507131538 1.0 - - - - - - - 702.5 9 8 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 443 57 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537022.[MT7]-AENLLR.2y5_1.heavy 430.26 / 644.373 4104.0 25.611100673675537 24 10 2 6 6 0.7387409594884347 72.90557967088793 0.03800010681152344 6 0.8371483125356844 3.015699946831244 4104.0 21.58866670377999 0.0 - - - - - - - 159.58823529411765 8 17 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 445 57 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537022.[MT7]-AENLLR.2b4_1.heavy 430.26 / 572.316 8019.0 25.611100673675537 24 10 2 6 6 0.7387409594884347 72.90557967088793 0.03800010681152344 6 0.8371483125356844 3.015699946831244 8019.0 4.781040727000988 4.0 - - - - - - - 316.0 44 2 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 447 58 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540231.[MT7]-QELWQGLEELR.3y7_1.heavy 515.611 / 844.452 13124.0 40.546600341796875 48 18 10 10 10 4.924753257461165 20.305585837929378 0.0 3 0.9885961533185088 11.545775276753462 13124.0 214.9055 0.0 - - - - - - - 138.1818181818182 26 11 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 449 58 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540231.[MT7]-QELWQGLEELR.3y6_1.heavy 515.611 / 716.394 106510.0 40.546600341796875 48 18 10 10 10 4.924753257461165 20.305585837929378 0.0 3 0.9885961533185088 11.545775276753462 106510.0 230.9935625 0.0 - - - - - - - 224.0 213 10 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 451 58 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540231.[MT7]-QELWQGLEELR.3y4_1.heavy 515.611 / 546.288 64418.0 40.546600341796875 48 18 10 10 10 4.924753257461165 20.305585837929378 0.0 3 0.9885961533185088 11.545775276753462 64418.0 299.27529166666665 0.0 - - - - - - - 304.0 128 10 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 453 58 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540231.[MT7]-QELWQGLEELR.3b3_1.heavy 515.611 / 515.295 N/A 40.546600341796875 48 18 10 10 10 4.924753257461165 20.305585837929378 0.0 3 0.9885961533185088 11.545775276753462 179490.0 14.096498096595274 0.0 - - - - - - - 18805.0 358 1 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 455 59 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538643.[MT7]-IQEPLFK[MT7].2b3_1.heavy 581.857 / 515.295 8193.0 32.42282485961914 30 13 4 5 8 2.8482894021337373 35.10879193844806 0.041900634765625 4 0.9256133617412404 4.496610556574295 8193.0 15.470131169424983 0.0 - - - - - - - 651.625 16 8 PPP2R5B;PPP2R5E protein phosphatase 2, regulatory subunit B', beta;protein phosphatase 2, regulatory subunit B', epsilon isoform 457 59 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538643.[MT7]-IQEPLFK[MT7].2y4_1.heavy 581.857 / 648.42 9470.0 32.42282485961914 30 13 4 5 8 2.8482894021337373 35.10879193844806 0.041900634765625 4 0.9256133617412404 4.496610556574295 9470.0 18.485281837160752 1.0 - - - - - - - 691.625 35 8 PPP2R5B;PPP2R5E protein phosphatase 2, regulatory subunit B', beta;protein phosphatase 2, regulatory subunit B', epsilon isoform 459 59 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538643.[MT7]-IQEPLFK[MT7].2y3_1.heavy 581.857 / 551.367 1383.0 32.42282485961914 30 13 4 5 8 2.8482894021337373 35.10879193844806 0.041900634765625 4 0.9256133617412404 4.496610556574295 1383.0 1.4530196647003917 15.0 - - - - - - - 1368.0 6 7 PPP2R5B;PPP2R5E protein phosphatase 2, regulatory subunit B', beta;protein phosphatase 2, regulatory subunit B', epsilon isoform 461 59 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538643.[MT7]-IQEPLFK[MT7].2y6_1.heavy 581.857 / 905.521 2873.0 32.42282485961914 30 13 4 5 8 2.8482894021337373 35.10879193844806 0.041900634765625 4 0.9256133617412404 4.496610556574295 2873.0 12.245544800178648 1.0 - - - - - - - 235.5 7 14 PPP2R5B;PPP2R5E protein phosphatase 2, regulatory subunit B', beta;protein phosphatase 2, regulatory subunit B', epsilon isoform 463 60 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537128.[MT7]-LPFPK[MT7].2y4_1.heavy 445.291 / 632.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 465 60 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537128.[MT7]-LPFPK[MT7].2y3_1.heavy 445.291 / 535.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 467 61 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57168.[MT7]-EHWNPTIVALVYNVLK[MT7].3y6_1.heavy 728.752 / 879.542 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 469 61 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57168.[MT7]-EHWNPTIVALVYNVLK[MT7].3b4_1.heavy 728.752 / 711.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 471 61 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57168.[MT7]-EHWNPTIVALVYNVLK[MT7].3y5_1.heavy 728.752 / 780.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 473 61 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57168.[MT7]-EHWNPTIVALVYNVLK[MT7].3b8_2.heavy 728.752 / 561.297 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 475 62 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56740.[MT7]-LNIWDWK[MT7].2y4_1.heavy 631.86 / 778.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 477 62 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56740.[MT7]-LNIWDWK[MT7].2y5_1.heavy 631.86 / 891.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 479 62 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56740.[MT7]-LNIWDWK[MT7].2y3_1.heavy 631.86 / 592.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 481 62 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56740.[MT7]-LNIWDWK[MT7].2b5_1.heavy 631.86 / 786.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 483 63 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56888.[MT7]-SDFEVFDALK[MT7].2y5_1.heavy 729.89 / 737.431 1843.0 39.445701599121094 46 16 10 10 10 2.871359540285836 34.82670790508014 0.0 3 0.9609097525950582 6.221615782666861 1843.0 18.100892857142856 0.0 - - - - - - - 146.875 3 16 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 485 63 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56888.[MT7]-SDFEVFDALK[MT7].2b4_1.heavy 729.89 / 623.279 2764.0 39.445701599121094 46 16 10 10 10 2.871359540285836 34.82670790508014 0.0 3 0.9609097525950582 6.221615782666861 2764.0 17.5839510019623 0.0 - - - - - - - 178.0625 5 16 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 487 63 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56888.[MT7]-SDFEVFDALK[MT7].2y6_1.heavy 729.89 / 836.5 1173.0 39.445701599121094 46 16 10 10 10 2.871359540285836 34.82670790508014 0.0 3 0.9609097525950582 6.221615782666861 1173.0 5.606573110542904 1.0 - - - - - - - 193.46153846153845 2 13 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 489 63 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56888.[MT7]-SDFEVFDALK[MT7].2b5_1.heavy 729.89 / 722.348 1843.0 39.445701599121094 46 16 10 10 10 2.871359540285836 34.82670790508014 0.0 3 0.9609097525950582 6.221615782666861 1843.0 11.460341906387127 0.0 - - - - - - - 230.5 3 16 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 491 64 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57172.[MT7]-TVDWALAEYMAFGSLLK[MT7].3b6_1.heavy 735.062 / 830.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 493 64 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57172.[MT7]-TVDWALAEYMAFGSLLK[MT7].3b5_1.heavy 735.062 / 717.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 495 64 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57172.[MT7]-TVDWALAEYMAFGSLLK[MT7].3b8_1.heavy 735.062 / 1030.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 497 64 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57172.[MT7]-TVDWALAEYMAFGSLLK[MT7].3y5_1.heavy 735.062 / 661.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 499 65 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538956.[MT7]-LAFYDLQEADLDK[MT7].3y3_1.heavy 610.324 / 519.326 17133.0 38.689998626708984 45 15 10 10 10 3.833391852118044 26.086558290342147 0.0 3 0.9598232578631624 6.136350187829831 17133.0 21.801685461510942 0.0 - - - - - - - 712.4 34 10 OGDHL oxoglutarate dehydrogenase-like 501 65 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538956.[MT7]-LAFYDLQEADLDK[MT7].3b5_1.heavy 610.324 / 754.389 38864.0 38.689998626708984 45 15 10 10 10 3.833391852118044 26.086558290342147 0.0 3 0.9598232578631624 6.136350187829831 38864.0 126.44965389561503 0.0 - - - - - - - 255.58333333333334 77 12 OGDHL oxoglutarate dehydrogenase-like 503 65 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538956.[MT7]-LAFYDLQEADLDK[MT7].3y4_1.heavy 610.324 / 634.353 16952.0 38.689998626708984 45 15 10 10 10 3.833391852118044 26.086558290342147 0.0 3 0.9598232578631624 6.136350187829831 16952.0 52.63929552570269 0.0 - - - - - - - 721.4285714285714 33 7 OGDHL oxoglutarate dehydrogenase-like 505 65 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538956.[MT7]-LAFYDLQEADLDK[MT7].3y5_1.heavy 610.324 / 705.39 14698.0 38.689998626708984 45 15 10 10 10 3.833391852118044 26.086558290342147 0.0 3 0.9598232578631624 6.136350187829831 14698.0 74.10072022160665 0.0 - - - - - - - 286.5882352941176 29 17 OGDHL oxoglutarate dehydrogenase-like 507 66 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57070.[MT7]-LEQISPFPFDLIK[MT7].3y3_1.heavy 612.357 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 509 66 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57070.[MT7]-LEQISPFPFDLIK[MT7].3y6_1.heavy 612.357 / 876.531 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 511 66 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57070.[MT7]-LEQISPFPFDLIK[MT7].3y4_1.heavy 612.357 / 632.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 513 66 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57070.[MT7]-LEQISPFPFDLIK[MT7].3b3_1.heavy 612.357 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 515 67 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56430.[MT7]-WSEGGK[MT7].2b3_1.heavy 476.261 / 547.263 2560.0 20.652649879455566 42 16 10 6 10 4.098236326909593 24.400740226566736 0.030200958251953125 3 0.9665130548222285 6.725199335729731 2560.0 2.070080862533693 1.0 - - - - - - - 760.75 5 8 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 517 67 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56430.[MT7]-WSEGGK[MT7].2y4_1.heavy 476.261 / 534.3 2634.0 20.652649879455566 42 16 10 6 10 4.098236326909593 24.400740226566736 0.030200958251953125 3 0.9665130548222285 6.725199335729731 2634.0 3.0514606741573034 1.0 - - - - - - - 276.45 5 20 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 519 67 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56430.[MT7]-WSEGGK[MT7].2y5_1.heavy 476.261 / 621.332 16585.0 20.652649879455566 42 16 10 6 10 4.098236326909593 24.400740226566736 0.030200958251953125 3 0.9665130548222285 6.725199335729731 16585.0 61.055245884600936 0.0 - - - - - - - 282.0 33 15 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 521 67 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56430.[MT7]-WSEGGK[MT7].2y3_1.heavy 476.261 / 405.258 6159.0 20.652649879455566 42 16 10 6 10 4.098236326909593 24.400740226566736 0.030200958251953125 3 0.9665130548222285 6.725199335729731 6159.0 9.748685600394259 0.0 - - - - - - - 765.9285714285714 12 14 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 523 68 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540029.[MT7]-LFDELTASYK[MT7].3y3_1.heavy 492.273 / 541.31 66350.0 38.40340042114258 44 14 10 10 10 1.0438460785792447 58.4349084108306 0.0 3 0.9306847207521984 4.66022382184855 66350.0 75.05984381330862 0.0 - - - - - - - 292.2857142857143 132 7 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 525 68 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540029.[MT7]-LFDELTASYK[MT7].3b4_1.heavy 492.273 / 649.331 61045.0 38.40340042114258 44 14 10 10 10 1.0438460785792447 58.4349084108306 0.0 3 0.9306847207521984 4.66022382184855 61045.0 139.1370975074147 0.0 - - - - - - - 717.8571428571429 122 7 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 527 68 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540029.[MT7]-LFDELTASYK[MT7].3y4_1.heavy 492.273 / 612.347 27824.0 38.40340042114258 44 14 10 10 10 1.0438460785792447 58.4349084108306 0.0 3 0.9306847207521984 4.66022382184855 27824.0 91.67815668202765 0.0 - - - - - - - 201.5 55 12 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 529 68 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540029.[MT7]-LFDELTASYK[MT7].3b3_1.heavy 492.273 / 520.289 30802.0 38.40340042114258 44 14 10 10 10 1.0438460785792447 58.4349084108306 0.0 3 0.9306847207521984 4.66022382184855 30802.0 32.50738245934892 0.0 - - - - - - - 784.4285714285714 61 7 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 531 69 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56695.[MT7]-QAAEVAAEK[MT7].3y3_1.heavy 402.231 / 491.295 22132.0 18.557100296020508 46 16 10 10 10 1.6845453066449596 46.54795548023263 0.0 3 0.9673930748145716 6.815853446642701 22132.0 113.04472225940303 0.0 - - - - - - - 231.89473684210526 44 19 RBM22 RNA binding motif protein 22 533 69 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56695.[MT7]-QAAEVAAEK[MT7].3b4_1.heavy 402.231 / 544.285 33456.0 18.557100296020508 46 16 10 10 10 1.6845453066449596 46.54795548023263 0.0 3 0.9673930748145716 6.815853446642701 33456.0 71.59672391017173 0.0 - - - - - - - 714.25 66 8 RBM22 RNA binding motif protein 22 535 69 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56695.[MT7]-QAAEVAAEK[MT7].3b5_1.heavy 402.231 / 643.353 10498.0 18.557100296020508 46 16 10 10 10 1.6845453066449596 46.54795548023263 0.0 3 0.9673930748145716 6.815853446642701 10498.0 82.15826086956523 0.0 - - - - - - - 195.5909090909091 20 22 RBM22 RNA binding motif protein 22 537 69 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56695.[MT7]-QAAEVAAEK[MT7].3b3_1.heavy 402.231 / 415.242 10946.0 18.557100296020508 46 16 10 10 10 1.6845453066449596 46.54795548023263 0.0 3 0.9673930748145716 6.815853446642701 10946.0 20.156009060039725 0.0 - - - - - - - 262.5 21 24 RBM22 RNA binding motif protein 22 539 70 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57055.[MT7]-FLESPDFQPNIAK[MT7].2b3_1.heavy 897.487 / 534.304 2041.0 35.71950149536133 42 12 10 10 10 1.4656122473656752 63.27966119657169 0.0 3 0.8830022608636358 3.5722798693522364 2041.0 4.2716836862847 1.0 - - - - - - - 253.72727272727272 4 11 PPP2R5C;PPP2R5D protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta 541 70 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57055.[MT7]-FLESPDFQPNIAK[MT7].2y5_1.heavy 897.487 / 686.432 2578.0 35.71950149536133 42 12 10 10 10 1.4656122473656752 63.27966119657169 0.0 3 0.8830022608636358 3.5722798693522364 2578.0 28.645440556400782 0.0 - - - - - - - 257.8 5 10 PPP2R5C;PPP2R5D protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta 543 70 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57055.[MT7]-FLESPDFQPNIAK[MT7].2b4_1.heavy 897.487 / 621.336 2470.0 35.71950149536133 42 12 10 10 10 1.4656122473656752 63.27966119657169 0.0 3 0.8830022608636358 3.5722798693522364 2470.0 12.947787808753432 0.0 - - - - - - - 226.66666666666666 4 9 PPP2R5C;PPP2R5D protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta 545 70 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57055.[MT7]-FLESPDFQPNIAK[MT7].2y9_1.heavy 897.487 / 1173.64 2363.0 35.71950149536133 42 12 10 10 10 1.4656122473656752 63.27966119657169 0.0 3 0.8830022608636358 3.5722798693522364 2363.0 12.529395348837209 0.0 - - - - - - - 241.75 4 8 PPP2R5C;PPP2R5D protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta 547 71 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB543136.[MT7]-DIVPGDIVEVAVGDK[MT7]VPADIR.4y5_1.heavy 617.102 / 571.32 5027.0 40.10129928588867 47 17 10 10 10 3.0183580382729445 25.805549005788823 0.0 3 0.9750862317565754 7.802555265772812 5027.0 19.080040712468197 0.0 - - - - - - - 291.2352941176471 10 17 ATP2A1 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 549 71 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB543136.[MT7]-DIVPGDIVEVAVGDK[MT7]VPADIR.4b7_1.heavy 617.102 / 854.474 3064.0 40.10129928588867 47 17 10 10 10 3.0183580382729445 25.805549005788823 0.0 3 0.9750862317565754 7.802555265772812 3064.0 31.563863974954117 0.0 - - - - - - - 204.4 6 10 ATP2A1 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 551 71 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB543136.[MT7]-DIVPGDIVEVAVGDK[MT7]VPADIR.4y9_1.heavy 617.102 / 1114.63 236.0 40.10129928588867 47 17 10 10 10 3.0183580382729445 25.805549005788823 0.0 3 0.9750862317565754 7.802555265772812 236.0 -0.2049481009672092 3.0 - - - - - - - 0.0 1 0 ATP2A1 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 553 71 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB543136.[MT7]-DIVPGDIVEVAVGDK[MT7]VPADIR.4b6_1.heavy 617.102 / 741.39 8955.0 40.10129928588867 47 17 10 10 10 3.0183580382729445 25.805549005788823 0.0 3 0.9750862317565754 7.802555265772812 8955.0 51.63730972687034 0.0 - - - - - - - 207.71428571428572 17 14 ATP2A1 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 555 72 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540034.[MT7]-LFDDLTSSYK[MT7].3y3_1.heavy 492.932 / 541.31 14483.0 37.168500900268555 43 20 10 5 8 7.710236889180111 12.969770116963783 0.042201995849609375 4 0.9900888023164347 12.38625306187836 14483.0 32.14119424837966 1.0 - - - - - - - 815.6666666666666 58 9 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 557 72 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540034.[MT7]-LFDDLTSSYK[MT7].3b4_1.heavy 492.932 / 635.316 35130.0 37.168500900268555 43 20 10 5 8 7.710236889180111 12.969770116963783 0.042201995849609375 4 0.9900888023164347 12.38625306187836 35130.0 91.85236355283786 0.0 - - - - - - - 318.1666666666667 70 12 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 559 72 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540034.[MT7]-LFDDLTSSYK[MT7].3b3_1.heavy 492.932 / 520.289 8024.0 37.168500900268555 43 20 10 5 8 7.710236889180111 12.969770116963783 0.042201995849609375 4 0.9900888023164347 12.38625306187836 8024.0 15.05888115008997 1.0 - - - - - - - 347.8888888888889 37 9 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 561 72 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540034.[MT7]-LFDDLTSSYK[MT7].3y4_1.heavy 492.932 / 628.342 16146.0 37.168500900268555 43 20 10 5 8 7.710236889180111 12.969770116963783 0.042201995849609375 4 0.9900888023164347 12.38625306187836 16146.0 16.29655172413793 1.0 - - - - - - - 383.25 32 12 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 563 73 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55800.[MT7]-TLITFVNK[MT7].2y4_1.heavy 612.384 / 651.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARVA parvin, alpha 565 73 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55800.[MT7]-TLITFVNK[MT7].2y5_1.heavy 612.384 / 752.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARVA parvin, alpha 567 73 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55800.[MT7]-TLITFVNK[MT7].2y3_1.heavy 612.384 / 504.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARVA parvin, alpha 569 73 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55800.[MT7]-TLITFVNK[MT7].2y6_1.heavy 612.384 / 865.526 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARVA parvin, alpha 571 74 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56696.[MT7]-APTIEQMK[MT7].2y4_1.heavy 603.344 / 679.357 696.0 26.164849281311035 38 16 10 6 6 1.8682586923780835 41.249731251236724 0.03989982604980469 5 0.9681456138412372 6.896331167155972 696.0 5.507913669064749 3.0 - - - - - - - 150.94444444444446 2 18 MAPK1 mitogen-activated protein kinase 1 573 74 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56696.[MT7]-APTIEQMK[MT7].2y5_1.heavy 603.344 / 792.441 557.0 26.164849281311035 38 16 10 6 6 1.8682586923780835 41.249731251236724 0.03989982604980469 5 0.9681456138412372 6.896331167155972 557.0 3.5050359712230215 2.0 - - - - - - - 0.0 1 0 MAPK1 mitogen-activated protein kinase 1 575 74 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56696.[MT7]-APTIEQMK[MT7].2y3_1.heavy 603.344 / 550.314 1462.0 26.164849281311035 38 16 10 6 6 1.8682586923780835 41.249731251236724 0.03989982604980469 5 0.9681456138412372 6.896331167155972 1462.0 1.2008213552361398 0.0 - - - - - - - 329.6 2 15 MAPK1 mitogen-activated protein kinase 1 577 74 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56696.[MT7]-APTIEQMK[MT7].2y7_1.heavy 603.344 / 990.541 3760.0 26.164849281311035 38 16 10 6 6 1.8682586923780835 41.249731251236724 0.03989982604980469 5 0.9681456138412372 6.896331167155972 3760.0 53.73353814644137 0.0 - - - - - - - 152.0 7 11 MAPK1 mitogen-activated protein kinase 1 579 75 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56026.[MT7]-SQWSPALTVSK[MT7].2y4_1.heavy 746.424 / 578.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2D4;UBE2D1 ubiquitin-conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) 581 75 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56026.[MT7]-SQWSPALTVSK[MT7].2y8_1.heavy 746.424 / 946.569 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2D4;UBE2D1 ubiquitin-conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) 583 75 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56026.[MT7]-SQWSPALTVSK[MT7].2b4_1.heavy 746.424 / 633.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2D4;UBE2D1 ubiquitin-conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) 585 75 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56026.[MT7]-SQWSPALTVSK[MT7].2y7_1.heavy 746.424 / 859.537 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2D4;UBE2D1 ubiquitin-conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) 587 76 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56555.[MT7]-QQEQQK[MT7].2y4_1.heavy 538.801 / 676.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 589 76 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56555.[MT7]-QQEQQK[MT7].2b3_1.heavy 538.801 / 530.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 591 76 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56555.[MT7]-QQEQQK[MT7].2y5_1.heavy 538.801 / 804.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 593 76 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56555.[MT7]-QQEQQK[MT7].2b5_1.heavy 538.801 / 786.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 595 77 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538657.[MT7]-VIYSQPSAR.2b3_1.heavy 582.828 / 520.325 2618.0 22.784000396728516 50 20 10 10 10 4.998045431733776 20.007821330529787 0.0 3 0.9910699038031959 13.050002045895791 2618.0 7.44039816239958 1.0 - - - - - - - 718.75 5 8 F11R F11 receptor 597 77 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538657.[MT7]-VIYSQPSAR.2y8_1.heavy 582.828 / 921.479 11966.0 22.784000396728516 50 20 10 10 10 4.998045431733776 20.007821330529787 0.0 3 0.9910699038031959 13.050002045895791 11966.0 24.58065620542083 0.0 - - - - - - - 236.5 23 16 F11R F11 receptor 599 77 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538657.[MT7]-VIYSQPSAR.2y6_1.heavy 582.828 / 645.331 5702.0 22.784000396728516 50 20 10 10 10 4.998045431733776 20.007821330529787 0.0 3 0.9910699038031959 13.050002045895791 5702.0 21.3371422764744 0.0 - - - - - - - 321.4375 11 16 F11R F11 receptor 601 77 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538657.[MT7]-VIYSQPSAR.2y7_1.heavy 582.828 / 808.395 7619.0 22.784000396728516 50 20 10 10 10 4.998045431733776 20.007821330529787 0.0 3 0.9910699038031959 13.050002045895791 7619.0 24.907337940795102 0.0 - - - - - - - 241.88235294117646 15 17 F11R F11 receptor 603 78 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55699.[MT7]-SVRK[MT7]AQR.2y4_1.heavy 566.861 / 646.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 605 78 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55699.[MT7]-SVRK[MT7]AQR.2b4_1.heavy 566.861 / 759.508 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 607 78 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55699.[MT7]-SVRK[MT7]AQR.2y6_1.heavy 566.861 / 901.581 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 609 78 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55699.[MT7]-SVRK[MT7]AQR.2b5_1.heavy 566.861 / 830.545 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 611 79 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539381.[MT7]-WNVDSVHAK[MT7].3y3_1.heavy 448.582 / 499.311 N/A 25.27039909362793 48 20 10 10 8 7.359558588177614 13.587771440618717 0.0 4 0.9964545484918461 20.720402964687402 13646.0 39.488943811888724 0.0 - - - - - - - 750.7777777777778 27 9 PARVA parvin, alpha 613 79 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539381.[MT7]-WNVDSVHAK[MT7].3b4_1.heavy 448.582 / 659.327 11153.0 25.27039909362793 48 20 10 10 8 7.359558588177614 13.587771440618717 0.0 4 0.9964545484918461 20.720402964687402 11153.0 42.27045671927307 1.0 - - - - - - - 248.28571428571428 25 14 PARVA parvin, alpha 615 79 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539381.[MT7]-WNVDSVHAK[MT7].3b5_1.heavy 448.582 / 746.359 7479.0 25.27039909362793 48 20 10 10 8 7.359558588177614 13.587771440618717 0.0 4 0.9964545484918461 20.720402964687402 7479.0 69.47497461928934 0.0 - - - - - - - 171.76923076923077 14 13 PARVA parvin, alpha 617 79 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539381.[MT7]-WNVDSVHAK[MT7].3b3_1.heavy 448.582 / 544.3 6692.0 25.27039909362793 48 20 10 10 8 7.359558588177614 13.587771440618717 0.0 4 0.9964545484918461 20.720402964687402 6692.0 12.625234966974523 1.0 - - - - - - - 662.5 13 10 PARVA parvin, alpha 619 80 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 572328.0 33.687801361083984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 572328.0 380.87698008162255 0.0 - - - - - - - 304.0 1144 4 621 80 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 136597.0 33.687801361083984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 136597.0 204.45722357927434 0.0 - - - - - - - 790.0 273 7 623 80 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 203513.0 33.687801361083984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 203513.0 193.25090950785304 0.0 - - - - - - - 405.3333333333333 407 3 625 81 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55808.[MT7]-SSPYPTDVAR.2y8_1.heavy 618.821 / 918.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 627 81 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55808.[MT7]-SSPYPTDVAR.2b4_1.heavy 618.821 / 579.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 629 81 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55808.[MT7]-SSPYPTDVAR.2y9_1.heavy 618.821 / 1005.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 631 81 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55808.[MT7]-SSPYPTDVAR.2y6_1.heavy 618.821 / 658.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 633 82 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57063.[MT7]-LQELDLSQNFLAK[MT7].3b4_1.heavy 603.012 / 628.379 2349.0 39.091073989868164 46 20 10 6 10 5.784200890012322 17.288472842060465 0.03730010986328125 3 0.9916916014936484 13.5301484069561 2349.0 8.071652939505821 0.0 - - - - - - - 599.0 4 7 TLR7 toll-like receptor 7 635 82 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57063.[MT7]-LQELDLSQNFLAK[MT7].3b5_1.heavy 603.012 / 743.406 6710.0 39.091073989868164 46 20 10 6 10 5.784200890012322 17.288472842060465 0.03730010986328125 3 0.9916916014936484 13.5301484069561 6710.0 25.51452142341227 0.0 - - - - - - - 731.0 13 7 TLR7 toll-like receptor 7 637 82 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57063.[MT7]-LQELDLSQNFLAK[MT7].3y4_1.heavy 603.012 / 622.404 2265.0 39.091073989868164 46 20 10 6 10 5.784200890012322 17.288472842060465 0.03730010986328125 3 0.9916916014936484 13.5301484069561 2265.0 10.33988331913282 0.0 - - - - - - - 218.35 4 20 TLR7 toll-like receptor 7 639 82 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57063.[MT7]-LQELDLSQNFLAK[MT7].3b3_1.heavy 603.012 / 515.295 4446.0 39.091073989868164 46 20 10 6 10 5.784200890012322 17.288472842060465 0.03730010986328125 3 0.9916916014936484 13.5301484069561 4446.0 9.149864231121564 0.0 - - - - - - - 1153.25 8 8 TLR7 toll-like receptor 7 641 83 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56326.[MT7]-LIVLVPPSK[MT7]PTVNIPSSATIGNR.3y18_2.heavy 887.868 / 990.553 N/A N/A - - - - - - - - - 0.0 - - - - - - - F11R F11 receptor 643 83 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56326.[MT7]-LIVLVPPSK[MT7]PTVNIPSSATIGNR.3y11_1.heavy 887.868 / 1129.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - F11R F11 receptor 645 83 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56326.[MT7]-LIVLVPPSK[MT7]PTVNIPSSATIGNR.3b4_1.heavy 887.868 / 583.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - F11R F11 receptor 647 83 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56326.[MT7]-LIVLVPPSK[MT7]PTVNIPSSATIGNR.3y9_1.heavy 887.868 / 902.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - F11R F11 receptor 649 84 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56755.[MT7]-LNITVVQAK[MT7].2y4_1.heavy 637.408 / 589.379 N/A 31.037832895914715 44 18 10 6 10 2.444620372456363 40.906146871188696 0.0391998291015625 3 0.9800283800652454 8.718269005545743 4021.0 13.595826533337288 0.0 - - - - - - - 201.25 8 12 TOLLIP toll interacting protein 651 84 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56755.