Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140404_SF100_02 B20140404_SF100_02 TB344821.[MT7]-GVVFNVTTVDLK[MT7].2y9_1.heavy 790.469 / 1180.67 14677.0 34.543399810791016 44 14 10 10 10 1.1245576974998814 54.20473832244364 0.0 3 0.9302632798558182 4.645953432408908 14677.0 107.86142289749085 0.0 - - - - - - - 282.8333333333333 29 12 CLIC5 chloride intracellular channel 5 3 1 B20140404_SF100_02 B20140404_SF100_02 TB344821.[MT7]-GVVFNVTTVDLK[MT7].2b6_1.heavy 790.469 / 760.447 22402.0 34.543399810791016 44 14 10 10 10 1.1245576974998814 54.20473832244364 0.0 3 0.9302632798558182 4.645953432408908 22402.0 15.677775080906148 0.0 - - - - - - - 1216.5 44 8 CLIC5 chloride intracellular channel 5 5 1 B20140404_SF100_02 B20140404_SF100_02 TB344821.[MT7]-GVVFNVTTVDLK[MT7].2y6_1.heavy 790.469 / 820.49 22866.0 34.543399810791016 44 14 10 10 10 1.1245576974998814 54.20473832244364 0.0 3 0.9302632798558182 4.645953432408908 22866.0 40.54203936332799 0.0 - - - - - - - 733.75 45 8 CLIC5 chloride intracellular channel 5 7 1 B20140404_SF100_02 B20140404_SF100_02 TB344821.[MT7]-GVVFNVTTVDLK[MT7].2b5_1.heavy 790.469 / 661.379 18076.0 34.543399810791016 44 14 10 10 10 1.1245576974998814 54.20473832244364 0.0 3 0.9302632798558182 4.645953432408908 18076.0 19.76347412177094 0.0 - - - - - - - 772.375 36 8 CLIC5 chloride intracellular channel 5 9 2 B20140404_SF100_02 B20140404_SF100_02 TB154266.[MT7]-GAWALTLR.2y5_1.heavy 516.31 / 573.372 8661.0 33.63850021362305 34 18 0 10 6 3.545368835320509 28.205810070804606 0.0 6 0.981730604663934 9.116683243695181 8661.0 5.219825436408978 2.0 - - - - - - - 722.0 145 4 SLC25A45 solute carrier family 25, member 45 11 2 B20140404_SF100_02 B20140404_SF100_02 TB154266.[MT7]-GAWALTLR.2b4_1.heavy 516.31 / 530.284 11869.0 33.63850021362305 34 18 0 10 6 3.545368835320509 28.205810070804606 0.0 6 0.981730604663934 9.116683243695181 11869.0 9.248917385108657 0.0 - - - - - - - 1810.2857142857142 23 7 SLC25A45 solute carrier family 25, member 45 13 2 B20140404_SF100_02 B20140404_SF100_02 TB154266.[MT7]-GAWALTLR.2y6_1.heavy 516.31 / 759.451 7699.0 33.63850021362305 34 18 0 10 6 3.545368835320509 28.205810070804606 0.0 6 0.981730604663934 9.116683243695181 7699.0 13.78432045512188 2.0 - - - - - - - 824.8571428571429 28 7 SLC25A45 solute carrier family 25, member 45 15 2 B20140404_SF100_02 B20140404_SF100_02 TB154266.[MT7]-GAWALTLR.2b5_1.heavy 516.31 / 643.368 7859.0 33.63850021362305 34 18 0 10 6 3.545368835320509 28.205810070804606 0.0 6 0.981730604663934 9.116683243695181 7859.0 6.667582724754469 3.0 - - - - - - - 320.5 27 2 SLC25A45 solute carrier family 25, member 45 17 3 B20140404_SF100_02 B20140404_SF100_02 TB154414.[MT7]-VAQGIVSYGR.2y8_1.heavy 597.342 / 879.468 34707.0 27.4689998626709 50 20 10 10 10 14.661782867427018 6.820452935649627 0.0 3 0.9958967767331743 19.25977383611941 34707.0 70.84647358259717 0.0 - - - - - - - 667.2857142857143 69 7 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 19 3 B20140404_SF100_02 B20140404_SF100_02 TB154414.[MT7]-VAQGIVSYGR.2b4_1.heavy 597.342 / 500.295 26431.0 27.4689998626709 50 20 10 10 10 14.661782867427018 6.820452935649627 0.0 3 0.9958967767331743 19.25977383611941 26431.0 19.27210435307167 0.0 - - - - - - - 734.0 52 4 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 21 3 B20140404_SF100_02 B20140404_SF100_02 TB154414.[MT7]-VAQGIVSYGR.2y9_1.heavy 597.342 / 950.505 126813.0 27.4689998626709 50 20 10 10 10 14.661782867427018 6.820452935649627 0.0 3 0.9958967767331743 19.25977383611941 126813.0 68.50033844465199 0.0 - - - - - - - 266.6666666666667 253 3 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 23 3 B20140404_SF100_02 B20140404_SF100_02 TB154414.[MT7]-VAQGIVSYGR.2y7_1.heavy 597.342 / 751.41 66610.0 27.4689998626709 50 20 10 10 10 14.661782867427018 6.820452935649627 0.0 3 0.9958967767331743 19.25977383611941 66610.0 88.36030799633454 0.0 - - - - - - - 734.0 133 8 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 25 4 B20140404_SF100_02 B20140404_SF100_02 TB154417.[MT7]-NLLSVAYK[MT7].3y3_1.heavy 399.248 / 525.315 451347.0 31.58650016784668 48 18 10 10 10 5.373632726025899 18.60938495399472 0.0 3 0.987017772035347 10.819739122240021 451347.0 99.66343155513997 0.0 - - - - - - - 668.0 902 2 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 27 4 B20140404_SF100_02 B20140404_SF100_02 TB154417.[MT7]-NLLSVAYK[MT7].3b4_1.heavy 399.248 / 572.352 287767.0 31.58650016784668 48 18 10 10 10 5.373632726025899 18.60938495399472 0.0 3 0.987017772035347 10.819739122240021 287767.0 114.41479968255652 0.0 - - - - - - - 334.0 575 1 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 29 4 B20140404_SF100_02 B20140404_SF100_02 TB154417.[MT7]-NLLSVAYK[MT7].3y4_1.heavy 399.248 / 624.384 43232.0 31.58650016784668 48 18 10 10 10 5.373632726025899 18.60938495399472 0.0 3 0.987017772035347 10.819739122240021 43232.0 104.41261477045907 0.0 - - - - - - - 167.0 86 6 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 31 4 B20140404_SF100_02 B20140404_SF100_02 TB154417.[MT7]-NLLSVAYK[MT7].3b3_1.heavy 399.248 / 485.32 261060.0 31.58650016784668 48 18 10 10 10 5.373632726025899 18.60938495399472 0.0 3 0.987017772035347 10.819739122240021 261060.0 460.39547412025263 0.0 - - - - - - - 334.0 522 1 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 33 5 B20140404_SF100_02 B20140404_SF100_02 TB154557.[MT7]-GFEDGIVQLK[MT7].3y3_1.heavy 465.269 / 532.357 151940.0 32.496498107910156 48 18 10 10 10 3.5141252223485053 28.456584120576544 0.0 3 0.9812737161324437 9.004435735869937 151940.0 69.51374568368425 0.0 - - - - - - - 664.0 303 1 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 35 5 B20140404_SF100_02 B20140404_SF100_02 TB154557.[MT7]-GFEDGIVQLK[MT7].3b6_1.heavy 465.269 / 763.374 161239.0 32.496498107910156 48 18 10 10 10 3.5141252223485053 28.456584120576544 0.0 3 0.9812737161324437 9.004435735869937 161239.0 111.88126703634387 0.0 - - - - - - - 387.3333333333333 322 3 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 37 5 B20140404_SF100_02 B20140404_SF100_02 TB154557.[MT7]-GFEDGIVQLK[MT7].3b4_1.heavy 465.269 / 593.269 98968.0 32.496498107910156 48 18 10 10 10 3.5141252223485053 28.456584120576544 0.0 3 0.9812737161324437 9.004435735869937 98968.0 38.76791136943831 0.0 - - - - - - - 332.0 197 1 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 39 5 B20140404_SF100_02 B20140404_SF100_02 TB154557.[MT7]-GFEDGIVQLK[MT7].3b5_1.heavy 465.269 / 650.29 416464.0 32.496498107910156 48 18 10 10 10 3.5141252223485053 28.456584120576544 0.0 3 0.9812737161324437 9.004435735869937 416464.0 194.24835007483372 0.0 - - - - - - - 1328.0 832 1 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 41 6 B20140404_SF100_02 B20140404_SF100_02 TB154418.[MT7]-EDGSVDFQR.2y8_1.heavy 598.787 / 923.422 10316.0 24.010350227355957 47 20 10 7 10 9.039342965388919 11.062750952463444 0.026700973510742188 3 0.99244373420558 14.188448454009057 10316.0 20.101767651067373 0.0 - - - - - - - 673.25 20 12 ANGPT2 angiopoietin 2 43 6 B20140404_SF100_02 B20140404_SF100_02 TB154418.[MT7]-EDGSVDFQR.2b4_1.heavy 598.787 / 533.232 3679.0 24.010350227355957 47 20 10 7 10 9.039342965388919 11.062750952463444 0.026700973510742188 3 0.99244373420558 14.188448454009057 3679.0 1.9014854533952243 2.0 - - - - - - - 1209.7692307692307 25 13 ANGPT2 angiopoietin 2 45 6 B20140404_SF100_02 B20140404_SF100_02 TB154418.[MT7]-EDGSVDFQR.2b6_1.heavy 598.787 / 747.328 18035.0 24.010350227355957 47 20 10 7 10 9.039342965388919 11.062750952463444 0.026700973510742188 3 0.99244373420558 14.188448454009057 18035.0 18.148619331375972 1.0 - - - - - - - 1082.0 36 7 ANGPT2 angiopoietin 2 47 6 B20140404_SF100_02 B20140404_SF100_02 TB154418.[MT7]-EDGSVDFQR.2y7_1.heavy 598.787 / 808.395 13202.0 24.010350227355957 47 20 10 7 10 9.039342965388919 11.062750952463444 0.026700973510742188 3 0.99244373420558 14.188448454009057 13202.0 10.205933935176802 0.0 - - - - - - - 1133.5714285714287 26 7 ANGPT2 angiopoietin 2 49 7 B20140404_SF100_02 B20140404_SF100_02 TB154419.[MT7]-QEGLGVFFR.2b3_1.heavy 598.831 / 459.232 2476.0 35.71032524108887 27 18 0 5 4 5.567350639367224 17.961864893669752 0.04630279541015625 9 0.9888169181243258 11.659396079487394 2476.0 2.36479723202049 21.0 - - - - - - - 1262.3333333333333 10 9 SLC25A45 solute carrier family 25, member 45 51 7 B20140404_SF100_02 B20140404_SF100_02 TB154419.[MT7]-QEGLGVFFR.2y8_1.heavy 598.831 / 924.494 7283.0 35.71032524108887 27 18 0 5 4 5.567350639367224 17.961864893669752 0.04630279541015625 9 0.9888169181243258 11.659396079487394 7283.0 22.29642272350291 0.0 - - - - - - - 278.09090909090907 14 11 SLC25A45 solute carrier family 25, member 45 53 7 B20140404_SF100_02 B20140404_SF100_02 TB154419.[MT7]-QEGLGVFFR.2b6_1.heavy 598.831 / 728.406 3641.0 35.71032524108887 27 18 0 5 4 5.567350639367224 17.961864893669752 0.04630279541015625 9 0.9888169181243258 11.659396079487394 3641.0 2.2995423340961096 4.0 - - - - - - - 400.5 14 4 SLC25A45 solute carrier family 25, member 45 55 7 B20140404_SF100_02 B20140404_SF100_02 TB154419.[MT7]-QEGLGVFFR.2y7_1.heavy 598.831 / 795.451 4515.0 35.71032524108887 27 18 0 5 4 5.567350639367224 17.961864893669752 0.04630279541015625 9 0.9888169181243258 11.659396079487394 4515.0 8.087194155958457 6.0 - - - - - - - 1147.25 59 8 SLC25A45 solute carrier family 25, member 45 57 8 B20140404_SF100_02 B20140404_SF100_02 TB154369.[MT7]-EAPEAPAVGR.2y8_1.heavy 570.81 / 796.431 33211.0 22.49650001525879 46 20 10 6 10 9.482597702665046 10.545633499973894 0.033599853515625 3 0.9916114071166123 13.465229182783288 33211.0 163.8458469651955 0.0 - - - - - - - 257.55555555555554 66 18 IQSEC3 IQ motif and Sec7 domain 3 59 8 B20140404_SF100_02 B20140404_SF100_02 TB154369.[MT7]-EAPEAPAVGR.2y9_1.heavy 570.81 / 867.468 25573.0 22.49650001525879 46 20 10 6 10 9.482597702665046 10.545633499973894 0.033599853515625 3 0.9916114071166123 13.465229182783288 25573.0 70.90164413168623 0.0 - - - - - - - 633.5714285714286 51 7 IQSEC3 IQ motif and Sec7 domain 3 61 8 B20140404_SF100_02 B20140404_SF100_02 TB154369.[MT7]-EAPEAPAVGR.2b5_1.heavy 570.81 / 642.321 6888.0 22.49650001525879 46 20 10 6 10 9.482597702665046 10.545633499973894 0.033599853515625 3 0.9916114071166123 13.465229182783288 6888.0 15.671196572717022 0.0 - - - - - - - 290.63157894736844 13 19 IQSEC3 IQ motif and Sec7 domain 3 63 8 B20140404_SF100_02 B20140404_SF100_02 TB154369.[MT7]-EAPEAPAVGR.2y7_1.heavy 570.81 / 699.378 3546.0 22.49650001525879 46 20 10 6 10 9.482597702665046 10.545633499973894 0.033599853515625 3 0.9916114071166123 13.465229182783288 3546.0 8.088166099886113 0.0 - - - - - - - 305.0 7 19 IQSEC3 IQ motif and Sec7 domain 3 65 9 B20140404_SF100_02 B20140404_SF100_02 TB501639.[MT7]-SHVEC[CAM]AR.2y4_1.heavy 501.749 / 535.229 2914.0 16.81719970703125 48 18 10 10 10 4.628387105781123 21.60579867554601 0.0 3 0.9864464938241073 10.588752556287 2914.0 19.84 0.0 - - - - - - - 122.19047619047619 5 21 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 67 9 B20140404_SF100_02 B20140404_SF100_02 TB501639.[MT7]-SHVEC[CAM]AR.2y5_1.heavy 501.749 / 634.298 2914.0 16.81719970703125 48 18 10 10 10 4.628387105781123 21.60579867554601 0.0 3 0.9864464938241073 10.588752556287 2914.0 74.81333333333333 0.0 - - - - - - - 83.29411764705883 5 17 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 69 9 B20140404_SF100_02 B20140404_SF100_02 TB501639.[MT7]-SHVEC[CAM]AR.2b4_1.heavy 501.749 / 597.311 729.0 16.81719970703125 48 18 10 10 10 4.628387105781123 21.60579867554601 0.0 3 0.9864464938241073 10.588752556287 729.0 11.236011539848539 0.0 - - - - - - - 0.0 1 0 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 71 9 B20140404_SF100_02 B20140404_SF100_02 TB501639.[MT7]-SHVEC[CAM]AR.2y6_1.heavy 501.749 / 771.357 3361.0 16.81719970703125 48 18 10 10 10 4.628387105781123 21.60579867554601 0.0 3 0.9864464938241073 10.588752556287 3361.0 41.076195456184635 0.0 - - - - - - - 89.875 6 16 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 73 10 B20140404_SF100_02 B20140404_SF100_02 TB154751.[MT7]-DSSQILSASFDQTIR.2y9_1.heavy 906.466 / 1024.51 18805.0 32.98379898071289 43 13 10 10 10 0.9329540237380067 63.9178257663375 0.0 3 0.9058797292340036 3.9907462009572208 18805.0 96.61284403669725 0.0 - - - - - - - 280.57142857142856 37 7 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 75 10 B20140404_SF100_02 B20140404_SF100_02 TB154751.[MT7]-DSSQILSASFDQTIR.2b4_1.heavy 906.466 / 562.259 20931.0 32.98379898071289 43 13 10 10 10 0.9329540237380067 63.9178257663375 0.0 3 0.9058797292340036 3.9907462009572208 20931.0 37.26391896099235 0.0 - - - - - - - 409.125 41 8 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 77 10 B20140404_SF100_02 B20140404_SF100_02 TB154751.[MT7]-DSSQILSASFDQTIR.2y10_1.heavy 906.466 / 1137.59 14553.0 32.98379898071289 43 13 10 10 10 0.9329540237380067 63.9178257663375 0.0 3 0.9058797292340036 3.9907462009572208 14553.0 108.32525061535017 0.0 - - - - - - - 294.6 29 10 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 79 10 B20140404_SF100_02 B20140404_SF100_02 TB154751.[MT7]-DSSQILSASFDQTIR.2b5_1.heavy 906.466 / 675.343 26327.0 32.98379898071289 43 13 10 10 10 0.9329540237380067 63.9178257663375 0.0 3 0.9058797292340036 3.9907462009572208 26327.0 28.581299694189603 0.0 - - - - - - - 368.25 52 8 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 81 11 B20140404_SF100_02 B20140404_SF100_02 TB154260.[MT7]-NPYTIK[MT7].2b3_1.heavy 512.307 / 519.268 7745.0 24.968074321746826 40 16 10 6 8 3.581767012151487 27.91918057783782 0.03289985656738281 4 0.9692899764436069 7.024324254218304 7745.0 7.015586469601115 2.0 - - - - - - - 1256.142857142857 42 7 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 83 11 B20140404_SF100_02 B20140404_SF100_02 TB154260.[MT7]-NPYTIK[MT7].2y4_1.heavy 512.307 / 668.41 8148.0 24.968074321746826 40 16 10 6 8 3.581767012151487 27.91918057783782 0.03289985656738281 4 0.9692899764436069 7.024324254218304 8148.0 6.492510457696158 1.0 - - - - - - - 1119.25 29 8 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 85 11 B20140404_SF100_02 B20140404_SF100_02 TB154260.[MT7]-NPYTIK[MT7].2y5_1.heavy 512.307 / 765.463 106977.0 24.968074321746826 40 16 10 6 8 3.581767012151487 27.91918057783782 0.03289985656738281 4 0.9692899764436069 7.024324254218304 106977.0 190.1334279312377 0.0 - - - - - - - 826.875 213 8 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 87 11 B20140404_SF100_02 B20140404_SF100_02 TB154260.[MT7]-NPYTIK[MT7].2y3_1.heavy 512.307 / 505.347 19040.0 24.968074321746826 40 16 10 6 8 3.581767012151487 27.91918057783782 0.03289985656738281 4 0.9692899764436069 7.024324254218304 19040.0 10.838030862648068 0.0 - - - - - - - 1290.8 38 5 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 89 12 B20140404_SF100_02 B20140404_SF100_02 TB501939.[MT7]-LTDVEAQVLNQTTR.2b4_1.heavy 866.471 / 573.336 62803.0 33.031700134277344 41 11 10 10 10 0.840122576163928 68.23671594481162 0.0 3 0.8580114181012244 3.2356211245263333 62803.0 111.06478642714569 0.0 - - - - - - - 691.8571428571429 125 7 ANGPT2 angiopoietin 2 91 12 B20140404_SF100_02 B20140404_SF100_02 TB501939.