[MT7]-LNITVVQAK[MT7].2y5_1.heavy 637.408 / 688.447 2614.0 31.037832895914715 44 18 10 6 10 2.444620372456363 40.906146871188696 0.0391998291015625 3 0.9800283800652454 8.718269005545743 2614.0 7.477860696517412 0.0 - - - - - - - 243.16666666666666 5 12 TOLLIP toll interacting protein 653 84 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56755.[MT7]-LNITVVQAK[MT7].2y6_1.heavy 637.408 / 789.495 5931.0 31.037832895914715 44 18 10 6 10 2.444620372456363 40.906146871188696 0.0391998291015625 3 0.9800283800652454 8.718269005545743 5931.0 35.4089552238806 0.0 - - - - - - - 185.84615384615384 11 13 TOLLIP toll interacting protein 655 84 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56755.[MT7]-LNITVVQAK[MT7].2y7_1.heavy 637.408 / 902.579 804.0 31.037832895914715 44 18 10 6 10 2.444620372456363 40.906146871188696 0.0391998291015625 3 0.9800283800652454 8.718269005545743 804.0 7.880792079207921 0.0 - - - - - - - 0.0 1 0 TOLLIP toll interacting protein 657 85 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540000.[MT7]-SDFEVFDALK[MT7].3b4_1.heavy 486.929 / 623.279 120970.0 39.445701599121094 48 18 10 10 10 6.71772538982085 14.885991045648687 0.0 3 0.9888892795823527 11.69737271331413 120970.0 107.78399270633832 0.0 - - - - - - - 284.14285714285717 241 7 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 659 85 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540000.[MT7]-SDFEVFDALK[MT7].3b5_1.heavy 486.929 / 722.348 67311.0 39.445701599121094 48 18 10 10 10 6.71772538982085 14.885991045648687 0.0 3 0.9888892795823527 11.69737271331413 67311.0 371.1419912484469 0.0 - - - - - - - 259.2857142857143 134 7 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 661 85 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540000.[MT7]-SDFEVFDALK[MT7].3y4_1.heavy 486.929 / 590.363 58757.0 39.445701599121094 48 18 10 10 10 6.71772538982085 14.885991045648687 0.0 3 0.9888892795823527 11.69737271331413 58757.0 157.61808135660112 0.0 - - - - - - - 250.5 117 10 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 663 85 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540000.[MT7]-SDFEVFDALK[MT7].3y5_1.heavy 486.929 / 737.431 17022.0 39.445701599121094 48 18 10 10 10 6.71772538982085 14.885991045648687 0.0 3 0.9888892795823527 11.69737271331413 17022.0 134.7984971098266 0.0 - - - - - - - 218.8 34 15 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 665 86 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56568.[MT7]-SWDSFFR.2b3_1.heavy 544.768 / 533.248 14367.0 39.35099983215332 43 17 10 6 10 2.763593560802409 36.18477095125559 0.036998748779296875 3 0.9713259477307955 7.270672555444721 14367.0 21.475422660226563 0.0 - - - - - - - 1211.6666666666667 28 9 OGDHL oxoglutarate dehydrogenase-like 667 86 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56568.[MT7]-SWDSFFR.2y4_1.heavy 544.768 / 556.288 16790.0 39.35099983215332 43 17 10 6 10 2.763593560802409 36.18477095125559 0.036998748779296875 3 0.9713259477307955 7.270672555444721 16790.0 46.408427957072995 0.0 - - - - - - - 259.8888888888889 33 9 OGDHL oxoglutarate dehydrogenase-like 669 86 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56568.[MT7]-SWDSFFR.2y5_1.heavy 544.768 / 671.315 3548.0 39.35099983215332 43 17 10 6 10 2.763593560802409 36.18477095125559 0.036998748779296875 3 0.9713259477307955 7.270672555444721 3548.0 11.189208559719127 0.0 - - - - - - - 265.6 7 15 OGDHL oxoglutarate dehydrogenase-like 671 86 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56568.[MT7]-SWDSFFR.2b4_1.heavy 544.768 / 620.28 2769.0 39.35099983215332 43 17 10 6 10 2.763593560802409 36.18477095125559 0.036998748779296875 3 0.9713259477307955 7.270672555444721 2769.0 9.690791143232394 2.0 - - - - - - - 267.0 5 12 OGDHL oxoglutarate dehydrogenase-like 673 87 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539264.[MT7]-VSILESLEK[MT7].3b4_1.heavy 435.934 / 557.378 43435.0 37.74169921875 50 20 10 10 10 71.05177017495117 1.407424470266813 0.0 3 0.9987542436229068 34.96235792171409 43435.0 566.4454747883694 0.0 - - - - - - - 174.66666666666666 86 12 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 675 87 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539264.[MT7]-VSILESLEK[MT7].3b5_1.heavy 435.934 / 686.42 18955.0 37.74169921875 50 20 10 10 10 71.05177017495117 1.407424470266813 0.0 3 0.9987542436229068 34.96235792171409 18955.0 233.32010360547034 0.0 - - - - - - - 209.5 37 10 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 677 87 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539264.[MT7]-VSILESLEK[MT7].3y4_1.heavy 435.934 / 620.374 28099.0 37.74169921875 50 20 10 10 10 71.05177017495117 1.407424470266813 0.0 3 0.9987542436229068 34.96235792171409 28099.0 142.17952499900082 0.0 - - - - - - - 162.0 56 10 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 679 87 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539264.[MT7]-VSILESLEK[MT7].3b3_1.heavy 435.934 / 444.294 88203.0 37.74169921875 50 20 10 10 10 71.05177017495117 1.407424470266813 0.0 3 0.9987542436229068 34.96235792171409 88203.0 254.14032721215793 0.0 - - - - - - - 135.85714285714286 176 7 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 681 88 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539110.[MT7]-IYEPLDVK[MT7].2b3_1.heavy 632.873 / 550.299 6611.0 32.28824996948242 42 17 10 5 10 3.939258255437938 25.385489733239822 0.0402984619140625 3 0.9777339596713991 8.255278503436436 6611.0 35.667751866389594 0.0 - - - - - - - 206.33333333333334 13 15 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 683 88 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539110.[MT7]-IYEPLDVK[MT7].2y5_1.heavy 632.873 / 715.447 8744.0 32.28824996948242 42 17 10 5 10 3.939258255437938 25.385489733239822 0.0402984619140625 3 0.9777339596713991 8.255278503436436 8744.0 52.38895246478873 0.0 - - - - - - - 229.84615384615384 17 13 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 685 88 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539110.[MT7]-IYEPLDVK[MT7].2y3_1.heavy 632.873 / 505.31 1813.0 32.28824996948242 42 17 10 5 10 3.939258255437938 25.385489733239822 0.0402984619140625 3 0.9777339596713991 8.255278503436436 1813.0 5.212375000000001 0.0 - - - - - - - 670.1428571428571 3 7 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 687 88 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539110.[MT7]-IYEPLDVK[MT7].2y7_1.heavy 632.873 / 1007.55 4479.0 32.28824996948242 42 17 10 5 10 3.939258255437938 25.385489733239822 0.0402984619140625 3 0.9777339596713991 8.255278503436436 4479.0 23.6827125 0.0 - - - - - - - 201.66666666666666 8 9 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 689 89 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539268.[MT7]-ILMGSTLRK[MT7].3y7_1.heavy 436.275 / 936.542 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 691 89 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539268.[MT7]-ILMGSTLRK[MT7].3y6_1.heavy 436.275 / 805.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 693 89 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539268.[MT7]-ILMGSTLRK[MT7].3y8_1.heavy 436.275 / 1049.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 695 89 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539268.[MT7]-ILMGSTLRK[MT7].3y8_2.heavy 436.275 / 525.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 697 90 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540414.[MT7]-DVPASELHELLSR.3b6_1.heavy 537.294 / 743.369 37017.0 35.828474044799805 46 20 10 6 10 9.670753236236619 10.340456173082446 0.03929901123046875 3 0.9949702567338692 17.39431218232417 37017.0 330.8617358342615 1.0 - - - - - - - 180.75 74 4 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 699 90 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540414.[MT7]-DVPASELHELLSR.3y6_1.heavy 537.294 / 754.421 41049.0 35.828474044799805 46 20 10 6 10 9.670753236236619 10.340456173082446 0.03929901123046875 3 0.9949702567338692 17.39431218232417 41049.0 131.57977451525164 0.0 - - - - - - - 206.71428571428572 82 7 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 701 90 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540414.[MT7]-DVPASELHELLSR.3b4_1.heavy 537.294 / 527.295 19232.0 35.828474044799805 46 20 10 6 10 9.670753236236619 10.340456173082446 0.03929901123046875 3 0.9949702567338692 17.39431218232417 19232.0 14.700145384363134 1.0 - - - - - - - 768.1428571428571 38 7 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 703 90 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540414.[MT7]-DVPASELHELLSR.3y5_1.heavy 537.294 / 617.362 81375.0 35.828474044799805 46 20 10 6 10 9.670753236236619 10.340456173082446 0.03929901123046875 3 0.9949702567338692 17.39431218232417 81375.0 106.64387947995615 0.0 - - - - - - - 310.3333333333333 162 3 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 705 91 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539116.[MT7]-DQFNVLIK[MT7].3y3_1.heavy 422.255 / 517.383 34288.0 34.11830139160156 45 15 10 10 10 2.1603125595474166 39.0432023439034 0.0 3 0.956971136581105 5.9280619499539755 34288.0 187.49313372702403 0.0 - - - - - - - 261.27272727272725 68 11 NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 707 91 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539116.[MT7]-DQFNVLIK[MT7].3b4_1.heavy 422.255 / 649.306 46233.0 34.11830139160156 45 15 10 10 10 2.1603125595474166 39.0432023439034 0.0 3 0.956971136581105 5.9280619499539755 46233.0 229.2242373112359 0.0 - - - - - - - 311.54545454545456 92 11 NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 709 91 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539116.[MT7]-DQFNVLIK[MT7].3b5_1.heavy 422.255 / 748.375 16370.0 34.11830139160156 45 15 10 10 10 2.1603125595474166 39.0432023439034 0.0 3 0.956971136581105 5.9280619499539755 16370.0 110.29380090497739 0.0 - - - - - - - 251.45454545454547 32 11 NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 711 91 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539116.[MT7]-DQFNVLIK[MT7].3b3_1.heavy 422.255 / 535.263 22674.0 34.11830139160156 45 15 10 10 10 2.1603125595474166 39.0432023439034 0.0 3 0.956971136581105 5.9280619499539755 22674.0 44.83682533616148 0.0 - - - - - - - 207.375 45 8 NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 713 92 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542666.[MT7]-DVYIVQDLMETDLYK[MT7].4b7_1.heavy 534.031 / 977.506 1662.0 44.7798490524292 44 18 10 6 10 10.13462163430058 9.867166590763533 0.034999847412109375 3 0.9876971835700025 11.115111824416438 1662.0 38.953125 0.0 - - - - - - - 287.5 3 4 MAPK1;MAPK3 mitogen-activated protein kinase 1;mitogen-activated protein kinase 3 715 92 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542666.[MT7]-DVYIVQDLMETDLYK[MT7].4b4_1.heavy 534.031 / 635.352 5752.0 44.7798490524292 44 18 10 6 10 10.13462163430058 9.867166590763533 0.034999847412109375 3 0.9876971835700025 11.115111824416438 5752.0 20.59217411113253 0.0 - - - - - - - 195.58823529411765 11 17 MAPK1;MAPK3 mitogen-activated protein kinase 1;mitogen-activated protein kinase 3 717 92 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542666.[MT7]-DVYIVQDLMETDLYK[MT7].4b5_1.heavy 534.031 / 734.42 3131.0 44.7798490524292 44 18 10 6 10 10.13462163430058 9.867166590763533 0.034999847412109375 3 0.9876971835700025 11.115111824416438 3131.0 18.394625 0.0 - - - - - - - 169.55 6 20 MAPK1;MAPK3 mitogen-activated protein kinase 1;mitogen-activated protein kinase 3 719 92 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542666.[MT7]-DVYIVQDLMETDLYK[MT7].4y3_1.heavy 534.031 / 567.362 2301.0 44.7798490524292 44 18 10 6 10 10.13462163430058 9.867166590763533 0.034999847412109375 3 0.9876971835700025 11.115111824416438 2301.0 0.0 1.0 - - - - - - - 140.8 4 15 MAPK1;MAPK3 mitogen-activated protein kinase 1;mitogen-activated protein kinase 3 721 93 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56187.[MT7]-DSTLTEPVVMALLK[MT7].3y3_1.heavy 602.349 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 723 93 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56187.[MT7]-DSTLTEPVVMALLK[MT7].3b6_1.heavy 602.349 / 791.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 725 93 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56187.[MT7]-DSTLTEPVVMALLK[MT7].3b5_1.heavy 602.349 / 662.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 727 93 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56187.[MT7]-DSTLTEPVVMALLK[MT7].3y5_1.heavy 602.349 / 719.461 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 729 94 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540147.[MT7]-LRDTADGTFLVR.3y7_1.heavy 503.283 / 807.436 14635.0 30.270200729370117 48 18 10 10 10 9.193396137430417 10.877373117085142 0.0 3 0.9839127808764336 9.717128376793866 14635.0 18.40738953920958 0.0 - - - - - - - 735.5714285714286 29 7 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 731 94 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540147.[MT7]-LRDTADGTFLVR.3b6_1.heavy 503.283 / 816.433 10480.0 30.270200729370117 48 18 10 10 10 9.193396137430417 10.877373117085142 0.0 3 0.9839127808764336 9.717128376793866 10480.0 26.580698504080473 0.0 - - - - - - - 279.1818181818182 20 11 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 733 94 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540147.[MT7]-LRDTADGTFLVR.3y6_1.heavy 503.283 / 692.409 50411.0 30.270200729370117 48 18 10 10 10 9.193396137430417 10.877373117085142 0.0 3 0.9839127808764336 9.717128376793866 50411.0 17.71988165233978 0.0 - - - - - - - 301.0 100 3 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 735 94 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540147.[MT7]-LRDTADGTFLVR.3y4_1.heavy 503.283 / 534.34 43816.0 30.270200729370117 48 18 10 10 10 9.193396137430417 10.877373117085142 0.0 3 0.9839127808764336 9.717128376793866 43816.0 19.960398258624494 0.0 - - - - - - - 286.0 87 6 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 737 95 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538934.[MT7]-FFMGTVVK[MT7].3b4_1.heavy 406.238 / 627.308 2606.0 36.20174980163574 43 18 10 5 10 5.069155884873547 19.727150293089586 0.043300628662109375 3 0.9800159923471286 8.715557375891198 2606.0 36.83480769230769 0.0 - - - - - - - 130.0 5 4 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 739 95 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538934.[MT7]-FFMGTVVK[MT7].3b5_1.heavy 406.238 / 728.356 938.0 36.20174980163574 43 18 10 5 10 5.069155884873547 19.727150293089586 0.043300628662109375 3 0.9800159923471286 8.715557375891198 938.0 8.568269230769232 0.0 - - - - - - - 0.0 1 0 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 741 95 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538934.[MT7]-FFMGTVVK[MT7].3b3_1.heavy 406.238 / 570.287 1980.0 36.20174980163574 43 18 10 5 10 5.069155884873547 19.727150293089586 0.043300628662109375 3 0.9800159923471286 8.715557375891198 1980.0 22.95685672155321 0.0 - - - - - - - 127.22222222222223 3 9 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 743 95 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538934.[MT7]-FFMGTVVK[MT7].3y4_1.heavy 406.238 / 590.399 730.0 36.20174980163574 43 18 10 5 10 5.069155884873547 19.727150293089586 0.043300628662109375 3 0.9800159923471286 8.715557375891198 730.0 2.1057692307692304 0.0 - - - - - - - 0.0 1 0 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 745 96 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56196.[MT7]-TYHEVVDEIYFK[MT7].3y3_1.heavy 610.989 / 601.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 747 96 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56196.[MT7]-TYHEVVDEIYFK[MT7].3b4_1.heavy 610.989 / 675.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 749 96 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56196.[MT7]-TYHEVVDEIYFK[MT7].3b3_1.heavy 610.989 / 546.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 751 96 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56196.[MT7]-TYHEVVDEIYFK[MT7].3b8_1.heavy 610.989 / 1117.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 753 97 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57193.[MT7]-EHWNQTIVSLIYNVLK[MT7].4y4_1.heavy 562.07 / 617.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 755 97 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57193.[MT7]-EHWNQTIVSLIYNVLK[MT7].4b4_1.heavy 562.07 / 711.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 757 97 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57193.[MT7]-EHWNQTIVSLIYNVLK[MT7].4b5_1.heavy 562.07 / 839.392 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 759 97 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57193.[MT7]-EHWNQTIVSLIYNVLK[MT7].4b3_1.heavy 562.07 / 597.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 761 98 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56194.[MT7]-LAFYDLQEADLDK[MT7].2y8_1.heavy 914.982 / 1075.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 763 98 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56194.[MT7]-LAFYDLQEADLDK[MT7].2y5_1.heavy 914.982 / 705.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 765 98 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56194.[MT7]-LAFYDLQEADLDK[MT7].2y3_1.heavy 914.982 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 767 98 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56194.[MT7]-LAFYDLQEADLDK[MT7].2b5_1.heavy 914.982 / 754.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 769 99 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56761.[MT7]-MNTTLSSLK[MT7].2y4_1.heavy 641.868 / 578.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 771 99 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56761.[MT7]-MNTTLSSLK[MT7].2y8_1.heavy 641.868 / 1007.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 773 99 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56761.[MT7]-MNTTLSSLK[MT7].2y5_1.heavy 641.868 / 691.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 775 100 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57192.[MT7]-EHWNQTIVSLIYNVLK[MT7].3b6_1.heavy 749.091 / 940.439 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 777 100 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57192.[MT7]-EHWNQTIVSLIYNVLK[MT7].3b5_1.heavy 749.091 / 839.392 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 779 100 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57192.[MT7]-EHWNQTIVSLIYNVLK[MT7].3y4_1.heavy 749.091 / 617.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 781 100 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57192.[MT7]-EHWNQTIVSLIYNVLK[MT7].3y5_1.heavy 749.091 / 780.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 783 101 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538102.[MT7]-LSGQDVER.2b4_1.heavy 524.281 / 530.305 1178.0 19.736133575439453 38 20 2 6 10 13.079801116079375 7.645376188256191 0.03230094909667969 3 0.9986940379977731 34.14678527303036 1178.0 4.840291094147583 0.0 - - - - - - - 199.48275862068965 2 29 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 785 101 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538102.[MT7]-LSGQDVER.2y6_1.heavy 524.281 / 703.337 1893.0 19.736133575439453 38 20 2 6 10 13.079801116079375 7.645376188256191 0.03230094909667969 3 0.9986940379977731 34.14678527303036 1893.0 11.365076635514018 0.0 - - - - - - - 162.58620689655172 3 29 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 787 101 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538102.[MT7]-LSGQDVER.2b5_1.heavy 524.281 / 645.332 N/A 19.736133575439453 38 20 2 6 10 13.079801116079375 7.645376188256191 0.03230094909667969 3 0.9986940379977731 34.14678527303036 6571.0 26.419224921235454 2.0 - - - - - - - 729.7142857142857 59 7 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 789 101 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538102.[MT7]-LSGQDVER.2y7_1.heavy 524.281 / 790.369 9214.0 19.736133575439453 38 20 2 6 10 13.079801116079375 7.645376188256191 0.03230094909667969 3 0.9986940379977731 34.14678527303036 9214.0 103.14614063874818 0.0 - - - - - - - 188.76190476190476 18 21 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 791 102 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538201.[MT7]-FDQGDTTR.2y5_1.heavy 542.263 / 549.263 6182.0 18.607924938201904 42 15 10 7 10 1.614133036449816 41.66927400643838 0.029100418090820312 3 0.952667930081199 5.650105468191724 6182.0 26.276353869397344 0.0 - - - - - - - 161.33333333333334 12 24 F11R F11 receptor 793 102 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538201.[MT7]-FDQGDTTR.2y6_1.heavy 542.263 / 677.321 22172.0 18.607924938201904 42 15 10 7 10 1.614133036449816 41.66927400643838 0.029100418090820312 3 0.952667930081199 5.650105468191724 22172.0 76.71171639455908 0.0 - - - - - - - 297.5 44 18 F11R F11 receptor 795 102 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538201.[MT7]-FDQGDTTR.2b5_1.heavy 542.263 / 707.312 22310.0 18.607924938201904 42 15 10 7 10 1.614133036449816 41.66927400643838 0.029100418090820312 3 0.952667930081199 5.650105468191724 22310.0 25.95614849413711 0.0 - - - - - - - 224.5 44 20 F11R F11 receptor 797 102 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538201.[MT7]-FDQGDTTR.2y7_1.heavy 542.263 / 792.348 18718.0 18.607924938201904 42 15 10 7 10 1.614133036449816 41.66927400643838 0.029100418090820312 3 0.952667930081199 5.650105468191724 18718.0 86.05425287661767 0.0 - - - - - - - 235.63636363636363 37 22 F11R F11 receptor 799 103 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56455.[MT7]-ALVQEK[MT7].2y4_1.heavy 488.307 / 647.385 10004.0 20.38800048828125 47 17 10 10 10 3.0050019522645113 26.635252511726698 0.0 3 0.979931412878778 8.697110283384072 10004.0 43.51058886765409 0.0 - - - - - - - 265.2068965517241 20 29 CASZ1;WAS castor zinc finger 1;Wiskott-Aldrich syndrome (eczema-thrombocytopenia) 801 103 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56455.[MT7]-ALVQEK[MT7].2y5_1.heavy 488.307 / 760.469 12057.0 20.38800048828125 47 17 10 10 10 3.0050019522645113 26.635252511726698 0.0 3 0.979931412878778 8.697110283384072 12057.0 62.34592723453017 0.0 - - - - - - - 177.68 24 25 CASZ1;WAS castor zinc finger 1;Wiskott-Aldrich syndrome (eczema-thrombocytopenia) 803 103 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56455.[MT7]-ALVQEK[MT7].2b4_1.heavy 488.307 / 556.357 3621.0 20.38800048828125 47 17 10 10 10 3.0050019522645113 26.635252511726698 0.0 3 0.979931412878778 8.697110283384072 3621.0 6.23425720431576 0.0 - - - - - - - 276.875 7 24 CASZ1;WAS castor zinc finger 1;Wiskott-Aldrich syndrome (eczema-thrombocytopenia) 805 103 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56455.[MT7]-ALVQEK[MT7].2y3_1.heavy 488.307 / 548.316 11871.0 20.38800048828125 47 17 10 10 10 3.0050019522645113 26.635252511726698 0.0 3 0.979931412878778 8.697110283384072 11871.0 23.699399663664217 0.0 - - - - - - - 276.8333333333333 23 24 CASZ1;WAS castor zinc finger 1;Wiskott-Aldrich syndrome (eczema-thrombocytopenia) 807 104 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56317.[MT7]-DIVPGDIVEVAVGDK[MT7]VPADIR.3y7_1.heavy 822.467 / 942.585 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP2A1 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 809 104 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56317.[MT7]-DIVPGDIVEVAVGDK[MT7]VPADIR.3b7_1.heavy 822.467 / 854.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP2A1 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 811 104 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56317.[MT7]-DIVPGDIVEVAVGDK[MT7]VPADIR.3y5_1.heavy 822.467 / 571.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP2A1 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 813 104 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56317.[MT7]-DIVPGDIVEVAVGDK[MT7]VPADIR.3y9_1.heavy 822.467 / 1114.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP2A1 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 815 105 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57054.[MT7]-FLESPDFQPNIAK[MT7].3b6_1.heavy 598.661 / 833.416 16879.0 35.71950149536133 44 14 10 10 10 3.579083172377473 22.125469747583207 0.0 3 0.9442683074552699 5.203233613717353 16879.0 111.30261375823503 0.0 - - - - - - - 259.42857142857144 33 14 PPP2R5C;PPP2R5D protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta 817 105 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57054.[MT7]-FLESPDFQPNIAK[MT7].3b4_1.heavy 598.661 / 621.336 12072.0 35.71950149536133 44 14 10 10 10 3.579083172377473 22.125469747583207 0.0 3 0.9442683074552699 5.203233613717353 12072.0 51.70947593582888 0.0 - - - - - - - 747.875 24 8 PPP2R5C;PPP2R5D protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta 819 105 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57054.[MT7]-FLESPDFQPNIAK[MT7].3b3_1.heavy 598.661 / 534.304 8653.0 35.71950149536133 44 14 10 10 10 3.579083172377473 22.125469747583207 0.0 3 0.9442683074552699 5.203233613717353 8653.0 7.713324351155865 0.0 - - - - - - - 656.1428571428571 17 7 PPP2R5C;PPP2R5D protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta 821 105 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57054.[MT7]-FLESPDFQPNIAK[MT7].3y5_1.heavy 598.661 / 686.432 24250.0 35.71950149536133 44 14 10 10 10 3.579083172377473 22.125469747583207 0.0 3 0.9442683074552699 5.203233613717353 24250.0 46.5272013001438 0.0 - - - - - - - 778.2857142857143 48 7 PPP2R5C;PPP2R5D protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta 823 106 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 206097.0 22.047100067138672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 206097.0 740.1600162014379 0.0 - - - - - - - 731.1428571428571 412 7 825 106 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 297342.0 22.047100067138672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 297342.0 2260.005953386557 0.0 - - - - - - - 333.3333333333333 594 9 827 106 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 1121390.0 22.047100067138672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1121390.0 6432.014564102035 0.0 - - - - - - - 794.3333333333334 2242 6 829 107 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540971.[MT7]-IAWTHITIPESLR.3y7_1.heavy 560.99 / 815.462 117583.0 37.95809841156006 43 17 10 6 10 5.50391218223967 18.168894540629765 0.035999298095703125 3 0.9787492653315433 8.450906399748376 117583.0 324.5136789157723 0.0 - - - - - - - 250.9090909090909 235 11 TOLLIP toll interacting protein 831 107 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540971.[MT7]-IAWTHITIPESLR.3b4_1.heavy 560.99 / 616.357 47346.0 37.95809841156006 43 17 10 6 10 5.50391218223967 18.168894540629765 0.035999298095703125 3 0.9787492653315433 8.450906399748376 47346.0 292.1350425909494 0.0 - - - - - - - 255.55555555555554 94 9 TOLLIP toll interacting protein 833 107 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540971.[MT7]-IAWTHITIPESLR.3y8_1.heavy 560.99 / 928.546 28132.0 37.95809841156006 43 17 10 6 10 5.50391218223967 18.168894540629765 0.035999298095703125 3 0.9787492653315433 8.450906399748376 28132.0 288.9645652173913 0.0 - - - - - - - 176.92307692307693 56 13 TOLLIP toll interacting protein 835 107 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540971.[MT7]-IAWTHITIPESLR.3y5_1.heavy 560.99 / 601.33 184971.0 37.95809841156006 43 17 10 6 10 5.50391218223967 18.168894540629765 0.035999298095703125 3 0.9787492653315433 8.450906399748376 184971.0 445.93927187556847 0.0 - - - - - - - 299.0 369 4 TOLLIP toll interacting protein 837 108 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57050.[MT7]-VLIDWINDVLVGER.3y6_1.heavy 595.672 / 672.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARVA parvin, alpha 839 108 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57050.[MT7]-VLIDWINDVLVGER.3b4_1.heavy 595.672 / 585.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARVA parvin, alpha 841 108 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57050.[MT7]-VLIDWINDVLVGER.3y8_1.heavy 595.672 / 901.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARVA parvin, alpha 843 108 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57050.[MT7]-VLIDWINDVLVGER.3y5_1.heavy 595.672 / 573.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARVA parvin, alpha 845 109 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56452.[MT7]-THWNK[MT7].2y4_1.heavy 487.277 / 728.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 847 109 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56452.[MT7]-THWNK[MT7].2b4_1.heavy 487.277 / 683.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 849 109 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56452.[MT7]-THWNK[MT7].2y3_1.heavy 487.277 / 591.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 851 110 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541097.[MT7]-DAFDTLFDHAPDK[MT7].3y3_1.heavy 593.965 / 503.295 54072.0 37.105201721191406 46 16 10 10 10 2.315301950389921 33.51577508087966 0.0 3 0.9664228454874297 6.716108086571312 54072.0 87.16127330692686 0.0 - - - - - - - 341.0 108 9 PARVB;PARVA parvin, beta;parvin, alpha 853 110 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541097.[MT7]-DAFDTLFDHAPDK[MT7].3b4_1.heavy 593.965 / 593.269 16341.0 37.105201721191406 46 16 10 10 10 2.315301950389921 33.51577508087966 0.0 3 0.9664228454874297 6.716108086571312 16341.0 9.004326268076422 0.0 - - - - - - - 396.0 32 1 PARVB;PARVA parvin, beta;parvin, alpha 855 110 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541097.[MT7]-DAFDTLFDHAPDK[MT7].3y4_1.heavy 593.965 / 574.332 17529.0 37.105201721191406 46 16 10 10 10 2.315301950389921 33.51577508087966 0.0 3 0.9664228454874297 6.716108086571312 17529.0 13.670870687817589 1.0 - - - - - - - 680.625 35 8 PARVB;PARVA parvin, beta;parvin, alpha 857 110 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541097.[MT7]-DAFDTLFDHAPDK[MT7].3b8_1.heavy 593.965 / 1069.5 6833.0 37.105201721191406 46 16 10 10 10 2.315301950389921 33.51577508087966 0.0 3 0.9664228454874297 6.716108086571312 6833.0 21.886464646464646 1.0 - - - - - - - 160.875 13 8 PARVB;PARVA parvin, beta;parvin, alpha 859 111 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538536.[MT7]-LNVLANVIR.2y8_1.heavy 578.37 / 898.547 10626.0 39.100399017333984 45 15 10 10 10 1.9911696108419208 43.08621631678914 0.0 3 0.9530238559732542 5.671640945964215 10626.0 61.37765055388586 0.0 - - - - - - - 214.0 21 16 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 861 111 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538536.[MT7]-LNVLANVIR.2y5_1.heavy 578.37 / 572.352 8431.0 39.100399017333984 45 15 10 10 10 1.9911696108419208 43.08621631678914 0.0 3 0.9530238559732542 5.671640945964215 8431.0 12.75381608670271 0.0 - - - - - - - 726.4545454545455 16 11 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 863 111 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538536.[MT7]-LNVLANVIR.2y6_1.heavy 578.37 / 685.435 8343.0 39.100399017333984 45 15 10 10 10 1.9911696108419208 43.08621631678914 0.0 3 0.9530238559732542 5.671640945964215 8343.0 25.411497098345198 0.0 - - - - - - - 304.3333333333333 16 15 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 865 111 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538536.[MT7]-LNVLANVIR.2y7_1.heavy 578.37 / 784.504 3601.0 39.100399017333984 45 15 10 10 10 1.9911696108419208 43.08621631678914 0.0 3 0.9530238559732542 5.671640945964215 3601.0 12.047697697697696 0.0 - - - - - - - 627.4285714285714 7 7 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 867 112 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56579.[MT7]-RYVDQK[MT7].2y4_1.heavy 548.821 / 633.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 869 112 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56579.[MT7]-RYVDQK[MT7].2y5_1.heavy 548.821 / 796.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 871 112 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56579.[MT7]-RYVDQK[MT7].2b4_1.heavy 548.821 / 678.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 873 112 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56579.[MT7]-RYVDQK[MT7].2y3_1.heavy 548.821 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 875 113 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB536967.[MT7]-SDVNK[MT7].2y4_1.heavy 425.747 / 619.353 664.0 13.597000122070312 50 20 10 10 10 21.537679421154074 4.643025743143948 0.0 3 0.9982138064147309 29.196678080350075 664.0 12.30201550387597 0.0 - - - - - - - 0.0 1 0 RBM22 RNA binding motif protein 22 877 113 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB536967.[MT7]-SDVNK[MT7].2b3_1.heavy 425.747 / 446.237 484.0 13.597000122070312 50 20 10 10 10 21.537679421154074 4.643025743143948 0.0 3 0.9982138064147309 29.196678080350075 484.0 6.658201058201058 0.0 - - - - - - - 0.0 0 0 RBM22 RNA binding motif protein 22 879 113 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB536967.[MT7]-SDVNK[MT7].2b4_1.heavy 425.747 / 560.28 233.0 13.597000122070312 50 20 10 10 10 21.537679421154074 4.643025743143948 0.0 3 0.9982138064147309 29.196678080350075 233.0 0.6517482517482518 16.0 - - - - - - - 0.0 1 0 RBM22 RNA binding motif protein 22 881 113 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB536967.[MT7]-SDVNK[MT7].2y3_1.heavy 425.747 / 504.326 1058.0 13.597000122070312 50 20 10 10 10 21.537679421154074 4.643025743143948 0.0 3 0.9982138064147309 29.196678080350075 1058.0 9.695994041800494 1.0 - - - - - - - 128.89285714285714 2 28 RBM22 RNA binding motif protein 22 883 114 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538671.[MT7]-IDPYVFDR.2y4_1.heavy 584.81 / 536.283 2876.0 34.69279861450195 50 20 10 10 10 9.874321674663298 10.127277933084946 0.0 3 0.9978057691506336 26.341576766624364 2876.0 4.720994557149925 2.0 - - - - - - - 1264.142857142857 5 7 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 885 114 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538671.[MT7]-IDPYVFDR.2b4_1.heavy 584.81 / 633.336 5309.0 34.69279861450195 50 20 10 10 10 9.874321674663298 10.127277933084946 0.0 3 0.9978057691506336 26.341576766624364 5309.0 10.975366366717308 0.0 - - - - - - - 774.2222222222222 10 9 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 887 114 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538671.[MT7]-IDPYVFDR.2y6_1.heavy 584.81 / 796.399 53421.0 34.69279861450195 50 20 10 10 10 9.874321674663298 10.127277933084946 0.0 3 0.9978057691506336 26.341576766624364 53421.0 154.05968804588025 0.0 - - - - - - - 301.6363636363636 106 11 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 889 114 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538671.[MT7]-IDPYVFDR.2y7_1.heavy 584.81 / 911.426 10507.0 34.69279861450195 50 20 10 10 10 9.874321674663298 10.127277933084946 0.0 3 0.9978057691506336 26.341576766624364 10507.0 136.49976886388652 0.0 - - - - - - - 184.5 21 12 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 891 115 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539256.[MT7]-SFSGLTYLK[MT7].3y3_1.heavy 435.255 / 567.362 8272.0 34.85179901123047 38 18 2 10 8 3.8646809027333537 25.875357504748578 0.0 4 0.9806945174278314 8.86790156852753 8272.0 1.6836520369529002 1.0 - - - - - - - 206.75 68 8 TLR7 toll-like receptor 7 893 115 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539256.[MT7]-SFSGLTYLK[MT7].3b4_1.heavy 435.255 / 523.263 12132.0 34.85179901123047 38 18 2 10 8 3.8646809027333537 25.875357504748578 0.0 4 0.9806945174278314 8.86790156852753 12132.0 57.95860070265614 0.0 - - - - - - - 206.0 24 15 TLR7 toll-like receptor 7 895 115 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539256.[MT7]-SFSGLTYLK[MT7].3b5_1.heavy 435.255 / 636.347 6838.0 34.85179901123047 38 18 2 10 8 3.8646809027333537 25.875357504748578 0.0 4 0.9806945174278314 8.86790156852753 6838.0 36.69932239562492 0.0 - - - - - - - 239.0 13 6 TLR7 toll-like receptor 7 897 115 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539256.[MT7]-SFSGLTYLK[MT7].3y4_1.heavy 435.255 / 668.41 2537.0 34.85179901123047 38 18 2 10 8 3.8646809027333537 25.875357504748578 0.0 4 0.9806945174278314 8.86790156852753 2537.0 10.830449541347253 0.0 - - - - - - - 275.8 5 10 TLR7 toll-like receptor 7 899 116 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57033.[MT7]-K[MT7]SDFEVFDALK[MT7].3b5_1.heavy 577.661 / 895.476 5909.0 35.79899978637695 38 8 10 10 10 0.5174770493289416 90.16203323812744 0.0 3 0.7993883578759605 2.7079527984199094 5909.0 27.010316702569256 1.0 - - - - - - - 229.7 11 10 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 901 116 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57033.[MT7]-K[MT7]SDFEVFDALK[MT7].3y4_1.heavy 577.661 / 590.363 16413.0 35.79899978637695 38 8 10 10 10 0.5174770493289416 90.16203323812744 0.0 3 0.7993883578759605 2.7079527984199094 16413.0 36.01001055105772 0.0 - - - - - - - 648.0 32 13 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 903 116 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57033.[MT7]-K[MT7]SDFEVFDALK[MT7].3b3_1.heavy 577.661 / 619.365 N/A 35.79899978637695 38 8 10 10 10 0.5174770493289416 90.16203323812744 0.0 3 0.7993883578759605 2.7079527984199094 4267.0 16.52900152763517 1.0 - - - - - - - 289.2142857142857 10 14 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 905 116 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57033.[MT7]-K[MT7]SDFEVFDALK[MT7].3y5_1.heavy 577.661 / 737.431 15647.0 35.79899978637695 38 8 10 10 10 0.5174770493289416 90.16203323812744 0.0 3 0.7993883578759605 2.7079527984199094 15647.0 36.4131901881736 0.0 - - - - - - - 255.11111111111111 31 9 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 907 117 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56572.[MT7]-FLFLDHR.2b3_1.heavy 546.31 / 552.33 5159.0 35.880401611328125 41 13 10 10 8 2.0843669987853173 47.97619615848641 0.0 4 0.91840434741542 4.290724386003028 5159.0 5.795316532225724 1.0 - - - - - - - 266.85714285714283 11 7 NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 909 117 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56572.[MT7]-FLFLDHR.2b4_1.heavy 546.31 / 665.414 3293.0 35.880401611328125 41 13 10 10 8 2.0843669987853173 47.97619615848641 0.0 4 0.91840434741542 4.290724386003028 3293.0 7.768665911514411 0.0 - - - - - - - 683.1111111111111 6 9 NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 911 117 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56572.[MT7]-FLFLDHR.2y6_1.heavy 546.31 / 800.441 4610.0 35.880401611328125 41 13 10 10 8 2.0843669987853173 47.97619615848641 0.0 4 0.91840434741542 4.290724386003028 4610.0 24.100911854103344 0.0 - - - - - - - 192.25 9 12 NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 913 117 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56572.[MT7]-FLFLDHR.2b5_1.heavy 546.31 / 780.441 18113.0 35.880401611328125 41 13 10 10 8 2.0843669987853173 47.97619615848641 0.0 4 0.91840434741542 4.290724386003028 18113.0 32.80774487471526 1.0 - - - - - - - 259.54545454545456 36 11 NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 915 118 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542678.[MT7]-LTVADALEPVQFEDGEK[MT7].3y6_1.heavy 717.047 / 868.417 10647.0 38.84560012817383 44 18 10 6 10 4.504247860895247 17.526820659115284 0.037200927734375 3 0.982159099418263 9.225845492688666 10647.0 33.96257047962807 0.0 - - - - - - - 685.7142857142857 21 7 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 917 118 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542678.[MT7]-LTVADALEPVQFEDGEK[MT7].3b6_1.heavy 717.047 / 715.411 26269.0 38.84560012817383 44 18 10 6 10 4.504247860895247 17.526820659115284 0.037200927734375 3 0.982159099418263 9.225845492688666 26269.0 35.6592592472281 0.0 - - - - - - - 291.0 52 3 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 919 118 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542678.[MT7]-LTVADALEPVQFEDGEK[MT7].3b5_1.heavy 717.047 / 644.374 20509.0 38.84560012817383 44 18 10 6 10 4.504247860895247 17.526820659115284 0.037200927734375 3 0.982159099418263 9.225845492688666 20509.0 27.075228967723454 0.0 - - - - - - - 1241.3333333333333 41 9 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 921 118 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542678.[MT7]-LTVADALEPVQFEDGEK[MT7].3b8_1.heavy 717.047 / 957.537 10298.0 38.84560012817383 44 18 10 6 10 4.504247860895247 17.526820659115284 0.037200927734375 3 0.982159099418263 9.225845492688666 10298.0 14.637999865565554 0.0 - - - - - - - 775.7777777777778 20 9 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 923 119 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56578.[MT7]-MISANIFR.2y5_1.heavy 548.309 / 620.352 1954.0 36.007198333740234 43 13 10 10 10 0.9502589509897912 68.64408435268665 0.0 3 0.9205226479624874 4.348319428353109 1954.0 6.297421731123388 3.0 - - - - - - - 287.0 3 14 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 925 119 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56578.[MT7]-MISANIFR.2y6_1.heavy 548.309 / 707.383 7163.0 36.007198333740234 43 13 10 10 10 0.9502589509897912 68.64408435268665 0.0 3 0.9205226479624874 4.348319428353109 7163.0 11.358196156814843 0.0 - - - - - - - 728.8571428571429 14 7 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 927 119 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56578.[MT7]-MISANIFR.2b5_1.heavy 548.309 / 661.346 2496.0 36.007198333740234 43 13 10 10 10 0.9502589509897912 68.64408435268665 0.0 3 0.9205226479624874 4.348319428353109 2496.0 7.703975686216537 0.0 - - - - - - - 266.6363636363636 4 11 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 929 119 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56578.[MT7]-MISANIFR.2y7_1.heavy 548.309 / 820.468 9225.0 36.007198333740234 43 13 10 10 10 0.9502589509897912 68.64408435268665 0.0 3 0.9205226479624874 4.348319428353109 9225.0 49.261584413869215 0.0 - - - - - - - 208.92307692307693 18 13 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 931 120 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539393.[MT7]-NLTIVDSGLK[MT7].3y3_1.heavy 449.941 / 461.32 58785.0 31.658899307250977 38 20 0 10 8 13.552456388307526 7.378736159319109 0.0 4 0.9902208346336632 12.469726227313805 58785.0 68.67751215451614 1.0 - - - - - - - 419.0 652 2 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 933 120 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539393.[MT7]-NLTIVDSGLK[MT7].3b4_1.heavy 449.941 / 586.368 53021.0 31.658899307250977 38 20 0 10 8 13.552456388307526 7.378736159319109 0.0 4 0.9902208346336632 12.469726227313805 53021.0 123.93893376050137 0.0 - - - - - - - 209.8 106 5 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 935 120 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539393.[MT7]-NLTIVDSGLK[MT7].3y4_1.heavy 449.941 / 548.352 52078.0 31.658899307250977 38 20 0 10 8 13.552456388307526 7.378736159319109 0.0 4 0.9902208346336632 12.469726227313805 52078.0 52.85379195588672 0.0 - - - - - - - 748.2857142857143 104 7 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 937 120 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539393.[MT7]-NLTIVDSGLK[MT7].3b3_1.heavy 449.941 / 473.284 48201.0 31.658899307250977 38 20 0 10 8 13.552456388307526 7.378736159319109 0.0 4 0.9902208346336632 12.469726227313805 48201.0 196.43931732983904 0.0 - - - - - - - 641.875 96 8 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 939 121 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56678.[MT7]-K[MT7]LEELK[MT7].2y4_1.heavy 596.387 / 662.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCDC72;PPP2R5A;EXOG coiled-coil domain containing 72;protein phosphatase 2, regulatory subunit B', alpha;endo/exonuclease (5'-3'), endonuclease G-like 941 121 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56678.[MT7]-K[MT7]LEELK[MT7].2b3_1.heavy 596.387 / 659.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCDC72;PPP2R5A;EXOG coiled-coil domain containing 72;protein phosphatase 2, regulatory subunit B', alpha;endo/exonuclease (5'-3'), endonuclease G-like 943 121 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56678.[MT7]-K[MT7]LEELK[MT7].2y5_1.heavy 596.387 / 775.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCDC72;PPP2R5A;EXOG coiled-coil domain containing 72;protein phosphatase 2, regulatory subunit B', alpha;endo/exonuclease (5'-3'), endonuclease G-like 945 121 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56678.[MT7]-K[MT7]LEELK[MT7].2b4_1.heavy 596.387 / 788.476 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCDC72;PPP2R5A;EXOG coiled-coil domain containing 72;protein phosphatase 2, regulatory subunit B', alpha;endo/exonuclease (5'-3'), endonuclease G-like 947 122 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56966.[MT7]-ILPIMFASLYK[MT7].2b8_2.heavy 792.477 / 509.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 949 122 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56966.[MT7]-ILPIMFASLYK[MT7].2y5_1.heavy 792.477 / 725.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 951 122 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56966.[MT7]-ILPIMFASLYK[MT7].2y9_1.heavy 792.477 / 1213.68 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 953 122 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56966.[MT7]-ILPIMFASLYK[MT7].2y7_1.heavy 792.477 / 1003.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 955 123 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56770.[MT7]-APEIMLNSK[MT7].2y4_1.heavy 645.87 / 605.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK1;MAPK3 mitogen-activated protein kinase 1;mitogen-activated protein kinase 3 957 123 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56770.[MT7]-APEIMLNSK[MT7].2y8_1.heavy 645.87 / 1075.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK1;MAPK3 mitogen-activated protein kinase 1;mitogen-activated protein kinase 3 959 123 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56770.[MT7]-APEIMLNSK[MT7].2y5_1.heavy 645.87 / 736.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK1;MAPK3 mitogen-activated protein kinase 1;mitogen-activated protein kinase 3 961 123 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56770.[MT7]-APEIMLNSK[MT7].2y6_1.heavy 645.87 / 849.498 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK1;MAPK3 mitogen-activated protein kinase 1;mitogen-activated protein kinase 3 963 124 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56050.[MT7]-TIHGLIYNALK[MT7].3b4_1.heavy 510.98 / 553.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C;PPP2R5D protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta 965 124 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56050.[MT7]-TIHGLIYNALK[MT7].3b3_2.heavy 510.98 / 248.654 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C;PPP2R5D protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta 967 124 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56050.[MT7]-TIHGLIYNALK[MT7].3b5_1.heavy 510.98 / 666.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C;PPP2R5D protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta 969 124 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56050.[MT7]-TIHGLIYNALK[MT7].3y4_1.heavy 510.98 / 589.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C;PPP2R5D protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta 971 125 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56879.[MT7]-K[MT7]IEEPLFK[MT7].3y3_1.heavy 479.301 / 551.367 17870.0 29.089099884033203 46 16 10 10 10 1.7145773295006037 41.42975695989051 0.0 3 0.9605893689490707 6.196107415105741 17870.0 22.19862505978001 0.0 - - - - - - - 803.6 35 10 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 973 125 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56879.[MT7]-K[MT7]IEEPLFK[MT7].3b3_2.heavy 479.301 / 330.22 26642.0 29.089099884033203 46 16 10 10 10 1.7145773295006037 41.42975695989051 0.0 3 0.9605893689490707 6.196107415105741 26642.0 19.342183838208488 0.0 - - - - - - - 1241.7142857142858 53 7 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 975 125 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56879.[MT7]-K[MT7]IEEPLFK[MT7].3b3_1.heavy 479.301 / 659.433 8935.0 29.089099884033203 46 16 10 10 10 1.7145773295006037 41.42975695989051 0.0 3 0.9605893689490707 6.196107415105741 8935.0 9.806707317073172 0.0 - - - - - - - 719.7777777777778 17 9 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 977 125 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56879.[MT7]-K[MT7]IEEPLFK[MT7].3y4_1.heavy 479.301 / 648.42 29511.0 29.089099884033203 46 16 10 10 10 1.7145773295006037 41.42975695989051 0.0 3 0.9605893689490707 6.196107415105741 29511.0 62.162860310421294 0.0 - - - - - - - 276.75 59 16 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 979 126 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542078.[MT7]-HLGAVNTIVFVDENRR.4y8_2.heavy 496.777 / 517.773 22774.0 31.050899505615234 40 10 10 10 10 1.299320909520075 59.63698070859196 0.0 3 0.8252308432265629 2.90798289536272 22774.0 27.42070516842167 0.0 - - - - - - - 737.6666666666666 45 9 CDC40 cell division cycle 40 homolog (S. cerevisiae) 981 126 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542078.[MT7]-HLGAVNTIVFVDENRR.4b4_1.heavy 496.777 / 523.311 11438.0 31.050899505615234 40 10 10 10 10 1.299320909520075 59.63698070859196 0.0 3 0.8252308432265629 2.90798289536272 11438.0 19.80930163799742 0.0 - - - - - - - 676.75 22 8 CDC40 cell division cycle 40 homolog (S. cerevisiae) 983 126 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542078.[MT7]-HLGAVNTIVFVDENRR.4b5_1.heavy 496.777 / 622.379 5413.0 31.050899505615234 40 10 10 10 10 1.299320909520075 59.63698070859196 0.0 3 0.8252308432265629 2.90798289536272 5413.0 8.811860465116279 0.0 - - - - - - - 715.0 10 11 CDC40 cell division cycle 40 homolog (S. cerevisiae) 985 126 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542078.[MT7]-HLGAVNTIVFVDENRR.4b6_1.heavy 496.777 / 736.422 2451.0 31.050899505615234 40 10 10 10 10 1.299320909520075 59.63698070859196 0.0 3 0.8252308432265629 2.90798289536272 2451.0 6.97805155628685 1.0 - - - - - - - 227.6153846153846 5 13 CDC40 cell division cycle 40 homolog (S. cerevisiae) 987 127 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB543338.[MT7]-EFVSWQQDLEDSVK[MT7]PTQQARPTVIR.4y15_2.heavy 812.184 / 920.53 4718.0 36.267601013183594 50 20 10 10 10 7.1245037190458635 14.036065379918467 0.0 3 0.9947809158961635 17.075607207107456 4718.0 58.466008724100334 0.0 - - - - - - - 173.84615384615384 9 13 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 989 127 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB543338.[MT7]-EFVSWQQDLEDSVK[MT7]PTQQARPTVIR.4b4_1.heavy 812.184 / 607.321 8944.0 36.267601013183594 50 20 10 10 10 7.1245037190458635 14.036065379918467 0.0 3 0.9947809158961635 17.075607207107456 8944.0 20.156354378818737 0.0 - - - - - - - 322.7857142857143 17 14 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 991 127 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB543338.[MT7]-EFVSWQQDLEDSVK[MT7]PTQQARPTVIR.4b3_1.heavy 812.184 / 520.289 10812.0 36.267601013183594 50 20 10 10 10 7.1245037190458635 14.036065379918467 0.0 3 0.9947809158961635 17.075607207107456 10812.0 18.253659041377254 0.0 - - - - - - - 245.8 21 10 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 993 127 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB543338.[MT7]-EFVSWQQDLEDSVK[MT7]PTQQARPTVIR.4y14_2.heavy 812.184 / 863.016 6389.0 36.267601013183594 50 20 10 10 10 7.1245037190458635 14.036065379918467 0.0 3 0.9947809158961635 17.075607207107456 6389.0 44.46825202464448 0.0 - - - - - - - 259.1818181818182 12 11 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 995 128 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 450261.0 31.09000015258789 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 450261.0 438.1149329120704 0.0 - - - - - - - 241.5 900 10 997 128 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 467854.0 31.09000015258789 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 467854.0 954.2133097317985 0.0 - - - - - - - 218.0 935 12 999 128 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 806012.0 31.09000015258789 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 806012.0 1069.8157943969165 0.0 - - - - - - - 1249.2857142857142 1612 7 1001 129 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538118.[MT7]-LQELMK[MT7].2y4_1.heavy 525.317 / 664.382 2857.0 30.669666290283203 35 14 10 5 6 1.2615639732490556 46.6800300064335 0.04010009765625 5 0.9441268632857266 5.196580850195311 2857.0 2.0981107584149035 2.0 - - - - - - - 235.44444444444446 6 18 PARVA parvin, alpha 1003 129 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538118.[MT7]-LQELMK[MT7].2b3_1.heavy 525.317 / 515.295 N/A 30.669666290283203 35 14 10 5 6 1.2615639732490556 46.6800300064335 0.04010009765625 5 0.9441268632857266 5.196580850195311 3317.0 1.2797878344581894 5.0 - - - - - - - 1225.6 7 10 PARVA parvin, alpha 1005 129 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538118.[MT7]-LQELMK[MT7].2y5_1.heavy 525.317 / 792.441 3594.0 30.669666290283203 35 14 10 5 6 1.2615639732490556 46.6800300064335 0.04010009765625 5 0.9441268632857266 5.196580850195311 3594.0 8.227307234415784 0.0 - - - - - - - 253.3125 7 16 PARVA parvin, alpha 1007 129 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538118.[MT7]-LQELMK[MT7].2y3_1.heavy 525.317 / 535.339 1659.0 30.669666290283203 35 14 10 5 6 1.2615639732490556 46.6800300064335 0.04010009765625 5 0.9441268632857266 5.196580850195311 1659.0 3.465395267794335 3.0 - - - - - - - 307.1111111111111 5 18 PARVA parvin, alpha 1009 130 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56871.[MT7]-VTHVEPWEK[MT7].2y4_1.heavy 706.892 / 703.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1011 130 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56871.[MT7]-VTHVEPWEK[MT7].2y3_1.heavy 706.892 / 606.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1013 130 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56871.[MT7]-VTHVEPWEK[MT7].2y6_1.heavy 706.892 / 931.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1015 130 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56871.[MT7]-VTHVEPWEK[MT7].2b5_1.heavy 706.892 / 710.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1017 131 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56308.[MT7]-VADPDHDHTGFLTEYVATR.3y7_1.heavy 763.374 / 839.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK1 mitogen-activated protein kinase 1 1019 131 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56308.[MT7]-VADPDHDHTGFLTEYVATR.3b5_1.heavy 763.374 / 642.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK1 mitogen-activated protein kinase 1 1021 131 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56308.[MT7]-VADPDHDHTGFLTEYVATR.3y8_1.heavy 763.374 / 952.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK1 mitogen-activated protein kinase 1 1023 131 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56308.[MT7]-VADPDHDHTGFLTEYVATR.3y10_1.heavy 763.374 / 1156.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK1 mitogen-activated protein kinase 1 1025 132 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56270.[MT7]-YQSNQQELTPLPLLK[MT7].2b8_1.heavy 1030.59 / 1135.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1027 132 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56270.[MT7]-YQSNQQELTPLPLLK[MT7].2y4_1.heavy 1030.59 / 614.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1029 132 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56270.[MT7]-YQSNQQELTPLPLLK[MT7].2y6_1.heavy 1030.59 / 824.573 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1031 132 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56270.[MT7]-YQSNQQELTPLPLLK[MT7].2b7_1.heavy 1030.59 / 1022.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1033 133 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56468.[MT7]-AFSMDDR.2y6_1.heavy 493.23 / 770.314 5531.0 25.367400487263996 38 14 10 6 8 3.531458623939407 28.31691112621565 0.037200927734375 4 0.9364504105188542 4.869437359000671 5531.0 53.77268546411214 0.0 - - - - - - - 227.33333333333334 11 15 TOLLIP toll interacting protein 1035 133 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56468.[MT7]-AFSMDDR.2b5_1.heavy 493.23 / 696.314 14086.0 25.367400487263996 38 14 10 6 8 3.531458623939407 28.31691112621565 0.037200927734375 4 0.9364504105188542 4.869437359000671 14086.0 50.47442786413356 0.0 - - - - - - - 277.4375 28 16 TOLLIP toll interacting protein 1037 133 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56468.[MT7]-AFSMDDR.2y5_1.heavy 493.23 / 623.245 1544.0 25.367400487263996 38 14 10 6 8 3.531458623939407 28.31691112621565 0.037200927734375 4 0.9364504105188542 4.869437359000671 1544.0 2.892822966507177 1.0 - - - - - - - 635.375 3 8 TOLLIP toll interacting protein 1039 133 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56468.[MT7]-AFSMDDR.2b4_2.heavy 493.23 / 291.147 N/A 25.367400487263996 38 14 10 6 8 3.531458623939407 28.31691112621565 0.037200927734375 4 0.9364504105188542 4.869437359000671 7075.0 2.0610374258695305 22.0 - - - - - - - 2766.0 29 1 TOLLIP toll interacting protein 1041 134 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56993.[MT7]-LVEDHLAVQSLIR.2y9_1.heavy 818.979 / 1036.63 2632.0 35.368024826049805 39 15 10 6 8 1.5674064796991707 42.44967333668954 0.03890228271484375 4 0.955644962359336 5.838111912058814 2632.0 26.34181818181818 0.0 - - - - - - - 164.58333333333334 5 12 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1043 134 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56993.[MT7]-LVEDHLAVQSLIR.2b4_1.heavy 818.979 / 601.331 3948.0 35.368024826049805 39 15 10 6 8 1.5674064796991707 42.44967333668954 0.03890228271484375 4 0.955644962359336 5.838111912058814 3948.0 16.8 0.0 - - - - - - - 229.27272727272728 7 11 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1045 134 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56993.[MT7]-LVEDHLAVQSLIR.2b5_1.heavy 818.979 / 738.39 1645.0 35.368024826049805 39 15 10 6 8 1.5674064796991707 42.44967333668954 0.03890228271484375 4 0.955644962359336 5.838111912058814 1645.0 2.0 1.0 - - - - - - - 248.26315789473685 3 19 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1047 134 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56993.