[MT7]-LTDVEAQVLNQTTR.2y9_1.heavy 866.471 / 1030.56 30566.0 33.031700134277344 41 11 10 10 10 0.840122576163928 68.23671594481162 0.0 3 0.8580114181012244 3.2356211245263333 30566.0 239.15912175648702 0.0 - - - - - - - 222.66666666666666 61 6 ANGPT2 angiopoietin 2 93 12 B20140404_SF100_02 B20140404_SF100_02 TB501939.[MT7]-LTDVEAQVLNQTTR.2y10_1.heavy 866.471 / 1159.61 28729.0 33.031700134277344 41 11 10 10 10 0.840122576163928 68.23671594481162 0.0 3 0.8580114181012244 3.2356211245263333 28729.0 122.14125748502994 0.0 - - - - - - - 250.5 57 10 ANGPT2 angiopoietin 2 95 12 B20140404_SF100_02 B20140404_SF100_02 TB501939.[MT7]-LTDVEAQVLNQTTR.2b5_1.heavy 866.471 / 702.379 44597.0 33.031700134277344 41 11 10 10 10 0.840122576163928 68.23671594481162 0.0 3 0.8580114181012244 3.2356211245263333 44597.0 64.75911676646706 0.0 - - - - - - - 200.4 89 5 ANGPT2 angiopoietin 2 97 13 B20140404_SF100_02 B20140404_SF100_02 TB501938.[MT7]-LVGVFHTEYGALNR.3y7_1.heavy 573.981 / 822.41 96979.0 32.546600341796875 48 18 10 10 10 3.618751342949169 21.97974962557768 0.0 3 0.989318475382484 11.930493552322902 96979.0 119.99878955978485 0.0 - - - - - - - 292.25 193 4 NIPSNAP3A nipsnap homolog 3A (C. elegans) 99 13 B20140404_SF100_02 B20140404_SF100_02 TB501938.[MT7]-LVGVFHTEYGALNR.3y6_1.heavy 573.981 / 693.368 167920.0 32.546600341796875 48 18 10 10 10 3.618751342949169 21.97974962557768 0.0 3 0.989318475382484 11.930493552322902 167920.0 141.96904912502634 0.0 - - - - - - - 1621.2857142857142 335 7 NIPSNAP3A nipsnap homolog 3A (C. elegans) 101 13 B20140404_SF100_02 B20140404_SF100_02 TB501938.[MT7]-LVGVFHTEYGALNR.3b4_1.heavy 573.981 / 513.352 214824.0 32.546600341796875 48 18 10 10 10 3.618751342949169 21.97974962557768 0.0 3 0.989318475382484 11.930493552322902 214824.0 60.41450363385732 0.0 - - - - - - - 1585.5 429 4 NIPSNAP3A nipsnap homolog 3A (C. elegans) 103 13 B20140404_SF100_02 B20140404_SF100_02 TB501938.[MT7]-LVGVFHTEYGALNR.3y8_1.heavy 573.981 / 923.458 126357.0 32.546600341796875 48 18 10 10 10 3.618751342949169 21.97974962557768 0.0 3 0.989318475382484 11.930493552322902 126357.0 143.85063665861136 0.0 - - - - - - - 267.2 252 5 NIPSNAP3A nipsnap homolog 3A (C. elegans) 105 14 B20140404_SF100_02 B20140404_SF100_02 TB154759.[MT7]-SIC[CAM]LLGSLQFHRK[MT7].4y5_1.heavy 462.52 / 859.502 8175.0 32.15810012817383 43 13 10 10 10 2.271311302517978 44.02743027304971 0.0 3 0.917028090438343 4.254487204517418 8175.0 44.056886227544915 0.0 - - - - - - - 250.5 16 6 RGS7BP regulator of G-protein signaling 7 binding protein 107 14 B20140404_SF100_02 B20140404_SF100_02 TB154759.[MT7]-SIC[CAM]LLGSLQFHRK[MT7].4b4_1.heavy 462.52 / 618.34 76741.0 32.15810012817383 43 13 10 10 10 2.271311302517978 44.02743027304971 0.0 3 0.917028090438343 4.254487204517418 76741.0 94.97510943217573 0.0 - - - - - - - 1048.7142857142858 153 7 RGS7BP regulator of G-protein signaling 7 binding protein 109 14 B20140404_SF100_02 B20140404_SF100_02 TB154759.[MT7]-SIC[CAM]LLGSLQFHRK[MT7].4y6_1.heavy 462.52 / 972.586 334.0 32.15810012817383 43 13 10 10 10 2.271311302517978 44.02743027304971 0.0 3 0.917028090438343 4.254487204517418 334.0 2.384 1.0 - - - - - - - 0.0 0 0 RGS7BP regulator of G-protein signaling 7 binding protein 111 14 B20140404_SF100_02 B20140404_SF100_02 TB154759.[MT7]-SIC[CAM]LLGSLQFHRK[MT7].4b3_1.heavy 462.52 / 505.256 115612.0 32.15810012817383 43 13 10 10 10 2.271311302517978 44.02743027304971 0.0 3 0.917028090438343 4.254487204517418 115612.0 50.87025246335015 0.0 - - - - - - - 167.0 231 1 RGS7BP regulator of G-protein signaling 7 binding protein 113 15 B20140404_SF100_02 B20140404_SF100_02 TB154612.[MT7]-LRETMPLPLK[MT7].3y3_1.heavy 495.974 / 501.352 187197.0 30.917400360107422 45 15 10 10 10 3.4035624485073948 29.380979932909472 0.0 3 0.9598883310309912 6.141359473263284 187197.0 143.41223803097486 0.0 - - - - - - - 499.0 374 1 RGS7BP regulator of G-protein signaling 7 binding protein 115 15 B20140404_SF100_02 B20140404_SF100_02 TB154612.[MT7]-LRETMPLPLK[MT7].3b4_1.heavy 495.974 / 644.385 8146.0 30.917400360107422 45 15 10 10 10 3.4035624485073948 29.380979932909472 0.0 3 0.9598883310309912 6.141359473263284 8146.0 16.175843052623577 0.0 - - - - - - - 867.8888888888889 16 9 RGS7BP regulator of G-protein signaling 7 binding protein 117 15 B20140404_SF100_02 B20140404_SF100_02 TB154612.[MT7]-LRETMPLPLK[MT7].3b5_1.heavy 495.974 / 775.425 69825.0 30.917400360107422 45 15 10 10 10 3.4035624485073948 29.380979932909472 0.0 3 0.9598883310309912 6.141359473263284 69825.0 71.95799899699097 0.0 - - - - - - - 360.1666666666667 139 6 RGS7BP regulator of G-protein signaling 7 binding protein 119 15 B20140404_SF100_02 B20140404_SF100_02 TB154612.[MT7]-LRETMPLPLK[MT7].3b7_1.heavy 495.974 / 985.562 831.0 30.917400360107422 45 15 10 10 10 3.4035624485073948 29.380979932909472 0.0 3 0.9598883310309912 6.141359473263284 831.0 1.5320416020009944 1.0 - - - - - - - 261.0 2 7 RGS7BP regulator of G-protein signaling 7 binding protein 121 16 B20140404_SF100_02 B20140404_SF100_02 TB154758.[MT7]-SIC[CAM]LLGSLQFHRK[MT7].3b10_2.heavy 616.357 / 632.348 6673.0 34.543399810791016 30 14 2 10 4 1.4968363971133127 44.53837894056761 0.0 9 0.9495705588052888 5.472403062421971 6673.0 4.0004796342728035 0.0 - - - - - - - 334.0 13 1 RGS7BP regulator of G-protein signaling 7 binding protein 123 16 B20140404_SF100_02 B20140404_SF100_02 TB154758.[MT7]-SIC[CAM]LLGSLQFHRK[MT7].3b3_1.heavy 616.357 / 505.256 5172.0 34.543399810791016 30 14 2 10 4 1.4968363971133127 44.53837894056761 0.0 9 0.9495705588052888 5.472403062421971 5172.0 2.8160066791721463 10.0 - - - - - - - 750.5 49 2 RGS7BP regulator of G-protein signaling 7 binding protein 125 16 B20140404_SF100_02 B20140404_SF100_02 TB154758.[MT7]-SIC[CAM]LLGSLQFHRK[MT7].3y5_1.heavy 616.357 / 859.502 8675.0 34.543399810791016 30 14 2 10 4 1.4968363971133127 44.53837894056761 0.0 9 0.9495705588052888 5.472403062421971 8675.0 16.3420807078978 1.0 - - - - - - - 687.875 22 8 RGS7BP regulator of G-protein signaling 7 binding protein 127 16 B20140404_SF100_02 B20140404_SF100_02 TB154758.[MT7]-SIC[CAM]LLGSLQFHRK[MT7].3y9_1.heavy 616.357 / 1229.72 N/A 34.543399810791016 30 14 2 10 4 1.4968363971133127 44.53837894056761 0.0 9 0.9495705588052888 5.472403062421971 0.0 0.0 24.0 - - - - - - - 0.0 1 0 RGS7BP regulator of G-protein signaling 7 binding protein 129 17 B20140404_SF100_02 B20140404_SF100_02 TB502100.[MT7]-APQLPTWWPLPTQVPAAEDYLTWK[MT7].3y3_1.heavy 1032.89 / 578.342 9271.0 42.79959964752197 46 20 10 6 10 17.08944082635779 5.851566532578739 0.037998199462890625 3 0.9974747832138652 24.55396333376347 9271.0 56.586528598680296 0.0 - - - - - - - 212.35294117647058 18 17 SPAG8 sperm associated antigen 8 131 17 B20140404_SF100_02 B20140404_SF100_02 TB502100.[MT7]-APQLPTWWPLPTQVPAAEDYLTWK[MT7].3b4_1.heavy 1032.89 / 554.342 21156.0 42.79959964752197 46 20 10 6 10 17.08944082635779 5.851566532578739 0.037998199462890625 3 0.9974747832138652 24.55396333376347 21156.0 66.04697304407979 0.0 - - - - - - - 293.42857142857144 42 14 SPAG8 sperm associated antigen 8 133 17 B20140404_SF100_02 B20140404_SF100_02 TB502100.[MT7]-APQLPTWWPLPTQVPAAEDYLTWK[MT7].3b8_1.heavy 1032.89 / 1124.6 5911.0 42.79959964752197 46 20 10 6 10 17.08944082635779 5.851566532578739 0.037998199462890625 3 0.9974747832138652 24.55396333376347 5911.0 48.7892667998196 0.0 - - - - - - - 160.75 11 12 SPAG8 sperm associated antigen 8 135 17 B20140404_SF100_02 B20140404_SF100_02 TB502100.[MT7]-APQLPTWWPLPTQVPAAEDYLTWK[MT7].3y5_1.heavy 1032.89 / 854.489 4231.0 42.79959964752197 46 20 10 6 10 17.08944082635779 5.851566532578739 0.037998199462890625 3 0.9974747832138652 24.55396333376347 4231.0 13.98450019149751 0.0 - - - - - - - 194.0 8 17 SPAG8 sperm associated antigen 8 137 18 B20140404_SF100_02 B20140404_SF100_02 TB154262.[MT7]-NSFLEK[MT7].2y4_1.heavy 513.297 / 680.41 9114.0 27.198200225830078 48 18 10 10 10 6.078851081935555 16.45047701483735 0.0 3 0.9880548728906754 11.280639579804628 9114.0 14.494796571311252 0.0 - - - - - - - 766.8571428571429 18 7 ANGPT2 angiopoietin 2 139 18 B20140404_SF100_02 B20140404_SF100_02 TB154262.[MT7]-NSFLEK[MT7].2y5_1.heavy 513.297 / 767.442 25219.0 27.198200225830078 48 18 10 10 10 6.078851081935555 16.45047701483735 0.0 3 0.9880548728906754 11.280639579804628 25219.0 101.02835276887872 0.0 - - - - - - - 321.14285714285717 50 7 ANGPT2 angiopoietin 2 141 18 B20140404_SF100_02 B20140404_SF100_02 TB154262.[MT7]-NSFLEK[MT7].2b4_1.heavy 513.297 / 606.337 8739.0 27.198200225830078 48 18 10 10 10 6.078851081935555 16.45047701483735 0.0 3 0.9880548728906754 11.280639579804628 8739.0 3.870523099814616 2.0 - - - - - - - 1248.4444444444443 41 9 ANGPT2 angiopoietin 2 143 18 B20140404_SF100_02 B20140404_SF100_02 TB154262.[MT7]-NSFLEK[MT7].2y3_1.heavy 513.297 / 533.341 14982.0 27.198200225830078 48 18 10 10 10 6.078851081935555 16.45047701483735 0.0 3 0.9880548728906754 11.280639579804628 14982.0 13.203846153846154 1.0 - - - - - - - 499.0 29 1 ANGPT2 angiopoietin 2 145 19 B20140404_SF100_02 B20140404_SF100_02 TB501935.[MT7]-NYDIPAEMTGLWR.2b3_1.heavy 855.426 / 537.242 53293.0 37.40119934082031 47 17 10 10 10 4.142108136855647 24.142295830043658 0.0 3 0.9775457978900864 8.220486968095356 53293.0 235.77332851471752 0.0 - - - - - - - 753.7142857142857 106 7 CLIC5 chloride intracellular channel 5 147 19 B20140404_SF100_02 B20140404_SF100_02 TB501935.[MT7]-NYDIPAEMTGLWR.2y9_1.heavy 855.426 / 1060.52 31000.0 37.40119934082031 47 17 10 10 10 4.142108136855647 24.142295830043658 0.0 3 0.9775457978900864 8.220486968095356 31000.0 86.25783840572572 0.0 - - - - - - - 678.5714285714286 62 7 CLIC5 chloride intracellular channel 5 149 19 B20140404_SF100_02 B20140404_SF100_02 TB501935.[MT7]-NYDIPAEMTGLWR.2y6_1.heavy 855.426 / 763.392 4485.0 37.40119934082031 47 17 10 10 10 4.142108136855647 24.142295830043658 0.0 3 0.9775457978900864 8.220486968095356 4485.0 6.111778022189238 1.0 - - - - - - - 670.6666666666666 8 12 CLIC5 chloride intracellular channel 5 151 19 B20140404_SF100_02 B20140404_SF100_02 TB501935.[MT7]-NYDIPAEMTGLWR.2y10_1.heavy 855.426 / 1173.61 9234.0 37.40119934082031 47 17 10 10 10 4.142108136855647 24.142295830043658 0.0 3 0.9775457978900864 8.220486968095356 9234.0 49.14306818181818 0.0 - - - - - - - 182.76923076923077 18 13 CLIC5 chloride intracellular channel 5 153 20 B20140404_SF100_02 B20140404_SF100_02 TB501534.[MT7]-NLVADR.2b3_1.heavy 416.244 / 471.305 56050.0 22.27199935913086 44 14 10 10 10 1.2658526839227429 51.40835624583112 0.0 3 0.9440723444264955 5.194023299279679 56050.0 69.17074093740588 1.0 - - - - - - - 1248.625 112 8 SPAG8 sperm associated antigen 8 155 20 B20140404_SF100_02 B20140404_SF100_02 TB501534.[MT7]-NLVADR.2y4_1.heavy 416.244 / 460.251 72014.0 22.27199935913086 44 14 10 10 10 1.2658526839227429 51.40835624583112 0.0 3 0.9440723444264955 5.194023299279679 72014.0 46.48544661104478 0.0 - - - - - - - 861.75 144 4 SPAG8 sperm associated antigen 8 157 20 B20140404_SF100_02 B20140404_SF100_02 TB501534.[MT7]-NLVADR.2y5_1.heavy 416.244 / 573.336 118993.0 22.27199935913086 44 14 10 10 10 1.2658526839227429 51.40835624583112 0.0 3 0.9440723444264955 5.194023299279679 118993.0 41.78307228586097 0.0 - - - - - - - 1266.0 237 1 SPAG8 sperm associated antigen 8 159 20 B20140404_SF100_02 B20140404_SF100_02 TB501534.[MT7]-NLVADR.2b5_1.heavy 416.244 / 657.369 98950.0 22.27199935913086 44 14 10 10 10 1.2658526839227429 51.40835624583112 0.0 3 0.9440723444264955 5.194023299279679 98950.0 27.21788480706078 1.0 - - - - - - - 422.0 197 1 SPAG8 sperm associated antigen 8 161 21 B20140404_SF100_02 B20140404_SF100_02 TB501941.[MT7]-ALMEGYGLVGLPLVR.3y7_1.heavy 578.003 / 753.498 60175.0 39.93069839477539 48 18 10 10 10 5.058238625937102 19.769727645356735 0.0 3 0.9857769668058914 10.33594433415065 60175.0 125.1605938341441 0.0 - - - - - - - 308.125 120 8 IQSEC3 IQ motif and Sec7 domain 3 163 21 B20140404_SF100_02 B20140404_SF100_02 TB501941.[MT7]-ALMEGYGLVGLPLVR.3y6_1.heavy 578.003 / 654.43 161016.0 39.93069839477539 48 18 10 10 10 5.058238625937102 19.769727645356735 0.0 3 0.9857769668058914 10.33594433415065 161016.0 544.9973376623376 0.0 - - - - - - - 205.33333333333334 322 3 IQSEC3 IQ motif and Sec7 domain 3 165 21 B20140404_SF100_02 B20140404_SF100_02 TB501941.[MT7]-ALMEGYGLVGLPLVR.3b4_1.heavy 578.003 / 589.314 30293.0 39.93069839477539 48 18 10 10 10 5.058238625937102 19.769727645356735 0.0 3 0.9857769668058914 10.33594433415065 30293.0 60.20792940047018 0.0 - - - - - - - 626.3 60 10 IQSEC3 IQ motif and Sec7 domain 3 167 21 B20140404_SF100_02 B20140404_SF100_02 TB501941.[MT7]-ALMEGYGLVGLPLVR.3b5_1.heavy 578.003 / 646.335 59149.0 39.93069839477539 48 18 10 10 10 5.058238625937102 19.769727645356735 0.0 3 0.9857769668058914 10.33594433415065 59149.0 79.88955844155845 0.0 - - - - - - - 748.1428571428571 118 7 IQSEC3 IQ motif and Sec7 domain 3 169 22 B20140404_SF100_02 B20140404_SF100_02 TB344833.[MT7]-IGLNLFNINPDK[MT7].2y4_1.heavy 823.479 / 617.338 3361.0 37.84429931640625 43 17 10 10 6 4.53698412589212 22.041073370592123 0.0 5 0.9761883608848518 7.98182432426899 3361.0 7.095243581468733 1.0 - - - - - - - 760.5555555555555 6 9 IQSEC3 IQ motif and Sec7 domain 3 171 22 B20140404_SF100_02 B20140404_SF100_02 TB344833.[MT7]-IGLNLFNINPDK[MT7].2b4_1.heavy 823.479 / 542.342 3112.0 37.84429931640625 43 17 10 10 6 4.53698412589212 22.041073370592123 0.0 5 0.9761883608848518 7.98182432426899 3112.0 9.842786824478676 1.0 - - - - - - - 323.5 14 10 IQSEC3 IQ motif and Sec7 domain 3 173 22 B20140404_SF100_02 B20140404_SF100_02 TB344833.[MT7]-IGLNLFNINPDK[MT7].2y3_1.heavy 823.479 / 503.295 8091.0 37.84429931640625 43 17 10 10 6 4.53698412589212 22.041073370592123 0.0 5 0.9761883608848518 7.98182432426899 8091.0 13.86514064829215 0.0 - - - - - - - 792.0909090909091 16 11 IQSEC3 IQ motif and Sec7 domain 3 175 22 B20140404_SF100_02 B20140404_SF100_02 TB344833.[MT7]-IGLNLFNINPDK[MT7].2y6_1.heavy 823.479 / 844.464 2241.0 37.84429931640625 43 17 10 10 6 4.53698412589212 22.041073370592123 0.0 5 0.9761883608848518 7.98182432426899 2241.0 4.095 1.0 - - - - - - - 728.7142857142857 4 7 IQSEC3 IQ motif and Sec7 domain 3 177 23 B20140404_SF100_02 B20140404_SF100_02 TB501940.[MT7]-EQEPTQQFIPVK[MT7].2b8_1.heavy 866.48 / 1132.54 6832.0 29.693199157714844 48 18 10 10 10 2.378001351159659 31.383248679849153 0.0 3 0.9854904128792142 10.233125975398199 6832.0 30.658630359607933 1.0 - - - - - - - 248.4 13 10 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 179 23 B20140404_SF100_02 B20140404_SF100_02 TB501940.[MT7]-EQEPTQQFIPVK[MT7].2b3_1.heavy 866.48 / 531.253 40059.0 29.693199157714844 48 18 10 10 10 2.378001351159659 31.383248679849153 0.0 3 0.9854904128792142 10.233125975398199 40059.0 85.14376410335825 0.0 - - - - - - - 327.8888888888889 80 9 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 181 23 B20140404_SF100_02 B20140404_SF100_02 TB501940.[MT7]-EQEPTQQFIPVK[MT7].2b6_1.heavy 866.48 / 857.412 12887.0 29.693199157714844 48 18 10 10 10 2.378001351159659 31.383248679849153 0.0 3 0.9854904128792142 10.233125975398199 12887.0 11.51482826859447 0.0 - - - - - - - 745.2 25 5 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 183 23 B20140404_SF100_02 B20140404_SF100_02 TB501940.