[MT7]-LVEDHLAVQSLIR.2y7_1.heavy 818.979 / 786.483 2851.0 35.368024826049805 39 15 10 6 8 1.5674064796991707 42.44967333668954 0.03890228271484375 4 0.955644962359336 5.838111912058814 2851.0 12.088586626139817 1.0 - - - - - - - 263.26666666666665 5 15 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1049 135 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540379.[MT7]-NVLFAHLDDNER.3y6_1.heavy 529.606 / 761.342 82688.0 32.595401763916016 50 20 10 10 10 15.991250301622362 6.253419721024233 0.0 3 0.9977085137281514 25.7763116140782 82688.0 127.64228691310797 0.0 - - - - - - - 663.6666666666666 165 9 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 1051 135 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540379.[MT7]-NVLFAHLDDNER.3b4_1.heavy 529.606 / 618.373 52707.0 32.595401763916016 50 20 10 10 10 15.991250301622362 6.253419721024233 0.0 3 0.9977085137281514 25.7763116140782 52707.0 87.18095149168678 0.0 - - - - - - - 1204.2857142857142 105 7 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 1053 135 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540379.[MT7]-NVLFAHLDDNER.3b5_1.heavy 529.606 / 689.41 52920.0 32.595401763916016 50 20 10 10 10 15.991250301622362 6.253419721024233 0.0 3 0.9977085137281514 25.7763116140782 52920.0 312.6130985915493 0.0 - - - - - - - 259.0 105 7 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 1055 135 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540379.[MT7]-NVLFAHLDDNER.3y5_1.heavy 529.606 / 648.258 74792.0 32.595401763916016 50 20 10 10 10 15.991250301622362 6.253419721024233 0.0 3 0.9977085137281514 25.7763116140782 74792.0 85.41251868163945 0.0 - - - - - - - 306.75 149 8 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 1057 136 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542237.[MT7]-K[MT7]LHEYNTQFQEK[MT7].4y4_1.heavy 500.026 / 695.385 6266.0 21.880599975585938 47 17 10 10 10 8.12657672039254 12.305304366236227 0.0 3 0.9799761580416689 8.706854823765457 6266.0 25.18283410138249 0.0 - - - - - - - 213.24 12 25 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1059 136 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542237.[MT7]-K[MT7]LHEYNTQFQEK[MT7].4b4_1.heavy 500.026 / 796.492 1253.0 21.880599975585938 47 17 10 10 10 8.12657672039254 12.305304366236227 0.0 3 0.9799761580416689 8.706854823765457 1253.0 1.4897245968121708 0.0 - - - - - - - 155.92 2 25 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1061 136 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542237.[MT7]-K[MT7]LHEYNTQFQEK[MT7].4y3_1.heavy 500.026 / 548.316 6132.0 21.880599975585938 47 17 10 10 10 8.12657672039254 12.305304366236227 0.0 3 0.9799761580416689 8.706854823765457 6132.0 20.352268701457966 0.0 - - - - - - - 626.6 12 10 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1063 136 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542237.[MT7]-K[MT7]LHEYNTQFQEK[MT7].4b6_2.heavy 500.026 / 537.303 13338.0 21.880599975585938 47 17 10 10 10 8.12657672039254 12.305304366236227 0.0 3 0.9799761580416689 8.706854823765457 13338.0 49.61134348196298 0.0 - - - - - - - 285.4583333333333 26 24 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1065 137 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56702.[MT7]-DAFLNLTK[MT7].2y4_1.heavy 605.358 / 619.39 2101.0 34.32809829711914 28 14 0 10 4 1.8848307255616676 53.05516227203938 0.0 9 0.942404384155798 5.117535163504897 2101.0 12.073619909502263 2.0 - - - - - - - 247.2941176470588 4 17 TLR7 toll-like receptor 7 1067 137 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56702.[MT7]-DAFLNLTK[MT7].2y5_1.heavy 605.358 / 732.474 1327.0 34.32809829711914 28 14 0 10 4 1.8848307255616676 53.05516227203938 0.0 9 0.942404384155798 5.117535163504897 1327.0 3.8415929565594498 3.0 - - - - - - - 214.0 2 15 TLR7 toll-like receptor 7 1069 137 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56702.[MT7]-DAFLNLTK[MT7].2y3_1.heavy 605.358 / 505.347 N/A 34.32809829711914 28 14 0 10 4 1.8848307255616676 53.05516227203938 0.0 9 0.942404384155798 5.117535163504897 774.0 -0.047717226299736765 28.0 - - - - - - - 774.25 27 8 TLR7 toll-like receptor 7 1071 137 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56702.[MT7]-DAFLNLTK[MT7].2y7_1.heavy 605.358 / 950.579 332.0 34.32809829711914 28 14 0 10 4 1.8848307255616676 53.05516227203938 0.0 9 0.942404384155798 5.117535163504897 332.0 1.2910407239819004 8.0 - - - - - - - 156.91666666666666 3 12 TLR7 toll-like receptor 7 1073 138 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 254482.0 25.81983248392741 23 -3 10 6 10 null 0.0 0.0391998291015625 3 0.0 0.0 254482.0 527.3366838543261 0.0 - - - - - - - 896.0 508 1 1075 138 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 325408.0 25.81983248392741 23 -3 10 6 10 null 0.0 0.0391998291015625 3 0.0 0.0 325408.0 2219.8227987595988 0.0 - - - - - - - 1287.0 650 3 1077 138 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 378000.0 25.81983248392741 23 -3 10 6 10 null 0.0 0.0391998291015625 3 0.0 0.0 378000.0 1762.2031951342594 0.0 - - - - - - - 1379.0 756 1 1079 139 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56083.[MT7]-RRDQFNVLIK[MT7].3y7_1.heavy 526.322 / 1005.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 1081 139 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56083.[MT7]-RRDQFNVLIK[MT7].3y3_1.heavy 526.322 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 1083 139 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56083.[MT7]-RRDQFNVLIK[MT7].3y4_1.heavy 526.322 / 616.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 1085 139 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56083.[MT7]-RRDQFNVLIK[MT7].3b8_2.heavy 526.322 / 587.334 N/A N/A - - - - - - - - - 0.0 - - - - - - - NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 1087 140 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55865.[MT7]-YQQDQVVK[MT7].2b4_1.heavy 648.364 / 679.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1089 140 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55865.[MT7]-YQQDQVVK[MT7].2b6_1.heavy 648.364 / 906.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1091 140 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55865.[MT7]-YQQDQVVK[MT7].2b5_1.heavy 648.364 / 807.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1093 140 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55865.[MT7]-YQQDQVVK[MT7].2y7_1.heavy 648.364 / 988.554 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1095 141 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56171.[MT7]-FLESPDFQPSIAK[MT7].2b8_1.heavy 883.982 / 1108.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1097 141 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56171.[MT7]-FLESPDFQPSIAK[MT7].2b3_1.heavy 883.982 / 534.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1099 141 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56171.[MT7]-FLESPDFQPSIAK[MT7].2y5_1.heavy 883.982 / 659.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1101 141 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56171.[MT7]-FLESPDFQPSIAK[MT7].2b4_1.heavy 883.982 / 621.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1103 142 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538891.[MT7]-ELDEITAK[MT7].3y3_1.heavy 402.899 / 463.3 32314.0 27.25309944152832 46 16 10 10 10 1.6744141776927703 39.81492008060325 0.0 3 0.961987658778609 6.309786415650572 32314.0 260.7405517241379 0.0 - - - - - - - 570.4285714285714 64 7 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1105 142 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538891.[MT7]-ELDEITAK[MT7].3b4_1.heavy 402.899 / 631.305 30861.0 27.25309944152832 46 16 10 10 10 1.6744141776927703 39.81492008060325 0.0 3 0.961987658778609 6.309786415650572 30861.0 71.70278052792713 0.0 - - - - - - - 204.54545454545453 61 11 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1107 142 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538891.[MT7]-ELDEITAK[MT7].3b5_1.heavy 402.899 / 744.39 1743.0 27.25309944152832 46 16 10 10 10 1.6744141776927703 39.81492008060325 0.0 3 0.961987658778609 6.309786415650572 1743.0 15.218854792787091 1.0 - - - - - - - 145.28571428571428 61 7 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1109 142 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538891.[MT7]-ELDEITAK[MT7].3b3_1.heavy 402.899 / 502.263 22293.0 27.25309944152832 46 16 10 10 10 1.6744141776927703 39.81492008060325 0.0 3 0.961987658778609 6.309786415650572 22293.0 62.54848682164516 1.0 - - - - - - - 689.875 44 8 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1111 143 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56166.[MT7]-SYLHIPQDVGVNLR.3y7_1.heavy 585.661 / 772.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1113 143 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56166.[MT7]-SYLHIPQDVGVNLR.3y6_1.heavy 585.661 / 657.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1115 143 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56166.[MT7]-SYLHIPQDVGVNLR.3b4_1.heavy 585.661 / 645.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1117 143 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56166.[MT7]-SYLHIPQDVGVNLR.3b3_1.heavy 585.661 / 508.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1119 144 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57124.[MT7]-FVQQLLELFDSEDPR.2b3_1.heavy 990.513 / 519.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1121 144 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57124.[MT7]-FVQQLLELFDSEDPR.2y5_1.heavy 990.513 / 603.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1123 144 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57124.[MT7]-FVQQLLELFDSEDPR.2b6_1.heavy 990.513 / 873.531 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1125 144 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57124.[MT7]-FVQQLLELFDSEDPR.2b7_1.heavy 990.513 / 1002.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1127 145 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540277.[MT7]-NSLVAVPSTVSAK[MT7].3b6_1.heavy 520.978 / 728.442 10974.0 29.123899459838867 44 14 10 10 10 1.840683457676978 54.32764638750235 0.0 3 0.9464165196756323 5.307479470218181 10974.0 21.143932640121555 0.0 - - - - - - - 287.93333333333334 21 15 PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 1129 145 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540277.[MT7]-NSLVAVPSTVSAK[MT7].3b4_1.heavy 520.978 / 558.337 11925.0 29.123899459838867 44 14 10 10 10 1.840683457676978 54.32764638750235 0.0 3 0.9464165196756323 5.307479470218181 11925.0 22.660984798650897 0.0 - - - - - - - 722.7272727272727 23 11 PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 1131 145 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540277.[MT7]-NSLVAVPSTVSAK[MT7].3b5_1.heavy 520.978 / 629.374 22812.0 29.123899459838867 44 14 10 10 10 1.840683457676978 54.32764638750235 0.0 3 0.9464165196756323 5.307479470218181 22812.0 5.010666036844591 1.0 - - - - - - - 1320.857142857143 45 7 PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 1133 145 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540277.[MT7]-NSLVAVPSTVSAK[MT7].3y4_1.heavy 520.978 / 548.352 6308.0 29.123899459838867 44 14 10 10 10 1.840683457676978 54.32764638750235 0.0 3 0.9464165196756323 5.307479470218181 6308.0 6.083713903884256 4.0 - - - - - - - 758.3333333333334 13 9 PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 1135 146 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57123.[MT7]-FVQQLLELFDSEDPR.3y7_1.heavy 660.678 / 865.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1137 146 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57123.[MT7]-FVQQLLELFDSEDPR.3b4_1.heavy 660.678 / 647.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1139 146 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57123.[MT7]-FVQQLLELFDSEDPR.3b5_1.heavy 660.678 / 760.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1141 146 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57123.[MT7]-FVQQLLELFDSEDPR.3b3_1.heavy 660.678 / 519.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1143 147 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542375.[MT7]-SPPILPPHLLQVILNK[MT7].3y7_1.heavy 689.769 / 971.637 1212.0 44.85854911804199 44 18 10 6 10 18.70519245011427 5.346109122731271 0.034900665283203125 3 0.9873083309930447 10.943156287057628 1212.0 2.981961676755723 0.0 - - - - - - - 224.44444444444446 2 18 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1145 147 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542375.[MT7]-SPPILPPHLLQVILNK[MT7].3y3_1.heavy 689.769 / 518.342 2078.0 44.85854911804199 44 18 10 6 10 18.70519245011427 5.346109122731271 0.034900665283203125 3 0.9873083309930447 10.943156287057628 2078.0 3.5293587521663774 2.0 - - - - - - - 760.6363636363636 4 11 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1147 147 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542375.[MT7]-SPPILPPHLLQVILNK[MT7].3b4_1.heavy 689.769 / 539.331 808.0 44.85854911804199 44 18 10 6 10 18.70519245011427 5.346109122731271 0.034900665283203125 3 0.9873083309930447 10.943156287057628 808.0 0.3141278439869988 4.0 - - - - - - - 0.0 1 0 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1149 147 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542375.[MT7]-SPPILPPHLLQVILNK[MT7].3b5_1.heavy 689.769 / 652.415 3347.0 44.85854911804199 44 18 10 6 10 18.70519245011427 5.346109122731271 0.034900665283203125 3 0.9873083309930447 10.943156287057628 3347.0 4.531852885069164 0.0 - - - - - - - 1195.5714285714287 6 7 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1151 148 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55726.[MT7]-TWNVGSSNR.2b3_1.heavy 582.798 / 546.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1153 148 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55726.[MT7]-TWNVGSSNR.2y8_1.heavy 582.798 / 919.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1155 148 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55726.[MT7]-TWNVGSSNR.2y5_1.heavy 582.798 / 520.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1157 148 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55726.[MT7]-TWNVGSSNR.2y6_1.heavy 582.798 / 619.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1159 149 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55725.[MT7]-IEEPLFK[MT7].2b3_1.heavy 582.349 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1161 149 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55725.[MT7]-IEEPLFK[MT7].2y4_1.heavy 582.349 / 648.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1163 149 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55725.[MT7]-IEEPLFK[MT7].2y6_1.heavy 582.349 / 906.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1165 150 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55459.[MT7]-FMTILR.2y4_1.heavy 462.776 / 502.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1167 150 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55459.[MT7]-FMTILR.2b3_1.heavy 462.776 / 524.266 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1169 150 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55459.[MT7]-FMTILR.2y3_1.heavy 462.776 / 401.287 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1171 151 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57026.[MT7]-VWEWDIPVDFK[MT7].2b3_1.heavy 861.461 / 559.3 3627.0 45.10240173339844 47 17 10 10 10 2.9076264070917297 27.322757774482625 0.0 3 0.979536478068217 8.61249108410662 3627.0 14.997478350679273 0.0 - - - - - - - 245.77777777777777 7 18 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1173 151 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57026.[MT7]-VWEWDIPVDFK[MT7].2y8_1.heavy 861.461 / 1163.62 553.0 45.10240173339844 47 17 10 10 10 2.9076264070917297 27.322757774482625 0.0 3 0.979536478068217 8.61249108410662 553.0 6.474146341463415 0.0 - - - - - - - 0.0 1 0 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1175 151 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57026.[MT7]-VWEWDIPVDFK[MT7].2y5_1.heavy 861.461 / 749.431 4610.0 45.10240173339844 47 17 10 10 10 2.9076264070917297 27.322757774482625 0.0 3 0.979536478068217 8.61249108410662 4610.0 18.1282593885361 0.0 - - - - - - - 276.4375 9 16 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1177 151 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57026.[MT7]-VWEWDIPVDFK[MT7].2b5_1.heavy 861.461 / 860.406 2213.0 45.10240173339844 47 17 10 10 10 2.9076264070917297 27.322757774482625 0.0 3 0.979536478068217 8.61249108410662 2213.0 4.597831978319784 1.0 - - - - - - - 225.22222222222223 4 18 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1179 152 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56478.[MT7]-TILHVK[MT7].2y4_1.heavy 499.834 / 640.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1181 152 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56478.[MT7]-TILHVK[MT7].2y5_1.heavy 499.834 / 753.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1183 152 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56478.[MT7]-TILHVK[MT7].2b4_1.heavy 499.834 / 609.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1185 152 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56478.[MT7]-TILHVK[MT7].2y3_1.heavy 499.834 / 527.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1187 153 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538484.[MT7]-GQVFDVGPR.2y4_1.heavy 559.807 / 428.262 135858.0 28.27199935913086 50 20 10 10 10 6.675538799500341 14.980064232041453 0.0 3 0.9929903819246815 14.731981971720046 135858.0 172.54973904783742 0.0 - - - - - - - 305.0 271 5 MAPK1 mitogen-activated protein kinase 1 1189 153 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538484.[MT7]-GQVFDVGPR.2y6_1.heavy 559.807 / 690.357 18145.0 28.27199935913086 50 20 10 10 10 6.675538799500341 14.980064232041453 0.0 3 0.9929903819246815 14.731981971720046 18145.0 40.10014919874747 0.0 - - - - - - - 663.3 36 10 MAPK1 mitogen-activated protein kinase 1 1191 153 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538484.[MT7]-GQVFDVGPR.2b5_1.heavy 559.807 / 691.353 72504.0 28.27199935913086 50 20 10 10 10 6.675538799500341 14.980064232041453 0.0 3 0.9929903819246815 14.731981971720046 72504.0 138.9045549918505 0.0 - - - - - - - 727.8181818181819 145 11 MAPK1 mitogen-activated protein kinase 1 1193 153 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538484.[MT7]-GQVFDVGPR.2y7_1.heavy 559.807 / 789.425 9606.0 28.27199935913086 50 20 10 10 10 6.675538799500341 14.980064232041453 0.0 3 0.9929903819246815 14.731981971720046 9606.0 42.203409836065575 0.0 - - - - - - - 212.47368421052633 19 19 MAPK1 mitogen-activated protein kinase 1 1195 154 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 118229.0 35.639198303222656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 118229.0 79.26491245225363 0.0 - - - - - - - 705.0 236 7 1197 154 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 241289.0 35.639198303222656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 241289.0 141.39745589215758 0.0 - - - - - - - 247.5 482 14 1199 154 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 235409.0 35.639198303222656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 235409.0 116.60300033126293 0.0 - - - - - - - 238.63636363636363 470 11 1201 155 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542368.[MT7]-YQSNQQELTPLPLLK[MT7].3y3_1.heavy 687.393 / 517.383 2459.0 38.554551124572754 46 20 10 6 10 5.631015283709016 17.758786819369522 0.035800933837890625 3 0.9917079008718285 13.543458109811176 2459.0 0.5334056399132322 1.0 - - - - - - - 641.0 4 10 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1203 155 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542368.[MT7]-YQSNQQELTPLPLLK[MT7].3y6_1.heavy 687.393 / 824.573 10802.0 38.554551124572754 46 20 10 6 10 5.631015283709016 17.758786819369522 0.035800933837890625 3 0.9917079008718285 13.543458109811176 10802.0 20.394667931688804 1.0 - - - - - - - 303.27272727272725 21 11 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1205 155 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542368.[MT7]-YQSNQQELTPLPLLK[MT7].3b3_1.heavy 687.393 / 523.263 2108.0 38.554551124572754 46 20 10 6 10 5.631015283709016 17.758786819369522 0.035800933837890625 3 0.9917079008718285 13.543458109811176 2108.0 2.109410675893099 0.0 - - - - - - - 216.6 4 15 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1207 155 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542368.[MT7]-YQSNQQELTPLPLLK[MT7].3y4_1.heavy 687.393 / 614.436 20637.0 38.554551124572754 46 20 10 6 10 5.631015283709016 17.758786819369522 0.035800933837890625 3 0.9917079008718285 13.543458109811176 20637.0 16.70774206672091 1.0 - - - - - - - 403.8 42 5 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1209 156 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539050.[MT7]-RLQGTQGAK[MT7].3b4_1.heavy 416.254 / 599.375 1897.0 14.855100313822428 30 14 2 6 8 1.4474838207616294 48.616637703960635 0.0345001220703125 4 0.9391274907501391 4.976496594295035 1897.0 28.136905487804878 0.0 - - - - - - - 106.66666666666667 3 18 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1211 156 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539050.[MT7]-RLQGTQGAK[MT7].3b5_1.heavy 416.254 / 700.422 2666.0 14.855100313822428 30 14 2 6 8 1.4474838207616294 48.616637703960635 0.0345001220703125 4 0.9391274907501391 4.976496594295035 2666.0 52.378850696748515 1.0 - - - - - - - 80.58823529411765 11 17 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1213 156 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539050.[MT7]-RLQGTQGAK[MT7].3y4_1.heavy 416.254 / 547.332 2831.0 14.855100313822428 30 14 2 6 8 1.4474838207616294 48.616637703960635 0.0345001220703125 4 0.9391274907501391 4.976496594295035 2831.0 28.310000000000002 0.0 - - - - - - - 121.88 5 25 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1215 156 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539050.[MT7]-RLQGTQGAK[MT7].3b3_1.heavy 416.254 / 542.353 N/A 14.855100313822428 30 14 2 6 8 1.4474838207616294 48.616637703960635 0.0345001220703125 4 0.9391274907501391 4.976496594295035 1319.0 1.253327076070439 3.0 - - - - - - - 281.55 4 20 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1217 157 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56989.[MT7]-GVLIEPVYPDIIR.2y8_1.heavy 814.481 / 972.551 45675.0 40.546600341796875 44 14 10 10 10 1.8773220767044572 44.59757488313399 0.0 3 0.9442491171156249 5.202329525201546 45675.0 130.89761976142387 0.0 - - - - - - - 187.75 91 12 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1219 157 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56989.[MT7]-GVLIEPVYPDIIR.2b4_1.heavy 814.481 / 527.367 27187.0 40.546600341796875 44 14 10 10 10 1.8773220767044572 44.59757488313399 0.0 3 0.9442491171156249 5.202329525201546 27187.0 120.26662446733044 0.0 - - - - - - - 640.75 54 8 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1221 157 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56989.[MT7]-GVLIEPVYPDIIR.2y9_1.heavy 814.481 / 1101.59 18487.0 40.546600341796875 44 14 10 10 10 1.8773220767044572 44.59757488313399 0.0 3 0.9442491171156249 5.202329525201546 18487.0 65.63711813978168 0.0 - - - - - - - 194.25 36 12 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1223 157 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56989.[MT7]-GVLIEPVYPDIIR.2y10_1.heavy 814.481 / 1214.68 10409.0 40.546600341796875 44 14 10 10 10 1.8773220767044572 44.59757488313399 0.0 3 0.9442491171156249 5.202329525201546 10409.0 108.63433623148276 0.0 - - - - - - - 191.07692307692307 20 13 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1225 158 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539148.[MT7]-MLTFNPHK[MT7].3y3_1.heavy 425.909 / 525.326 3854.0 28.365975379943848 31 13 6 6 6 5.737869324953754 17.42807204847001 0.034900665283203125 5 0.9247127576945905 4.4692899411303735 3854.0 7.101656036862282 0.0 - - - - - - - 302.3076923076923 7 13 MAPK1 mitogen-activated protein kinase 1 1227 158 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539148.[MT7]-MLTFNPHK[MT7].3b4_1.heavy 425.909 / 637.35 1233.0 28.365975379943848 31 13 6 6 6 5.737869324953754 17.42807204847001 0.034900665283203125 5 0.9247127576945905 4.4692899411303735 1233.0 13.103961038961039 1.0 - - - - - - - 227.3 3 20 MAPK1 mitogen-activated protein kinase 1 1229 158 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539148.[MT7]-MLTFNPHK[MT7].3b5_1.heavy 425.909 / 751.393 1156.0 28.365975379943848 31 13 6 6 6 5.737869324953754 17.42807204847001 0.034900665283203125 5 0.9247127576945905 4.4692899411303735 1156.0 2.001731601731602 1.0 - - - - - - - 115.5 2 12 MAPK1 mitogen-activated protein kinase 1 1231 158 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539148.[MT7]-MLTFNPHK[MT7].3b3_1.heavy 425.909 / 490.282 3700.0 28.365975379943848 31 13 6 6 6 5.737869324953754 17.42807204847001 0.034900665283203125 5 0.9247127576945905 4.4692899411303735 3700.0 26.348484848484844 1.0 - - - - - - - 231.05555555555554 12 18 MAPK1 mitogen-activated protein kinase 1 1233 159 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56382.[MT7]-FVAHK[MT7].2y4_1.heavy 445.279 / 598.379 3045.0 18.70236651102702 39 16 10 3 10 2.4489895917174644 33.610480578884754 0.05809974670410156 3 0.9685730472386275 6.943320996137759 3045.0 20.842412761714854 0.0 - - - - - - - 241.07692307692307 6 26 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 1235 159 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56382.[MT7]-FVAHK[MT7].2b3_1.heavy 445.279 / 462.283 2160.0 18.70236651102702 39 16 10 3 10 2.4489895917174644 33.610480578884754 0.05809974670410156 3 0.9685730472386275 6.943320996137759 2160.0 17.90300061236987 0.0 - - - - - - - 241.82608695652175 4 23 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 1237 159 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56382.[MT7]-FVAHK[MT7].2y3_1.heavy 445.279 / 499.311 4285.0 18.70236651102702 39 16 10 3 10 2.4489895917174644 33.610480578884754 0.05809974670410156 3 0.9685730472386275 6.943320996137759 4285.0 14.832848671726754 0.0 - - - - - - - 271.5 8 24 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 1239 160 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540892.[MT7]-GVIVESAYSDIVK[MT7].3y3_1.heavy 556.653 / 503.367 54241.0 34.79220008850098 42 16 10 6 10 2.6642670859952475 29.89761988718983 0.039798736572265625 3 0.9659862076160479 6.672615380527068 54241.0 50.97608724999276 0.0 - - - - - - - 1255.0 108 7 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1241 160 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540892.[MT7]-GVIVESAYSDIVK[MT7].3b4_1.heavy 556.653 / 513.352 60389.0 34.79220008850098 42 16 10 6 10 2.6642670859952475 29.89761988718983 0.039798736572265625 3 0.9659862076160479 6.672615380527068 60389.0 60.89466081242054 0.0 - - - - - - - 329.5 120 2 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1243 160 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540892.[MT7]-GVIVESAYSDIVK[MT7].3b5_1.heavy 556.653 / 642.394 48312.0 34.79220008850098 42 16 10 6 10 2.6642670859952475 29.89761988718983 0.039798736572265625 3 0.9659862076160479 6.672615380527068 48312.0 55.51990506307244 0.0 - - - - - - - 817.3333333333334 96 9 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1245 160 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540892.[MT7]-GVIVESAYSDIVK[MT7].3y5_1.heavy 556.653 / 705.426 72467.0 34.79220008850098 42 16 10 6 10 2.6642670859952475 29.89761988718983 0.039798736572265625 3 0.9659862076160479 6.672615380527068 72467.0 120.84313097727579 0.0 - - - - - - - 718.7272727272727 144 11 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1247 161 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542658.[MT7]-DVYIVQDLMETDLYK[MT7].3y3_1.heavy 711.706 / 567.362 9227.0 44.77109909057617 50 20 10 10 10 7.9956991966120565 12.506723619914576 0.0 3 0.9910581323330768 13.041396581958038 9227.0 100.19945312499999 0.0 - - - - - - - 128.0 18 17 MAPK1;MAPK3 mitogen-activated protein kinase 1;mitogen-activated protein kinase 3 1249 161 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542658.[MT7]-DVYIVQDLMETDLYK[MT7].3b4_1.heavy 711.706 / 635.352 19608.0 44.77109909057617 50 20 10 10 10 7.9956991966120565 12.506723619914576 0.0 3 0.9910581323330768 13.041396581958038 19608.0 173.5558622183709 0.0 - - - - - - - 120.0 39 16 MAPK1;MAPK3 mitogen-activated protein kinase 1;mitogen-activated protein kinase 3 1251 161 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542658.[MT7]-DVYIVQDLMETDLYK[MT7].3b5_1.heavy 711.706 / 734.42 8074.0 44.77109909057617 50 20 10 10 10 7.9956991966120565 12.506723619914576 0.0 3 0.9910581323330768 13.041396581958038 8074.0 46.4255 0.0 - - - - - - - 172.0 16 16 MAPK1;MAPK3 mitogen-activated protein kinase 1;mitogen-activated protein kinase 3 1253 161 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542658.[MT7]-DVYIVQDLMETDLYK[MT7].3b7_1.heavy 711.706 / 977.506 7305.0 44.77109909057617 50 20 10 10 10 7.9956991966120565 12.506723619914576 0.0 3 0.9910581323330768 13.041396581958038 7305.0 137.7296875 0.0 - - - - - - - 122.18181818181819 14 11 MAPK1;MAPK3 mitogen-activated protein kinase 1;mitogen-activated protein kinase 3 1255 162 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542365.[MT7]-YQSNQQELTPLPLLK[MT7].4y4_1.heavy 515.796 / 614.436 32770.0 38.59035110473633 44 18 10 6 10 4.406391495807415 22.694306689532198 0.035797119140625 3 0.9832862250704981 9.532753019365847 32770.0 53.87610169491525 0.0 - - - - - - - 363.0 65 1 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1257 162 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542365.[MT7]-YQSNQQELTPLPLLK[MT7].4b4_1.heavy 515.796 / 637.306 9168.0 38.59035110473633 44 18 10 6 10 4.406391495807415 22.694306689532198 0.035797119140625 3 0.9832862250704981 9.532753019365847 9168.0 50.567837945187335 0.0 - - - - - - - 211.91666666666666 18 12 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1259 162 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542365.[MT7]-YQSNQQELTPLPLLK[MT7].4b5_1.heavy 515.796 / 765.365 5265.0 38.59035110473633 44 18 10 6 10 4.406391495807415 22.694306689532198 0.035797119140625 3 0.9832862250704981 9.532753019365847 5265.0 7.628031496062992 1.0 - - - - - - - 202.6153846153846 14 13 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1261 162 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB542365.[MT7]-YQSNQQELTPLPLLK[MT7].4y3_1.heavy 515.796 / 517.383 13253.0 38.59035110473633 44 18 10 6 10 4.406391495807415 22.694306689532198 0.035797119140625 3 0.9832862250704981 9.532753019365847 13253.0 15.723898305084745 0.0 - - - - - - - 1205.857142857143 26 7 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1263 163 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539141.[MT7]-LNITVVQAK[MT7].3y3_1.heavy 425.274 / 490.311 53998.0 31.011699676513672 42 14 10 10 8 1.8016512641442983 44.23634010196844 0.0 4 0.9395100752533192 4.992372169056537 53998.0 101.2870839871515 0.0 - - - - - - - 231.57142857142858 107 7 TOLLIP toll interacting protein 1265 163 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539141.[MT7]-LNITVVQAK[MT7].3b4_1.heavy 425.274 / 586.368 26948.0 31.011699676513672 42 14 10 10 8 1.8016512641442983 44.23634010196844 0.0 4 0.9395100752533192 4.992372169056537 26948.0 101.1042470760234 1.0 - - - - - - - 665.8571428571429 57 7 TOLLIP toll interacting protein 1267 163 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539141.[MT7]-LNITVVQAK[MT7].3y4_1.heavy 425.274 / 589.379 22389.0 31.011699676513672 42 14 10 10 8 1.8016512641442983 44.23634010196844 0.0 4 0.9395100752533192 4.992372169056537 22389.0 88.38801917081139 0.0 - - - - - - - 177.25 44 8 TOLLIP toll interacting protein 1269 163 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539141.[MT7]-LNITVVQAK[MT7].3b3_1.heavy 425.274 / 485.32 31102.0 31.011699676513672 42 14 10 10 8 1.8016512641442983 44.23634010196844 0.0 4 0.9395100752533192 4.992372169056537 31102.0 17.6560702558689 0.0 - - - - - - - 747.0 62 8 TOLLIP toll interacting protein 1271 164 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB536859.[MT7]-LTSLSR.2b3_1.heavy 410.754 / 446.273 1799.0 24.216750621795654 46 20 10 6 10 4.093020214346668 24.43183633676779 0.03339958190917969 3 0.9941982421898613 16.194680175601874 1799.0 7.446476438274258 1.0 - - - - - - - 272.8 3 20 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 1273 164 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB536859.[MT7]-LTSLSR.2y4_1.heavy 410.754 / 462.267 2235.0 24.216750621795654 46 20 10 6 10 4.093020214346668 24.43183633676779 0.03339958190917969 3 0.9941982421898613 16.194680175601874 2235.0 3.6898230187748142 0.0 - - - - - - - 235.42105263157896 4 19 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 1275 164 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB536859.[MT7]-LTSLSR.2y5_1.heavy 410.754 / 563.315 12862.0 24.216750621795654 46 20 10 6 10 4.093020214346668 24.43183633676779 0.03339958190917969 3 0.9941982421898613 16.194680175601874 12862.0 27.494 0.0 - - - - - - - 278.25 25 20 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 1277 164 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB536859.[MT7]-LTSLSR.2b5_1.heavy 410.754 / 646.389 1853.0 24.216750621795654 46 20 10 6 10 4.093020214346668 24.43183633676779 0.03339958190917969 3 0.9941982421898613 16.194680175601874 1853.0 10.534329392479261 0.0 - - - - - - - 189.8695652173913 3 23 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 1279 165 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541518.[MT7]-GPVY[MT7]IGELPQDFLR.3y6_1.heavy 631.356 / 775.41 3729.0 38.176534016927086 36 20 2 6 8 7.468777150428448 13.389072666904177 0.036502838134765625 4 0.9925502010489294 14.289601160035305 3729.0 34.831318681318685 0.0 - - - - - - - 157.1818181818182 7 11 TOLLIP toll interacting protein 1281 165 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541518.[MT7]-GPVY[MT7]IGELPQDFLR.3y5_1.heavy 631.356 / 678.357 1273.0 38.176534016927086 36 20 2 6 8 7.468777150428448 13.389072666904177 0.036502838134765625 4 0.9925502010489294 14.289601160035305 1273.0 2.573978021978022 2.0 - - - - - - - 268.8636363636364 20 22 TOLLIP toll interacting protein 1283 165 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541518.[MT7]-GPVY[MT7]IGELPQDFLR.3b7_2.heavy 631.356 / 502.786 N/A 38.176534016927086 36 20 2 6 8 7.468777150428448 13.389072666904177 0.036502838134765625 4 0.9925502010489294 14.289601160035305 3365.0 11.542425431711145 0.0 - - - - - - - 247.0 6 14 TOLLIP toll interacting protein 1285 165 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541518.[MT7]-GPVY[MT7]IGELPQDFLR.3y9_1.heavy 631.356 / 1074.56 1091.0 38.176534016927086 36 20 2 6 8 7.468777150428448 13.389072666904177 0.036502838134765625 4 0.9925502010489294 14.289601160035305 1091.0 16.784615384615385 0.0 - - - - - - - 216.125 2 8 TOLLIP toll interacting protein 1287 166 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539995.[MT7]-NHFYQFGEIR.3y6_1.heavy 485.581 / 749.394 17774.0 31.011699676513672 50 20 10 10 10 15.474219346721831 6.462361542082231 0.0 3 0.998797980144555 35.59287233242323 17774.0 71.27006115292508 0.0 - - - - - - - 314.27272727272725 35 11 RBM22 RNA binding motif protein 22 1289 166 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539995.[MT7]-NHFYQFGEIR.3b4_1.heavy 485.581 / 706.343 6616.0 31.011699676513672 50 20 10 10 10 15.474219346721831 6.462361542082231 0.0 3 0.998797980144555 35.59287233242323 6616.0 28.323971946630174 0.0 - - - - - - - 205.0 13 13 RBM22 RNA binding motif protein 22 1291 166 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539995.[MT7]-NHFYQFGEIR.3b3_1.heavy 485.581 / 543.28 18268.0 31.011699676513672 50 20 10 10 10 15.474219346721831 6.462361542082231 0.0 3 0.998797980144555 35.59287233242323 18268.0 25.25989759532146 0.0 - - - - - - - 382.625 36 8 RBM22 RNA binding motif protein 22 1293 166 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539995.[MT7]-NHFYQFGEIR.3y5_1.heavy 485.581 / 621.336 37522.0 31.011699676513672 50 20 10 10 10 15.474219346721831 6.462361542082231 0.0 3 0.998797980144555 35.59287233242323 37522.0 69.56966565349543 0.0 - - - - - - - 822.6666666666666 75 9 RBM22 RNA binding motif protein 22 1295 167 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539230.[MT7]-YQQDQVVK[MT7].3y3_1.heavy 432.578 / 489.352 9894.0 20.57705020904541 38 15 9 6 8 2.820415372136301 28.027331757434794 0.030200958251953125 4 0.9524493390083936 5.636999194507923 9894.0 14.196482225656876 1.0 - - - - - - - 682.0769230769231 23 13 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1297 167 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539230.[MT7]-YQQDQVVK[MT7].3b4_1.heavy 432.578 / 679.317 7763.0 20.57705020904541 38 15 9 6 8 2.820415372136301 28.027331757434794 0.030200958251953125 4 0.9524493390083936 5.636999194507923 7763.0 79.16217105263158 0.0 - - - - - - - 156.875 15 24 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1299 167 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539230.[MT7]-YQQDQVVK[MT7].3b5_1.heavy 432.578 / 807.375 3044.0 20.57705020904541 38 15 9 6 8 2.820415372136301 28.027331757434794 0.030200958251953125 4 0.9524493390083936 5.636999194507923 3044.0 81.97438596491227 0.0 - - - - - - - 104.5 6 12 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1301 167 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539230.[MT7]-YQQDQVVK[MT7].3b3_1.heavy 432.578 / 564.29 4985.0 20.57705020904541 38 15 9 6 8 2.820415372136301 28.027331757434794 0.030200958251953125 4 0.9524493390083936 5.636999194507923 4985.0 15.517719176918785 0.0 - - - - - - - 207.36363636363637 9 22 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1303 168 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55715.[MT7]-FNPDEDK[MT7].2y4_1.heavy 576.792 / 650.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1305 168 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55715.[MT7]-FNPDEDK[MT7].2b4_1.heavy 576.792 / 618.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1307 168 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55715.[MT7]-FNPDEDK[MT7].2y3_1.heavy 576.792 / 535.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1309 168 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55715.[MT7]-FNPDEDK[MT7].2y6_1.heavy 576.792 / 861.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1311 169 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538782.[MT7]-YNSFISLTV.2b3_1.heavy 594.325 / 509.248 1307.0 44.03184986114502 39 13 10 6 10 4.789022773891536 20.881086752222835 0.038600921630859375 3 0.9147209316801911 4.195709136574035 1307.0 2.4439777211365996 1.0 - - - - - - - 210.625 2 16 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 1313 169 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538782.[MT7]-YNSFISLTV.2b4_1.heavy 594.325 / 656.316 3507.0 44.03184986114502 39 13 10 6 10 4.789022773891536 20.881086752222835 0.038600921630859375 3 0.9147209316801911 4.195709136574035 3507.0 18.549517898317898 0.0 - - - - - - - 227.875 7 16 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 1315 169 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538782.[MT7]-YNSFISLTV.2b6_1.heavy 594.325 / 856.432 2338.0 44.03184986114502 39 13 10 6 10 4.789022773891536 20.881086752222835 0.038600921630859375 3 0.9147209316801911 4.195709136574035 2338.0 31.512173913043476 0.0 - - - - - - - 96.5 4 10 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 1317 169 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538782.[MT7]-YNSFISLTV.2b5_1.heavy 594.325 / 769.4 3232.0 44.03184986114502 39 13 10 6 10 4.789022773891536 20.881086752222835 0.038600921630859375 3 0.9147209316801911 4.195709136574035 3232.0 17.55926845789117 0.0 - - - - - - - 160.66666666666666 6 12 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 1319 170 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55708.[MT7]-VIPEDGAAAR.2y8_1.heavy 571.818 / 786.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1321 170 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55708.[MT7]-VIPEDGAAAR.2y9_1.heavy 571.818 / 899.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1323 170 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55708.[MT7]-VIPEDGAAAR.2y6_1.heavy 571.818 / 560.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1325 170 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55708.[MT7]-VIPEDGAAAR.2y7_1.heavy 571.818 / 689.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1327 171 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55987.[MT7]-LNVLANVIRK[MT7].3y7_1.heavy 476.648 / 957.633 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1329 171 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55987.[MT7]-LNVLANVIRK[MT7].3y6_1.heavy 476.648 / 844.549 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1331 171 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55987.[MT7]-LNVLANVIRK[MT7].3y8_2.heavy 476.648 / 528.854 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1333 171 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55987.[MT7]-LNVLANVIRK[MT7].3y9_2.heavy 476.648 / 585.876 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1335 172 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56489.[MT7]-WYSLSGR.2b3_1.heavy 506.77 / 581.284 6167.0 31.287900924682617 50 20 10 10 10 6.356544628351923 15.731817496249883 0.0 3 0.9901654430094762 12.434502131220775 6167.0 11.725613408885227 0.0 - - - - - - - 624.9090909090909 12 11 TOLLIP toll interacting protein 1337 172 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56489.[MT7]-WYSLSGR.2y5_2.heavy 506.77 / 260.148 N/A 31.287900924682617 50 20 10 10 10 6.356544628351923 15.731817496249883 0.0 3 0.9901654430094762 12.434502131220775 505.0 0.4991762767710049 27.0 - - - - - - - 262.6 2 10 TOLLIP toll interacting protein 1339 172 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56489.[MT7]-WYSLSGR.2y5_1.heavy 506.77 / 519.289 12637.0 31.287900924682617 50 20 10 10 10 6.356544628351923 15.731817496249883 0.0 3 0.9901654430094762 12.434502131220775 12637.0 35.50486900228484 0.0 - - - - - - - 277.75 25 8 TOLLIP toll interacting protein 1341 172 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56489.[MT7]-WYSLSGR.2y6_1.heavy 506.77 / 682.352 37406.0 31.287900924682617 50 20 10 10 10 6.356544628351923 15.731817496249883 0.0 3 0.9901654430094762 12.434502131220775 37406.0 58.48936442731207 0.0 - - - - - - - 246.88888888888889 74 9 TOLLIP toll interacting protein 1343 173 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56345.[MT7]-LVVSK[MT7].2b3_1.heavy 417.289 / 456.33 2952.0 24.02549997965495 30 14 2 6 8 2.28508917145079 33.2495313235281 0.033901214599609375 4 0.9345864598089817 4.7987953998576875 2952.0 4.658631534211645 0.0 - - - - - - - 606.4444444444445 5 9 PCID2 PCI domain containing 2 1345 173 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56345.[MT7]-LVVSK[MT7].2y4_1.heavy 417.289 / 576.384 12032.0 24.02549997965495 30 14 2 6 8 2.28508917145079 33.2495313235281 0.033901214599609375 4 0.9345864598089817 4.7987953998576875 12032.0 26.02243817044909 1.0 - - - - - - - 628.4285714285714 73 7 PCID2 PCI domain containing 2 1347 173 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56345.[MT7]-LVVSK[MT7].2y3_1.heavy 417.289 / 477.315 6740.0 24.02549997965495 30 14 2 6 8 2.28508917145079 33.2495313235281 0.033901214599609375 4 0.9345864598089817 4.7987953998576875 6740.0 20.173119470215763 0.0 - - - - - - - 632.5714285714286 13 14 PCID2 PCI domain containing 2 1349 174 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56826.[MT7]-DSVMVLSATHR.2y8_1.heavy 680.362 / 914.488 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1351 174 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56826.[MT7]-DSVMVLSATHR.2b4_1.heavy 680.362 / 577.277 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1353 174 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56826.[MT7]-DSVMVLSATHR.2y6_1.heavy 680.362 / 684.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1355 174 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56826.[MT7]-DSVMVLSATHR.2b5_1.heavy 680.362 / 676.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1357 175 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538975.[MT7]-TLITFVNK[MT7].3y3_1.heavy 408.592 / 504.326 17880.0 34.81209945678711 50 20 10 10 10 35.23947421461382 2.83772678874221 0.0 3 0.9982861516217869 29.80671568936705 17880.0 110.62716845976131 0.0 - - - - - - - 203.53846153846155 35 13 PARVA parvin, alpha 1359 175 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538975.[MT7]-TLITFVNK[MT7].3b4_1.heavy 408.592 / 573.373 11478.0 34.81209945678711 50 20 10 10 10 35.23947421461382 2.83772678874221 0.0 3 0.9982861516217869 29.80671568936705 11478.0 22.16767391304348 0.0 - - - - - - - 268.0 22 7 PARVA parvin, alpha 1361 175 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538975.[MT7]-TLITFVNK[MT7].3b5_1.heavy 408.592 / 720.441 3201.0 34.81209945678711 50 20 10 10 10 35.23947421461382 2.83772678874221 0.0 3 0.9982861516217869 29.80671568936705 3201.0 24.623076923076923 0.0 - - - - - - - 303.5 6 4 PARVA parvin, alpha 1363 175 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538975.[MT7]-TLITFVNK[MT7].3b3_1.heavy 408.592 / 472.325 20970.0 34.81209945678711 50 20 10 10 10 35.23947421461382 2.83772678874221 0.0 3 0.9982861516217869 29.80671568936705 20970.0 73.7012084592145 0.0 - - - - - - - 703.75 41 8 PARVA parvin, alpha 1365 176 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 284304.0 38.4739990234375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 284304.0 210.91860488744794 0.0 - - - - - - - 225.0 568 8 1367 176 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 539752.0 38.4739990234375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 539752.0 262.3697767234136 0.0 - - - - - - - 420.0 1079 3 1369 176 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 624690.0 38.4739990234375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 624690.0 248.38090595488305 0.0 - - - - - - - 405.0 1249 6 1371 177 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55471.[MT7]-FSASNNR.2y4_1.heavy 470.242 / 490.237 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 1373 177 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55471.[MT7]-FSASNNR.2y3_2.heavy 470.242 / 202.106 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 1375 177 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55471.[MT7]-FSASNNR.2b4_1.heavy 470.242 / 537.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 1377 177 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55471.[MT7]-FSASNNR.2y6_1.heavy 470.242 / 648.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 1379 178 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56147.[MT7]-APGPIHYPSQDPQR.3y7_1.heavy 569.629 / 827.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 1381 178 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56147.[MT7]-APGPIHYPSQDPQR.3y6_1.heavy 569.629 / 730.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 1383 178 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56147.[MT7]-APGPIHYPSQDPQR.3b5_1.heavy 569.629 / 580.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 1385 178 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56147.[MT7]-APGPIHYPSQDPQR.3y8_1.heavy 569.629 / 990.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 1387 179 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55473.[MT7]-YVDEK[MT7].2b3_1.heavy 471.263 / 522.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1389 179 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55473.[MT7]-YVDEK[MT7].2y4_1.heavy 471.263 / 634.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1391 179 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55473.[MT7]-YVDEK[MT7].2b4_1.heavy 471.263 / 651.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1393 179 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55473.[MT7]-YVDEK[MT7].2y3_1.heavy 471.263 / 535.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1395 180 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55602.[MT7]-IMEPLFR.2b3_1.heavy 525.3 / 518.276 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 1397 180 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55602.[MT7]-IMEPLFR.2y4_1.heavy 525.3 / 532.324 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 1399 180 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55602.[MT7]-IMEPLFR.2b4_1.heavy 525.3 / 615.329 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 1401 180 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55602.[MT7]-IMEPLFR.2y6_1.heavy 525.3 / 792.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 1403 181 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541502.[MT7]-DVPASELHELLSRK[MT7].4b4_1.heavy 471.271 / 527.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1405 181 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541502.[MT7]-DVPASELHELLSRK[MT7].4y6_1.heavy 471.271 / 889.559 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1407 181 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541502.[MT7]-DVPASELHELLSRK[MT7].4y7_2.heavy 471.271 / 513.813 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1409 181 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541502.[MT7]-DVPASELHELLSRK[MT7].4b6_1.heavy 471.271 / 743.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1411 182 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539987.[MT7]-SSGPPATFPSSK[MT7].3b6_1.heavy 484.264 / 641.338 3457.0 23.796024322509766 40 18 10 6 6 4.631732402581104 21.590193756503176 0.0326995849609375 6 0.9827959320724147 9.395549528212536 3457.0 1.1106629711369145 2.0 - - - - - - - 248.46153846153845 6 13 OGDHL oxoglutarate dehydrogenase-like 1413 182 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539987.[MT7]-SSGPPATFPSSK[MT7].3b5_1.heavy 484.264 / 570.3 793.0 23.796024322509766 40 18 10 6 6 4.631732402581104 21.590193756503176 0.0326995849609375 6 0.9827959320724147 9.395549528212536 793.0 1.1188712522045856 18.0 - - - - - - - 623.4285714285714 4 7 OGDHL oxoglutarate dehydrogenase-like 1415 182 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539987.[MT7]-SSGPPATFPSSK[MT7].3y4_1.heavy 484.264 / 562.332 13149.0 23.796024322509766 40 18 10 6 6 4.631732402581104 21.590193756503176 0.0326995849609375 6 0.9827959320724147 9.395549528212536 13149.0 2.2026757884820682 1.0 - - - - - - - 297.5 26 8 OGDHL oxoglutarate dehydrogenase-like 1417 182 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539987.[MT7]-SSGPPATFPSSK[MT7].3b7_1.heavy 484.264 / 742.385 1814.0 23.796024322509766 40 18 10 6 6 4.631732402581104 21.590193756503176 0.0326995849609375 6 0.9827959320724147 9.395549528212536 1814.0 0.18827192527244416 5.0 - - - - - - - 139.46153846153845 3 13 OGDHL oxoglutarate dehydrogenase-like 1419 183 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 649371.0 33.776798248291016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 649371.0 559.3504429345735 0.0 - - - - - - - 760.375 1298 8 1421 183 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 114252.0 33.776798248291016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 114252.0 133.54040646020945 0.0 - - - - - - - 1232.4285714285713 228 7 1423 183 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 85164.0 33.776798248291016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 85164.0 108.0682952341888 0.0 - - - - - - - 263.7692307692308 170 13 1425 184 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55577.[MT7]-QILLPFR.2y4_1.heavy 515.83 / 532.324 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1427 184 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55577.[MT7]-QILLPFR.2y5_1.heavy 515.83 / 645.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1429 184 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55577.[MT7]-QILLPFR.2b4_1.heavy 515.83 / 612.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1431 184 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55577.[MT7]-QILLPFR.2y6_1.heavy 515.83 / 758.492 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1433 185 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55700.[MT7]-GLLTEEATR.2y3_2.heavy 567.318 / 174.105 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC11A2 solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 1435 185 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55700.[MT7]-GLLTEEATR.2y6_1.heavy 567.318 / 706.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC11A2 solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 1437 185 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55700.[MT7]-GLLTEEATR.2b5_1.heavy 567.318 / 658.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC11A2 solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 1439 185 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55700.[MT7]-GLLTEEATR.2y7_1.heavy 567.318 / 819.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC11A2 solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 1441 186 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57003.[MT7]-GVIVESAYSDIVK[MT7].2y8_1.heavy 834.477 / 1026.56 4065.0 34.78556696573893 46 20 10 6 10 6.2957509654344905 15.883728652710243 0.039798736572265625 3 0.9938944680090614 15.786265397680015 4065.0 20.325 0.0 - - - - - - - 177.69230769230768 8 13 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1443 186 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57003.[MT7]-GVIVESAYSDIVK[MT7].2b4_1.heavy 834.477 / 513.352 N/A 34.78556696573893 46 20 10 6 10 6.2957509654344905 15.883728652710243 0.039798736572265625 3 0.9938944680090614 15.786265397680015 8790.0 29.30808387363774 0.0 - - - - - - - 249.8181818181818 17 11 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1445 186 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57003.[MT7]-GVIVESAYSDIVK[MT7].2y3_1.heavy 834.477 / 503.367 4725.0 34.78556696573893 46 20 10 6 10 6.2957509654344905 15.883728652710243 0.039798736572265625 3 0.9938944680090614 15.786265397680015 4725.0 5.524590163934426 1.0 - - - - - - - 285.6666666666667 9 15 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1447 186 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57003.[MT7]-GVIVESAYSDIVK[MT7].2y6_1.heavy 834.477 / 868.49 4505.0 34.78556696573893 46 20 10 6 10 6.2957509654344905 15.883728652710243 0.039798736572265625 3 0.9938944680090614 15.786265397680015 4505.0 11.285819980771272 0.0 - - - - - - - 280.77777777777777 9 9 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1449 187 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539224.[MT7]-VLIPLHSVK[MT7].3y3_1.heavy 431.955 / 477.315 27593.0 31.169099807739258 50 20 10 10 10 13.548510817984047 7.380884980160462 0.0 3 0.9988395980796013 36.22564651727109 27593.0 47.5201736363962 0.0 - - - - - - - 285.0 55 5 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1451 187 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539224.[MT7]-VLIPLHSVK[MT7].3b5_1.heavy 431.955 / 680.483 5905.0 31.169099807739258 50 20 10 10 10 13.548510817984047 7.380884980160462 0.0 3 0.9988395980796013 36.22564651727109 5905.0 42.410129895938724 0.0 - - - - - - - 240.63636363636363 11 11 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1453 187 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539224.[MT7]-VLIPLHSVK[MT7].3y4_1.heavy 431.955 / 614.374 7229.0 31.169099807739258 50 20 10 10 10 13.548510817984047 7.380884980160462 0.0 3 0.9988395980796013 36.22564651727109 7229.0 47.5827711968874 0.0 - - - - - - - 180.23076923076923 14 13 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1455 187 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539224.[MT7]-VLIPLHSVK[MT7].3b3_1.heavy 431.955 / 470.346 28509.0 31.169099807739258 50 20 10 10 10 13.548510817984047 7.380884980160462 0.0 3 0.9988395980796013 36.22564651727109 28509.0 59.07082196796338 0.0 - - - - - - - 264.6 57 5 PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1457 188 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55701.[MT7]-VLGVSGSQSR.2y8_1.heavy 567.323 / 777.385 902.0 25.330166498819988 28 16 2 6 4 1.1448030492831323 54.6415578402855 0.03730010986328125 10 0.9624592229235501 6.349545591469275 902.0 6.268754959695945 4.0 - - - - - - - 194.25 6 20 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1459 188 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55701.[MT7]-VLGVSGSQSR.2b4_1.heavy 567.323 / 513.352 N/A 25.330166498819988 28 16 2 6 4 1.1448030492831323 54.6415578402855 0.03730010986328125 10 0.9624592229235501 6.349545591469275 763.0 0.8023117695473252 33.0 - - - - - - - 351.85714285714283 2 14 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1461 188 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55701.[MT7]-VLGVSGSQSR.2y9_1.heavy 567.323 / 890.469 3400.0 25.330166498819988 28 16 2 6 4 1.1448030492831323 54.6415578402855 0.03730010986328125 10 0.9624592229235501 6.349545591469275 3400.0 34.36690647482014 4.0 - - - - - - - 253.0 14 17 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1463 188 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55701.[MT7]-VLGVSGSQSR.2y6_1.heavy 567.323 / 621.295 1457.0 25.330166498819988 28 16 2 6 4 1.1448030492831323 54.6415578402855 0.03730010986328125 10 0.9624592229235501 6.349545591469275 1457.0 3.7789625360230548 2.0 - - - - - - - 242.85 2 20 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1465 189 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56736.[MT7]-FLDTAFNLQAFEGK[MT7].3b4_1.heavy 630.34 / 621.336 1016.0 43.54800033569336 43 13 10 10 10 1.3282057932399158 44.55720753156108 0.0 3 0.9226977740559226 4.409894438340132 1016.0 4.517003579729724 4.0 - - - - - - - 232.6875 5 16 OGDHL oxoglutarate dehydrogenase-like 1467 189 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56736.[MT7]-FLDTAFNLQAFEGK[MT7].3b5_1.heavy 630.34 / 692.374 3927.0 43.54800033569336 43 13 10 10 10 1.3282057932399158 44.55720753156108 0.0 3 0.9226977740559226 4.409894438340132 3927.0 32.385097340628576 0.0 - - - - - - - 143.35294117647058 7 17 OGDHL oxoglutarate dehydrogenase-like 1469 189 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56736.