[MT7]-EQEPTQQFIPVK[MT7].2b7_1.heavy 866.48 / 985.471 5900.0 29.693199157714844 48 18 10 10 10 2.378001351159659 31.383248679849153 0.0 3 0.9854904128792142 10.233125975398199 5900.0 36.045016077170416 0.0 - - - - - - - 330.125 11 8 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 185 24 B20140404_SF100_02 B20140404_SF100_02 TB501742.[MT7]-QQNNAALER.2y8_1.heavy 594.316 / 915.464 27335.0 19.834999084472656 44 14 10 10 10 3.7299593999430813 26.809943293625658 0.0 3 0.9468879686030299 5.331196981362399 27335.0 195.17765944626456 0.0 - - - - - - - 182.125 54 16 CLIC5 chloride intracellular channel 5 187 24 B20140404_SF100_02 B20140404_SF100_02 TB501742.[MT7]-QQNNAALER.2b4_1.heavy 594.316 / 629.312 5134.0 19.834999084472656 44 14 10 10 10 3.7299593999430813 26.809943293625658 0.0 3 0.9468879686030299 5.331196981362399 5134.0 41.97833425567239 0.0 - - - - - - - 180.46666666666667 10 15 CLIC5 chloride intracellular channel 5 189 24 B20140404_SF100_02 B20140404_SF100_02 TB501742.[MT7]-QQNNAALER.2b5_1.heavy 594.316 / 700.349 5967.0 19.834999084472656 44 14 10 10 10 3.7299593999430813 26.809943293625658 0.0 3 0.9468879686030299 5.331196981362399 5967.0 23.47481657449957 0.0 - - - - - - - 151.0 11 17 CLIC5 chloride intracellular channel 5 191 24 B20140404_SF100_02 B20140404_SF100_02 TB501742.[MT7]-QQNNAALER.2y7_1.heavy 594.316 / 787.406 7909.0 19.834999084472656 44 14 10 10 10 3.7299593999430813 26.809943293625658 0.0 3 0.9468879686030299 5.331196981362399 7909.0 71.71932950469596 0.0 - - - - - - - 199.5 15 16 CLIC5 chloride intracellular channel 5 193 25 B20140404_SF100_02 B20140404_SF100_02 TB154545.[MT7]-RFEIAC[CAM]YK[MT7].3y3_1.heavy 458.92 / 614.309 171640.0 27.83370018005371 44 14 10 10 10 2.147969031255796 36.62876281487773 0.0 3 0.9449067645567981 5.233580270872091 171640.0 100.24607773851591 0.0 - - - - - - - 849.0 343 1 SBDS Shwachman-Bodian-Diamond syndrome 195 25 B20140404_SF100_02 B20140404_SF100_02 TB154545.[MT7]-RFEIAC[CAM]YK[MT7].3b4_1.heavy 458.92 / 690.406 52638.0 27.83370018005371 44 14 10 10 10 2.147969031255796 36.62876281487773 0.0 3 0.9449067645567981 5.233580270872091 52638.0 131.08113559322032 0.0 - - - - - - - 707.7142857142857 105 7 SBDS Shwachman-Bodian-Diamond syndrome 197 25 B20140404_SF100_02 B20140404_SF100_02 TB154545.[MT7]-RFEIAC[CAM]YK[MT7].3y4_1.heavy 458.92 / 685.346 77967.0 27.83370018005371 44 14 10 10 10 2.147969031255796 36.62876281487773 0.0 3 0.9449067645567981 5.233580270872091 77967.0 20.25539279404341 0.0 - - - - - - - 778.5 155 2 SBDS Shwachman-Bodian-Diamond syndrome 199 25 B20140404_SF100_02 B20140404_SF100_02 TB154545.[MT7]-RFEIAC[CAM]YK[MT7].3b3_1.heavy 458.92 / 577.321 104003.0 27.83370018005371 44 14 10 10 10 2.147969031255796 36.62876281487773 0.0 3 0.9449067645567981 5.233580270872091 104003.0 108.22537579062752 0.0 - - - - - - - 283.0 208 1 SBDS Shwachman-Bodian-Diamond syndrome 201 26 B20140404_SF100_02 B20140404_SF100_02 TB154541.[MT7]-HIIQLQSIK[MT7].3y3_1.heavy 456.625 / 491.331 168310.0 28.542699813842773 50 20 10 10 10 8.607135013646287 11.618267848878144 0.0 3 0.9959040884117599 19.27696840269098 168310.0 48.281677310286234 0.0 - - - - - - - 1214.0 336 1 ANGPT2 angiopoietin 2 203 26 B20140404_SF100_02 B20140404_SF100_02 TB154541.[MT7]-HIIQLQSIK[MT7].3b4_1.heavy 456.625 / 636.395 85293.0 28.542699813842773 50 20 10 10 10 8.607135013646287 11.618267848878144 0.0 3 0.9959040884117599 19.27696840269098 85293.0 82.86915413643305 0.0 - - - - - - - 379.5 170 2 ANGPT2 angiopoietin 2 205 26 B20140404_SF100_02 B20140404_SF100_02 TB154541.[MT7]-HIIQLQSIK[MT7].3y4_1.heavy 456.625 / 619.39 33996.0 28.542699813842773 50 20 10 10 10 8.607135013646287 11.618267848878144 0.0 3 0.9959040884117599 19.27696840269098 33996.0 29.87018121911038 0.0 - - - - - - - 328.8333333333333 67 6 ANGPT2 angiopoietin 2 207 26 B20140404_SF100_02 B20140404_SF100_02 TB154541.[MT7]-HIIQLQSIK[MT7].3b3_1.heavy 456.625 / 508.336 88025.0 28.542699813842773 50 20 10 10 10 8.607135013646287 11.618267848878144 0.0 3 0.9959040884117599 19.27696840269098 88025.0 29.22416403852347 0.0 - - - - - - - 1062.0 176 1 ANGPT2 angiopoietin 2 209 27 B20140404_SF100_02 B20140404_SF100_02 TB154607.[MT7]-DLDEVLQTHSVFVNVSK[MT7].3b6_1.heavy 740.07 / 829.442 10644.0 34.35929870605469 44 14 10 10 10 0.9937472083170821 52.18625816905403 0.0 3 0.9385113341446166 4.951239855926531 10644.0 28.002276958996877 0.0 - - - - - - - 347.25 21 8 SBDS Shwachman-Bodian-Diamond syndrome 211 27 B20140404_SF100_02 B20140404_SF100_02 TB154607.[MT7]-DLDEVLQTHSVFVNVSK[MT7].3y6_1.heavy 740.07 / 837.495 22676.0 34.35929870605469 44 14 10 10 10 0.9937472083170821 52.18625816905403 0.0 3 0.9385113341446166 4.951239855926531 22676.0 41.670619150467964 0.0 - - - - - - - 837.7142857142857 45 7 SBDS Shwachman-Bodian-Diamond syndrome 213 27 B20140404_SF100_02 B20140404_SF100_02 TB154607.[MT7]-DLDEVLQTHSVFVNVSK[MT7].3b4_1.heavy 740.07 / 617.29 20979.0 34.35929870605469 44 14 10 10 10 0.9937472083170821 52.18625816905403 0.0 3 0.9385113341446166 4.951239855926531 20979.0 18.799639719145937 0.0 - - - - - - - 463.0 41 1 SBDS Shwachman-Bodian-Diamond syndrome 215 27 B20140404_SF100_02 B20140404_SF100_02 TB154607.[MT7]-DLDEVLQTHSVFVNVSK[MT7].3b5_1.heavy 740.07 / 716.358 21133.0 34.35929870605469 44 14 10 10 10 0.9937472083170821 52.18625816905403 0.0 3 0.9385113341446166 4.951239855926531 21133.0 24.94141296581096 0.0 - - - - - - - 370.6 42 5 SBDS Shwachman-Bodian-Diamond syndrome 217 28 B20140404_SF100_02 B20140404_SF100_02 TB154373.[MT7]-LLLQLQDR.2y5_1.heavy 571.854 / 659.347 95433.0 33.733001708984375 46 16 10 10 10 2.768975526051066 36.11443982049691 0.0 3 0.967644224508522 6.842400011137376 95433.0 111.4111012670887 0.0 - - - - - - - 479.0 190 2 DEF8 differentially expressed in FDCP 8 homolog (mouse) 219 28 B20140404_SF100_02 B20140404_SF100_02 TB154373.[MT7]-LLLQLQDR.2b4_1.heavy 571.854 / 612.42 48993.0 33.733001708984375 46 16 10 10 10 2.768975526051066 36.11443982049691 0.0 3 0.967644224508522 6.842400011137376 48993.0 11.761768473949008 0.0 - - - - - - - 798.0 97 1 DEF8 differentially expressed in FDCP 8 homolog (mouse) 221 28 B20140404_SF100_02 B20140404_SF100_02 TB154373.[MT7]-LLLQLQDR.2y6_1.heavy 571.854 / 772.431 100700.0 33.733001708984375 46 16 10 10 10 2.768975526051066 36.11443982049691 0.0 3 0.967644224508522 6.842400011137376 100700.0 121.45248798280892 0.0 - - - - - - - 425.6666666666667 201 3 DEF8 differentially expressed in FDCP 8 homolog (mouse) 223 28 B20140404_SF100_02 B20140404_SF100_02 TB154373.[MT7]-LLLQLQDR.2y7_1.heavy 571.854 / 885.515 133734.0 33.733001708984375 46 16 10 10 10 2.768975526051066 36.11443982049691 0.0 3 0.967644224508522 6.842400011137376 133734.0 230.95155416293642 0.0 - - - - - - - 479.0 267 3 DEF8 differentially expressed in FDCP 8 homolog (mouse) 225 29 B20140404_SF100_02 B20140404_SF100_02 TB154606.[MT7]-LQMWDTAGQER.2y8_1.heavy 739.863 / 962.433 13465.0 31.253999710083008 48 18 10 10 10 9.29320253703965 10.760553167913095 0.0 3 0.9838595579705854 9.701050810454218 13465.0 48.01153609282491 0.0 - - - - - - - 276.8888888888889 26 9 RAB26 RAB26, member RAS oncogene family 227 29 B20140404_SF100_02 B20140404_SF100_02 TB154606.[MT7]-LQMWDTAGQER.2y9_1.heavy 739.863 / 1093.47 13132.0 31.253999710083008 48 18 10 10 10 9.29320253703965 10.760553167913095 0.0 3 0.9838595579705854 9.701050810454218 13132.0 80.08390615091947 0.0 - - - - - - - 284.7142857142857 26 14 RAB26 RAB26, member RAS oncogene family 229 29 B20140404_SF100_02 B20140404_SF100_02 TB154606.[MT7]-LQMWDTAGQER.2y6_1.heavy 739.863 / 661.326 19616.0 31.253999710083008 48 18 10 10 10 9.29320253703965 10.760553167913095 0.0 3 0.9838595579705854 9.701050810454218 19616.0 23.060951347440767 0.0 - - - - - - - 499.0 39 3 RAB26 RAB26, member RAS oncogene family 231 29 B20140404_SF100_02 B20140404_SF100_02 TB154606.[MT7]-LQMWDTAGQER.2y10_1.heavy 739.863 / 1221.53 8478.0 31.253999710083008 48 18 10 10 10 9.29320253703965 10.760553167913095 0.0 3 0.9838595579705854 9.701050810454218 8478.0 40.857831325301206 0.0 - - - - - - - 249.1 16 10 RAB26 RAB26, member RAS oncogene family 233 30 B20140404_SF100_02 B20140404_SF100_02 TB154609.[MT7]-QYDGIFYEFR.3b4_1.heavy 494.578 / 608.28 181849.0 36.39569854736328 42 14 8 10 10 1.370497242956229 44.327611645119234 0.0 3 0.9337949437016261 4.769700665675526 181849.0 137.86160475433906 0.0 - - - - - - - 349.0 363 2 NIPSNAP3A nipsnap homolog 3A (C. elegans) 235 30 B20140404_SF100_02 B20140404_SF100_02 TB154609.[MT7]-QYDGIFYEFR.3b3_1.heavy 494.578 / 551.258 52655.0 36.39569854736328 42 14 8 10 10 1.370497242956229 44.327611645119234 0.0 3 0.9337949437016261 4.769700665675526 52655.0 55.04269689737471 1.0 - - - - - - - 262.0 470 8 NIPSNAP3A nipsnap homolog 3A (C. elegans) 237 30 B20140404_SF100_02 B20140404_SF100_02 TB154609.[MT7]-QYDGIFYEFR.3y4_1.heavy 494.578 / 614.293 87991.0 36.39569854736328 42 14 8 10 10 1.370497242956229 44.327611645119234 0.0 3 0.9337949437016261 4.769700665675526 87991.0 147.5266766109785 0.0 - - - - - - - 768.3 175 10 NIPSNAP3A nipsnap homolog 3A (C. elegans) 239 30 B20140404_SF100_02 B20140404_SF100_02 TB154609.[MT7]-QYDGIFYEFR.3y5_1.heavy 494.578 / 761.362 120674.0 36.39569854736328 42 14 8 10 10 1.370497242956229 44.327611645119234 0.0 3 0.9337949437016261 4.769700665675526 120674.0 142.05442238949794 0.0 - - - - - - - 729.3333333333334 241 9 NIPSNAP3A nipsnap homolog 3A (C. elegans) 241 31 B20140404_SF100_02 B20140404_SF100_02 TB154371.[MT7]-GSGGFGSTGK[MT7].2y5_1.heavy 571.806 / 593.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 243 31 B20140404_SF100_02 B20140404_SF100_02 TB154371.[MT7]-GSGGFGSTGK[MT7].2y9_1.heavy 571.806 / 941.481 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 245 31 B20140404_SF100_02 B20140404_SF100_02 TB154371.[MT7]-GSGGFGSTGK[MT7].2b5_1.heavy 571.806 / 550.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 247 31 B20140404_SF100_02 B20140404_SF100_02 TB154371.[MT7]-GSGGFGSTGK[MT7].2b9_1.heavy 571.806 / 852.397 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 249 32 B20140404_SF100_02 B20140404_SF100_02 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 2178520.0 28.91320037841797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2178520.0 360.8882486934257 0.0 - - - - - - - 868.0 4357 1 251 32 B20140404_SF100_02 B20140404_SF100_02 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 652952.0 28.91320037841797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 652952.0 166.10632548993087 0.0 - - - - - - - 1109.6666666666667 1305 3 253 32 B20140404_SF100_02 B20140404_SF100_02 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 495878.0 28.91320037841797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 495878.0 233.79237524382336 0.0 - - - - - - - 1447.0 991 1 255 33 B20140404_SF100_02 B20140404_SF100_02 TB154271.[MT7]-DVEEEK[MT7].2y4_1.heavy 518.774 / 678.343 15524.0 19.71339988708496 50 20 10 10 10 8.487403816231145 11.782165920839297 0.0 3 0.9961199848510185 19.806381352664594 15524.0 49.84444347823179 0.0 - - - - - - - 292.2142857142857 31 14 IL31;SMU1 interleukin 31;smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 257 33 B20140404_SF100_02 B20140404_SF100_02 TB154271.[MT7]-DVEEEK[MT7].2y5_1.heavy 518.774 / 777.411 18558.0 19.71339988708496 50 20 10 10 10 8.487403816231145 11.782165920839297 0.0 3 0.9961199848510185 19.806381352664594 18558.0 53.72052631578947 0.0 - - - - - - - 715.5714285714286 37 7 IL31;SMU1 interleukin 31;smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 259 33 B20140404_SF100_02 B20140404_SF100_02 TB154271.[MT7]-DVEEEK[MT7].2b4_1.heavy 518.774 / 617.29 9526.0 19.71339988708496 50 20 10 10 10 8.487403816231145 11.782165920839297 0.0 3 0.9961199848510185 19.806381352664594 9526.0 17.887440159084772 0.0 - - - - - - - 258.6666666666667 19 9 IL31;SMU1 interleukin 31;smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 261 33 B20140404_SF100_02 B20140404_SF100_02 TB154271.[MT7]-DVEEEK[MT7].2y3_1.heavy 518.774 / 549.3 10655.0 19.71339988708496 50 20 10 10 10 8.487403816231145 11.782165920839297 0.0 3 0.9961199848510185 19.806381352664594 10655.0 27.7917238131628 0.0 - - - - - - - 705.4444444444445 21 9 IL31;SMU1 interleukin 31;smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 263 34 B20140404_SF100_02 B20140404_SF100_02 TB501746.[MT7]-NLLSVAYK[MT7].2y4_1.heavy 598.368 / 624.384 50947.0 31.58650016784668 47 17 10 10 10 2.8593916291801147 27.569736483698634 0.0 3 0.9713990025026757 7.2799970675425865 50947.0 50.54685524444729 0.0 - - - - - - - 165.0 101 2 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 265 34 B20140404_SF100_02 B20140404_SF100_02 TB501746.[MT7]-NLLSVAYK[MT7].2y5_1.heavy 598.368 / 711.416 129098.0 31.58650016784668 47 17 10 10 10 2.8593916291801147 27.569736483698634 0.0 3 0.9713990025026757 7.2799970675425865 129098.0 90.71270223954902 0.0 - - - - - - - 330.0 258 1 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 267 34 B20140404_SF100_02 B20140404_SF100_02 TB501746.[MT7]-NLLSVAYK[MT7].2y3_1.heavy 598.368 / 525.315 77822.0 31.58650016784668 47 17 10 10 10 2.8593916291801147 27.569736483698634 0.0 3 0.9713990025026757 7.2799970675425865 77822.0 37.62782627872268 0.0 - - - - - - - 824.0 155 2 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 269 34 B20140404_SF100_02 B20140404_SF100_02 TB501746.[MT7]-NLLSVAYK[MT7].2y6_1.heavy 598.368 / 824.5 53915.0 31.58650016784668 47 17 10 10 10 2.8593916291801147 27.569736483698634 0.0 3 0.9713990025026757 7.2799970675425865 53915.0 40.39881582069139 0.0 - - - - - - - 247.5 107 2 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 271 35 B20140404_SF100_02 B20140404_SF100_02 TB501946.[MT7]-APGPWQAMQVWADR.3y6_1.heavy 586.295 / 774.389 20064.0 37.737266540527344 42 20 8 6 8 4.826138111610267 20.720501089562575 0.038898468017578125 4 0.991017689251962 13.011959852064363 20064.0 38.597587957138515 0.0 - - - - - - - 345.0 40 3 DEF8 differentially expressed in FDCP 8 homolog (mouse) 273 35 B20140404_SF100_02 B20140404_SF100_02 TB501946.[MT7]-APGPWQAMQVWADR.3y4_1.heavy 586.295 / 547.262 22783.0 37.737266540527344 42 20 8 6 8 4.826138111610267 20.720501089562575 0.038898468017578125 4 0.991017689251962 13.011959852064363 22783.0 25.121652317880795 1.0 - - - - - - - 702.7142857142857 59 7 DEF8 differentially expressed in FDCP 8 homolog (mouse) 275 35 B20140404_SF100_02 B20140404_SF100_02 TB501946.[MT7]-APGPWQAMQVWADR.3y8_1.heavy 586.295 / 976.467 11780.0 37.737266540527344 42 20 8 6 8 4.826138111610267 20.720501089562575 0.038898468017578125 4 0.991017689251962 13.011959852064363 11780.0 32.33648300541655 0.0 - - - - - - - 258.77777777777777 23 9 DEF8 differentially expressed in FDCP 8 homolog (mouse) 277 35 B20140404_SF100_02 B20140404_SF100_02 TB501946.[MT7]-APGPWQAMQVWADR.3y5_1.heavy 586.295 / 646.331 N/A 37.737266540527344 42 20 8 6 8 4.826138111610267 20.720501089562575 0.038898468017578125 4 0.991017689251962 13.011959852064363 21100.0 16.011868306752657 1.0 - - - - - - - 744.25 61 4 DEF8 differentially expressed in FDCP 8 homolog (mouse) 279 36 B20140404_SF100_02 B20140404_SF100_02 TB154273.[MT7]-FVEDLK[MT7].2y4_1.heavy 519.807 / 648.369 19412.0 29.324899673461914 44 16 10 10 8 2.440651798515179 34.65202112167163 0.0 4 0.9638770929662186 6.473735426856122 19412.0 17.98060813395746 0.0 - - - - - - - 313.0 38 1 IQSEC3 IQ motif and Sec7 domain 3 281 36 B20140404_SF100_02 B20140404_SF100_02 TB154273.