[MT7]-FLDTAFNLQAFEGK[MT7].3y4_1.heavy 630.34 / 624.347 4875.0 43.54800033569336 43 13 10 10 10 1.3282057932399158 44.55720753156108 0.0 3 0.9226977740559226 4.409894438340132 4875.0 34.55861197087929 0.0 - - - - - - - 245.94736842105263 9 19 OGDHL oxoglutarate dehydrogenase-like 1471 189 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56736.[MT7]-FLDTAFNLQAFEGK[MT7].3b3_1.heavy 630.34 / 520.289 2370.0 43.54800033569336 43 13 10 10 10 1.3282057932399158 44.55720753156108 0.0 3 0.9226977740559226 4.409894438340132 2370.0 20.080788177339905 0.0 - - - - - - - 198.53333333333333 4 15 OGDHL oxoglutarate dehydrogenase-like 1473 190 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55976.[MT7]-YIGSVEEAEK[MT7].2y4_1.heavy 706.879 / 620.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1475 190 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55976.[MT7]-YIGSVEEAEK[MT7].2y8_1.heavy 706.879 / 992.502 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1477 190 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55976.[MT7]-YIGSVEEAEK[MT7].2y5_1.heavy 706.879 / 749.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1479 190 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55976.[MT7]-YIGSVEEAEK[MT7].2y9_1.heavy 706.879 / 1105.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC40 cell division cycle 40 homolog (S. cerevisiae) 1481 191 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55871.[MT7]-VLIPMHTAK[MT7].3y3_1.heavy 433.268 / 463.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1483 191 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55871.[MT7]-VLIPMHTAK[MT7].3b5_1.heavy 433.268 / 698.439 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1485 191 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55871.[MT7]-VLIPMHTAK[MT7].3y4_1.heavy 433.268 / 600.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1487 191 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55871.[MT7]-VLIPMHTAK[MT7].3b3_1.heavy 433.268 / 470.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1489 192 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55872.[MT7]-DATLTEHVIR.2y4_1.heavy 649.863 / 524.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1491 192 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55872.[MT7]-DATLTEHVIR.2y9_1.heavy 649.863 / 1039.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1493 192 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55872.[MT7]-DATLTEHVIR.2b6_1.heavy 649.863 / 775.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1495 192 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55872.[MT7]-DATLTEHVIR.2y6_1.heavy 649.863 / 754.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1497 193 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56358.[MT7]-THSPK[MT7].2b3_1.heavy 429.258 / 470.248 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C;PPP2R5D protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta 1499 193 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56358.[MT7]-THSPK[MT7].2y4_1.heavy 429.258 / 612.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C;PPP2R5D protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta 1501 193 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56358.[MT7]-THSPK[MT7].2y3_1.heavy 429.258 / 475.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C;PPP2R5D protein phosphatase 2, regulatory subunit B', gamma;protein phosphatase 2, regulatory subunit B', delta 1503 194 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541953.[MT7]-GK[MT7]QEEEK[MT7]PGEEK[MT7].4y5_1.heavy 491.775 / 703.374 1423.0 14.40726629892985 42 20 10 6 6 8.448674806398811 11.836175766199753 0.034399986267089844 6 0.9974127110107933 24.2575099426989 1423.0 26.35185185185185 0.0 - - - - - - - 71.46153846153847 2 26 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1505 194 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541953.[MT7]-GK[MT7]QEEEK[MT7]PGEEK[MT7].4y4_1.heavy 491.775 / 606.321 671.0 14.40726629892985 42 20 10 6 6 8.448674806398811 11.836175766199753 0.034399986267089844 6 0.9974127110107933 24.2575099426989 671.0 2.6271711211384936 0.0 - - - - - - - 0.0 1 0 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1507 194 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541953.[MT7]-GK[MT7]QEEEK[MT7]PGEEK[MT7].4y8_2.heavy 491.775 / 617.332 N/A 14.40726629892985 42 20 10 6 6 8.448674806398811 11.836175766199753 0.034399986267089844 6 0.9974127110107933 24.2575099426989 1369.0 14.37784094171691 0.0 - - - - - - - 65.72 2 25 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1509 194 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541953.[MT7]-GK[MT7]QEEEK[MT7]PGEEK[MT7].4y3_1.heavy 491.775 / 549.3 322.0 14.40726629892985 42 20 10 6 6 8.448674806398811 11.836175766199753 0.034399986267089844 6 0.9974127110107933 24.2575099426989 322.0 0.2661157024793388 11.0 - - - - - - - 0.0 1 0 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1511 195 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55875.[MT7]-SFSGLTYLK[MT7].2y8_1.heavy 652.379 / 1072.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - TLR7 toll-like receptor 7 1513 195 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55875.[MT7]-SFSGLTYLK[MT7].2b4_1.heavy 652.379 / 523.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - TLR7 toll-like receptor 7 1515 195 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55875.[MT7]-SFSGLTYLK[MT7].2y3_1.heavy 652.379 / 567.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - TLR7 toll-like receptor 7 1517 195 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55875.[MT7]-SFSGLTYLK[MT7].2b5_1.heavy 652.379 / 636.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - TLR7 toll-like receptor 7 1519 196 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56353.[MT7]-ILAIK[MT7].2b3_1.heavy 423.307 / 442.315 5781.0 32.26810073852539 32 11 10 10 1 0.5121981386946721 96.8345766526532 0.0 18 0.8616220298655488 3.278601995517378 5781.0 10.182120877451563 0.0 - - - - - - - 665.8571428571429 11 7 ATP2A1 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 1521 196 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56353.[MT7]-ILAIK[MT7].2y4_1.heavy 423.307 / 588.42 26386.0 32.26810073852539 32 11 10 10 1 0.5121981386946721 96.8345766526532 0.0 18 0.8616220298655488 3.278601995517378 26386.0 39.44758069844035 1.0 - - - - - - - 242.33333333333334 56 15 ATP2A1 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 1523 196 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56353.[MT7]-ILAIK[MT7].2y3_1.heavy 423.307 / 475.336 559.0 32.26810073852539 32 11 10 10 1 0.5121981386946721 96.8345766526532 0.0 18 0.8616220298655488 3.278601995517378 559.0 0.9424196018376723 22.0 - - - - - - - 260.9 10 10 ATP2A1 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 1525 197 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55879.[MT7]-VSILESLEK[MT7].2y4_1.heavy 653.397 / 620.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 1527 197 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55879.[MT7]-VSILESLEK[MT7].2y8_1.heavy 653.397 / 1062.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 1529 197 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55879.[MT7]-VSILESLEK[MT7].2y5_1.heavy 653.397 / 749.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 1531 197 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55879.[MT7]-VSILESLEK[MT7].2y6_1.heavy 653.397 / 862.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 1533 198 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57142.[MT7]-SPPILPPHLLQVILNK[MT7].4b11_2.heavy 517.579 / 669.407 40084.0 44.84982395172119 29 3 10 6 10 0.8413659212655953 78.0486358470295 0.034900665283203125 3 0.5922646297897294 1.8628175838566672 40084.0 12.94598985546201 0.0 - - - - - - - 804.0 80 2 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1535 198 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57142.[MT7]-SPPILPPHLLQVILNK[MT7].4b4_1.heavy 517.579 / 539.331 21836.0 44.84982395172119 29 3 10 6 10 0.8413659212655953 78.0486358470295 0.034900665283203125 3 0.5922646297897294 1.8628175838566672 21836.0 14.894496191280453 0.0 - - - - - - - 402.0 43 2 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1537 198 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57142.[MT7]-SPPILPPHLLQVILNK[MT7].4b5_1.heavy 517.579 / 652.415 13485.0 44.84982395172119 29 3 10 6 10 0.8413659212655953 78.0486358470295 0.034900665283203125 3 0.5922646297897294 1.8628175838566672 13485.0 13.93010052023631 0.0 - - - - - - - 309.0 26 2 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1539 198 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57142.[MT7]-SPPILPPHLLQVILNK[MT7].4b9_2.heavy 517.579 / 548.835 16640.0 44.84982395172119 29 3 10 6 10 0.8413659212655953 78.0486358470295 0.034900665283203125 3 0.5922646297897294 1.8628175838566672 16640.0 7.594608466506792 0.0 - - - - - - - 309.3333333333333 33 3 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1541 199 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56360.[MT7]-LNVVK[MT7].2b3_1.heavy 430.794 / 471.305 581.0 24.678699493408203 33 12 9 10 2 1.5150421310367068 53.08185740824511 0.0 13 0.8948788710741907 3.772570640740304 581.0 0.19440726577437856 29.0 - - - - - - - 639.2 4 10 PARVA parvin, alpha 1543 199 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56360.[MT7]-LNVVK[MT7].2y4_1.heavy 430.794 / 603.395 18655.0 24.678699493408203 33 12 9 10 2 1.5150421310367068 53.08185740824511 0.0 13 0.8948788710741907 3.772570640740304 18655.0 23.698722481777573 0.0 - - - - - - - 232.42857142857142 37 7 PARVA parvin, alpha 1545 199 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56360.[MT7]-LNVVK[MT7].2b4_1.heavy 430.794 / 570.373 1743.0 24.678699493408203 33 12 9 10 2 1.5150421310367068 53.08185740824511 0.0 13 0.8948788710741907 3.772570640740304 1743.0 2.389414575763996 7.0 - - - - - - - 653.625 42 8 PARVA parvin, alpha 1547 199 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56360.[MT7]-LNVVK[MT7].2y3_1.heavy 430.794 / 489.352 872.0 24.678699493408203 33 12 9 10 2 1.5150421310367068 53.08185740824511 0.0 13 0.8948788710741907 3.772570640740304 872.0 0.482360172095882 18.0 - - - - - - - 668.125 3 8 PARVA parvin, alpha 1549 200 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539351.[MT7]-K[MT7]DDSFLGK[MT7].3y3_1.heavy 447.929 / 461.32 7818.0 24.343550205230713 43 17 10 6 10 3.6215207274892824 27.612709556222175 0.03700065612792969 3 0.9789748893915308 8.496290455616748 7818.0 19.24325097043434 0.0 - - - - - - - 674.8181818181819 15 11 PARVA parvin, alpha 1551 200 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539351.[MT7]-K[MT7]DDSFLGK[MT7].3b4_1.heavy 447.929 / 734.392 1125.0 24.343550205230713 43 17 10 6 10 3.6215207274892824 27.612709556222175 0.03700065612792969 3 0.9789748893915308 8.496290455616748 1125.0 4.661452857958129 1.0 - - - - - - - 187.38888888888889 3 18 PARVA parvin, alpha 1553 200 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539351.[MT7]-K[MT7]DDSFLGK[MT7].3b3_1.heavy 447.929 / 647.36 1800.0 24.343550205230713 43 17 10 6 10 3.6215207274892824 27.612709556222175 0.03700065612792969 3 0.9789748893915308 8.496290455616748 1800.0 10.083985765124554 0.0 - - - - - - - 196.72222222222223 3 18 PARVA parvin, alpha 1555 200 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539351.[MT7]-K[MT7]DDSFLGK[MT7].3y5_1.heavy 447.929 / 695.421 4781.0 24.343550205230713 43 17 10 6 10 3.6215207274892824 27.612709556222175 0.03700065612792969 3 0.9789748893915308 8.496290455616748 4781.0 22.954093317516804 0.0 - - - - - - - 216.30769230769232 9 13 PARVA parvin, alpha 1557 201 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541451.[MT7]-VDQSILTGESVSVIK[MT7].3b6_1.heavy 621.694 / 800.463 5575.0 34.85179901123047 41 11 10 10 10 1.828046790897082 47.74255436389237 0.0 3 0.8562404338795956 3.2151284841189334 5575.0 52.02651376146789 0.0 - - - - - - - 240.4 11 5 ATP2A1;ATP2A2 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1;ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 1559 201 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541451.[MT7]-VDQSILTGESVSVIK[MT7].3b4_1.heavy 621.694 / 574.295 4045.0 34.85179901123047 41 11 10 10 10 1.828046790897082 47.74255436389237 0.0 3 0.8562404338795956 3.2151284841189334 4045.0 10.815964481587883 0.0 - - - - - - - 227.0 8 13 ATP2A1;ATP2A2 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1;ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 1561 201 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541451.[MT7]-VDQSILTGESVSVIK[MT7].3b5_1.heavy 621.694 / 687.379 5247.0 34.85179901123047 41 11 10 10 10 1.828046790897082 47.74255436389237 0.0 3 0.8562404338795956 3.2151284841189334 5247.0 11.50558829621491 0.0 - - - - - - - 218.66666666666666 10 12 ATP2A1;ATP2A2 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1;ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 1563 201 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541451.[MT7]-VDQSILTGESVSVIK[MT7].3y4_1.heavy 621.694 / 590.399 16725.0 34.85179901123047 41 11 10 10 10 1.828046790897082 47.74255436389237 0.0 3 0.8562404338795956 3.2151284841189334 16725.0 22.066000392982097 0.0 - - - - - - - 671.7142857142857 33 7 ATP2A1;ATP2A2 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1;ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 1565 202 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539623.[MT7]-RYVESLWK[MT7].3b6_1.heavy 456.934 / 892.501 1019.0 30.656299591064453 43 13 10 10 10 1.2862764199137906 51.33968430614273 0.0 3 0.9202706222814817 4.341347508731791 1019.0 9.661290322580646 2.0 - - - - - - - 148.5 2 10 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1567 202 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539623.[MT7]-RYVESLWK[MT7].3b4_1.heavy 456.934 / 692.385 8336.0 30.656299591064453 43 13 10 10 10 1.2862764199137906 51.33968430614273 0.0 3 0.9202706222814817 4.341347508731791 8336.0 42.45379436116278 0.0 - - - - - - - 679.2222222222222 16 9 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1569 202 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539623.[MT7]-RYVESLWK[MT7].3b5_1.heavy 456.934 / 779.417 16765.0 30.656299591064453 43 13 10 10 10 1.2862764199137906 51.33968430614273 0.0 3 0.9202706222814817 4.341347508731791 16765.0 82.98742006394885 0.0 - - - - - - - 239.33333333333334 33 12 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1571 202 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539623.[MT7]-RYVESLWK[MT7].3y4_1.heavy 456.934 / 677.41 10004.0 30.656299591064453 43 13 10 10 10 1.2862764199137906 51.33968430614273 0.0 3 0.9202706222814817 4.341347508731791 10004.0 32.38705035971223 0.0 - - - - - - - 228.66666666666666 20 15 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1573 203 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538455.[MT7]-ITPTQQQR.2y5_1.heavy 558.318 / 660.342 2067.0 17.249274730682373 46 20 10 6 10 8.510890711700856 11.749651521493398 0.03209877014160156 3 0.9977432422419246 25.973961299059862 2067.0 20.233860489328475 0.0 - - - - - - - 147.05555555555554 4 18 TOLLIP toll interacting protein 1575 203 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538455.[MT7]-ITPTQQQR.2y6_1.heavy 558.318 / 757.395 43685.0 17.249274730682373 46 20 10 6 10 8.510890711700856 11.749651521493398 0.03209877014160156 3 0.9977432422419246 25.973961299059862 43685.0 1241.98660853722 0.0 - - - - - - - 203.27272727272728 87 11 TOLLIP toll interacting protein 1577 203 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538455.[MT7]-ITPTQQQR.2b5_1.heavy 558.318 / 685.4 1898.0 17.249274730682373 46 20 10 6 10 8.510890711700856 11.749651521493398 0.03209877014160156 3 0.9977432422419246 25.973961299059862 1898.0 37.21568627450981 0.0 - - - - - - - 96.95238095238095 3 21 TOLLIP toll interacting protein 1579 203 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538455.[MT7]-ITPTQQQR.2y7_1.heavy 558.318 / 858.443 36263.0 17.249274730682373 46 20 10 6 10 8.510890711700856 11.749651521493398 0.03209877014160156 3 0.9977432422419246 25.973961299059862 36263.0 582.375184636508 0.0 - - - - - - - 208.76923076923077 72 13 TOLLIP toll interacting protein 1581 204 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541258.[MT7]-LNVAEVTQSEIAQK[MT7].3b6_1.heavy 606.679 / 770.453 36440.0 32.71580123901367 45 15 10 10 10 2.2172707880509166 37.18789930334667 0.0 3 0.952513599910154 5.640842779412979 36440.0 384.6354782241907 0.0 - - - - - - - 238.1875 72 16 PARVA parvin, alpha 1583 204 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541258.[MT7]-LNVAEVTQSEIAQK[MT7].3b4_1.heavy 606.679 / 542.342 28390.0 32.71580123901367 45 15 10 10 10 2.2172707880509166 37.18789930334667 0.0 3 0.952513599910154 5.640842779412979 28390.0 41.32450191570881 0.0 - - - - - - - 251.07692307692307 56 13 PARVA parvin, alpha 1585 204 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541258.[MT7]-LNVAEVTQSEIAQK[MT7].3b5_1.heavy 606.679 / 671.385 79841.0 32.71580123901367 45 15 10 10 10 2.2172707880509166 37.18789930334667 0.0 3 0.952513599910154 5.640842779412979 79841.0 257.29367980277897 0.0 - - - - - - - 355.8181818181818 159 11 PARVA parvin, alpha 1587 204 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541258.[MT7]-LNVAEVTQSEIAQK[MT7].3y4_1.heavy 606.679 / 603.395 50798.0 32.71580123901367 45 15 10 10 10 2.2172707880509166 37.18789930334667 0.0 3 0.952513599910154 5.640842779412979 50798.0 79.36186691254767 0.0 - - - - - - - 652.75 101 8 PARVA parvin, alpha 1589 205 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539080.[MT7]-ELIFEETAR.2b3_1.heavy 626.339 / 500.32 10826.0 33.59590148925781 50 20 10 10 10 11.27063490674842 8.87261461553722 0.0 3 0.9979447867560851 27.21820721781885 10826.0 40.641906669507776 0.0 - - - - - - - 680.4285714285714 21 7 MAPK1 mitogen-activated protein kinase 1 1591 205 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539080.[MT7]-ELIFEETAR.2y8_1.heavy 626.339 / 978.526 17322.0 33.59590148925781 50 20 10 10 10 11.27063490674842 8.87261461553722 0.0 3 0.9979447867560851 27.21820721781885 17322.0 101.26707692307693 0.0 - - - - - - - 177.85714285714286 34 14 MAPK1 mitogen-activated protein kinase 1 1593 205 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539080.[MT7]-ELIFEETAR.2y6_1.heavy 626.339 / 752.357 17539.0 33.59590148925781 50 20 10 10 10 11.27063490674842 8.87261461553722 0.0 3 0.9979447867560851 27.21820721781885 17539.0 90.87612716000528 0.0 - - - - - - - 216.625 35 8 MAPK1 mitogen-activated protein kinase 1 1595 205 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539080.[MT7]-ELIFEETAR.2y7_1.heavy 626.339 / 865.441 10285.0 33.59590148925781 50 20 10 10 10 11.27063490674842 8.87261461553722 0.0 3 0.9979447867560851 27.21820721781885 10285.0 40.15072080186806 0.0 - - - - - - - 234.66666666666666 20 12 MAPK1 mitogen-activated protein kinase 1 1597 206 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538453.[MT7]-LLYPVSK[MT7].2b3_1.heavy 554.354 / 534.341 9083.0 31.358200550079346 37 14 10 5 8 1.7732464221660413 47.5153194907964 0.04080009460449219 4 0.939197031219491 4.979371111192004 9083.0 7.7396825372797755 1.0 - - - - - - - 798.3 21 10 PIK3R1;PIK3R2 phosphoinositide-3-kinase, regulatory subunit 1 (alpha);phosphoinositide-3-kinase, regulatory subunit 2 (beta) 1599 206 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538453.[MT7]-LLYPVSK[MT7].2y4_1.heavy 554.354 / 574.368 17068.0 31.358200550079346 37 14 10 5 8 1.7732464221660413 47.5153194907964 0.04080009460449219 4 0.939197031219491 4.979371111192004 17068.0 50.740602630651054 0.0 - - - - - - - 311.875 34 8 PIK3R1;PIK3R2 phosphoinositide-3-kinase, regulatory subunit 1 (alpha);phosphoinositide-3-kinase, regulatory subunit 2 (beta) 1601 206 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538453.[MT7]-LLYPVSK[MT7].2y5_1.heavy 554.354 / 737.431 7686.0 31.358200550079346 37 14 10 5 8 1.7732464221660413 47.5153194907964 0.04080009460449219 4 0.939197031219491 4.979371111192004 7686.0 41.68018217609162 0.0 - - - - - - - 299.2857142857143 15 14 PIK3R1;PIK3R2 phosphoinositide-3-kinase, regulatory subunit 1 (alpha);phosphoinositide-3-kinase, regulatory subunit 2 (beta) 1603 206 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538453.[MT7]-LLYPVSK[MT7].2y6_1.heavy 554.354 / 850.516 3394.0 31.358200550079346 37 14 10 5 8 1.7732464221660413 47.5153194907964 0.04080009460449219 4 0.939197031219491 4.979371111192004 3394.0 -0.04544626593806922 3.0 - - - - - - - 282.75 8 12 PIK3R1;PIK3R2 phosphoinositide-3-kinase, regulatory subunit 1 (alpha);phosphoinositide-3-kinase, regulatory subunit 2 (beta) 1605 207 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537218.[MT7]-QTSSFLV.2b3_1.heavy 463.259 / 461.248 4144.0 36.11530113220215 37 12 10 5 10 1.8846564779253256 41.73983856111627 0.043201446533203125 3 0.8930159274643847 3.7389758600667093 4144.0 9.836081417165927 2.0 - - - - - - - 713.4545454545455 8 11 F11R F11 receptor 1607 207 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537218.[MT7]-QTSSFLV.2b4_1.heavy 463.259 / 548.28 21155.0 36.11530113220215 37 12 10 5 10 1.8846564779253256 41.73983856111627 0.043201446533203125 3 0.8930159274643847 3.7389758600667093 21155.0 35.54428646135307 0.0 - - - - - - - 311.42857142857144 42 7 F11R F11 receptor 1609 207 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537218.[MT7]-QTSSFLV.2b6_1.heavy 463.259 / 808.432 11232.0 36.11530113220215 37 12 10 5 10 1.8846564779253256 41.73983856111627 0.043201446533203125 3 0.8930159274643847 3.7389758600667093 11232.0 20.677871559633026 0.0 - - - - - - - 716.2857142857143 22 7 F11R F11 receptor 1611 207 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537218.[MT7]-QTSSFLV.2b5_1.heavy 463.259 / 695.348 35766.0 36.11530113220215 37 12 10 5 10 1.8846564779253256 41.73983856111627 0.043201446533203125 3 0.8930159274643847 3.7389758600667093 35766.0 40.233462147366815 0.0 - - - - - - - 299.75 71 4 F11R F11 receptor 1613 208 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539765.[MT7]-VTHVEPWEK[MT7].3y3_1.heavy 471.597 / 606.337 24811.0 25.909099578857422 50 20 10 10 10 15.840487106628204 6.312937179700526 0.0 3 0.9980182183030454 27.718052566808563 24811.0 123.60224452554746 0.0 - - - - - - - 216.30769230769232 49 13 PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1615 208 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539765.[MT7]-VTHVEPWEK[MT7].3b4_1.heavy 471.597 / 581.353 8567.0 25.909099578857422 50 20 10 10 10 15.840487106628204 6.312937179700526 0.0 3 0.9980182183030454 27.718052566808563 8567.0 21.529761280765722 0.0 - - - - - - - 298.7142857142857 17 14 PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1617 208 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539765.[MT7]-VTHVEPWEK[MT7].3y4_1.heavy 471.597 / 703.39 26045.0 25.909099578857422 50 20 10 10 10 15.840487106628204 6.312937179700526 0.0 3 0.9980182183030454 27.718052566808563 26045.0 91.98545981486747 0.0 - - - - - - - 224.06666666666666 52 15 PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1619 208 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539765.[MT7]-VTHVEPWEK[MT7].3b3_1.heavy 471.597 / 482.284 40438.0 25.909099578857422 50 20 10 10 10 15.840487106628204 6.312937179700526 0.0 3 0.9980182183030454 27.718052566808563 40438.0 140.77375209681003 0.0 - - - - - - - 294.9 80 10 PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1621 209 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537492.[MT7]-FTVVVLR.2y4_1.heavy 489.317 / 486.34 36141.0 35.55889892578125 45 15 10 10 10 5.495952480700192 18.195208264839266 0.0 3 0.9555331829419188 5.8307142411004165 36141.0 87.88276273344653 0.0 - - - - - - - 279.14285714285717 72 7 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1623 209 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537492.[MT7]-FTVVVLR.2b3_1.heavy 489.317 / 492.294 31149.0 35.55889892578125 45 15 10 10 10 5.495952480700192 18.195208264839266 0.0 3 0.9555331829419188 5.8307142411004165 31149.0 53.324835247740765 0.0 - - - - - - - 784.7692307692307 62 13 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1625 209 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537492.[MT7]-FTVVVLR.2y5_1.heavy 489.317 / 585.408 35056.0 35.55889892578125 45 15 10 10 10 5.495952480700192 18.195208264839266 0.0 3 0.9555331829419188 5.8307142411004165 35056.0 28.90892385553593 0.0 - - - - - - - 325.75 70 4 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1627 209 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537492.[MT7]-FTVVVLR.2b4_1.heavy 489.317 / 591.362 47211.0 35.55889892578125 45 15 10 10 10 5.495952480700192 18.195208264839266 0.0 3 0.9555331829419188 5.8307142411004165 47211.0 42.98195185094223 1.0 - - - - - - - 1193.5714285714287 103 7 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1629 210 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539181.[MT7]-VLYNLFTK[MT7].2y5_1.heavy 643.392 / 766.458 2627.0 39.85559844970703 48 18 10 10 10 9.533977155990565 10.488802140370785 0.0 3 0.9871735302510403 10.885377587559113 2627.0 10.726079838019933 1.0 - - - - - - - 194.41176470588235 6 17 PARVB;PARVA parvin, beta;parvin, alpha 1631 210 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539181.[MT7]-VLYNLFTK[MT7].2b4_1.heavy 643.392 / 634.368 2712.0 39.85559844970703 48 18 10 10 10 9.533977155990565 10.488802140370785 0.0 3 0.9871735302510403 10.885377587559113 2712.0 5.930173377853542 2.0 - - - - - - - 664.7692307692307 5 13 PARVB;PARVA parvin, beta;parvin, alpha 1633 210 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539181.[MT7]-VLYNLFTK[MT7].2y3_1.heavy 643.392 / 539.331 2458.0 39.85559844970703 48 18 10 10 10 9.533977155990565 10.488802140370785 0.0 3 0.9871735302510403 10.885377587559113 2458.0 2.4114084924983175 0.0 - - - - - - - 762.6666666666666 4 9 PARVB;PARVA parvin, beta;parvin, alpha 1635 210 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539181.[MT7]-VLYNLFTK[MT7].2y6_1.heavy 643.392 / 929.521 2627.0 39.85559844970703 48 18 10 10 10 9.533977155990565 10.488802140370785 0.0 3 0.9871735302510403 10.885377587559113 2627.0 22.36281265818366 0.0 - - - - - - - 161.0 5 10 PARVB;PARVA parvin, beta;parvin, alpha 1637 211 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56225.[MT7]-TRDQYLMWLTQK[MT7].3y3_1.heavy 624.341 / 520.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1639 211 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56225.[MT7]-TRDQYLMWLTQK[MT7].3b4_1.heavy 624.341 / 645.344 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1641 211 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56225.[MT7]-TRDQYLMWLTQK[MT7].3y4_1.heavy 624.341 / 633.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1643 211 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56225.[MT7]-TRDQYLMWLTQK[MT7].3b7_1.heavy 624.341 / 1052.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1645 212 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540097.[MT7]-NSNLQHINFTR.3b4_1.heavy 496.599 / 573.311 12337.0 25.81329917907715 44 18 10 6 10 4.324637542986459 18.3690358283467 0.0391998291015625 3 0.9830122416863177 9.45534983305643 12337.0 16.33937155821073 0.0 - - - - - - - 776.75 24 12 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 1647 212 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540097.[MT7]-NSNLQHINFTR.3b5_1.heavy 496.599 / 701.37 14462.0 25.81329917907715 44 18 10 6 10 4.324637542986459 18.3690358283467 0.0391998291015625 3 0.9830122416863177 9.45534983305643 14462.0 24.51385239253852 0.0 - - - - - - - 796.5 28 8 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 1649 212 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540097.[MT7]-NSNLQHINFTR.3y4_1.heavy 496.599 / 537.278 25976.0 25.81329917907715 44 18 10 6 10 4.324637542986459 18.3690358283467 0.0391998291015625 3 0.9830122416863177 9.45534983305643 25976.0 69.38436702196879 0.0 - - - - - - - 358.0 51 9 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 1651 212 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB540097.[MT7]-NSNLQHINFTR.3y5_1.heavy 496.599 / 650.362 18643.0 25.81329917907715 44 18 10 6 10 4.324637542986459 18.3690358283467 0.0391998291015625 3 0.9830122416863177 9.45534983305643 18643.0 60.86758059610706 0.0 - - - - - - - 290.0 37 13 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 1653 213 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55623.[MT7]-IPVPVQK[MT7].2y4_1.heavy 534.855 / 615.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1655 213 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55623.[MT7]-IPVPVQK[MT7].2y5_1.heavy 534.855 / 714.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1657 213 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55623.[MT7]-IPVPVQK[MT7].2y3_1.heavy 534.855 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1659 213 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55623.[MT7]-IPVPVQK[MT7].2y6_1.heavy 534.855 / 811.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1661 214 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55624.[MT7]-DDSFLGK[MT7].2y4_1.heavy 535.292 / 608.389 1574.0 33.86589813232422 30 8 8 10 4 0.6495473585233267 91.70436672246326 0.0 8 0.7878724784304866 2.630688212916252 1574.0 1.9273469387755102 5.0 - - - - - - - 667.5 3 14 PARVA parvin, alpha 1663 214 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55624.