[MT7]-FVEDLK[MT7].2y5_1.heavy 519.807 / 747.437 32092.0 29.324899673461914 44 16 10 10 8 2.440651798515179 34.65202112167163 0.0 4 0.9638770929662186 6.473735426856122 32092.0 31.885972994254868 1.0 - - - - - - - 313.0 99 2 IQSEC3 IQ motif and Sec7 domain 3 283 36 B20140404_SF100_02 B20140404_SF100_02 TB154273.[MT7]-FVEDLK[MT7].2y3_2.heavy 519.807 / 260.167 4383.0 29.324899673461914 44 16 10 10 8 2.440651798515179 34.65202112167163 0.0 4 0.9638770929662186 6.473735426856122 4383.0 3.058444554202646 11.0 - - - - - - - 470.0 18 2 IQSEC3 IQ motif and Sec7 domain 3 285 36 B20140404_SF100_02 B20140404_SF100_02 TB154273.[MT7]-FVEDLK[MT7].2b4_1.heavy 519.807 / 635.316 49468.0 29.324899673461914 44 16 10 10 8 2.440651798515179 34.65202112167163 0.0 4 0.9638770929662186 6.473735426856122 49468.0 42.52451979624041 0.0 - - - - - - - 730.6666666666666 98 3 IQSEC3 IQ motif and Sec7 domain 3 287 37 B20140404_SF100_02 B20140404_SF100_02 TB154923.[MT7]-SGTALSGPDAPPNGPLQPGRPSLGGGVDFYDVAFK[MT7].4b10_1.heavy 933.233 / 1001.5 10379.0 35.9581995010376 40 15 10 5 10 1.9144614991694238 41.643171116675205 0.043598175048828125 3 0.9518814687919029 5.603368071549444 10379.0 42.03182769994199 0.0 - - - - - - - 257.3333333333333 20 6 RAB26 RAB26, member RAS oncogene family 289 37 B20140404_SF100_02 B20140404_SF100_02 TB154923.[MT7]-SGTALSGPDAPPNGPLQPGRPSLGGGVDFYDVAFK[MT7].4b5_1.heavy 933.233 / 574.332 12764.0 35.9581995010376 40 15 10 5 10 1.9144614991694238 41.643171116675205 0.043598175048828125 3 0.9518814687919029 5.603368071549444 12764.0 20.808877717663485 0.0 - - - - - - - 234.0 25 6 RAB26 RAB26, member RAS oncogene family 291 37 B20140404_SF100_02 B20140404_SF100_02 TB154923.[MT7]-SGTALSGPDAPPNGPLQPGRPSLGGGVDFYDVAFK[MT7].4y3_1.heavy 933.233 / 509.32 4769.0 35.9581995010376 40 15 10 5 10 1.9144614991694238 41.643171116675205 0.043598175048828125 3 0.9518814687919029 5.603368071549444 4769.0 0.11188376712811487 1.0 - - - - - - - 315.75 10 8 RAB26 RAB26, member RAS oncogene family 293 37 B20140404_SF100_02 B20140404_SF100_02 TB154923.[MT7]-SGTALSGPDAPPNGPLQPGRPSLGGGVDFYDVAFK[MT7].4b9_1.heavy 933.233 / 930.465 7855.0 35.9581995010376 40 15 10 5 10 1.9144614991694238 41.643171116675205 0.043598175048828125 3 0.9518814687919029 5.603368071549444 7855.0 8.92633331905881 0.0 - - - - - - - 280.6 15 5 RAB26 RAB26, member RAS oncogene family 295 38 B20140404_SF100_02 B20140404_SF100_02 TB154602.[MT7]-DALQAMILSLPR.3y6_1.heavy 491.286 / 698.456 22231.0 40.5160493850708 42 16 10 6 10 2.596218754517446 31.661979714806954 0.039798736572265625 3 0.9687381657665007 6.961730345714516 22231.0 83.94713028169014 0.0 - - - - - - - 236.5 44 14 IQSEC3 IQ motif and Sec7 domain 3 297 38 B20140404_SF100_02 B20140404_SF100_02 TB154602.[MT7]-DALQAMILSLPR.3b4_1.heavy 491.286 / 572.316 29137.0 40.5160493850708 42 16 10 6 10 2.596218754517446 31.661979714806954 0.039798736572265625 3 0.9687381657665007 6.961730345714516 29137.0 94.90044014084508 0.0 - - - - - - - 262.0 58 13 IQSEC3 IQ motif and Sec7 domain 3 299 38 B20140404_SF100_02 B20140404_SF100_02 TB154602.[MT7]-DALQAMILSLPR.3b5_1.heavy 491.286 / 643.353 53827.0 40.5160493850708 42 16 10 6 10 2.596218754517446 31.661979714806954 0.039798736572265625 3 0.9687381657665007 6.961730345714516 53827.0 196.3116697372395 0.0 - - - - - - - 783.8571428571429 107 7 IQSEC3 IQ motif and Sec7 domain 3 301 38 B20140404_SF100_02 B20140404_SF100_02 TB154602.[MT7]-DALQAMILSLPR.3y5_1.heavy 491.286 / 585.372 37367.0 40.5160493850708 42 16 10 6 10 2.596218754517446 31.661979714806954 0.039798736572265625 3 0.9687381657665007 6.961730345714516 37367.0 89.94803697183099 0.0 - - - - - - - 189.36363636363637 74 11 IQSEC3 IQ motif and Sec7 domain 3 303 39 B20140404_SF100_02 B20140404_SF100_02 TB154275.[MT7]-LFFSLK[MT7].2b3_1.heavy 521.831 / 552.33 16439.0 36.83399963378906 46 16 10 10 10 2.2755350572589577 43.94570836472062 0.0 3 0.9619628267203267 6.307713211982375 16439.0 35.3243422551657 0.0 - - - - - - - 776.1428571428571 32 14 CYBASC3 cytochrome b, ascorbate dependent 3 305 39 B20140404_SF100_02 B20140404_SF100_02 TB154275.[MT7]-LFFSLK[MT7].2y4_1.heavy 521.831 / 638.399 25270.0 36.83399963378906 46 16 10 10 10 2.2755350572589577 43.94570836472062 0.0 3 0.9619628267203267 6.307713211982375 25270.0 69.98573412110544 0.0 - - - - - - - 247.27272727272728 50 11 CYBASC3 cytochrome b, ascorbate dependent 3 307 39 B20140404_SF100_02 B20140404_SF100_02 TB154275.[MT7]-LFFSLK[MT7].2y5_1.heavy 521.831 / 785.468 34916.0 36.83399963378906 46 16 10 10 10 2.2755350572589577 43.94570836472062 0.0 3 0.9619628267203267 6.307713211982375 34916.0 65.49840165322063 0.0 - - - - - - - 645.0 69 8 CYBASC3 cytochrome b, ascorbate dependent 3 309 39 B20140404_SF100_02 B20140404_SF100_02 TB154275.[MT7]-LFFSLK[MT7].2b5_1.heavy 521.831 / 752.446 1359.0 36.83399963378906 46 16 10 10 10 2.2755350572589577 43.94570836472062 0.0 3 0.9619628267203267 6.307713211982375 1359.0 4.396617647058823 5.0 - - - - - - - 251.07692307692307 13 13 CYBASC3 cytochrome b, ascorbate dependent 3 311 40 B20140404_SF100_02 B20140404_SF100_02 TB501943.[MT7]-SVFFGPDFITVTK[MT7].2y4_1.heavy 873.489 / 592.379 21653.0 38.152400970458984 43 13 10 10 10 1.0742367243266142 56.30798366169721 0.0 3 0.9292637685280936 4.612618313628282 21653.0 57.88402946344958 0.0 - - - - - - - 788.625 43 8 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 313 40 B20140404_SF100_02 B20140404_SF100_02 TB501943.[MT7]-SVFFGPDFITVTK[MT7].2y8_1.heavy 873.489 / 1064.61 20415.0 38.152400970458984 43 13 10 10 10 1.0742367243266142 56.30798366169721 0.0 3 0.9292637685280936 4.612618313628282 20415.0 133.8268892477929 0.0 - - - - - - - 257.5833333333333 40 12 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 315 40 B20140404_SF100_02 B20140404_SF100_02 TB501943.[MT7]-SVFFGPDFITVTK[MT7].2y9_1.heavy 873.489 / 1121.63 31427.0 38.152400970458984 43 13 10 10 10 1.0742367243266142 56.30798366169721 0.0 3 0.9292637685280936 4.612618313628282 31427.0 90.33587712379081 0.0 - - - - - - - 309.3333333333333 62 12 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 317 40 B20140404_SF100_02 B20140404_SF100_02 TB501943.[MT7]-SVFFGPDFITVTK[MT7].2b5_1.heavy 873.489 / 682.368 28334.0 38.152400970458984 43 13 10 10 10 1.0742367243266142 56.30798366169721 0.0 3 0.9292637685280936 4.612618313628282 28334.0 36.56271941295397 0.0 - - - - - - - 707.1428571428571 56 7 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 319 41 B20140404_SF100_02 B20140404_SF100_02 TB154539.[MT7]-HSHTLQEVK[MT7].3y3_1.heavy 456.261 / 519.326 14792.0 20.08180046081543 47 17 10 10 10 3.904528995052955 25.611283749384413 0.0 3 0.9770723726645678 8.134849527867297 14792.0 29.380064436761135 0.0 - - - - - - - 653.5 29 10 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 321 41 B20140404_SF100_02 B20140404_SF100_02 TB154539.[MT7]-HSHTLQEVK[MT7].3b3_1.heavy 456.261 / 506.259 8185.0 20.08180046081543 47 17 10 10 10 3.904528995052955 25.611283749384413 0.0 3 0.9770723726645678 8.134849527867297 8185.0 5.7165401613697675 1.0 - - - - - - - 741.625 16 8 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 323 41 B20140404_SF100_02 B20140404_SF100_02 TB154539.[MT7]-HSHTLQEVK[MT7].3y4_1.heavy 456.261 / 647.385 12014.0 20.08180046081543 47 17 10 10 10 3.904528995052955 25.611283749384413 0.0 3 0.9770723726645678 8.134849527867297 12014.0 44.02068197448697 0.0 - - - - - - - 601.0 24 7 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 325 41 B20140404_SF100_02 B20140404_SF100_02 TB154539.[MT7]-HSHTLQEVK[MT7].3y5_1.heavy 456.261 / 760.469 3004.0 20.08180046081543 47 17 10 10 10 3.904528995052955 25.611283749384413 0.0 3 0.9770723726645678 8.134849527867297 3004.0 38.328110469166155 1.0 - - - - - - - 312.9166666666667 9 12 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 327 42 B20140404_SF100_02 B20140404_SF100_02 TB344847.[MT7]-ALMEGYGLVGLPLVR.2b3_1.heavy 866.501 / 460.271 14328.0 39.93069839477539 39 9 10 10 10 1.9370385015532459 36.11996577159421 0.0 3 0.8097462743384366 2.7832785519202305 14328.0 21.893301256930815 0.0 - - - - - - - 717.8571428571429 28 7 IQSEC3 IQ motif and Sec7 domain 3 329 42 B20140404_SF100_02 B20140404_SF100_02 TB344847.[MT7]-ALMEGYGLVGLPLVR.2y9_1.heavy 866.501 / 923.604 7485.0 39.93069839477539 39 9 10 10 10 1.9370385015532459 36.11996577159421 0.0 3 0.8097462743384366 2.7832785519202305 7485.0 9.209072184721819 0.0 - - - - - - - 321.0 14 9 IQSEC3 IQ motif and Sec7 domain 3 331 42 B20140404_SF100_02 B20140404_SF100_02 TB344847.[MT7]-ALMEGYGLVGLPLVR.2y6_1.heavy 866.501 / 654.43 8554.0 39.93069839477539 39 9 10 10 10 1.9370385015532459 36.11996577159421 0.0 3 0.8097462743384366 2.7832785519202305 8554.0 21.82319575650417 0.0 - - - - - - - 748.4545454545455 17 11 IQSEC3 IQ motif and Sec7 domain 3 333 42 B20140404_SF100_02 B20140404_SF100_02 TB344847.[MT7]-ALMEGYGLVGLPLVR.2y11_1.heavy 866.501 / 1143.69 6309.0 39.93069839477539 39 9 10 10 10 1.9370385015532459 36.11996577159421 0.0 3 0.8097462743384366 2.7832785519202305 6309.0 25.796144859813083 0.0 - - - - - - - 196.16666666666666 12 12 IQSEC3 IQ motif and Sec7 domain 3 335 43 B20140404_SF100_02 B20140404_SF100_02 TB501755.[MT7]-ELVVGIYER.2y8_1.heavy 611.352 / 948.551 31546.0 32.01490020751953 44 14 10 10 10 1.408224605096158 49.27317729335084 0.0 3 0.94060632985274 5.038705355366946 31546.0 40.292290322930526 0.0 - - - - - - - 626.25 63 8 IQSEC3 IQ motif and Sec7 domain 3 337 43 B20140404_SF100_02 B20140404_SF100_02 TB501755.[MT7]-ELVVGIYER.2y5_1.heavy 611.352 / 637.33 47402.0 32.01490020751953 44 14 10 10 10 1.408224605096158 49.27317729335084 0.0 3 0.94060632985274 5.038705355366946 47402.0 82.49343410382963 0.0 - - - - - - - 723.6666666666666 94 6 IQSEC3 IQ motif and Sec7 domain 3 339 43 B20140404_SF100_02 B20140404_SF100_02 TB501755.[MT7]-ELVVGIYER.2y6_1.heavy 611.352 / 736.399 35551.0 32.01490020751953 44 14 10 10 10 1.408224605096158 49.27317729335084 0.0 3 0.94060632985274 5.038705355366946 35551.0 20.260253280570637 1.0 - - - - - - - 167.0 75 1 IQSEC3 IQ motif and Sec7 domain 3 341 43 B20140404_SF100_02 B20140404_SF100_02 TB501755.[MT7]-ELVVGIYER.2y7_1.heavy 611.352 / 835.467 25203.0 32.01490020751953 44 14 10 10 10 1.408224605096158 49.27317729335084 0.0 3 0.94060632985274 5.038705355366946 25203.0 24.239102873953993 0.0 - - - - - - - 626.25 50 4 IQSEC3 IQ motif and Sec7 domain 3 343 44 B20140404_SF100_02 B20140404_SF100_02 TB154431.[MT7]-QQALEVIK[MT7].3y3_1.heavy 406.255 / 503.367 97663.0 27.88089942932129 50 20 10 10 10 5.592003721855638 17.88267765437327 0.0 3 0.9940020212950631 15.927316007718451 97663.0 120.07745901639345 0.0 - - - - - - - 818.75 195 4 SBDS Shwachman-Bodian-Diamond syndrome 345 44 B20140404_SF100_02 B20140404_SF100_02 TB154431.[MT7]-QQALEVIK[MT7].3b4_1.heavy 406.255 / 585.348 80437.0 27.88089942932129 50 20 10 10 10 5.592003721855638 17.88267765437327 0.0 3 0.9940020212950631 15.927316007718451 80437.0 66.87673946360152 0.0 - - - - - - - 213.5 160 2 SBDS Shwachman-Bodian-Diamond syndrome 347 44 B20140404_SF100_02 B20140404_SF100_02 TB154431.[MT7]-QQALEVIK[MT7].3b5_1.heavy 406.255 / 714.39 83853.0 27.88089942932129 50 20 10 10 10 5.592003721855638 17.88267765437327 0.0 3 0.9940020212950631 15.927316007718451 83853.0 139.4277049180328 0.0 - - - - - - - 284.75 167 8 SBDS Shwachman-Bodian-Diamond syndrome 349 44 B20140404_SF100_02 B20140404_SF100_02 TB154431.[MT7]-QQALEVIK[MT7].3b3_1.heavy 406.255 / 472.264 188065.0 27.88089942932129 50 20 10 10 10 5.592003721855638 17.88267765437327 0.0 3 0.9940020212950631 15.927316007718451 188065.0 117.2648091186766 0.0 - - - - - - - 427.0 376 1 SBDS Shwachman-Bodian-Diamond syndrome 351 45 B20140404_SF100_02 B20140404_SF100_02 TB344842.[MT7]-TGQVVDISDTIYPR.2y8_1.heavy 854.455 / 964.51 11029.0 31.875200271606445 50 20 10 10 10 4.5374538287662105 17.695757313495044 0.0 3 0.9926090968667227 14.346493493104086 11029.0 41.59653052817595 0.0 - - - - - - - 222.66666666666666 22 6 XIAP X-linked inhibitor of apoptosis 353 45 B20140404_SF100_02 B20140404_SF100_02 TB344842.[MT7]-TGQVVDISDTIYPR.2y5_1.heavy 854.455 / 649.367 16042.0 31.875200271606445 50 20 10 10 10 4.5374538287662105 17.695757313495044 0.0 3 0.9926090968667227 14.346493493104086 16042.0 26.18362998405103 0.0 - - - - - - - 190.85714285714286 32 7 XIAP X-linked inhibitor of apoptosis 355 45 B20140404_SF100_02 B20140404_SF100_02 TB344842.[MT7]-TGQVVDISDTIYPR.2y10_1.heavy 854.455 / 1178.61 11864.0 31.875200271606445 50 20 10 10 10 4.5374538287662105 17.695757313495044 0.0 3 0.9926090968667227 14.346493493104086 11864.0 35.14335329341317 1.0 - - - - - - - 214.71428571428572 23 7 XIAP X-linked inhibitor of apoptosis 357 45 B20140404_SF100_02 B20140404_SF100_02 TB344842.[MT7]-TGQVVDISDTIYPR.2b5_1.heavy 854.455 / 629.374 10026.0 31.875200271606445 50 20 10 10 10 4.5374538287662105 17.695757313495044 0.0 3 0.9926090968667227 14.346493493104086 10026.0 23.449571718102256 0.0 - - - - - - - 262.42857142857144 20 7 XIAP X-linked inhibitor of apoptosis 359 46 B20140404_SF100_02 B20140404_SF100_02 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 1069350.0 19.050500869750977 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1069350.0 1173.8758557144652 0.0 - - - - - - - 424.0 2138 2 361 46 B20140404_SF100_02 B20140404_SF100_02 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 2084230.0 19.050500869750977 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2084230.0 3366.126179203909 0.0 - - - - - - - 363.6666666666667 4168 3 363 46 B20140404_SF100_02 B20140404_SF100_02 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 743107.0 19.050500869750977 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 743107.0 1491.436126386956 0.0 - - - - - - - 400.0 1486 5 365 47 B20140404_SF100_02 B20140404_SF100_02 TB501751.[MT7]-EDWVFLTR.2y4_1.heavy 605.323 / 536.319 20757.0 35.721900939941406 47 17 10 10 10 4.4119652607702635 22.665636307059565 0.0 3 0.9792440307893929 8.551391748216956 20757.0 14.875208975459843 0.0 - - - - - - - 229.0 41 2 TMEM145 transmembrane protein 145 367 47 B20140404_SF100_02 B20140404_SF100_02 TB501751.[MT7]-EDWVFLTR.2b3_1.heavy 605.323 / 575.258 16637.0 35.721900939941406 47 17 10 10 10 4.4119652607702635 22.665636307059565 0.0 3 0.9792440307893929 8.551391748216956 16637.0 16.750967699175792 0.0 - - - - - - - 916.0 33 3 TMEM145 transmembrane protein 145 369 47 B20140404_SF100_02 B20140404_SF100_02 TB501751.[MT7]-EDWVFLTR.2b4_1.heavy 605.323 / 674.327 21063.0 35.721900939941406 47 17 10 10 10 4.4119652607702635 22.665636307059565 0.0 3 0.9792440307893929 8.551391748216956 21063.0 22.795669774578073 0.0 - - - - - - - 1264.7142857142858 42 7 TMEM145 transmembrane protein 145 371 47 B20140404_SF100_02 B20140404_SF100_02 TB501751.[MT7]-EDWVFLTR.2y7_1.heavy 605.323 / 936.494 24726.0 35.721900939941406 47 17 10 10 10 4.4119652607702635 22.665636307059565 0.0 3 0.9792440307893929 8.551391748216956 24726.0 45.82517221922379 0.0 - - - - - - - 327.14285714285717 49 7 TMEM145 transmembrane protein 145 373 48 B20140404_SF100_02 B20140404_SF100_02 TB154389.[MT7]-DC[CAM]AEVFK[MT7].2y4_1.heavy 578.799 / 666.394 7106.0 26.028499603271484 43 13 10 10 10 1.1209427529254676 54.52544190549092 0.0 3 0.9192030915987577 4.3121767644513795 7106.0 13.173124390054323 0.0 - - - - - - - 300.0 14 7 ANGPT2 angiopoietin 2 375 48 B20140404_SF100_02 B20140404_SF100_02 TB154389.[MT7]-DC[CAM]AEVFK[MT7].2b4_1.heavy 578.799 / 620.247 12110.0 26.028499603271484 43 13 10 10 10 1.1209427529254676 54.52544190549092 0.0 3 0.9192030915987577 4.3121767644513795 12110.0 11.933629948616323 0.0 - - - - - - - 657.7142857142857 24 7 ANGPT2 angiopoietin 2 377 48 B20140404_SF100_02 B20140404_SF100_02 TB154389.[MT7]-DC[CAM]AEVFK[MT7].2y3_1.heavy 578.799 / 537.352 14813.0 26.028499603271484 43 13 10 10 10 1.1209427529254676 54.52544190549092 0.0 3 0.9192030915987577 4.3121767644513795 14813.0 12.914328664336571 0.0 - - - - - - - 741.0 29 5 ANGPT2 angiopoietin 2 379 48 B20140404_SF100_02 B20140404_SF100_02 TB154389.[MT7]-DC[CAM]AEVFK[MT7].2y6_1.heavy 578.799 / 897.462 9708.0 26.028499603271484 43 13 10 10 10 1.1209427529254676 54.52544190549092 0.0 3 0.9192030915987577 4.3121767644513795 9708.0 42.55732382310984 0.0 - - - - - - - 278.57142857142856 19 14 ANGPT2 angiopoietin 2 381 49 B20140404_SF100_02 B20140404_SF100_02 TB154388.[MT7]-EQEPTQQFIPVK[MT7].3b6_1.heavy 577.989 / 857.412 56203.0 29.693199157714844 48 18 10 10 10 3.673074521782639 22.063376878737234 0.0 3 0.9896416879199886 12.11552617603557 56203.0 72.50387010676157 0.0 - - - - - - - 257.2 112 5 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 383 49 B20140404_SF100_02 B20140404_SF100_02 TB154388.[MT7]-EQEPTQQFIPVK[MT7].3b5_1.heavy 577.989 / 729.354 74509.0 29.693199157714844 48 18 10 10 10 3.673074521782639 22.063376878737234 0.0 3 0.9896416879199886 12.11552617603557 74509.0 63.559981320049815 0.0 - - - - - - - 482.0 149 1 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 385 49 B20140404_SF100_02 B20140404_SF100_02 TB154388.[MT7]-EQEPTQQFIPVK[MT7].3b3_1.heavy 577.989 / 531.253 246168.0 29.693199157714844 48 18 10 10 10 3.673074521782639 22.063376878737234 0.0 3 0.9896416879199886 12.11552617603557 246168.0 121.10824884884983 0.0 - - - - - - - 963.0 492 1 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 387 49 B20140404_SF100_02 B20140404_SF100_02 TB154388.[MT7]-EQEPTQQFIPVK[MT7].3b7_1.heavy 577.989 / 985.471 66801.0 29.693199157714844 48 18 10 10 10 3.673074521782639 22.063376878737234 0.0 3 0.9896416879199886 12.11552617603557 66801.0 210.68982172661646 0.0 - - - - - - - 353.5 133 10 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 389 50 B20140404_SF100_02 B20140404_SF100_02 TB344941.[MT7]-GTVLDQVPINPSLYLVK[MT7].2y8_1.heavy 1072.63 / 1077.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPIN2B;SPIN2A spindlin family, member 2B;spindlin family, member 2A 391 50 B20140404_SF100_02 B20140404_SF100_02 TB344941.[MT7]-GTVLDQVPINPSLYLVK[MT7].2b6_1.heavy 1072.63 / 758.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPIN2B;SPIN2A spindlin family, member 2B;spindlin family, member 2A 393 50 B20140404_SF100_02 B20140404_SF100_02 TB344941.[MT7]-GTVLDQVPINPSLYLVK[MT7].2b7_1.heavy 1072.63 / 857.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPIN2B;SPIN2A spindlin family, member 2B;spindlin family, member 2A 395 50 B20140404_SF100_02 B20140404_SF100_02 TB344941.[MT7]-GTVLDQVPINPSLYLVK[MT7].2b5_1.heavy 1072.63 / 630.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPIN2B;SPIN2A spindlin family, member 2B;spindlin family, member 2A 397 51 B20140404_SF100_02 B20140404_SF100_02 TB154532.[MT7]-QAHLNPFNK[MT7].3y3_1.heavy 452.926 / 552.326 92809.0 26.224199295043945 50 20 10 10 10 6.256189737864553 15.984169948485828 0.0 3 0.9935812133764725 15.395837651334372 92809.0 68.94713044889122 0.0 - - - - - - - 1251.25 185 8 DEF8 differentially expressed in FDCP 8 homolog (mouse) 399 51 B20140404_SF100_02 B20140404_SF100_02 TB154532.[MT7]-QAHLNPFNK[MT7].3b5_1.heavy 452.926 / 708.391 47765.0 26.224199295043945 50 20 10 10 10 6.256189737864553 15.984169948485828 0.0 3 0.9935812133764725 15.395837651334372 47765.0 67.3892229040739 0.0 - - - - - - - 1227.857142857143 95 7 DEF8 differentially expressed in FDCP 8 homolog (mouse) 401 51 B20140404_SF100_02 B20140404_SF100_02 TB154532.[MT7]-QAHLNPFNK[MT7].3y4_1.heavy 452.926 / 649.379 163531.0 26.224199295043945 50 20 10 10 10 6.256189737864553 15.984169948485828 0.0 3 0.9935812133764725 15.395837651334372 163531.0 146.7210858124311 0.0 - - - - - - - 435.0 327 2 DEF8 differentially expressed in FDCP 8 homolog (mouse) 403 51 B20140404_SF100_02 B20140404_SF100_02 TB154532.[MT7]-QAHLNPFNK[MT7].3b3_1.heavy 452.926 / 481.264 174194.0 26.224199295043945 50 20 10 10 10 6.256189737864553 15.984169948485828 0.0 3 0.9935812133764725 15.395837651334372 174194.0 133.07430108670712 0.0 - - - - - - - 761.6 348 5 DEF8 differentially expressed in FDCP 8 homolog (mouse) 405 52 B20140404_SF100_02 B20140404_SF100_02 TB154439.[MT7]-LSEHATAPTR.3y6_1.heavy 409.559 / 616.341 89888.0 20.72249984741211 47 17 10 10 10 3.4372832380081384 22.726129521883372 0.0 3 0.9771707688512168 8.152429084344018 89888.0 42.83285443354401 0.0 - - - - - - - 638.3333333333334 179 3 DUT deoxyuridine triphosphatase 407 52 B20140404_SF100_02 B20140404_SF100_02 TB154439.[MT7]-LSEHATAPTR.3b4_1.heavy 409.559 / 611.327 24445.0 20.72249984741211 47 17 10 10 10 3.4372832380081384 22.726129521883372 0.0 3 0.9771707688512168 8.152429084344018 24445.0 24.58543868359458 1.0 - - - - - - - 777.4285714285714 109 7 DUT deoxyuridine triphosphatase 409 52 B20140404_SF100_02 B20140404_SF100_02 TB154439.[MT7]-LSEHATAPTR.3b3_1.heavy 409.559 / 474.268 179009.0 20.72249984741211 47 17 10 10 10 3.4372832380081384 22.726129521883372 0.0 3 0.9771707688512168 8.152429084344018 179009.0 63.50542950434506 0.0 - - - - - - - 1328.3333333333333 358 3 DUT deoxyuridine triphosphatase 411 52 B20140404_SF100_02 B20140404_SF100_02 TB154439.[MT7]-LSEHATAPTR.3y5_1.heavy 409.559 / 545.304 183070.0 20.72249984741211 47 17 10 10 10 3.4372832380081384 22.726129521883372 0.0 3 0.9771707688512168 8.152429084344018 183070.0 81.41750438796325 0.0 - - - - - - - 1686.0 366 2 DUT deoxyuridine triphosphatase 413 53 B20140404_SF100_02 B20140404_SF100_02 TB154536.[MT7]-HESLLGFFK[MT7].3b6_1.heavy 455.93 / 781.432 8870.0 34.952701568603516 47 17 10 10 10 3.90360931072873 25.617317728277445 0.0 3 0.9762165446418674 7.986571138665308 8870.0 28.12439024390244 0.0 - - - - - - - 236.14285714285714 17 14 SLC25A45 solute carrier family 25, member 45 415 53 B20140404_SF100_02 B20140404_SF100_02 TB154536.[MT7]-HESLLGFFK[MT7].3b4_1.heavy 455.93 / 611.327 35328.0 34.952701568603516 47 17 10 10 10 3.90360931072873 25.617317728277445 0.0 3 0.9762165446418674 7.986571138665308 35328.0 30.28860310421286 0.0 - - - - - - - 263.0 70 4 SLC25A45 solute carrier family 25, member 45 417 53 B20140404_SF100_02 B20140404_SF100_02 TB154536.[MT7]-HESLLGFFK[MT7].3b3_1.heavy 455.93 / 498.243 33374.0 34.952701568603516 47 17 10 10 10 3.90360931072873 25.617317728277445 0.0 3 0.9762165446418674 7.986571138665308 33374.0 43.09553002821443 0.0 - - - - - - - 360.8 66 5 SLC25A45 solute carrier family 25, member 45 419 53 B20140404_SF100_02 B20140404_SF100_02 TB154536.[MT7]-HESLLGFFK[MT7].3y4_1.heavy 455.93 / 642.373 36381.0 34.952701568603516 47 17 10 10 10 3.90360931072873 25.617317728277445 0.0 3 0.9762165446418674 7.986571138665308 36381.0 96.71378199020721 0.0 - - - - - - - 343.85714285714283 72 7 SLC25A45 solute carrier family 25, member 45 421 54 B20140404_SF100_02 B20140404_SF100_02 TB154733.[MT7]-ISSISQPGNDFSTK[MT7].3y7_1.heavy 590.315 / 912.454 7439.0 28.072500228881836 44 14 10 10 10 1.531844985042011 53.551654374320194 0.0 3 0.9349463577484162 4.812199211463581 7439.0 10.581610968294772 0.0 - - - - - - - 335.8 14 10 ANGPT2 angiopoietin 2 423 54 B20140404_SF100_02 B20140404_SF100_02 TB154733.[MT7]-ISSISQPGNDFSTK[MT7].3b4_1.heavy 590.315 / 545.341 N/A 28.072500228881836 44 14 10 10 10 1.531844985042011 53.551654374320194 0.0 3 0.9349463577484162 4.812199211463581 33987.0 9.144387861984828 0.0 - - - - - - - 2626.0 67 2 ANGPT2 angiopoietin 2 425 54 B20140404_SF100_02 B20140404_SF100_02 TB154733.[MT7]-ISSISQPGNDFSTK[MT7].3y4_1.heavy 590.315 / 626.363 34279.0 28.072500228881836 44 14 10 10 10 1.531844985042011 53.551654374320194 0.0 3 0.9349463577484162 4.812199211463581 34279.0 8.737378849395125 0.0 - - - - - - - 583.0 68 1 ANGPT2 angiopoietin 2 427 54 B20140404_SF100_02 B20140404_SF100_02 TB154733.[MT7]-ISSISQPGNDFSTK[MT7].3y8_1.heavy 590.315 / 1009.51 16337.0 28.072500228881836 44 14 10 10 10 1.531844985042011 53.551654374320194 0.0 3 0.9349463577484162 4.812199211463581 16337.0 113.86385222617412 0.0 - - - - - - - 182.5 32 8 ANGPT2 angiopoietin 2 429 55 B20140404_SF100_02 B20140404_SF100_02 TB154638.[MT7]-GNVGVVLFNFGK[MT7].2y5_1.heavy 769.95 / 756.416 6136.0 36.922401428222656 47 17 10 10 10 3.0535296678257096 27.33206704783707 0.0 3 0.9789528336407263 8.49182184229236 6136.0 6.705969609410554 0.0 - - - - - - - 650.625 12 8 DUT deoxyuridine triphosphatase 431 55 B20140404_SF100_02 B20140404_SF100_02 TB154638.[MT7]-GNVGVVLFNFGK[MT7].2b6_1.heavy 769.95 / 670.4 8004.0 36.922401428222656 47 17 10 10 10 3.0535296678257096 27.33206704783707 0.0 3 0.9789528336407263 8.49182184229236 8004.0 11.262351738241307 0.0 - - - - - - - 1276.857142857143 16 7 DUT deoxyuridine triphosphatase 433 55 B20140404_SF100_02 B20140404_SF100_02 TB154638.[MT7]-GNVGVVLFNFGK[MT7].2b5_1.heavy 769.95 / 571.332 11072.0 36.922401428222656 47 17 10 10 10 3.0535296678257096 27.33206704783707 0.0 3 0.9789528336407263 8.49182184229236 11072.0 16.123391837271942 0.0 - - - - - - - 724.1428571428571 22 7 DUT deoxyuridine triphosphatase 435 55 B20140404_SF100_02 B20140404_SF100_02 TB154638.[MT7]-GNVGVVLFNFGK[MT7].2y7_1.heavy 769.95 / 968.569 5469.0 36.922401428222656 47 17 10 10 10 3.0535296678257096 27.33206704783707 0.0 3 0.9789528336407263 8.49182184229236 5469.0 11.479160419790105 0.0 - - - - - - - 667.1428571428571 10 7 DUT deoxyuridine triphosphatase 437 56 B20140404_SF100_02 B20140404_SF100_02 TB154383.[MT7]-GEVQVSDK[MT7].2y4_1.heavy 575.321 / 592.342 13588.0 21.08210055033366 30 14 0 6 10 1.607499023741268 44.131461024091514 0.036899566650390625 3 0.943991575721332 5.190241177886861 13588.0 36.43058896200273 0.0 - - - - - - - 264.6 27 15 SBDS Shwachman-Bodian-Diamond syndrome 439 56 B20140404_SF100_02 B20140404_SF100_02 TB154383.[MT7]-GEVQVSDK[MT7].2y5_1.heavy 575.321 / 720.401 12596.0 21.08210055033366 30 14 0 6 10 1.607499023741268 44.131461024091514 0.036899566650390625 3 0.943991575721332 5.190241177886861 12596.0 51.26404839968774 0.0 - - - - - - - 225.0 25 19 SBDS Shwachman-Bodian-Diamond syndrome 441 56 B20140404_SF100_02 B20140404_SF100_02 TB154383.[MT7]-GEVQVSDK[MT7].2b4_1.heavy 575.321 / 558.3 N/A 21.08210055033366 30 14 0 6 10 1.607499023741268 44.131461024091514 0.036899566650390625 3 0.943991575721332 5.190241177886861 20764.0 8.288000837912309 1.0 - - - - - - - 2214.0 849 1 SBDS Shwachman-Bodian-Diamond syndrome 443 56 B20140404_SF100_02 B20140404_SF100_02 TB154383.[MT7]-GEVQVSDK[MT7].2b7_1.heavy 575.321 / 859.428 18932.0 21.08210055033366 30 14 0 6 10 1.607499023741268 44.131461024091514 0.036899566650390625 3 0.943991575721332 5.190241177886861 18932.0 41.20852979972896 0.0 - - - - - - - 288.85714285714283 37 14 SBDS Shwachman-Bodian-Diamond syndrome 445 57 B20140404_SF100_02 B20140404_SF100_02 TB501955.[MT7]-SLEVLVADLVNAQK[MT7].3b4_1.heavy 596.355 / 573.336 188665.0 41.804100036621094 43 13 10 10 10 0.8915908129927874 70.41387652866207 0.0 3 0.9022464608484839 3.914651799818889 188665.0 132.62370116259433 0.0 - - - - - - - 414.25 377 4 XIAP X-linked inhibitor of apoptosis 447 57 B20140404_SF100_02 B20140404_SF100_02 TB501955.[MT7]-SLEVLVADLVNAQK[MT7].3b5_1.heavy 596.355 / 686.42 285275.0 41.804100036621094 43 13 10 10 10 0.8915908129927874 70.41387652866207 0.0 3 0.9022464608484839 3.914651799818889 285275.0 81.85000719917119 0.0 - - - - - - - 769.4285714285714 570 7 XIAP X-linked inhibitor of apoptosis 449 57 B20140404_SF100_02 B20140404_SF100_02 TB501955.[MT7]-SLEVLVADLVNAQK[MT7].3y4_1.heavy 596.355 / 604.354 282707.0 41.804100036621094 43 13 10 10 10 0.8915908129927874 70.41387652866207 0.0 3 0.9022464608484839 3.914651799818889 282707.0 408.74627379217515 0.0 - - - - - - - 435.0 565 4 XIAP X-linked inhibitor of apoptosis 451 57 B20140404_SF100_02 B20140404_SF100_02 TB501955.[MT7]-SLEVLVADLVNAQK[MT7].3b8_1.heavy 596.355 / 971.553 120639.0 41.804100036621094 43 13 10 10 10 0.8915908129927874 70.41387652866207 0.0 3 0.9022464608484839 3.914651799818889 120639.0 217.9427082925472 0.0 - - - - - - - 745.8571428571429 241 7 XIAP X-linked inhibitor of apoptosis 453 58 B20140404_SF100_02 B20140404_SF100_02 TB154243.[MT7]-ALDDC[CAM]K[MT7].2y4_1.heavy 505.265 / 681.299 29307.0 21.239700317382812 45 15 10 10 10 3.204668574986335 31.204474865369317 0.0 3 0.9532488219273569 5.685378945502592 29307.0 71.92305380454317 0.0 - - - - - - - 673.5 58 8 RGS7BP regulator of G-protein signaling 7 binding protein 455 58 B20140404_SF100_02 B20140404_SF100_02 TB154243.[MT7]-ALDDC[CAM]K[MT7].2y5_1.heavy 505.265 / 794.383 43580.0 21.239700317382812 45 15 10 10 10 3.204668574986335 31.204474865369317 0.0 3 0.9532488219273569 5.685378945502592 43580.0 44.808682492319726 0.0 - - - - - - - 778.0 87 8 RGS7BP regulator of G-protein signaling 7 binding protein 457 58 B20140404_SF100_02 B20140404_SF100_02 TB154243.[MT7]-ALDDC[CAM]K[MT7].2b4_1.heavy 505.265 / 559.284 87388.0 21.239700317382812 45 15 10 10 10 3.204668574986335 31.204474865369317 0.0 3 0.9532488219273569 5.685378945502592 87388.0 175.83638562761269 0.0 - - - - - - - 772.8181818181819 174 11 RGS7BP regulator of G-protein signaling 7 binding protein 459 58 B20140404_SF100_02 B20140404_SF100_02 TB154243.[MT7]-ALDDC[CAM]K[MT7].2y3_1.heavy 505.265 / 566.273 46921.0 21.239700317382812 45 15 10 10 10 3.204668574986335 31.204474865369317 0.0 3 0.9532488219273569 5.685378945502592 46921.0 85.206810404342 0.0 - - - - - - - 750.5555555555555 93 9 RGS7BP regulator of G-protein signaling 7 binding protein 461 59 B20140404_SF100_02 B20140404_SF100_02 TB501959.[MT7]-FASVFQPPLPPDSPR.3y6_1.heavy 600.325 / 668.336 134780.0 35.08359909057617 47 17 10 10 10 3.6804164009678826 27.170838596877736 0.0 3 0.9792032333298731 8.542970639524787 134780.0 23.406380999770885 0.0 - - - - - - - 3531.0 269 1 C3orf70 chromosome 3 open reading frame 70 463 59 B20140404_SF100_02 B20140404_SF100_02 TB501959.[MT7]-FASVFQPPLPPDSPR.3b4_1.heavy 600.325 / 549.315 101162.0 35.08359909057617 47 17 10 10 10 3.6804164009678826 27.170838596877736 0.0 3 0.9792032333298731 8.542970639524787 101162.0 14.857162685475746 0.0 - - - - - - - 3837.5 202 2 C3orf70 chromosome 3 open reading frame 70 465 59 B20140404_SF100_02 B20140404_SF100_02 TB501959.[MT7]-FASVFQPPLPPDSPR.3y8_1.heavy 600.325 / 878.473 52346.0 35.08359909057617 47 17 10 10 10 3.6804164009678826 27.170838596877736 0.0 3 0.9792032333298731 8.542970639524787 52346.0 16.715970019647465 1.0 - - - - - - - 1228.0 127 2 C3orf70 chromosome 3 open reading frame 70 467 59 B20140404_SF100_02 B20140404_SF100_02 TB501959.[MT7]-FASVFQPPLPPDSPR.3y9_1.heavy 600.325 / 975.526 44517.0 35.08359909057617 47 17 10 10 10 3.6804164009678826 27.170838596877736 0.0 3 0.9792032333298731 8.542970639524787 44517.0 31.352240404525666 0.0 - - - - - - - 1382.0 89 1 C3orf70 chromosome 3 open reading frame 70 469 60 B20140404_SF100_02 B20140404_SF100_02 TB154529.[MT7]-LFEVTDVNK[MT7].2b3_1.heavy 676.887 / 534.304 7357.0 33.47319984436035 26 5 10 5 6 0.5752022977545946 91.09239460808175 0.046802520751953125 6 0.6856829722780374 2.1408390691932473 7357.0 4.609845234166921 2.0 - - - - - - - 1672.0 30 9 IQSEC3 IQ motif and Sec7 domain 3 471 60 B20140404_SF100_02 B20140404_SF100_02 TB154529.[MT7]-LFEVTDVNK[MT7].2y8_1.heavy 676.887 / 1095.58 334.0 33.47319984436035 26 5 10 5 6 0.5752022977545946 91.09239460808175 0.046802520751953125 6 0.6856829722780374 2.1408390691932473 334.0 0.5096909272183449 32.0 - - - - - - - 300.6 19 5 IQSEC3 IQ motif and Sec7 domain 3 473 60 B20140404_SF100_02 B20140404_SF100_02 TB154529.[MT7]-LFEVTDVNK[MT7].2y5_1.heavy 676.887 / 720.401 36783.0 33.47319984436035 26 5 10 5 6 0.5752022977545946 91.09239460808175 0.046802520751953125 6 0.6856829722780374 2.1408390691932473 36783.0 27.406185989536034 0.0 - - - - - - - 669.0 73 7 IQSEC3 IQ motif and Sec7 domain 3 475 60 B20140404_SF100_02 B20140404_SF100_02 TB154529.[MT7]-LFEVTDVNK[MT7].2y3_1.heavy 676.887 / 504.326 10366.0 33.47319984436035 26 5 10 5 6 0.5752022977545946 91.09239460808175 0.046802520751953125 6 0.6856829722780374 2.1408390691932473 10366.0 8.061296111665005 1.0 - - - - - - - 1077.2222222222222 27 9 IQSEC3 IQ motif and Sec7 domain 3 477 61 B20140404_SF100_02 B20140404_SF100_02 TB154426.[MT7]-DVEEGDEK[MT7].2y4_1.heavy 604.798 / 592.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - SBDS Shwachman-Bodian-Diamond syndrome 479 61 B20140404_SF100_02 B20140404_SF100_02 TB154426.[MT7]-DVEEGDEK[MT7].2y5_1.heavy 604.798 / 721.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - SBDS Shwachman-Bodian-Diamond syndrome 481 61 B20140404_SF100_02 B20140404_SF100_02 TB154426.[MT7]-DVEEGDEK[MT7].2b6_1.heavy 604.798 / 789.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - SBDS Shwachman-Bodian-Diamond syndrome 483 61 B20140404_SF100_02 B20140404_SF100_02 TB154426.[MT7]-DVEEGDEK[MT7].2y7_1.heavy 604.798 / 949.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - SBDS Shwachman-Bodian-Diamond syndrome 485 62 B20140404_SF100_02 B20140404_SF100_02 TB154259.[MT7]-MTVQEDR.2y4_1.heavy 511.757 / 547.247 4918.0 21.55470085144043 42 20 6 10 6 7.498690299698308 13.3356620960894 0.0 5 0.9967595855372541 21.674283247278062 4918.0 5.7741917292561755 0.0 - - - - - - - 717.7777777777778 9 9 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 487 62 B20140404_SF100_02 B20140404_SF100_02 TB154259.[MT7]-MTVQEDR.2y5_1.heavy 511.757 / 646.315 6459.0 21.55470085144043 42 20 6 10 6 7.498690299698308 13.3356620960894 0.0 5 0.9967595855372541 21.674283247278062 6459.0 9.97368171181459 1.0 - - - - - - - 1247.7777777777778 13 9 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 489 62 B20140404_SF100_02 B20140404_SF100_02 TB154259.[MT7]-MTVQEDR.2b4_1.heavy 511.757 / 604.325 4771.0 21.55470085144043 42 20 6 10 6 7.498690299698308 13.3356620960894 0.0 5 0.9967595855372541 21.674283247278062 4771.0 6.028894237101998 0.0 - - - - - - - 717.0769230769231 9 13 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 491 62 B20140404_SF100_02 B20140404_SF100_02 TB154259.[MT7]-MTVQEDR.2y6_1.heavy 511.757 / 747.363 22093.0 21.55470085144043 42 20 6 10 6 7.498690299698308 13.3356620960894 0.0 5 0.9967595855372541 21.674283247278062 22093.0 27.06927352744065 1.0 - - - - - - - 727.9166666666666 66 12 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 493 63 B20140404_SF100_02 B20140404_SF100_02 TB154528.[MT7]-VMLVGDSGVGK[MT7].3b6_1.heavy 450.595 / 759.419 18334.0 29.461999893188477 41 17 6 10 8 3.1820164769339043 31.426612880508088 0.0 4 0.9794708954038006 8.598675916422652 18334.0 48.56189240506329 0.0 - - - - - - - 807.5555555555555 36 9 RAB26 RAB26, member RAS oncogene family 495 63 B20140404_SF100_02 B20140404_SF100_02 TB154528.[MT7]-VMLVGDSGVGK[MT7].3b4_1.heavy 450.595 / 587.371 42357.0 29.461999893188477 41 17 6 10 8 3.1820164769339043 31.426612880508088 0.0 4 0.9794708954038006 8.598675916422652 42357.0 26.615419964085515 1.0 - - - - - - - 316.0 87 2 RAB26 RAB26, member RAS oncogene family 497 63 B20140404_SF100_02 B20140404_SF100_02 TB154528.[MT7]-VMLVGDSGVGK[MT7].3b5_1.heavy 450.595 / 644.392 16911.0 29.461999893188477 41 17 6 10 8 3.1820164769339043 31.426612880508088 0.0 4 0.9794708954038006 8.598675916422652 16911.0 17.02742653809194 1.0 - - - - - - - 812.5714285714286 47 7 RAB26 RAB26, member RAS oncogene family 499 63 B20140404_SF100_02 B20140404_SF100_02 TB154528.[MT7]-VMLVGDSGVGK[MT7].3y4_1.heavy 450.595 / 504.326 36351.0 29.461999893188477 41 17 6 10 8 3.1820164769339043 31.426612880508088 0.0 4 0.9794708954038006 8.598675916422652 36351.0 25.298277802903392 1.0 - - - - - - - 316.0 138 2 RAB26 RAB26, member RAS oncogene family 501 64 B20140404_SF100_02 B20140404_SF100_02 TB154422.[MT7]-MMLEDFIR.2b3_1.heavy 599.808 / 520.274 2528.0 37.80220031738281 44 16 10 10 8 2.9490880917876443 26.211977665949966 0.0 4 0.9654050221121618 6.6160044641569815 2528.0 2.6504451038575665 3.0 - - - - - - - 1125.0 5 10 IQSEC3 IQ motif and Sec7 domain 3 503 64 B20140404_SF100_02 B20140404_SF100_02 TB154422.[MT7]-MMLEDFIR.2y4_1.heavy 599.808 / 550.298 N/A 37.80220031738281 44 16 10 10 8 2.9490880917876443 26.211977665949966 0.0 4 0.9654050221121618 6.6160044641569815 2275.0 1.439873417721519 21.0 - - - - - - - 1280.125 8 8 IQSEC3 IQ motif and Sec7 domain 3 505 64 B20140404_SF100_02 B20140404_SF100_02 TB154422.[MT7]-MMLEDFIR.2b5_1.heavy 599.808 / 764.344 7964.0 37.80220031738281 44 16 10 10 8 2.9490880917876443 26.211977665949966 0.0 4 0.9654050221121618 6.6160044641569815 7964.0 10.855605874605843 0.0 - - - - - - - 726.75 15 8 IQSEC3 IQ motif and Sec7 domain 3 507 64 B20140404_SF100_02 B20140404_SF100_02 TB154422.[MT7]-MMLEDFIR.2y7_1.heavy 599.808 / 923.466 5815.0 37.80220031738281 44 16 10 10 8 2.9490880917876443 26.211977665949966 0.0 4 0.9654050221121618 6.6160044641569815 5815.0 19.881324110671933 1.0 - - - - - - - 189.4 11 10 IQSEC3 IQ motif and Sec7 domain 3 509 65 B20140404_SF100_02 B20140404_SF100_02 TB501761.[MT7]-DIATIVADK[MT7].2y4_1.heavy 617.368 / 576.347 57869.0 30.42799949645996 50 20 10 10 10 10.852229812960546 9.214696124530326 0.0 3 0.9970050518256008 22.54546845460702 57869.0 26.38070928891954 0.0 - - - - - - - 1366.5 115 2 SBDS Shwachman-Bodian-Diamond syndrome 511 65 B20140404_SF100_02 B20140404_SF100_02 TB501761.[MT7]-DIATIVADK[MT7].2y5_1.heavy 617.368 / 689.431 24273.0 30.42799949645996 50 20 10 10 10 10.852229812960546 9.214696124530326 0.0 3 0.9970050518256008 22.54546845460702 24273.0 21.36953110047847 0.0 - - - - - - - 482.0 48 1 SBDS Shwachman-Bodian-Diamond syndrome 513 65 B20140404_SF100_02 B20140404_SF100_02 TB501761.[MT7]-DIATIVADK[MT7].2y6_1.heavy 617.368 / 790.479 32792.0 30.42799949645996 50 20 10 10 10 10.852229812960546 9.214696124530326 0.0 3 0.9970050518256008 22.54546845460702 32792.0 46.776890547757546 0.0 - - - - - - - 763.5 65 8 SBDS Shwachman-Bodian-Diamond syndrome 515 65 B20140404_SF100_02 B20140404_SF100_02 TB501761.[MT7]-DIATIVADK[MT7].2y7_1.heavy 617.368 / 861.516 22505.0 30.42799949645996 50 20 10 10 10 10.852229812960546 9.214696124530326 0.0 3 0.9970050518256008 22.54546845460702 22505.0 32.2 0.0 - - - - - - - 294.5 45 6 SBDS Shwachman-Bodian-Diamond syndrome 517 66 B20140404_SF100_02 B20140404_SF100_02 TB154420.[MT7]-LIMQYLK[MT7].2y5_1.heavy 598.869 / 826.461 34261.0 34.952701568603516 39 11 10 10 8 1.7435706836037081 44.256860362443255 0.0 4 0.8592586273999051 3.2502824682959472 34261.0 32.18170111501908 0.0 - - - - - - - 453.0 68 1 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 519 66 B20140404_SF100_02 B20140404_SF100_02 TB154420.[MT7]-LIMQYLK[MT7].2b4_1.heavy 598.869 / 630.377 16452.0 34.952701568603516 39 11 10 10 8 1.7435706836037081 44.256860362443255 0.0 4 0.8592586273999051 3.2502824682959472 16452.0 15.63840587682098 1.0 - - - - - - - 339.75 46 4 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 521 66 B20140404_SF100_02 B20140404_SF100_02 TB154420.[MT7]-LIMQYLK[MT7].2y3_1.heavy 598.869 / 567.362 82107.0 34.952701568603516 39 11 10 10 8 1.7435706836037081 44.256860362443255 0.0 4 0.8592586273999051 3.2502824682959472 82107.0 51.727830760774026 0.0 - - - - - - - 453.0 164 2 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 523 66 B20140404_SF100_02 B20140404_SF100_02 TB154420.[MT7]-LIMQYLK[MT7].2y6_1.heavy 598.869 / 939.545 14942.0 34.952701568603516 39 11 10 10 8 1.7435706836037081 44.256860362443255 0.0 4 0.8592586273999051 3.2502824682959472 14942.0 19.013680446208355 1.0 - - - - - - - 264.25 32 8 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 525 67 B20140404_SF100_02 B20140404_SF100_02 TB344952.[MT7]-EINPLLFSYVEELVEIR.3y7_1.heavy 736.408 / 887.483 2041.0 44.63819885253906 43 15 10 10 8 2.6118477720943902 38.2870705821465 0.0 4 0.9594238266498145 6.10586611966347 2041.0 11.043894938076637 1.0 - - - - - - - 214.4090909090909 4 22 DEF8 differentially expressed in FDCP 8 homolog (mouse) 527 67 B20140404_SF100_02 B20140404_SF100_02 TB344952.[MT7]-EINPLLFSYVEELVEIR.3b4_1.heavy 736.408 / 598.332 726.0 44.63819885253906 43 15 10 10 8 2.6118477720943902 38.2870705821465 0.0 4 0.9594238266498145 6.10586611966347 726.0 0.984406779661017 25.0 - - - - - - - 235.04545454545453 5 22 DEF8 differentially expressed in FDCP 8 homolog (mouse) 529 67 B20140404_SF100_02 B20140404_SF100_02 TB344952.[MT7]-EINPLLFSYVEELVEIR.3b5_1.heavy 736.408 / 711.416 2677.0 44.63819885253906 43 15 10 10 8 2.6118477720943902 38.2870705821465 0.0 4 0.9594238266498145 6.10586611966347 2677.0 10.795194457948469 0.0 - - - - - - - 211.66666666666666 5 21 DEF8 differentially expressed in FDCP 8 homolog (mouse) 531 67 B20140404_SF100_02 B20140404_SF100_02 TB344952.[MT7]-EINPLLFSYVEELVEIR.3b3_1.heavy 736.408 / 501.279 3221.0 44.63819885253906 43 15 10 10 8 2.6118477720943902 38.2870705821465 0.0 4 0.9594238266498145 6.10586611966347 3221.0 6.7032892629420955 0.0 - - - - - - - 247.2 6 20 DEF8 differentially expressed in FDCP 8 homolog (mouse) 533 68 B20140404_SF100_02 B20140404_SF100_02 TB154522.[MT7]-GEGLTPYQGK[MT7].2y5_1.heavy 669.369 / 736.411 43304.0 24.524300575256348 41 15 10 6 10 1.2368485106195208 51.20484806112306 0.03280067443847656 3 0.9572396410120596 5.946780006094294 43304.0 195.498640776699 0.0 - - - - - - - 627.25 86 8 ZCCHC24 zinc finger, CCHC domain containing 24 535 68 B20140404_SF100_02 B20140404_SF100_02 TB154522.[MT7]-GEGLTPYQGK[MT7].2b4_1.heavy 669.369 / 501.279 20456.0 24.524300575256348 41 15 10 6 10 1.2368485106195208 51.20484806112306 0.03280067443847656 3 0.9572396410120596 5.946780006094294 20456.0 51.29136229101671 0.0 - - - - - - - 1209.3333333333333 40 9 ZCCHC24 zinc finger, CCHC domain containing 24 537 68 B20140404_SF100_02 B20140404_SF100_02 TB154522.[MT7]-GEGLTPYQGK[MT7].2y6_1.heavy 669.369 / 837.459 15129.0 24.524300575256348 41 15 10 6 10 1.2368485106195208 51.20484806112306 0.03280067443847656 3 0.9572396410120596 5.946780006094294 15129.0 40.50077720207254 0.0 - - - - - - - 199.0 30 19 ZCCHC24 zinc finger, CCHC domain containing 24 539 68 B20140404_SF100_02 B20140404_SF100_02 TB154522.[MT7]-GEGLTPYQGK[MT7].2b5_1.heavy 669.369 / 602.327 24933.0 24.524300575256348 41 15 10 6 10 1.2368485106195208 51.20484806112306 0.03280067443847656 3 0.9572396410120596 5.946780006094294 24933.0 57.9552683002626 0.0 - - - - - - - 708.9090909090909 49 11 ZCCHC24 zinc finger, CCHC domain containing 24 541 69 B20140404_SF100_02 B20140404_SF100_02 TB154520.[MT7]-AAEPGYLVTK[MT7].3b6_1.heavy 446.262 / 733.364 198206.0 27.423999786376953 48 18 10 10 10 4.577647365916547 21.84528252319361 0.0 3 0.9828705505822684 9.416050439920204 198206.0 164.75911157887003 0.0 - - - - - - - 1255.0 396 6 PCDHB5;PCDHGB5;PCDHGB2;PCDHGB1;PCDHB15;PCDHB14;PCDHB13;PCDHB11;PCDHB10;PCDHB9;PCDHB8;PCDHB7;PCDHB6;PCDHB4;PCDHB3;PCDHB2;PCDHB16 protocadherin beta 5;protocadherin gamma subfamily B, 5;protocadherin gamma subfamily B, 2;protocadherin gamma subfamily B, 1;protocadherin beta 15;protocadherin beta 14;protocadherin beta 13;protocadherin beta 11;protocadherin beta 10;protocadherin beta 9;protocadherin beta 8;protocadherin beta 7;protocadherin beta 6;protocadherin beta 4;protocadherin beta 3;protocadherin beta 2;protocadherin beta 16 543 69 B20140404_SF100_02 B20140404_SF100_02 TB154520.[MT7]-AAEPGYLVTK[MT7].3y3_1.heavy 446.262 / 491.331 353114.0 27.423999786376953 48 18 10 10 10 4.577647365916547 21.84528252319361 0.0 3 0.9828705505822684 9.416050439920204 353114.0 115.17095102998505 0.0 - - - - - - - 2285.5 706 2 PCDHB5;PCDHGB5;PCDHGB2;PCDHGB1;PCDHB15;PCDHB14;PCDHB13;PCDHB11;PCDHB10;PCDHB9;PCDHB8;PCDHB7;PCDHB6;PCDHB4;PCDHB3;PCDHB2;PCDHB16 protocadherin beta 5;protocadherin gamma subfamily B, 5;protocadherin gamma subfamily B, 2;protocadherin gamma subfamily B, 1;protocadherin beta 15;protocadherin beta 14;protocadherin beta 13;protocadherin beta 11;protocadherin beta 10;protocadherin beta 9;protocadherin beta 8;protocadherin beta 7;protocadherin beta 6;protocadherin beta 4;protocadherin beta 3;protocadherin beta 2;protocadherin beta 16 545 69 B20140404_SF100_02 B20140404_SF100_02 TB154520.[MT7]-AAEPGYLVTK[MT7].3b5_1.heavy 446.262 / 570.3 361989.0 27.423999786376953 48 18 10 10 10 4.577647365916547 21.84528252319361 0.0 3 0.9828705505822684 9.416050439920204 361989.0 290.5499019081227 0.0 - - - - - - - 403.0 723 1 PCDHB5;PCDHGB5;PCDHGB2;PCDHGB1;PCDHB15;PCDHB14;PCDHB13;PCDHB11;PCDHB10;PCDHB9;PCDHB8;PCDHB7;PCDHB6;PCDHB4;PCDHB3;PCDHB2;PCDHB16 protocadherin beta 5;protocadherin gamma subfamily B, 5;protocadherin gamma subfamily B, 2;protocadherin gamma subfamily B, 1;protocadherin beta 15;protocadherin beta 14;protocadherin beta 13;protocadherin beta 11;protocadherin beta 10;protocadherin beta 9;protocadherin beta 8;protocadherin beta 7;protocadherin beta 6;protocadherin beta 4;protocadherin beta 3;protocadherin beta 2;protocadherin beta 16 547 69 B20140404_SF100_02 B20140404_SF100_02 TB154520.[MT7]-AAEPGYLVTK[MT7].3y4_1.heavy 446.262 / 604.415 83505.0 27.423999786376953 48 18 10 10 10 4.577647365916547 21.84528252319361 0.0 3 0.9828705505822684 9.416050439920204 83505.0 15.325693212842099 1.0 - - - - - - - 269.0 168 1 PCDHB5;PCDHGB5;PCDHGB2;PCDHGB1;PCDHB15;PCDHB14;PCDHB13;PCDHB11;PCDHB10;PCDHB9;PCDHB8;PCDHB7;PCDHB6;PCDHB4;PCDHB3;PCDHB2;PCDHB16 protocadherin beta 5;protocadherin gamma subfamily B, 5;protocadherin gamma subfamily B, 2;protocadherin gamma subfamily B, 1;protocadherin beta 15;protocadherin beta 14;protocadherin beta 13;protocadherin beta 11;protocadherin beta 10;protocadherin beta 9;protocadherin beta 8;protocadherin beta 7;protocadherin beta 6;protocadherin beta 4;protocadherin beta 3;protocadherin beta 2;protocadherin beta 16 549 70 B20140404_SF100_02 B20140404_SF100_02 TB344953.[MT7]-IFYPEIEEVQALDDTER.2b3_1.heavy 1106.05 / 568.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 551 70 B20140404_SF100_02 B20140404_SF100_02 TB344953.[MT7]-IFYPEIEEVQALDDTER.2y4_1.heavy 1106.05 / 520.236 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 553 70 B20140404_SF100_02 B20140404_SF100_02 TB344953.[MT7]-IFYPEIEEVQALDDTER.2y9_1.heavy 1106.05 / 1046.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 555 70 B20140404_SF100_02 B20140404_SF100_02 TB344953.