[MT7]-DDSFLGK[MT7].2y5_1.heavy 535.292 / 695.421 N/A 33.86589813232422 30 8 8 10 4 0.6495473585233267 91.70436672246326 0.0 8 0.7878724784304866 2.630688212916252 210.0 0.19751341877533132 31.0 - - - - - - - 240.0 6 14 PARVA parvin, alpha 1665 214 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55624.[MT7]-DDSFLGK[MT7].2b4_1.heavy 535.292 / 609.264 2414.0 33.86589813232422 30 8 8 10 4 0.6495473585233267 91.70436672246326 0.0 8 0.7878724784304866 2.630688212916252 2414.0 2.5355110173425874 0.0 - - - - - - - 711.4444444444445 4 9 PARVA parvin, alpha 1667 214 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55624.[MT7]-DDSFLGK[MT7].2y6_1.heavy 535.292 / 810.448 630.0 33.86589813232422 30 8 8 10 4 0.6495473585233267 91.70436672246326 0.0 8 0.7878724784304866 2.630688212916252 630.0 3.025 10.0 - - - - - - - 0.0 1 0 PARVA parvin, alpha 1669 215 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB536754.[MT7]-SPTPK[MT7].2b3_1.heavy 409.255 / 430.242 N/A N/A - - - - - - - - - 0.0 - - - - - - - SRRM2;PARVA;CCL11 serine/arginine repetitive matrix 2;parvin, alpha;chemokine (C-C motif) ligand 11 1671 215 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB536754.[MT7]-SPTPK[MT7].2y4_1.heavy 409.255 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - SRRM2;PARVA;CCL11 serine/arginine repetitive matrix 2;parvin, alpha;chemokine (C-C motif) ligand 11 1673 215 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB536754.[MT7]-SPTPK[MT7].2y3_2.heavy 409.255 / 245.161 N/A N/A - - - - - - - - - 0.0 - - - - - - - SRRM2;PARVA;CCL11 serine/arginine repetitive matrix 2;parvin, alpha;chemokine (C-C motif) ligand 11 1675 215 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB536754.[MT7]-SPTPK[MT7].2y3_1.heavy 409.255 / 489.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - SRRM2;PARVA;CCL11 serine/arginine repetitive matrix 2;parvin, alpha;chemokine (C-C motif) ligand 11 1677 216 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538178.[MT7]-IVQWDIR.2y4_1.heavy 537.315 / 589.309 2646.0 35.00559997558594 42 14 10 10 8 2.3085270555297814 32.8915519922253 0.0 4 0.9349714729837248 4.813138722964603 2646.0 1.35 1.0 - - - - - - - 826.625 5 8 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1679 216 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538178.[MT7]-IVQWDIR.2y5_1.heavy 537.315 / 717.368 6725.0 35.00559997558594 42 14 10 10 8 2.3085270555297814 32.8915519922253 0.0 4 0.9349714729837248 4.813138722964603 6725.0 17.740173847316704 0.0 - - - - - - - 650.2 13 10 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1681 216 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538178.[MT7]-IVQWDIR.2y6_1.heavy 537.315 / 816.436 16867.0 35.00559997558594 42 14 10 10 8 2.3085270555297814 32.8915519922253 0.0 4 0.9349714729837248 4.813138722964603 16867.0 37.219217952763366 1.0 - - - - - - - 254.15384615384616 34 13 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1683 216 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538178.[MT7]-IVQWDIR.2b5_1.heavy 537.315 / 786.427 31859.0 35.00559997558594 42 14 10 10 8 2.3085270555297814 32.8915519922253 0.0 4 0.9349714729837248 4.813138722964603 31859.0 130.03673469387755 0.0 - - - - - - - 299.07142857142856 63 14 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1685 217 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55814.[MT7]-RLQGTQGAK[MT7].2b8_1.heavy 623.877 / 956.539 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1687 217 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55814.[MT7]-RLQGTQGAK[MT7].2y8_1.heavy 623.877 / 946.544 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1689 217 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55814.[MT7]-RLQGTQGAK[MT7].2b5_1.heavy 623.877 / 700.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1691 217 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55814.[MT7]-RLQGTQGAK[MT7].2y7_1.heavy 623.877 / 833.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5B protein phosphatase 2, regulatory subunit B', beta 1693 218 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 181869.0 41.91116587320963 23 -3 10 6 10 null 0.0 0.033397674560546875 3 0.0 0.0 181869.0 732.0642814648407 0.0 - - - - - - - 191.375 363 8 1695 218 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 368035.0 41.91116587320963 23 -3 10 6 10 null 0.0 0.033397674560546875 3 0.0 0.0 368035.0 642.8313544710987 0.0 - - - - - - - 719.375 736 8 1697 218 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 268979.0 41.91116587320963 23 -3 10 6 10 null 0.0 0.033397674560546875 3 0.0 0.0 268979.0 1113.6483799138396 0.0 - - - - - - - 655.625 537 8 1699 219 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57256.[MT7]-EIADFDIFDDPESPFSTFNFQYPNQAFK[MT7].4b4_1.heavy 905.18 / 573.3 1239.0 49.563825607299805 44 17 10 7 10 2.9771117338459674 27.072029306926577 0.02410125732421875 3 0.9759494654486813 7.941923904974287 1239.0 0.43436043698591753 0.0 - - - - - - - 176.12121212121212 2 33 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1701 219 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57256.[MT7]-EIADFDIFDDPESPFSTFNFQYPNQAFK[MT7].4y7_1.heavy 905.18 / 1011.54 597.0 49.563825607299805 44 17 10 7 10 2.9771117338459674 27.072029306926577 0.02410125732421875 3 0.9759494654486813 7.941923904974287 597.0 6.229565217391304 0.0 - - - - - - - 0.0 1 0 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1703 219 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57256.[MT7]-EIADFDIFDDPESPFSTFNFQYPNQAFK[MT7].4y6_1.heavy 905.18 / 848.475 1928.0 49.563825607299805 44 17 10 7 10 2.9771117338459674 27.072029306926577 0.02410125732421875 3 0.9759494654486813 7.941923904974287 1928.0 13.412173913043478 0.0 - - - - - - - 185.2258064516129 3 31 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1705 219 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57256.[MT7]-EIADFDIFDDPESPFSTFNFQYPNQAFK[MT7].4b6_1.heavy 905.18 / 835.395 2066.0 49.563825607299805 44 17 10 7 10 2.9771117338459674 27.072029306926577 0.02410125732421875 3 0.9759494654486813 7.941923904974287 2066.0 13.787324935663008 0.0 - - - - - - - 205.03333333333333 4 30 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1707 220 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57255.[MT7]-GHHVAQLDPLGILDADLDSFVPSDLITTIDK[MT7].4y5_1.heavy 901.734 / 721.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1709 220 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57255.[MT7]-GHHVAQLDPLGILDADLDSFVPSDLITTIDK[MT7].4b8_1.heavy 901.734 / 1002.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1711 220 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57255.[MT7]-GHHVAQLDPLGILDADLDSFVPSDLITTIDK[MT7].4b11_2.heavy 901.734 / 635.345 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1713 220 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57255.[MT7]-GHHVAQLDPLGILDADLDSFVPSDLITTIDK[MT7].4y10_1.heavy 901.734 / 1246.7 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1715 221 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57257.[MT7]-FFVDGQWVHDPSEPVVTSQLGTINNLIHVK[MT7].4b7_1.heavy 916.99 / 1024.5 2105.0 42.22169876098633 40 10 10 10 10 0.9256181874526587 71.18246900649771 0.0 3 0.8250758927398054 2.9066545147397576 2105.0 13.972142857142856 0.0 - - - - - - - 197.94117647058823 4 17 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1717 221 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57257.[MT7]-FFVDGQWVHDPSEPVVTSQLGTINNLIHVK[MT7].4b4_1.heavy 916.99 / 653.341 4140.0 42.22169876098633 40 10 10 10 10 0.9256181874526587 71.18246900649771 0.0 3 0.8250758927398054 2.9066545147397576 4140.0 7.306200444098282 0.0 - - - - - - - 787.3333333333334 8 9 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1719 221 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57257.[MT7]-FFVDGQWVHDPSEPVVTSQLGTINNLIHVK[MT7].4y3_1.heavy 916.99 / 527.342 8069.0 42.22169876098633 40 10 10 10 10 0.9256181874526587 71.18246900649771 0.0 3 0.8250758927398054 2.9066545147397576 8069.0 8.62994652406417 1.0 - - - - - - - 322.73333333333335 16 15 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1721 221 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57257.[MT7]-FFVDGQWVHDPSEPVVTSQLGTINNLIHVK[MT7].4b6_1.heavy 916.99 / 838.422 3789.0 42.22169876098633 40 10 10 10 10 0.9256181874526587 71.18246900649771 0.0 3 0.8250758927398054 2.9066545147397576 3789.0 10.931059063136455 0.0 - - - - - - - 268.29411764705884 7 17 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1723 222 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538443.[MT7]-ELLLAEK[MT7].2b3_1.heavy 552.349 / 500.32 11535.0 31.49209976196289 43 17 8 10 8 3.093296115087751 32.327975169348825 0.0 4 0.9771966067535945 8.157064135958485 11535.0 17.56667260231997 1.0 - - - - - - - 673.7142857142857 30 7 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1725 222 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538443.[MT7]-ELLLAEK[MT7].2y4_1.heavy 552.349 / 604.379 10231.0 31.49209976196289 43 17 8 10 8 3.093296115087751 32.327975169348825 0.0 4 0.9771966067535945 8.157064135958485 10231.0 12.419982763059222 0.0 - - - - - - - 692.1 20 10 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1727 222 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538443.[MT7]-ELLLAEK[MT7].2y5_1.heavy 552.349 / 717.463 5116.0 31.49209976196289 43 17 8 10 8 3.093296115087751 32.327975169348825 0.0 4 0.9771966067535945 8.157064135958485 5116.0 4.907076251090067 1.0 - - - - - - - 727.125 10 8 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1729 222 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538443.[MT7]-ELLLAEK[MT7].2y6_1.heavy 552.349 / 830.547 9429.0 31.49209976196289 43 17 8 10 8 3.093296115087751 32.327975169348825 0.0 4 0.9771966067535945 8.157064135958485 9429.0 26.304630212946815 0.0 - - - - - - - 182.27272727272728 18 11 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1731 223 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55561.[MT7]-NPDMEK[MT7].2b3_1.heavy 511.265 / 471.232 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1733 223 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55561.[MT7]-NPDMEK[MT7].2y4_1.heavy 511.265 / 666.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1735 223 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55561.[MT7]-NPDMEK[MT7].2y5_1.heavy 511.265 / 763.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1737 223 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55561.[MT7]-NPDMEK[MT7].2y3_1.heavy 511.265 / 551.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1739 224 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56236.[MT7]-QIQEEITGNTEALSGR.2b3_1.heavy 945.488 / 514.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARVA parvin, alpha 1741 224 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56236.[MT7]-QIQEEITGNTEALSGR.2y12_1.heavy 945.488 / 1247.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARVA parvin, alpha 1743 224 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56236.[MT7]-QIQEEITGNTEALSGR.2y10_1.heavy 945.488 / 1005.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARVA parvin, alpha 1745 224 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56236.[MT7]-QIQEEITGNTEALSGR.2b5_1.heavy 945.488 / 772.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARVA parvin, alpha 1747 225 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539188.[MT7]-DTTLTEPVIR.2y8_1.heavy 644.865 / 928.546 1221.0 28.813366572062176 40 14 10 6 10 1.8942648588131579 44.267035150783585 0.03189849853515625 3 0.9390516399873762 4.973366827158444 1221.0 16.059819672131148 1.0 - - - - - - - 185.85714285714286 2 7 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1749 225 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539188.[MT7]-DTTLTEPVIR.2y9_1.heavy 644.865 / 1029.59 2604.0 28.813366572062176 40 14 10 6 10 1.8942648588131579 44.267035150783585 0.03189849853515625 3 0.9390516399873762 4.973366827158444 2604.0 35.718409318409314 0.0 - - - - - - - 130.0 5 10 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1751 225 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539188.[MT7]-DTTLTEPVIR.2y6_1.heavy 644.865 / 714.414 4558.0 28.813366572062176 40 14 10 6 10 1.8942648588131579 44.267035150783585 0.03189849853515625 3 0.9390516399873762 4.973366827158444 4558.0 56.13351511020223 0.0 - - - - - - - 197.5 9 14 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1753 225 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539188.[MT7]-DTTLTEPVIR.2y7_1.heavy 644.865 / 827.498 N/A 28.813366572062176 40 14 10 6 10 1.8942648588131579 44.267035150783585 0.03189849853515625 3 0.9390516399873762 4.973366827158444 1302.0 0.670109918530971 1.0 - - - - - - - 170.7 2 10 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1755 226 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538842.[MT7]-RSQGSSQFR.2b8_1.heavy 598.816 / 1022.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1757 226 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538842.[MT7]-RSQGSSQFR.2y8_1.heavy 598.816 / 896.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1759 226 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538842.[MT7]-RSQGSSQFR.2b7_1.heavy 598.816 / 875.445 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1761 226 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538842.[MT7]-RSQGSSQFR.2y7_1.heavy 598.816 / 809.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1763 227 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55566.[MT7]-TMTALAK[MT7].2y4_1.heavy 512.309 / 546.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 1765 227 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55566.[MT7]-TMTALAK[MT7].2y5_1.heavy 512.309 / 647.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 1767 227 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55566.[MT7]-TMTALAK[MT7].2b4_1.heavy 512.309 / 549.282 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 1769 227 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55566.[MT7]-TMTALAK[MT7].2y6_1.heavy 512.309 / 778.461 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 1771 228 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55758.[MT7]-VYYDLVK[MT7].2y5_1.heavy 594.349 / 781.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1773 228 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55758.[MT7]-VYYDLVK[MT7].2b4_1.heavy 594.349 / 685.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1775 228 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55758.[MT7]-VYYDLVK[MT7].2y3_1.heavy 594.349 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1777 228 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55758.[MT7]-VYYDLVK[MT7].2y6_1.heavy 594.349 / 944.521 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1779 229 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537198.[MT7]-WC[CAM]PGVR.2y4_1.heavy 459.74 / 428.262 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 1781 229 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537198.[MT7]-WC[CAM]PGVR.2b4_1.heavy 459.74 / 645.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBM22 RNA binding motif protein 22 1783 230 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55423.[MT7]-SFLTK[MT7].2b3_1.heavy 442.278 / 492.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADNP;PRPF38B activity-dependent neuroprotector homeobox;PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1785 230 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55423.[MT7]-SFLTK[MT7].2y4_1.heavy 442.278 / 652.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADNP;PRPF38B activity-dependent neuroprotector homeobox;PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1787 230 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55423.[MT7]-SFLTK[MT7].2y3_1.heavy 442.278 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADNP;PRPF38B activity-dependent neuroprotector homeobox;PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1789 231 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55420.[MT7]-TIIDK[MT7].2b3_1.heavy 439.283 / 472.325 1000.0 25.315224647521973 19 0 10 3 6 0.5455619661767553 100.05881511623018 0.07220077514648438 6 0.3946915915350981 1.4980541955197324 1000.0 0.0 8.0 - - - - - - - 621.2 3 10 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1791 231 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55420.[MT7]-TIIDK[MT7].2y4_1.heavy 439.283 / 632.41 1000.0 25.315224647521973 19 0 10 3 6 0.5455619661767553 100.05881511623018 0.07220077514648438 6 0.3946915915350981 1.4980541955197324 1000.0 0.5602240896358543 3.0 - - - - - - - 260.6470588235294 2 17 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1793 231 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55420.[MT7]-TIIDK[MT7].2b4_1.heavy 439.283 / 587.352 8571.0 25.315224647521973 19 0 10 3 6 0.5455619661767553 100.05881511623018 0.07220077514648438 6 0.3946915915350981 1.4980541955197324 8571.0 16.506305647871073 0.0 - - - - - - - 309.5 17 6 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1795 231 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55420.[MT7]-TIIDK[MT7].2y3_1.heavy 439.283 / 519.326 786.0 25.315224647521973 19 0 10 3 6 0.5455619661767553 100.05881511623018 0.07220077514648438 6 0.3946915915350981 1.4980541955197324 786.0 0.6420070011668612 16.0 - - - - - - - 698.9285714285714 3 14 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1797 232 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539086.[MT7]-SEGAGGHAPGK[MT7].3b6_1.heavy 419.226 / 603.286 82351.0 13.529000282287598 45 15 10 10 10 4.477555781471171 22.333613444597542 0.0 3 0.9567431443723079 5.912304768561238 82351.0 430.40386053199137 0.0 - - - - - - - 159.22727272727272 164 22 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1799 232 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539086.[MT7]-SEGAGGHAPGK[MT7].3y3_1.heavy 419.226 / 445.289 173757.0 13.529000282287598 45 15 10 10 10 4.477555781471171 22.333613444597542 0.0 3 0.9567431443723079 5.912304768561238 173757.0 319.62085531848913 0.0 - - - - - - - 194.63636363636363 347 22 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1801 232 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539086.[MT7]-SEGAGGHAPGK[MT7].3b5_1.heavy 419.226 / 546.264 12950.0 13.529000282287598 45 15 10 10 10 4.477555781471171 22.333613444597542 0.0 3 0.9567431443723079 5.912304768561238 12950.0 111.28205128205127 0.0 - - - - - - - 149.6153846153846 25 26 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1803 232 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539086.[MT7]-SEGAGGHAPGK[MT7].3y4_1.heavy 419.226 / 516.326 24049.0 13.529000282287598 45 15 10 10 10 4.477555781471171 22.333613444597542 0.0 3 0.9567431443723079 5.912304768561238 24049.0 198.59468325791858 0.0 - - - - - - - 118.36 48 25 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1805 233 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541468.[MT7]-GSTMEEELENITTK[MT7].3b6_1.heavy 623.983 / 779.336 2902.0 36.30860137939453 47 17 10 10 10 4.473588205612015 22.353420879139538 0.0 3 0.9754796805120068 7.865165599872702 2902.0 10.060266666666667 0.0 - - - - - - - 216.66666666666666 5 12 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1807 233 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541468.[MT7]-GSTMEEELENITTK[MT7].3b4_1.heavy 623.983 / 521.251 3402.0 36.30860137939453 47 17 10 10 10 4.473588205612015 22.353420879139538 0.0 3 0.9754796805120068 7.865165599872702 3402.0 18.370800000000003 0.0 - - - - - - - 211.11111111111111 6 9 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1809 233 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541468.[MT7]-GSTMEEELENITTK[MT7].3b5_1.heavy 623.983 / 650.294 4002.0 36.30860137939453 47 17 10 10 10 4.473588205612015 22.353420879139538 0.0 3 0.9754796805120068 7.865165599872702 4002.0 7.960021978021977 0.0 - - - - - - - 216.66666666666666 8 12 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1811 233 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541468.[MT7]-GSTMEEELENITTK[MT7].3b7_1.heavy 623.983 / 908.379 5603.0 36.30860137939453 47 17 10 10 10 4.473588205612015 22.353420879139538 0.0 3 0.9754796805120068 7.865165599872702 5603.0 38.38055 0.0 - - - - - - - 162.5 11 8 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1813 234 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55750.[MT7]-VQLYELK[MT7].2y4_1.heavy 590.863 / 696.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1815 234 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55750.[MT7]-VQLYELK[MT7].2y5_1.heavy 590.863 / 809.489 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1817 234 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55750.[MT7]-VQLYELK[MT7].2y3_1.heavy 590.863 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1819 234 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55750.[MT7]-VQLYELK[MT7].2y6_1.heavy 590.863 / 937.547 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF38B PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 1821 235 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541542.[MT7]-RATLNELVEYVSTNR.3y7_1.heavy 637.013 / 868.416 18439.0 37.88504886627197 41 15 10 6 10 2.036198314741464 33.009688832129555 0.036998748779296875 3 0.955904723090729 5.855411362160921 18439.0 78.78856823266219 0.0 - - - - - - - 259.35714285714283 36 14 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1823 235 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541542.[MT7]-RATLNELVEYVSTNR.3y6_1.heavy 637.013 / 739.373 14714.0 37.88504886627197 41 15 10 6 10 2.036198314741464 33.009688832129555 0.036998748779296875 3 0.955904723090729 5.855411362160921 14714.0 89.23357310194393 0.0 - - - - - - - 211.06666666666666 29 15 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1825 235 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541542.[MT7]-RATLNELVEYVSTNR.3b6_1.heavy 637.013 / 829.465 13224.0 37.88504886627197 41 15 10 6 10 2.036198314741464 33.009688832129555 0.036998748779296875 3 0.955904723090729 5.855411362160921 13224.0 99.44971028279858 0.0 - - - - - - - 272.64285714285717 26 14 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1827 235 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541542.[MT7]-RATLNELVEYVSTNR.3b5_1.heavy 637.013 / 700.422 3446.0 37.88504886627197 41 15 10 6 10 2.036198314741464 33.009688832129555 0.036998748779296875 3 0.955904723090729 5.855411362160921 3446.0 14.724519015659954 0.0 - - - - - - - 285.6666666666667 6 15 PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1829 236 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539742.[MT7]-LDHLVEIDFR.3y6_1.heavy 467.593 / 778.409 10305.0 36.96175003051758 45 20 10 5 10 4.659203857410257 21.462894318512042 0.0402984619140625 3 0.9921984915220259 13.963372591193393 10305.0 117.64057618770522 0.0 - - - - - - - 154.14285714285714 20 7 TLR7 toll-like receptor 7 1831 236 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539742.[MT7]-LDHLVEIDFR.3y4_1.heavy 467.593 / 550.298 9422.0 36.96175003051758 45 20 10 5 10 4.659203857410257 21.462894318512042 0.0402984619140625 3 0.9921984915220259 13.963372591193393 9422.0 18.399151752403405 0.0 - - - - - - - 250.66666666666666 18 9 TLR7 toll-like receptor 7 1833 236 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539742.[MT7]-LDHLVEIDFR.3b3_1.heavy 467.593 / 510.279 41219.0 36.96175003051758 45 20 10 5 10 4.659203857410257 21.462894318512042 0.0402984619140625 3 0.9921984915220259 13.963372591193393 41219.0 117.9394812323597 0.0 - - - - - - - 236.91666666666666 82 12 TLR7 toll-like receptor 7 1835 236 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539742.[MT7]-LDHLVEIDFR.3y5_1.heavy 467.593 / 679.341 24928.0 36.96175003051758 45 20 10 5 10 4.659203857410257 21.462894318512042 0.0402984619140625 3 0.9921984915220259 13.963372591193393 24928.0 173.13937414965986 0.0 - - - - - - - 238.14285714285714 49 14 TLR7 toll-like receptor 7 1837 237 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57246.[MT7]-K[MT7]SSGQPVTFTDIFGMLIGETLIHNR.4y8_1.heavy 763.165 / 939.501 1584.0 50.064300537109375 46 16 10 10 10 2.3882566448896094 41.871546851541254 0.0 3 0.9616153330950513 6.278912247509412 1584.0 30.171428571428574 0.0 - - - - - - - 35.7 3 10 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1839 237 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57246.[MT7]-K[MT7]SSGQPVTFTDIFGMLIGETLIHNR.4b11_2.heavy 763.165 / 718.885 N/A 50.064300537109375 46 16 10 10 10 2.3882566448896094 41.871546851541254 0.0 3 0.9616153330950513 6.278912247509412 4096.0 13.0031746031746 0.0 - - - - - - - 52.6 8 20 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1841 237 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57246.[MT7]-K[MT7]SSGQPVTFTDIFGMLIGETLIHNR.4y9_1.heavy 763.165 / 1052.58 443.0 50.064300537109375 46 16 10 10 10 2.3882566448896094 41.871546851541254 0.0 3 0.9616153330950513 6.278912247509412 443.0 20.92647619047619 0.0 - - - - - - - 0.0 0 0 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1843 237 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57246.[MT7]-K[MT7]SSGQPVTFTDIFGMLIGETLIHNR.4b5_1.heavy 763.165 / 776.451 8341.0 50.064300537109375 46 16 10 10 10 2.3882566448896094 41.871546851541254 0.0 3 0.9616153330950513 6.278912247509412 8341.0 238.31428571428572 0.0 - - - - - - - 39.666666666666664 16 9 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1845 238 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539463.[MT7]-DSVMVLSATHR.3y6_1.heavy 453.911 / 684.379 10973.0 27.029600143432617 48 18 10 10 10 5.989994373063696 16.69450650065521 0.0 3 0.9885215702305472 11.50813197925702 10973.0 40.693392712550605 0.0 - - - - - - - 232.0 21 14 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1847 238 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539463.[MT7]-DSVMVLSATHR.3b4_1.heavy 453.911 / 577.277 31330.0 27.029600143432617 48 18 10 10 10 5.989994373063696 16.69450650065521 0.0 3 0.9885215702305472 11.50813197925702 31330.0 78.5332919203639 0.0 - - - - - - - 660.0 62 7 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1849 238 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539463.[MT7]-DSVMVLSATHR.3b5_1.heavy 453.911 / 676.346 10900.0 27.029600143432617 48 18 10 10 10 5.989994373063696 16.69450650065521 0.0 3 0.9885215702305472 11.50813197925702 10900.0 58.110918433397 0.0 - - - - - - - 284.52941176470586 21 17 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1851 238 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539463.[MT7]-DSVMVLSATHR.3y5_1.heavy 453.911 / 571.295 42302.0 27.029600143432617 48 18 10 10 10 5.989994373063696 16.69450650065521 0.0 3 0.9885215702305472 11.50813197925702 42302.0 99.62334386775251 0.0 - - - - - - - 296.77777777777777 84 9 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 1853 239 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57243.[MT7]-EVQYNPTYETMFAPEFGPENPFR.3b4_1.heavy 969.785 / 664.342 3325.0 43.914798736572266 36 10 10 6 10 1.2505512888484103 63.3880743592545 0.0391998291015625 3 0.8381741437717037 3.02551840147839 3325.0 8.887033945464665 0.0 - - - - - - - 203.15 6 20 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1855 239 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57243.[MT7]-EVQYNPTYETMFAPEFGPENPFR.3b5_1.heavy 969.785 / 778.385 9444.0 43.914798736572266 36 10 10 6 10 1.2505512888484103 63.3880743592545 0.0391998291015625 3 0.8381741437717037 3.02551840147839 9444.0 52.22100164574526 0.0 - - - - - - - 213.06666666666666 18 15 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1857 239 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57243.[MT7]-EVQYNPTYETMFAPEFGPENPFR.3b3_1.heavy 969.785 / 501.279 2128.0 43.914798736572266 36 10 10 6 10 1.2505512888484103 63.3880743592545 0.0391998291015625 3 0.8381741437717037 3.02551840147839 2128.0 14.96 0.0 - - - - - - - 196.26315789473685 4 19 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1859 239 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57243.[MT7]-EVQYNPTYETMFAPEFGPENPFR.3y10_1.heavy 969.785 / 1189.56 8180.0 43.914798736572266 36 10 10 6 10 1.2505512888484103 63.3880743592545 0.0391998291015625 3 0.8381741437717037 3.02551840147839 8180.0 97.89860902255639 0.0 - - - - - - - 179.30769230769232 16 13 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1861 240 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541133.[MT7]-EDLETGVHLDPAVK[MT7].3b6_1.heavy 604.331 / 789.375 5098.0 29.33180046081543 47 17 10 10 10 2.547903986813237 31.005999440678654 0.0 3 0.9709647979380143 7.225093731099024 5098.0 24.00236748722298 0.0 - - - - - - - 180.9047619047619 10 21 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1863 240 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541133.[MT7]-EDLETGVHLDPAVK[MT7].3b4_1.heavy 604.331 / 631.305 2852.0 29.33180046081543 47 17 10 10 10 2.547903986813237 31.005999440678654 0.0 3 0.9709647979380143 7.225093731099024 2852.0 15.403486062445602 0.0 - - - - - - - 207.25 5 20 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1865 240 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541133.