[MT7]-IFYPEIEEVQALDDTER.2y7_1.heavy 1106.05 / 819.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 557 71 B20140404_SF100_02 B20140404_SF100_02 TB154524.[MT7]-LMALLGQALK[MT7].3y3_1.heavy 449.288 / 475.336 208663.0 39.80659866333008 44 14 10 10 10 1.2268485797749484 48.850025772665695 0.0 3 0.9388280362661864 4.964174230524036 208663.0 394.52817261628803 0.0 - - - - - - - 205.2 417 5 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 559 71 B20140404_SF100_02 B20140404_SF100_02 TB154524.[MT7]-LMALLGQALK[MT7].3b4_1.heavy 449.288 / 573.355 269455.0 39.80659866333008 44 14 10 10 10 1.2268485797749484 48.850025772665695 0.0 3 0.9388280362661864 4.964174230524036 269455.0 936.5448195961989 0.0 - - - - - - - 190.71428571428572 538 7 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 561 71 B20140404_SF100_02 B20140404_SF100_02 TB154524.[MT7]-LMALLGQALK[MT7].3b3_1.heavy 449.288 / 460.271 184634.0 39.80659866333008 44 14 10 10 10 1.2268485797749484 48.850025772665695 0.0 3 0.9388280362661864 4.964174230524036 184634.0 272.8182309814727 0.0 - - - - - - - 188.5 369 6 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 563 71 B20140404_SF100_02 B20140404_SF100_02 TB154524.[MT7]-LMALLGQALK[MT7].3y5_1.heavy 449.288 / 660.416 50831.0 39.80659866333008 44 14 10 10 10 1.2268485797749484 48.850025772665695 0.0 3 0.9388280362661864 4.964174230524036 50831.0 520.2896261143305 0.0 - - - - - - - 233.54545454545453 101 11 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 565 72 B20140404_SF100_02 B20140404_SF100_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 2430500.0 20.87529945373535 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2430500.0 3912.9178594240157 0.0 - - - - - - - 230.0 4861 1 567 72 B20140404_SF100_02 B20140404_SF100_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 1576010.0 20.87529945373535 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1576010.0 1517.4664405442481 0.0 - - - - - - - 996.0 3152 1 569 72 B20140404_SF100_02 B20140404_SF100_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 1535690.0 20.87529945373535 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1535690.0 3919.3515847964773 0.0 - - - - - - - 306.5 3071 2 571 73 B20140404_SF100_02 B20140404_SF100_02 TB154113.[MT7]-GC[CAM]EMAR.2y4_1.heavy 434.2 / 506.239 2288.0 18.902074813842773 35 16 6 5 8 3.4576466750816426 28.92140504715936 0.04489898681640625 4 0.967425965704075 6.819312572349967 2288.0 2.8323745064861816 1.0 - - - - - - - 724.4166666666666 4 12 RGS7BP regulator of G-protein signaling 7 binding protein 573 73 B20140404_SF100_02 B20140404_SF100_02 TB154113.[MT7]-GC[CAM]EMAR.2b3_1.heavy 434.2 / 491.204 5147.0 18.902074813842773 35 16 6 5 8 3.4576466750816426 28.92140504715936 0.04489898681640625 4 0.967425965704075 6.819312572349967 5147.0 9.199310493031252 0.0 - - - - - - - 712.6153846153846 10 13 RGS7BP regulator of G-protein signaling 7 binding protein 575 73 B20140404_SF100_02 B20140404_SF100_02 TB154113.[MT7]-GC[CAM]EMAR.2y5_1.heavy 434.2 / 666.27 3889.0 18.902074813842773 35 16 6 5 8 3.4576466750816426 28.92140504715936 0.04489898681640625 4 0.967425965704075 6.819312572349967 3889.0 20.363848530110666 0.0 - - - - - - - 264.375 7 16 RGS7BP regulator of G-protein signaling 7 binding protein 577 73 B20140404_SF100_02 B20140404_SF100_02 TB154113.[MT7]-GC[CAM]EMAR.2b4_1.heavy 434.2 / 622.245 4404.0 18.902074813842773 35 16 6 5 8 3.4576466750816426 28.92140504715936 0.04489898681640625 4 0.967425965704075 6.819312572349967 4404.0 11.347184520334034 2.0 - - - - - - - 686.2857142857143 15 7 RGS7BP regulator of G-protein signaling 7 binding protein 579 74 B20140404_SF100_02 B20140404_SF100_02 TB154724.[MT7]-SVFFGPDFITVTK[MT7].3b4_1.heavy 582.662 / 625.347 228435.0 38.152400970458984 45 15 10 10 10 3.0233787505783534 33.07557810309761 0.0 3 0.9553716279984473 5.8200714049436355 228435.0 311.81381152762833 0.0 - - - - - - - 368.3333333333333 456 3 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 581 74 B20140404_SF100_02 B20140404_SF100_02 TB154724.[MT7]-SVFFGPDFITVTK[MT7].3b5_1.heavy 582.662 / 682.368 217258.0 38.152400970458984 45 15 10 10 10 3.0233787505783534 33.07557810309761 0.0 3 0.9553716279984473 5.8200714049436355 217258.0 179.55603337193313 0.0 - - - - - - - 409.0 434 3 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 583 74 B20140404_SF100_02 B20140404_SF100_02 TB154724.[MT7]-SVFFGPDFITVTK[MT7].3y4_1.heavy 582.662 / 592.379 642666.0 38.152400970458984 45 15 10 10 10 3.0233787505783534 33.07557810309761 0.0 3 0.9553716279984473 5.8200714049436355 642666.0 332.07764926812484 0.0 - - - - - - - 675.5 1285 2 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 585 74 B20140404_SF100_02 B20140404_SF100_02 TB154724.[MT7]-SVFFGPDFITVTK[MT7].3b7_1.heavy 582.662 / 894.448 301632.0 38.152400970458984 45 15 10 10 10 3.0233787505783534 33.07557810309761 0.0 3 0.9553716279984473 5.8200714049436355 301632.0 518.4086838534599 0.0 - - - - - - - 270.2 603 5 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 587 75 B20140404_SF100_02 B20140404_SF100_02 TB154628.[MT7]-SPTLSTDTLRK[MT7].3y10_2.heavy 502.962 / 638.373 125213.0 25.04210090637207 37 7 10 10 10 0.922810433735322 67.37126520780144 0.0 3 0.7342154452362799 2.338686949087043 125213.0 65.29853894815163 0.0 - - - - - - - 683.6666666666666 250 6 IQSEC3 IQ motif and Sec7 domain 3 589 75 B20140404_SF100_02 B20140404_SF100_02 TB154628.[MT7]-SPTLSTDTLRK[MT7].3y7_1.heavy 502.962 / 964.554 20342.0 25.04210090637207 37 7 10 10 10 0.922810433735322 67.37126520780144 0.0 3 0.7342154452362799 2.338686949087043 20342.0 90.78212792642141 0.0 - - - - - - - 208.125 40 16 IQSEC3 IQ motif and Sec7 domain 3 591 75 B20140404_SF100_02 B20140404_SF100_02 TB154628.[MT7]-SPTLSTDTLRK[MT7].3y4_1.heavy 502.962 / 661.448 10256.0 25.04210090637207 37 7 10 10 10 0.922810433735322 67.37126520780144 0.0 3 0.7342154452362799 2.338686949087043 10256.0 13.58667098959571 0.0 - - - - - - - 1196.8181818181818 20 11 IQSEC3 IQ motif and Sec7 domain 3 593 75 B20140404_SF100_02 B20140404_SF100_02 TB154628.[MT7]-SPTLSTDTLRK[MT7].3y8_1.heavy 502.962 / 1077.64 N/A 25.04210090637207 37 7 10 10 10 0.922810433735322 67.37126520780144 0.0 3 0.7342154452362799 2.338686949087043 0.0 0.0 28.0 - - - - - - - 0.0 0 0 IQSEC3 IQ motif and Sec7 domain 3 595 76 B20140404_SF100_02 B20140404_SF100_02 TB154723.[MT7]-GQC[CAM]LLYNWEEER.2y8_1.heavy 870.91 / 1138.52 10162.0 33.40299987792969 47 17 10 10 10 3.5065224332282576 22.800388646187926 0.0 3 0.9770478733282466 8.130490017330784 10162.0 73.35193759930665 0.0 - - - - - - - 268.93333333333334 20 15 SPAG8 sperm associated antigen 8 597 76 B20140404_SF100_02 B20140404_SF100_02 TB154723.[MT7]-GQC[CAM]LLYNWEEER.2b4_1.heavy 870.91 / 603.304 16291.0 33.40299987792969 47 17 10 10 10 3.5065224332282576 22.800388646187926 0.0 3 0.9770478733282466 8.130490017330784 16291.0 21.574832171774112 0.0 - - - - - - - 342.875 32 8 SPAG8 sperm associated antigen 8 599 76 B20140404_SF100_02 B20140404_SF100_02 TB154723.[MT7]-GQC[CAM]LLYNWEEER.2b5_1.heavy 870.91 / 716.388 15000.0 33.40299987792969 47 17 10 10 10 3.5065224332282576 22.800388646187926 0.0 3 0.9770478733282466 8.130490017330784 15000.0 12.25693441538476 0.0 - - - - - - - 342.875 30 8 SPAG8 sperm associated antigen 8 601 76 B20140404_SF100_02 B20140404_SF100_02 TB154723.[MT7]-GQC[CAM]LLYNWEEER.2y7_1.heavy 870.91 / 1025.43 12581.0 33.40299987792969 47 17 10 10 10 3.5065224332282576 22.800388646187926 0.0 3 0.9770478733282466 8.130490017330784 12581.0 87.50642679900744 0.0 - - - - - - - 230.28571428571428 25 7 SPAG8 sperm associated antigen 8 603 77 B20140404_SF100_02 B20140404_SF100_02 TB154396.[MT7]-QAIEEC[CAM]K[MT7].2y4_1.heavy 583.31 / 709.331 12127.0 20.903949737548828 44 18 10 6 10 5.848960841997756 17.097054109503024 0.03820037841796875 3 0.9883543278572222 11.42503966166822 12127.0 57.792734375 0.0 - - - - - - - 225.94117647058823 24 17 DEF8 differentially expressed in FDCP 8 homolog (mouse) 605 77 B20140404_SF100_02 B20140404_SF100_02 TB154396.[MT7]-QAIEEC[CAM]K[MT7].2y5_1.heavy 583.31 / 822.415 7062.0 20.903949737548828 44 18 10 6 10 5.848960841997756 17.097054109503024 0.03820037841796875 3 0.9883543278572222 11.42503966166822 7062.0 23.458530130293155 0.0 - - - - - - - 157.94444444444446 14 18 DEF8 differentially expressed in FDCP 8 homolog (mouse) 607 77 B20140404_SF100_02 B20140404_SF100_02 TB154396.[MT7]-QAIEEC[CAM]K[MT7].2y3_1.heavy 583.31 / 580.288 7752.0 20.903949737548828 44 18 10 6 10 5.848960841997756 17.097054109503024 0.03820037841796875 3 0.9883543278572222 11.42503966166822 7752.0 25.941920743473766 0.0 - - - - - - - 254.0 15 13 DEF8 differentially expressed in FDCP 8 homolog (mouse) 609 77 B20140404_SF100_02 B20140404_SF100_02 TB154396.[MT7]-QAIEEC[CAM]K[MT7].2y6_1.heavy 583.31 / 893.452 17731.0 20.903949737548828 44 18 10 6 10 5.848960841997756 17.097054109503024 0.03820037841796875 3 0.9883543278572222 11.42503966166822 17731.0 96.07750992467427 0.0 - - - - - - - 239.41176470588235 35 17 DEF8 differentially expressed in FDCP 8 homolog (mouse) 611 78 B20140404_SF100_02 B20140404_SF100_02 TB154721.[MT7]-NFSNDIMLLQLER.2y8_1.heavy 868.96 / 1015.6 2443.0 37.358699798583984 42 12 10 10 10 0.9087506194068479 56.078632478469096 0.0 3 0.8967901961348131 3.8079728800540202 2443.0 8.832875882878705 0.0 - - - - - - - 273.375 4 16 GZMH;GZMB granzyme H (cathepsin G-like 2, protein h-CCPX);granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 613 78 B20140404_SF100_02 B20140404_SF100_02 TB154721.[MT7]-NFSNDIMLLQLER.2b4_1.heavy 868.96 / 607.296 2700.0 37.358699798583984 42 12 10 10 10 0.9087506194068479 56.078632478469096 0.0 3 0.8967901961348131 3.8079728800540202 2700.0 1.2597200622083982 1.0 - - - - - - - 314.3333333333333 5 9 GZMH;GZMB granzyme H (cathepsin G-like 2, protein h-CCPX);granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 615 78 B20140404_SF100_02 B20140404_SF100_02 TB154721.[MT7]-NFSNDIMLLQLER.2b6_1.heavy 868.96 / 835.407 1543.0 37.358699798583984 42 12 10 10 10 0.9087506194068479 56.078632478469096 0.0 3 0.8967901961348131 3.8079728800540202 1543.0 2.594159378036929 10.0 - - - - - - - 295.9 3 10 GZMH;GZMB granzyme H (cathepsin G-like 2, protein h-CCPX);granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 617 78 B20140404_SF100_02 B20140404_SF100_02 TB154721.[MT7]-NFSNDIMLLQLER.2b5_1.heavy 868.96 / 722.323 5914.0 37.358699798583984 42 12 10 10 10 0.9087506194068479 56.078632478469096 0.0 3 0.8967901961348131 3.8079728800540202 5914.0 8.705285390346615 0.0 - - - - - - - 685.5555555555555 11 9 GZMH;GZMB granzyme H (cathepsin G-like 2, protein h-CCPX);granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 619 79 B20140404_SF100_02 B20140404_SF100_02 TB501628.[MT7]-GLWK[MT7]PPDIK[MT7].3y3_1.heavy 495.977 / 519.326 10455.0 30.135099411010742 36 20 0 10 6 12.962866129522263 7.714343340494362 0.0 5 0.9969470636250483 22.330216908983957 10455.0 1.691594421409725 4.0 - - - - - - - 936.0 76 2 SPAG8 sperm associated antigen 8 621 79 B20140404_SF100_02 B20140404_SF100_02 TB501628.[MT7]-GLWK[MT7]PPDIK[MT7].3b3_1.heavy 495.977 / 501.294 10767.0 30.135099411010742 36 20 0 10 6 12.962866129522263 7.714343340494362 0.0 5 0.9969470636250483 22.330216908983957 10767.0 6.141239167910985 2.0 - - - - - - - 468.0 380 1 SPAG8 sperm associated antigen 8 623 79 B20140404_SF100_02 B20140404_SF100_02 TB501628.[MT7]-GLWK[MT7]PPDIK[MT7].3y4_1.heavy 495.977 / 616.379 25436.0 30.135099411010742 36 20 0 10 6 12.962866129522263 7.714343340494362 0.0 5 0.9969470636250483 22.330216908983957 25436.0 24.742314357587833 0.0 - - - - - - - 312.0 50 2 SPAG8 sperm associated antigen 8 625 79 B20140404_SF100_02 B20140404_SF100_02 TB501628.[MT7]-GLWK[MT7]PPDIK[MT7].3y5_1.heavy 495.977 / 713.431 56489.0 30.135099411010742 36 20 0 10 6 12.962866129522263 7.714343340494362 0.0 5 0.9969470636250483 22.330216908983957 56489.0 41.827261142215576 0.0 - - - - - - - 312.0 112 2 SPAG8 sperm associated antigen 8 627 80 B20140404_SF100_02 B20140404_SF100_02 TB154622.[MT7]-SWVQGNLTAC[CAM]GR.2y8_1.heavy 746.876 / 848.404 34831.0 28.637300491333008 48 18 10 10 10 5.500750696455809 18.179336879315592 0.0 3 0.9831927327273456 9.50612801067913 34831.0 132.9014691918333 0.0 - - - - - - - 340.625 69 8 TOR2A torsin family 2, member A 629 80 B20140404_SF100_02 B20140404_SF100_02 TB154622.[MT7]-SWVQGNLTAC[CAM]GR.2y9_1.heavy 746.876 / 976.463 43311.0 28.637300491333008 48 18 10 10 10 5.500750696455809 18.179336879315592 0.0 3 0.9831927327273456 9.50612801067913 43311.0 46.62941215323646 0.0 - - - - - - - 302.6 86 5 TOR2A torsin family 2, member A 631 80 B20140404_SF100_02 B20140404_SF100_02 TB154622.[MT7]-SWVQGNLTAC[CAM]GR.2y10_1.heavy 746.876 / 1075.53 18173.0 28.637300491333008 48 18 10 10 10 5.500750696455809 18.179336879315592 0.0 3 0.9831927327273456 9.50612801067913 18173.0 34.93654290429043 0.0 - - - - - - - 218.44444444444446 36 9 TOR2A torsin family 2, member A 633 80 B20140404_SF100_02 B20140404_SF100_02 TB154622.[MT7]-SWVQGNLTAC[CAM]GR.2y7_1.heavy 746.876 / 791.383 7269.0 28.637300491333008 48 18 10 10 10 5.500750696455809 18.179336879315592 0.0 3 0.9831927327273456 9.50612801067913 7269.0 50.92203024938256 0.0 - - - - - - - 268.8888888888889 14 9 TOR2A torsin family 2, member A 635 81 B20140404_SF100_02 B20140404_SF100_02 TB501564.[MT7]-LLETLR.2y4_1.heavy 444.785 / 518.293 52125.0 31.34760093688965 48 18 10 10 10 3.01039976031647 25.75600299298738 0.0 3 0.9842811938290142 9.830646086208095 52125.0 27.71261830716501 0.0 - - - - - - - 1803.0 104 7 B3GALTL;CNNM1;PPFIA3 beta 1,3-galactosyltransferase-like;cyclin M1;protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3 637 81 B20140404_SF100_02 B20140404_SF100_02 TB501564.[MT7]-LLETLR.2b3_1.heavy 444.785 / 500.32 48355.0 31.34760093688965 48 18 10 10 10 3.01039976031647 25.75600299298738 0.0 3 0.9842811938290142 9.830646086208095 48355.0 38.10642164355941 1.0 - - - - - - - 369.0 96 4 B3GALTL;CNNM1;PPFIA3 beta 1,3-galactosyltransferase-like;cyclin M1;protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3 639 81 B20140404_SF100_02 B20140404_SF100_02 TB501564.[MT7]-LLETLR.2y5_1.heavy 444.785 / 631.377 180636.0 31.34760093688965 48 18 10 10 10 3.01039976031647 25.75600299298738 0.0 3 0.9842811938290142 9.830646086208095 180636.0 155.9256857382269 0.0 - - - - - - - 492.0 361 1 B3GALTL;CNNM1;PPFIA3 beta 1,3-galactosyltransferase-like;cyclin M1;protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3 641 81 B20140404_SF100_02 B20140404_SF100_02 TB501564.[MT7]-LLETLR.2b4_1.heavy 444.785 / 601.368 58682.0 31.34760093688965 48 18 10 10 10 3.01039976031647 25.75600299298738 0.0 3 0.9842811938290142 9.830646086208095 58682.0 36.28664298149501 0.0 - - - - - - - 983.0 117 1 B3GALTL;CNNM1;PPFIA3 beta 1,3-galactosyltransferase-like;cyclin M1;protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3 643 82 B20140404_SF100_02 B20140404_SF100_02 TB154327.[MT7]-VLAMEDK[MT7].2y4_1.heavy 547.312 / 666.325 11869.0 27.243999481201172 50 20 10 10 10 12.468226064268421 8.020387141245465 0.0 3 0.9985692538005634 32.62340406967922 11869.0 8.452720820733347 1.0 - - - - - - - 765.7142857142857 23 7 ANGPT2 angiopoietin 2 645 82 B20140404_SF100_02 B20140404_SF100_02 TB154327.[MT7]-VLAMEDK[MT7].2y5_1.heavy 547.312 / 737.362 18250.0 27.243999481201172 50 20 10 10 10 12.468226064268421 8.020387141245465 0.0 3 0.9985692538005634 32.62340406967922 18250.0 61.8694900936876 0.0 - - - - - - - 276.6666666666667 36 6 ANGPT2 angiopoietin 2 647 82 B20140404_SF100_02 B20140404_SF100_02 TB154327.[MT7]-VLAMEDK[MT7].2y3_1.heavy 547.312 / 535.284 N/A 27.243999481201172 50 20 10 10 10 12.468226064268421 8.020387141245465 0.0 3 0.9985692538005634 32.62340406967922 9316.0 6.100827691142852 5.0 - - - - - - - 893.0 30 1 ANGPT2 angiopoietin 2 649 82 B20140404_SF100_02 B20140404_SF100_02 TB154327.[MT7]-VLAMEDK[MT7].2y6_1.heavy 547.312 / 850.446 18250.0 27.243999481201172 50 20 10 10 10 12.468226064268421 8.020387141245465 0.0 3 0.9985692538005634 32.62340406967922 18250.0 22.492598652570017 0.0 - - - - - - - 685.875 36 8 ANGPT2 angiopoietin 2 651 83 B20140404_SF100_02 B20140404_SF100_02 TB344924.[MT7]-LLPPLLLLLLSLPPRAR.3y7_1.heavy 680.458 / 796.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM145 transmembrane protein 145 653 83 B20140404_SF100_02 B20140404_SF100_02 TB344924.[MT7]-LLPPLLLLLLSLPPRAR.3y15_2.heavy 680.458 / 835.048 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM145 transmembrane protein 145 655 83 B20140404_SF100_02 B20140404_SF100_02 TB344924.[MT7]-LLPPLLLLLLSLPPRAR.3b5_1.heavy 680.458 / 678.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM145 transmembrane protein 145 657 83 B20140404_SF100_02 B20140404_SF100_02 TB344924.[MT7]-LLPPLLLLLLSLPPRAR.3y5_1.heavy 680.458 / 596.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM145 transmembrane protein 145 659 84 B20140404_SF100_02 B20140404_SF100_02 TB154513.[MT7]-SVPWVPILK[MT7].2b3_1.heavy 663.923 / 428.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 661 84 B20140404_SF100_02 B20140404_SF100_02 TB154513.[MT7]-SVPWVPILK[MT7].2y3_1.heavy 663.923 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 663 84 B20140404_SF100_02 B20140404_SF100_02 TB154513.[MT7]-SVPWVPILK[MT7].2y6_1.heavy 663.923 / 899.583 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 665 84 B20140404_SF100_02 B20140404_SF100_02 TB154513.[MT7]-SVPWVPILK[MT7].2y7_1.heavy 663.923 / 996.636 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 667 85 B20140404_SF100_02 B20140404_SF100_02 TB154122.[MT7]-GRPASQPTVIR.3y6_1.heavy 442.597 / 713.43 20519.0 21.519100189208984 50 20 10 10 10 7.948151557122327 12.581541668061192 0.0 3 0.9937875414771682 15.649682310505499 20519.0 43.68833923007868 0.0 - - - - - - - 643.875 41 8 OLFML2B olfactomedin-like 2B 669 85 B20140404_SF100_02 B20140404_SF100_02 TB154122.[MT7]-GRPASQPTVIR.3b6_1.heavy 442.597 / 741.412 31902.0 21.519100189208984 50 20 10 10 10 7.948151557122327 12.581541668061192 0.0 3 0.9937875414771682 15.649682310505499 31902.0 20.56239667244672 0.0 - - - - - - - 620.4444444444445 63 9 OLFML2B olfactomedin-like 2B 671 85 B20140404_SF100_02 B20140404_SF100_02 TB154122.[MT7]-GRPASQPTVIR.3y4_1.heavy 442.597 / 488.319 54160.0 21.519100189208984 50 20 10 10 10 7.948151557122327 12.581541668061192 0.0 3 0.9937875414771682 15.649682310505499 54160.0 50.14249586136452 0.0 - - - - - - - 733.5555555555555 108 9 OLFML2B olfactomedin-like 2B 673 85 B20140404_SF100_02 B20140404_SF100_02 TB154122.[MT7]-GRPASQPTVIR.3y5_1.heavy 442.597 / 585.372 157188.0 21.519100189208984 50 20 10 10 10 7.948151557122327 12.581541668061192 0.0 3 0.9937875414771682 15.649682310505499 157188.0 54.84114126408426 0.0 - - - - - - - 73.0 314 1 OLFML2B olfactomedin-like 2B 675 86 B20140404_SF100_02 B20140404_SF100_02 TB154793.[MT7]-GNLSSK[MT7]EDWVFLTR.3y6_1.heavy 647.354 / 821.467 17771.0 33.49660110473633 44 14 10 10 10 2.388373153365612 32.12836194941609 0.0 3 0.9478993774875002 5.383157113205028 17771.0 10.61826635865922 0.0 - - - - - - - 720.25 35 4 TMEM145 transmembrane protein 145 677 86 B20140404_SF100_02 B20140404_SF100_02 TB154793.[MT7]-GNLSSK[MT7]EDWVFLTR.3b10_2.heavy 647.354 / 702.872 7204.0 33.49660110473633 44 14 10 10 10 2.388373153365612 32.12836194941609 0.0 3 0.9478993774875002 5.383157113205028 7204.0 4.86135831381733 1.0 - - - - - - - 1235.2857142857142 14 7 TMEM145 transmembrane protein 145 679 86 B20140404_SF100_02 B20140404_SF100_02 TB154793.[MT7]-GNLSSK[MT7]EDWVFLTR.3y4_1.heavy 647.354 / 536.319 7845.0 33.49660110473633 44 14 10 10 10 2.388373153365612 32.12836194941609 0.0 3 0.9478993774875002 5.383157113205028 7845.0 6.157070024060105 1.0 - - - - - - - 832.4 15 5 TMEM145 transmembrane protein 145 681 86 B20140404_SF100_02 B20140404_SF100_02 TB154793.[MT7]-GNLSSK[MT7]EDWVFLTR.3b8_2.heavy 647.354 / 560.298 28657.0 33.49660110473633 44 14 10 10 10 2.388373153365612 32.12836194941609 0.0 3 0.9478993774875002 5.383157113205028 28657.0 1.5660010523707466 1.0 - - - - - - - 880.5 82 2 TMEM145 transmembrane protein 145 683 87 B20140404_SF100_02 B20140404_SF100_02 TB502003.[MT7]-ELVISIGDVSVSC[CAM]PSLR.3y6_1.heavy 659.027 / 719.351 287170.0 36.702598571777344 50 20 10 10 10 7.4449481740260355 13.431926947306415 0.0 3 0.9940716368251774 16.020651790428456 287170.0 116.53881044642304 0.0 - - - - - - - 679.0 574 2 RGS7BP regulator of G-protein signaling 7 binding protein 685 87 B20140404_SF100_02 B20140404_SF100_02 TB502003.[MT7]-ELVISIGDVSVSC[CAM]PSLR.3b4_1.heavy 659.027 / 599.388 156749.0 36.702598571777344 50 20 10 10 10 7.4449481740260355 13.431926947306415 0.0 3 0.9940716368251774 16.020651790428456 156749.0 56.49579912253341 0.0 - - - - - - - 1357.0 313 3 RGS7BP regulator of G-protein signaling 7 binding protein 687 87 B20140404_SF100_02 B20140404_SF100_02 TB502003.[MT7]-ELVISIGDVSVSC[CAM]PSLR.3b5_1.heavy 659.027 / 686.42 109249.0 36.702598571777344 50 20 10 10 10 7.4449481740260355 13.431926947306415 0.0 3 0.9940716368251774 16.020651790428456 109249.0 50.02107596150456 0.0 - - - - - - - 407.0 218 1 RGS7BP regulator of G-protein signaling 7 binding protein 689 87 B20140404_SF100_02 B20140404_SF100_02 TB502003.[MT7]-ELVISIGDVSVSC[CAM]PSLR.3y8_1.heavy 659.027 / 905.451 200856.0 36.702598571777344 50 20 10 10 10 7.4449481740260355 13.431926947306415 0.0 3 0.9940716368251774 16.020651790428456 200856.0 161.2974608766256 0.0 - - - - - - - 271.0 401 1 RGS7BP regulator of G-protein signaling 7 binding protein 691 88 B20140404_SF100_02 B20140404_SF100_02 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 1978580.0 33.976600646972656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1978580.0 178.05396107466726 0.0 - - - - - - - 345.0 3957 7 693 88 B20140404_SF100_02 B20140404_SF100_02 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 1001870.0 33.976600646972656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1001870.0 164.4585456087241 0.0 - - - - - - - 268.3333333333333 2003 3 695 88 B20140404_SF100_02 B20140404_SF100_02 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1351480.0 33.976600646972656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1351480.0 216.76958855576248 0.0 - - - - - - - 281.75 2702 4 697 89 B20140404_SF100_02 B20140404_SF100_02 TB501674.[MT7]-AQPGSPPPR.2y8_1.heavy 525.794 / 835.442 10413.0 18.549800872802734 50 20 10 10 10 14.69763609639689 6.803815208386802 0.0 3 0.9967384894344524 21.604034703740332 10413.0 28.909314099685677 0.0 - - - - - - - 229.0 20 6 SLC25A45 solute carrier family 25, member 45 699 89 B20140404_SF100_02 B20140404_SF100_02 TB501674.[MT7]-AQPGSPPPR.2y6_1.heavy 525.794 / 610.331 3635.0 18.549800872802734 50 20 10 10 10 14.69763609639689 6.803815208386802 0.0 3 0.9967384894344524 21.604034703740332 3635.0 13.373212002084024 0.0 - - - - - - - 237.92307692307693 7 13 SLC25A45 solute carrier family 25, member 45 701 89 B20140404_SF100_02 B20140404_SF100_02 TB501674.[MT7]-AQPGSPPPR.2b5_1.heavy 525.794 / 585.311 4421.0 18.549800872802734 50 20 10 10 10 14.69763609639689 6.803815208386802 0.0 3 0.9967384894344524 21.604034703740332 4421.0 12.152113033504966 1.0 - - - - - - - 206.2 9 5 SLC25A45 solute carrier family 25, member 45 703 89 B20140404_SF100_02 B20140404_SF100_02 TB501674.[MT7]-AQPGSPPPR.2y7_1.heavy 525.794 / 707.383 57913.0 18.549800872802734 50 20 10 10 10 14.69763609639689 6.803815208386802 0.0 3 0.9967384894344524 21.604034703740332 57913.0 105.20359028983219 0.0 - - - - - - - 368.5 115 2 SLC25A45 solute carrier family 25, member 45 705 90 B20140404_SF100_02 B20140404_SF100_02 TB154224.[MT7]-GLTGTAGK[MT7].2y4_1.heavy 496.803 / 520.321 11237.0 21.414499282836914 50 20 10 10 10 15.734029650327562 6.355650918575594 0.0 3 0.9972376788704788 23.476062909747057 11237.0 19.774880618125778 1.0 - - - - - - - 662.3 22 10 ANGPT2 angiopoietin 2 707 90 B20140404_SF100_02 B20140404_SF100_02 TB154224.[MT7]-GLTGTAGK[MT7].2y5_1.heavy 496.803 / 577.343 32297.0 21.414499282836914 50 20 10 10 10 15.734029650327562 6.355650918575594 0.0 3 0.9972376788704788 23.476062909747057 32297.0 50.842128970342394 0.0 - - - - - - - 725.5 64 12 ANGPT2 angiopoietin 2 709 90 B20140404_SF100_02 B20140404_SF100_02 TB154224.[MT7]-GLTGTAGK[MT7].2y6_1.heavy 496.803 / 678.39 34529.0 21.414499282836914 50 20 10 10 10 15.734029650327562 6.355650918575594 0.0 3 0.9972376788704788 23.476062909747057 34529.0 32.52282554778083 0.0 - - - - - - - 712.2857142857143 69 7 ANGPT2 angiopoietin 2 711 90 B20140404_SF100_02 B20140404_SF100_02 TB154224.[MT7]-GLTGTAGK[MT7].2y7_1.heavy 496.803 / 791.474 11386.0 21.414499282836914 50 20 10 10 10 15.734029650327562 6.355650918575594 0.0 3 0.9972376788704788 23.476062909747057 11386.0 28.99225950929987 0.0 - - - - - - - 648.5714285714286 22 7 ANGPT2 angiopoietin 2 713 91 B20140404_SF100_02 B20140404_SF100_02 TB501773.[MT7]-YYAGWADK[MT7].2y5_1.heavy 631.326 / 720.38 26661.0 29.139400482177734 48 18 10 10 10 5.175585258011673 19.321486366242844 0.0 3 0.9861122265715351 10.460252270158259 26661.0 26.989325620290884 0.0 - - - - - - - 282.0 53 5 ALDH2;ALDH1A2 aldehyde dehydrogenase 2 family (mitochondrial);aldehyde dehydrogenase 1 family, member A2 715 91 B20140404_SF100_02 B20140404_SF100_02 TB501773.[MT7]-YYAGWADK[MT7].2b4_1.heavy 631.326 / 599.295 14106.0 29.139400482177734 48 18 10 10 10 5.175585258011673 19.321486366242844 0.0 3 0.9861122265715351 10.460252270158259 14106.0 10.519892847459644 0.0 - - - - - - - 423.0 28 1 ALDH2;ALDH1A2 aldehyde dehydrogenase 2 family (mitochondrial);aldehyde dehydrogenase 1 family, member A2 717 91 B20140404_SF100_02 B20140404_SF100_02 TB501773.[MT7]-YYAGWADK[MT7].2y6_1.heavy 631.326 / 791.417 17915.0 29.139400482177734 48 18 10 10 10 5.175585258011673 19.321486366242844 0.0 3 0.9861122265715351 10.460252270158259 17915.0 34.14649822695036 0.0 - - - - - - - 785.5714285714286 35 7 ALDH2;ALDH1A2 aldehyde dehydrogenase 2 family (mitochondrial);aldehyde dehydrogenase 1 family, member A2 719 91 B20140404_SF100_02 B20140404_SF100_02 TB501773.[MT7]-YYAGWADK[MT7].2y7_1.heavy 631.326 / 954.48 17069.0 29.139400482177734 48 18 10 10 10 5.175585258011673 19.321486366242844 0.0 3 0.9861122265715351 10.460252270158259 17069.0 28.826635638297873 0.0 - - - - - - - 302.14285714285717 34 7 ALDH2;ALDH1A2 aldehyde dehydrogenase 2 family (mitochondrial);aldehyde dehydrogenase 1 family, member A2 721 92 B20140404_SF100_02 B20140404_SF100_02 TB154222.[MT7]-FPTQLSR.2y4_1.heavy 496.786 / 503.294 11343.0 27.88089942932129 50 20 10 10 10 10.650122113386521 9.389563700336018 0.0 3 0.9993969825426589 50.25457457313717 11343.0 9.132461367041849 2.0 - - - - - - - 717.6666666666666 28 3 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 723 92 B20140404_SF100_02 B20140404_SF100_02 TB154222.[MT7]-FPTQLSR.2y5_1.heavy 496.786 / 604.341 14501.0 27.88089942932129 50 20 10 10 10 10.650122113386521 9.389563700336018 0.0 3 0.9993969825426589 50.25457457313717 14501.0 7.007086476917379 1.0 - - - - - - - 431.0 38 1 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 725 92 B20140404_SF100_02 B20140404_SF100_02 TB154222.[MT7]-FPTQLSR.2b4_1.heavy 496.786 / 618.337 12060.0 27.88089942932129 50 20 10 10 10 10.650122113386521 9.389563700336018 0.0 3 0.9993969825426589 50.25457457313717 12060.0 5.706874917790632 1.0 - - - - - - - 144.0 24 1 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 727 92 B20140404_SF100_02 B20140404_SF100_02 TB154222.[MT7]-FPTQLSR.2y6_1.heavy 496.786 / 701.394 319744.0 27.88089942932129 50 20 10 10 10 10.650122113386521 9.389563700336018 0.0 3 0.9993969825426589 50.25457457313717 319744.0 183.71825885084155 0.0 - - - - - - - 1866.0 639 2 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 729 93 B20140404_SF100_02 B20140404_SF100_02 TB501772.[MT7]-DC[CAM]PQARPK[MT7].3y6_1.heavy 420.564 / 840.517 3013.0 18.032499313354492 35 5 10 10 10 2.4085150592014437 41.51935841877424 0.0 3 0.6556432634019392 2.039502870247448 3013.0 102.60021689497717 0.0 - - - - - - - 54.5 6 8 ZCCHC24 zinc finger, CCHC domain containing 24 731 93 B20140404_SF100_02 B20140404_SF100_02 TB501772.[MT7]-DC[CAM]PQARPK[MT7].3b4_1.heavy 420.564 / 645.278 29913.0 18.032499313354492 35 5 10 10 10 2.4085150592014437 41.51935841877424 0.0 3 0.6556432634019392 2.039502870247448 29913.0 116.1909917355372 0.0 - - - - - - - 240.625 59 16 ZCCHC24 zinc finger, CCHC domain containing 24 733 93 B20140404_SF100_02 B20140404_SF100_02 TB501772.[MT7]-DC[CAM]PQARPK[MT7].3y7_2.heavy 420.564 / 500.778 129670.0 18.032499313354492 35 5 10 10 10 2.4085150592014437 41.51935841877424 0.0 3 0.6556432634019392 2.039502870247448 129670.0 147.65624375023145 0.0 - - - - - - - 758.4444444444445 259 9 ZCCHC24 zinc finger, CCHC domain containing 24 735 93 B20140404_SF100_02 B20140404_SF100_02 TB501772.[MT7]-DC[CAM]PQARPK[MT7].3y5_1.heavy 420.564 / 743.464 11435.0 18.032499313354492 35 5 10 10 10 2.4085150592014437 41.51935841877424 0.0 3 0.6556432634019392 2.039502870247448 11435.0 45.49287712548684 0.0 - - - - - - - 201.07692307692307 22 13 ZCCHC24 zinc finger, CCHC domain containing 24 737 94 B20140404_SF100_02 B20140404_SF100_02 TB154221.[MT7]-TVTQEDR.2y5_1.heavy 496.76 / 648.295 19920.0 18.456899642944336 46 16 10 10 10 2.6935431601324913 37.12582054749075 0.0 3 0.9653931047929238 6.614858560092341 19920.0 20.888568514110844 0.0 - - - - - - - 202.9 39 10 SPAG8 sperm associated antigen 8 739 94 B20140404_SF100_02 B20140404_SF100_02 TB154221.[MT7]-TVTQEDR.2b4_1.heavy 496.76 / 574.332 5853.0 18.456899642944336 46 16 10 10 10 2.6935431601324913 37.12582054749075 0.0 3 0.9653931047929238 6.614858560092341 5853.0 10.506899130677978 0.0 - - - - - - - 287.0833333333333 11 12 SPAG8 sperm associated antigen 8 741 94 B20140404_SF100_02 B20140404_SF100_02 TB154221.[MT7]-TVTQEDR.2y6_1.heavy 496.76 / 747.363 28417.0 18.456899642944336 46 16 10 10 10 2.6935431601324913 37.12582054749075 0.0 3 0.9653931047929238 6.614858560092341 28417.0 40.02338825045615 0.0 - - - - - - - 764.7 56 10 SPAG8 sperm associated antigen 8 743 94 B20140404_SF100_02 B20140404_SF100_02 TB154221.[MT7]-TVTQEDR.2b5_1.heavy 496.76 / 703.374 18976.0 18.456899642944336 46 16 10 10 10 2.6935431601324913 37.12582054749075 0.0 3 0.9653931047929238 6.614858560092341 18976.0 111.55587878787878 0.0 - - - - - - - 229.66666666666666 37 15 SPAG8 sperm associated antigen 8 745 95 B20140404_SF100_02 B20140404_SF100_02 TB154659.[MT7]-SIC[CAM]LLGSLQFHR.3y7_1.heavy 525.625 / 844.442 30635.0 34.73030090332031 50 20 10 10 10 6.062011437851786 16