[MT7]-EDLETGVHLDPAVK[MT7].3y4_1.heavy 604.331 / 558.373 18751.0 29.33180046081543 47 17 10 10 10 2.547903986813237 31.005999440678654 0.0 3 0.9709647979380143 7.225093731099024 18751.0 57.8204870652895 0.0 - - - - - - - 765.2857142857143 37 7 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1867 240 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541133.[MT7]-EDLETGVHLDPAVK[MT7].3b7_1.heavy 604.331 / 888.443 5444.0 29.33180046081543 47 17 10 10 10 2.547903986813237 31.005999440678654 0.0 3 0.9709647979380143 7.225093731099024 5444.0 82.42744904372812 0.0 - - - - - - - 181.3 10 10 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1869 241 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541135.[MT7]-DRYYGINDPVADK[MT7].3b5_1.heavy 605.316 / 799.385 1605.0 26.992799758911133 40 10 10 10 10 1.3776899172037131 72.58527390762157 0.0 3 0.834678380907276 2.9924318873942815 1605.0 11.809784735812134 1.0 - - - - - - - 212.91666666666666 3 12 RBM22 RNA binding motif protein 22 1871 241 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541135.[MT7]-DRYYGINDPVADK[MT7].3b8_1.heavy 605.316 / 1141.54 1678.0 26.992799758911133 40 10 10 10 10 1.3776899172037131 72.58527390762157 0.0 3 0.834678380907276 2.9924318873942815 1678.0 45.05315068493151 0.0 - - - - - - - 194.66666666666666 3 3 RBM22 RNA binding motif protein 22 1873 241 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541135.[MT7]-DRYYGINDPVADK[MT7].3y5_1.heavy 605.316 / 673.4 10069.0 26.992799758911133 40 10 10 10 10 1.3776899172037131 72.58527390762157 0.0 3 0.834678380907276 2.9924318873942815 10069.0 57.72433561643835 0.0 - - - - - - - 219.0 20 16 RBM22 RNA binding motif protein 22 1875 241 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541135.[MT7]-DRYYGINDPVADK[MT7].3b8_2.heavy 605.316 / 571.273 17585.0 26.992799758911133 40 10 10 10 10 1.3776899172037131 72.58527390762157 0.0 3 0.834678380907276 2.9924318873942815 17585.0 56.781311154598825 0.0 - - - - - - - 677.8571428571429 35 7 RBM22 RNA binding motif protein 22 1877 242 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55532.[MT7]-EELWK[MT7].2y4_1.heavy 496.786 / 719.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A;PPP2R5E;EPB41L4A protein phosphatase 2, regulatory subunit B', alpha;protein phosphatase 2, regulatory subunit B', epsilon isoform;erythrocyte membrane protein band 4.1 like 4A 1879 242 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55532.[MT7]-EELWK[MT7].2b3_1.heavy 496.786 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A;PPP2R5E;EPB41L4A protein phosphatase 2, regulatory subunit B', alpha;protein phosphatase 2, regulatory subunit B', epsilon isoform;erythrocyte membrane protein band 4.1 like 4A 1881 242 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55532.[MT7]-EELWK[MT7].2y3_1.heavy 496.786 / 590.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A;PPP2R5E;EPB41L4A protein phosphatase 2, regulatory subunit B', alpha;protein phosphatase 2, regulatory subunit B', epsilon isoform;erythrocyte membrane protein band 4.1 like 4A 1883 243 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55439.[MT7]-SPSVPK[MT7].2b3_1.heavy 451.781 / 416.226 N/A 22.18589973449707 14 2 2 10 0 0.5187053297176321 100.23257236575232 0.0 28 0.4762449264431218 1.624443008328088 3175.0 1.790170204221024 8.0 - - - - - - - 1729.0 12 10 PARVA parvin, alpha 1885 243 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55439.[MT7]-SPSVPK[MT7].2y4_1.heavy 451.781 / 574.368 306.0 22.18589973449707 14 2 2 10 0 0.5187053297176321 100.23257236575232 0.0 28 0.4762449264431218 1.624443008328088 306.0 1.5992537313432837 34.0 - - - - - - - 221.6551724137931 2 29 PARVA parvin, alpha 1887 243 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55439.[MT7]-SPSVPK[MT7].2y5_1.heavy 451.781 / 671.421 574.0 22.18589973449707 14 2 2 10 0 0.5187053297176321 100.23257236575232 0.0 28 0.4762449264431218 1.624443008328088 574.0 2.487168867703368 4.0 - - - - - - - 153.11111111111111 2 27 PARVA parvin, alpha 1889 243 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55439.[MT7]-SPSVPK[MT7].2y3_1.heavy 451.781 / 487.336 5279.0 22.18589973449707 14 2 2 10 0 0.5187053297176321 100.23257236575232 0.0 28 0.4762449264431218 1.624443008328088 5279.0 12.739668174962294 1.0 - - - - - - - 663.1111111111111 21 9 PARVA parvin, alpha 1891 244 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56107.[MT7]-LLAAHDVPVFGWR.3b4_1.heavy 542.307 / 513.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1893 244 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56107.[MT7]-LLAAHDVPVFGWR.3y4_1.heavy 542.307 / 565.288 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1895 244 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56107.[MT7]-LLAAHDVPVFGWR.3y8_1.heavy 542.307 / 975.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1897 244 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56107.[MT7]-LLAAHDVPVFGWR.3y5_1.heavy 542.307 / 664.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - OGDHL oxoglutarate dehydrogenase-like 1899 245 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56245.[MT7]-RATLNELVEYVSTNR.2y9_1.heavy 955.017 / 1080.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1901 245 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56245.[MT7]-RATLNELVEYVSTNR.2b6_1.heavy 955.017 / 829.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1903 245 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56245.[MT7]-RATLNELVEYVSTNR.2y6_1.heavy 955.017 / 739.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1905 245 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56245.[MT7]-RATLNELVEYVSTNR.2b9_1.heavy 955.017 / 1170.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5A protein phosphatase 2, regulatory subunit B', alpha 1907 246 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55647.[MT7]-HSLEWK[MT7].2y4_1.heavy 544.311 / 719.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 1909 246 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55647.[MT7]-HSLEWK[MT7].2y5_1.heavy 544.311 / 806.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 1911 246 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55647.[MT7]-HSLEWK[MT7].2b4_1.heavy 544.311 / 611.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 1913 246 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55647.[MT7]-HSLEWK[MT7].2y3_1.heavy 544.311 / 606.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 1915 247 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538190.[MT7]-ISEIIDSR.2y5_1.heavy 538.807 / 603.346 N/A 30.696399688720703 39 9 10 10 10 0.6985402791905457 75.39930014246875 0.0 3 0.8057736862229903 2.7536861342902434 23080.0 26.738024164889836 0.0 - - - - - - - 764.1428571428571 46 7 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1917 247 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538190.[MT7]-ISEIIDSR.2b4_1.heavy 538.807 / 587.352 13604.0 30.696399688720703 39 9 10 10 10 0.6985402791905457 75.39930014246875 0.0 3 0.8057736862229903 2.7536861342902434 13604.0 49.447920408109155 0.0 - - - - - - - 683.7142857142857 27 7 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1919 247 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538190.[MT7]-ISEIIDSR.2b6_1.heavy 538.807 / 815.463 37060.0 30.696399688720703 39 9 10 10 10 0.6985402791905457 75.39930014246875 0.0 3 0.8057736862229903 2.7536861342902434 37060.0 310.5219990367453 0.0 - - - - - - - 215.8 74 10 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1921 247 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB538190.[MT7]-ISEIIDSR.2y7_1.heavy 538.807 / 819.421 22799.0 30.696399688720703 39 9 10 10 10 0.6985402791905457 75.39930014246875 0.0 3 0.8057736862229903 2.7536861342902434 22799.0 63.50406392694064 0.0 - - - - - - - 262.7 45 10 PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1923 248 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537994.[MT7]-EEVNEK[MT7].2y4_1.heavy 518.282 / 633.369 1268.0 15.17389965057373 48 18 10 10 10 2.750846495593359 28.994151186790916 0.0 3 0.9822686913728413 9.254397751830085 1268.0 5.967058823529412 0.0 - - - - - - - 104.0 2 16 PIK3R1;PIK3R2 phosphoinositide-3-kinase, regulatory subunit 1 (alpha);phosphoinositide-3-kinase, regulatory subunit 2 (beta) 1925 248 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537994.[MT7]-EEVNEK[MT7].2b3_1.heavy 518.282 / 502.263 620.0 15.17389965057373 48 18 10 10 10 2.750846495593359 28.994151186790916 0.0 3 0.9822686913728413 9.254397751830085 620.0 0.6250493096646943 8.0 - - - - - - - 0.0 1 0 PIK3R1;PIK3R2 phosphoinositide-3-kinase, regulatory subunit 1 (alpha);phosphoinositide-3-kinase, regulatory subunit 2 (beta) 1927 248 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537994.[MT7]-EEVNEK[MT7].2y5_1.heavy 518.282 / 762.411 1015.0 15.17389965057373 48 18 10 10 10 2.750846495593359 28.994151186790916 0.0 3 0.9822686913728413 9.254397751830085 1015.0 5.281799488018801 0.0 - - - - - - - 104.83333333333333 2 18 PIK3R1;PIK3R2 phosphoinositide-3-kinase, regulatory subunit 1 (alpha);phosphoinositide-3-kinase, regulatory subunit 2 (beta) 1929 248 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537994.[MT7]-EEVNEK[MT7].2y3_1.heavy 518.282 / 534.3 1466.0 15.17389965057373 48 18 10 10 10 2.750846495593359 28.994151186790916 0.0 3 0.9822686913728413 9.254397751830085 1466.0 13.746403122246003 0.0 - - - - - - - 156.45 2 20 PIK3R1;PIK3R2 phosphoinositide-3-kinase, regulatory subunit 1 (alpha);phosphoinositide-3-kinase, regulatory subunit 2 (beta) 1931 249 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56100.[MT7]-NQGLTVFETGQK[MT7].3b6_1.heavy 537.298 / 757.432 645.0 34.87125015258789 20 8 2 6 4 1.2581237359089543 49.902415164648474 0.03890228271484375 9 0.7918514662721295 2.6566685302080346 645.0 0.8012422360248448 11.0 - - - - - - - 201.25 2 16 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1933 249 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56100.[MT7]-NQGLTVFETGQK[MT7].3b4_1.heavy 537.298 / 557.316 2580.0 34.87125015258789 20 8 2 6 4 1.2581237359089543 49.902415164648474 0.03890228271484375 9 0.7918514662721295 2.6566685302080346 2580.0 1.0117087294105482 6.0 - - - - - - - 430.0 28 4 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1935 249 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56100.[MT7]-NQGLTVFETGQK[MT7].3b5_1.heavy 537.298 / 658.364 6665.0 34.87125015258789 20 8 2 6 4 1.2581237359089543 49.902415164648474 0.03890228271484375 9 0.7918514662721295 2.6566685302080346 6665.0 13.220764256399178 0.0 - - - - - - - 677.0 13 10 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1937 249 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56100.[MT7]-NQGLTVFETGQK[MT7].3y4_1.heavy 537.298 / 577.343 537.0 34.87125015258789 20 8 2 6 4 1.2581237359089543 49.902415164648474 0.03890228271484375 9 0.7918514662721295 2.6566685302080346 537.0 0.7227313211281543 29.0 - - - - - - - 698.5 13 10 CDC40 cell division cycle 40 homolog (S. cerevisiae) 1939 250 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539637.[MT7]-GRLNVLANVIR.3y6_1.heavy 456.957 / 685.435 5088.0 33.90810012817383 48 18 10 10 10 3.4116456251768628 23.242167616492075 0.0 3 0.9804548299901384 8.813181859164649 5088.0 22.717195581603086 0.0 - - - - - - - 241.45454545454547 10 11 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1941 250 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539637.[MT7]-GRLNVLANVIR.3b4_1.heavy 456.957 / 585.359 2544.0 33.90810012817383 48 18 10 10 10 3.4116456251768628 23.242167616492075 0.0 3 0.9804548299901384 8.813181859164649 2544.0 8.228090301359103 0.0 - - - - - - - 212.84615384615384 5 13 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1943 250 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539637.[MT7]-GRLNVLANVIR.3y4_1.heavy 456.957 / 501.314 5530.0 33.90810012817383 48 18 10 10 10 3.4116456251768628 23.242167616492075 0.0 3 0.9804548299901384 8.813181859164649 5530.0 6.417633760361718 0.0 - - - - - - - 315.85714285714283 11 7 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1945 250 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB539637.[MT7]-GRLNVLANVIR.3y5_1.heavy 456.957 / 572.352 9401.0 33.90810012817383 48 18 10 10 10 3.4116456251768628 23.242167616492075 0.0 3 0.9804548299901384 8.813181859164649 9401.0 43.63267377201112 0.0 - - - - - - - 322.5833333333333 18 12 OGDH;OGDHL oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate dehydrogenase-like 1947 251 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541531.[MT7]-DLAEDLYDGQVLQK[MT7].3y3_1.heavy 632.338 / 532.357 76399.0 36.53850173950195 43 13 10 10 10 1.2494428502794617 48.202273004266026 0.0 3 0.9259767768543853 4.507775385180506 76399.0 167.2115058351025 0.0 - - - - - - - 355.8 152 5 PARVA parvin, alpha 1949 251 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541531.[MT7]-DLAEDLYDGQVLQK[MT7].3b6_1.heavy 632.338 / 801.411 44772.0 36.53850173950195 43 13 10 10 10 1.2494428502794617 48.202273004266026 0.0 3 0.9259767768543853 4.507775385180506 44772.0 89.32187404928507 0.0 - - - - - - - 240.21428571428572 89 14 PARVA parvin, alpha 1951 251 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541531.[MT7]-DLAEDLYDGQVLQK[MT7].3b4_1.heavy 632.338 / 573.3 14430.0 36.53850173950195 43 13 10 10 10 1.2494428502794617 48.202273004266026 0.0 3 0.9259767768543853 4.507775385180506 14430.0 35.02864249578415 0.0 - - - - - - - 283.4 28 15 PARVA parvin, alpha 1953 251 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541531.[MT7]-DLAEDLYDGQVLQK[MT7].3b5_1.heavy 632.338 / 688.327 75411.0 36.53850173950195 43 13 10 10 10 1.2494428502794617 48.202273004266026 0.0 3 0.9259767768543853 4.507775385180506 75411.0 267.06693581179206 0.0 - - - - - - - 304.9166666666667 150 12 PARVA parvin, alpha 1955 252 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55836.[MT7]-DQFNVLIK[MT7].2b3_1.heavy 632.879 / 535.263 4436.0 39.445701599121094 42 12 10 10 10 1.1884435695263758 65.90592563189466 0.0 3 0.8812536389071142 3.5453400415839424 4436.0 17.611910669975185 0.0 - - - - - - - 266.15 8 20 NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 1957 252 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55836.[MT7]-DQFNVLIK[MT7].2b4_1.heavy 632.879 / 649.306 5162.0 39.445701599121094 42 12 10 10 10 1.1884435695263758 65.90592563189466 0.0 3 0.8812536389071142 3.5453400415839424 5162.0 13.32602747753834 0.0 - - - - - - - 233.05555555555554 10 18 NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 1959 252 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55836.[MT7]-DQFNVLIK[MT7].2y3_1.heavy 632.879 / 517.383 1855.0 39.445701599121094 42 12 10 10 10 1.1884435695263758 65.90592563189466 0.0 3 0.8812536389071142 3.5453400415839424 1855.0 0.6132231404958678 1.0 - - - - - - - 715.875 3 8 NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 1961 252 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55836.[MT7]-DQFNVLIK[MT7].2b5_1.heavy 632.879 / 748.375 645.0 39.445701599121094 42 12 10 10 10 1.1884435695263758 65.90592563189466 0.0 3 0.8812536389071142 3.5453400415839424 645.0 1.6676321394848372 5.0 - - - - - - - 0.0 1 0 NPAS2;CLOCK neuronal PAS domain protein 2;clock homolog (mouse) 1963 253 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537206.[MT7]-IFLLK[MT7].2b3_1.heavy 461.322 / 518.346 3072.0 38.01259994506836 46 20 10 6 10 4.003254468195054 24.9796761096446 0.037200927734375 3 0.9932746854003497 15.040503306268006 3072.0 10.506666666666666 0.0 - - - - - - - 270.0 6 16 PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 1965 253 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537206.[MT7]-IFLLK[MT7].2y4_1.heavy 461.322 / 664.451 15842.0 38.01259994506836 46 20 10 6 10 4.003254468195054 24.9796761096446 0.037200927734375 3 0.9932746854003497 15.040503306268006 15842.0 44.14307291666667 0.0 - - - - - - - 288.0 31 14 PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 1967 253 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537206.[MT7]-IFLLK[MT7].2b4_1.heavy 461.322 / 631.43 768.0 38.01259994506836 46 20 10 6 10 4.003254468195054 24.9796761096446 0.037200927734375 3 0.9932746854003497 15.040503306268006 768.0 5.6 7.0 - - - - - - - 204.8 3 15 PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 1969 253 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537206.[MT7]-IFLLK[MT7].2y3_1.heavy 461.322 / 517.383 6913.0 38.01259994506836 46 20 10 6 10 4.003254468195054 24.9796761096446 0.037200927734375 3 0.9932746854003497 15.040503306268006 6913.0 10.539024522569443 0.0 - - - - - - - 272.0 13 12 PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 1971 254 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55937.[MT7]-EAMVESIEYR.2y8_1.heavy 685.841 / 1026.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1973 254 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55937.[MT7]-EAMVESIEYR.2y5_1.heavy 685.841 / 667.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1975 254 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55937.[MT7]-EAMVESIEYR.2y9_1.heavy 685.841 / 1097.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1977 254 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55937.[MT7]-EAMVESIEYR.2b5_1.heavy 685.841 / 704.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1979 255 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55935.[MT7]-RYVESLWK[MT7].2y4_1.heavy 684.898 / 677.41 1535.0 33.776798248291016 40 10 10 10 10 0.769714196291133 79.62598255492475 0.0 3 0.8208089208316326 2.870746257128212 1535.0 1.4820220074904102 1.0 - - - - - - - 252.5 3 10 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1981 255 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55935.[MT7]-RYVESLWK[MT7].2b4_1.heavy 684.898 / 692.385 3509.0 33.776798248291016 40 10 10 10 10 0.769714196291133 79.62598255492475 0.0 3 0.8208089208316326 2.870746257128212 3509.0 9.41088218001908 0.0 - - - - - - - 219.55555555555554 7 9 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1983 255 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55935.[MT7]-RYVESLWK[MT7].2b7_1.heavy 684.898 / 1078.58 N/A 33.776798248291016 40 10 10 10 10 0.769714196291133 79.62598255492475 0.0 3 0.8208089208316326 2.870746257128212 0.0 0.0 20.0 - - - - - - - 0.0 0 0 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1985 255 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55935.[MT7]-RYVESLWK[MT7].2b5_1.heavy 684.898 / 779.417 768.0 33.776798248291016 40 10 10 10 10 0.769714196291133 79.62598255492475 0.0 3 0.8208089208316326 2.870746257128212 768.0 7.255128334439283 6.0 - - - - - - - 0.0 1 0 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 1987 256 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55830.[MT7]-EDNIEAVGK[MT7].2y4_1.heavy 631.845 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1989 256 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55830.[MT7]-EDNIEAVGK[MT7].2b3_1.heavy 631.845 / 503.222 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1991 256 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55830.[MT7]-EDNIEAVGK[MT7].2b6_1.heavy 631.845 / 816.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1993 256 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55830.[MT7]-EDNIEAVGK[MT7].2b5_1.heavy 631.845 / 745.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) 1995 257 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB536872.[MT7]-AATVVAR.2y5_1.heavy 416.262 / 545.341 5778.0 17.527000427246094 42 20 6 10 6 3.353838714656388 23.012389695616978 0.0 5 0.9923412582554785 14.09308554285803 5778.0 32.1 0.0 - - - - - - - 197.46153846153845 11 26 PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 1997 257 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB536872.[MT7]-AATVVAR.2b4_1.heavy 416.262 / 487.3 6492.0 17.527000427246094 42 20 6 10 6 3.353838714656388 23.012389695616978 0.0 5 0.9923412582554785 14.09308554285803 6492.0 18.91052036199095 1.0 - - - - - - - 287.45454545454544 19 22 PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 1999 257 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB536872.[MT7]-AATVVAR.2y6_1.heavy 416.262 / 616.378 17367.0 17.527000427246094 42 20 6 10 6 3.353838714656388 23.012389695616978 0.0 5 0.9923412582554785 14.09308554285803 17367.0 48.14234558823529 0.0 - - - - - - - 187.0 34 18 PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 2001 257 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB536872.[MT7]-AATVVAR.2b5_1.heavy 416.262 / 586.368 6627.0 17.527000427246094 42 20 6 10 6 3.353838714656388 23.012389695616978 0.0 5 0.9923412582554785 14.09308554285803 6627.0 12.697495169377522 2.0 - - - - - - - 267.14285714285717 52 14 PRKAR1A;PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1);protein kinase, cAMP-dependent, regulatory, type I, beta 2003 258 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537484.[MT7]-TLQEAK[MT7].2y4_1.heavy 489.297 / 619.353 5011.0 18.21660041809082 50 20 10 10 10 3.6817328832927996 21.59277421482778 0.0 3 0.991302801504537 13.223834751231653 5011.0 15.986363376796422 0.0 - - - - - - - 204.43478260869566 10 23 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 2005 258 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537484.[MT7]-TLQEAK[MT7].2y5_1.heavy 489.297 / 732.437 7534.0 18.21660041809082 50 20 10 10 10 3.6817328832927996 21.59277421482778 0.0 3 0.991302801504537 13.223834751231653 7534.0 40.5170200023955 0.0 - - - - - - - 191.5 15 26 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 2007 258 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537484.[MT7]-TLQEAK[MT7].2b4_1.heavy 489.297 / 616.342 3145.0 18.21660041809082 50 20 10 10 10 3.6817328832927996 21.59277421482778 0.0 3 0.991302801504537 13.223834751231653 3145.0 13.318614634776154 0.0 - - - - - - - 204.78571428571428 6 28 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 2009 258 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB537484.[MT7]-TLQEAK[MT7].2y3_1.heavy 489.297 / 491.295 4838.0 18.21660041809082 50 20 10 10 10 3.6817328832927996 21.59277421482778 0.0 3 0.991302801504537 13.223834751231653 4838.0 7.292911815009919 0.0 - - - - - - - 219.8181818181818 9 22 NTRK2 neurotrophic tyrosine kinase, receptor, type 2 2011 259 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57233.[MT7]-IVVQGEPGDDFYIITEGTASVLQR.3b6_1.heavy 917.816 / 770.453 51663.0 45.12295150756836 41 16 10 5 10 4.057016765881792 24.648653375299773 0.04109954833984375 3 0.9606470001263135 6.20067296966889 51663.0 96.96529895468561 0.0 - - - - - - - 251.5 103 6 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 2013 259 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57233.[MT7]-IVVQGEPGDDFYIITEGTASVLQR.3b4_1.heavy 917.816 / 584.389 14276.0 45.12295150756836 41 16 10 5 10 4.057016765881792 24.648653375299773 0.04109954833984375 3 0.9606470001263135 6.20067296966889 14276.0 45.53551724137931 0.0 - - - - - - - 341.0 28 12 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 2015 259 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57233.[MT7]-IVVQGEPGDDFYIITEGTASVLQR.3y5_1.heavy 917.816 / 602.362 16054.0 45.12295150756836 41 16 10 5 10 4.057016765881792 24.648653375299773 0.04109954833984375 3 0.9606470001263135 6.20067296966889 16054.0 80.68650368689734 0.0 - - - - - - - 276.125 32 8 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 2017 259 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB57233.[MT7]-IVVQGEPGDDFYIITEGTASVLQR.3y10_1.heavy 917.816 / 1061.56 19933.0 45.12295150756836 41 16 10 5 10 4.057016765881792 24.648653375299773 0.04109954833984375 3 0.9606470001263135 6.20067296966889 19933.0 129.17501558379286 0.0 - - - - - - - 244.3846153846154 39 13 PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta 2019 260 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55449.[MT7]-LFTLK[MT7].2b3_1.heavy 455.304 / 506.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100288728;ARL6IP1;PRPF38B similar to hCG2045522;ADP-ribosylation factor-like 6 interacting protein 1;PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 2021 260 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55449.[MT7]-LFTLK[MT7].2y4_1.heavy 455.304 / 652.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100288728;ARL6IP1;PRPF38B similar to hCG2045522;ADP-ribosylation factor-like 6 interacting protein 1;PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 2023 260 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55449.[MT7]-LFTLK[MT7].2y3_1.heavy 455.304 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100288728;ARL6IP1;PRPF38B similar to hCG2045522;ADP-ribosylation factor-like 6 interacting protein 1;PRP38 pre-mRNA processing factor 38 (yeast) domain containing B 2025 261 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56253.[MT7]-RAALSEMVEYITHNR.3y7_1.heavy 645.339 / 932.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 2027 261 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56253.[MT7]-RAALSEMVEYITHNR.3b6_1.heavy 645.339 / 772.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 2029 261 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56253.[MT7]-RAALSEMVEYITHNR.3y4_1.heavy 645.339 / 527.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 2031 261 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB56253.[MT7]-RAALSEMVEYITHNR.3y5_1.heavy 645.339 / 640.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP2R5C protein phosphatase 2, regulatory subunit B', gamma 2033 262 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541348.[MT7]-NVSHNPLLLLTPQK[MT7].3y6_1.heavy 621.375 / 843.542 1414.0 36.294934590657554 45 20 10 5 10 21.17681680517216 4.722145019244644 0.0410003662109375 3 0.9993687770783131 49.1188445218852 1414.0 0.9333333333333333 1.0 - - - - - - - 288.57142857142856 2 14 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 2035 262 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541348.[MT7]-NVSHNPLLLLTPQK[MT7].3y3_1.heavy 621.375 / 516.326 12624.0 36.294934590657554 45 20 10 5 10 21.17681680517216 4.722145019244644 0.0410003662109375 3 0.9993687770783131 49.1188445218852 12624.0 15.71750495049505 0.0 - - - - - - - 168.33333333333334 25 3 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 2037 262 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541348.[MT7]-NVSHNPLLLLTPQK[MT7].3b5_1.heavy 621.375 / 696.354 4545.0 36.294934590657554 45 20 10 5 10 21.17681680517216 4.722145019244644 0.0410003662109375 3 0.9993687770783131 49.1188445218852 4545.0 13.004999999999999 0.0 - - - - - - - 678.1428571428571 9 7 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 2039 262 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541348.[MT7]-NVSHNPLLLLTPQK[MT7].3y4_1.heavy 621.375 / 617.374 N/A 36.294934590657554 45 20 10 5 10 21.17681680517216 4.722145019244644 0.0410003662109375 3 0.9993687770783131 49.1188445218852 4646.0 12.288571428571426 0.0 - - - - - - - 757.5 9 8 PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) 2041 263 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55636.[MT7]-ALDLLDK[MT7].2y4_1.heavy 538.334 / 632.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK1 mitogen-activated protein kinase 1 2043 263 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55636.[MT7]-ALDLLDK[MT7].2b4_1.heavy 538.334 / 557.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK1 mitogen-activated protein kinase 1 2045 263 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55636.[MT7]-ALDLLDK[MT7].2b6_1.heavy 538.334 / 785.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK1 mitogen-activated protein kinase 1 2047 263 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB55636.[MT7]-ALDLLDK[MT7].2y3_1.heavy 538.334 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK1 mitogen-activated protein kinase 1 2049 264 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541534.[MT7]-EVFISGSFNNWSTK[MT7].3b4_1.heavy 635.331 / 633.373 5069.0 36.90230178833008 50 20 10 10 10 23.222197268523125 4.3062247229958075 0.0 3 0.9961940883945539 19.998396944210644 5069.0 7.906061974969525 1.0 - - - - - - - 696.7142857142857 10 7 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 2051 264 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541534.[MT7]-EVFISGSFNNWSTK[MT7].3b5_1.heavy 635.331 / 720.405 1148.0 36.90230178833008 50 20 10 10 10 23.222197268523125 4.3062247229958075 0.0 3 0.9961940883945539 19.998396944210644 1148.0 2.3942541495975793 4.0 - - - - - - - 737.7142857142857 3 7 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 2053 264 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541534.[MT7]-EVFISGSFNNWSTK[MT7].3y4_1.heavy 635.331 / 665.374 3825.0 36.90230178833008 50 20 10 10 10 23.222197268523125 4.3062247229958075 0.0 3 0.9961940883945539 19.998396944210644 3825.0 9.819449305566604 0.0 - - - - - - - 350.6666666666667 7 9 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 2055 264 B20140228_KEGG1700_set10_03 B20140228_KEGG1700_set10_03 TB541534.[MT7]-EVFISGSFNNWSTK[MT7].3b3_1.heavy 635.331 / 520.289 9563.0 36.90230178833008 50 20 10 10 10 23.222197268523125 4.3062247229958075 0.0 3 0.9961940883945539 19.998396944210644 9563.0 11.672710890987236 0.0 - - - - - - - 751.2857142857143 19 7 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit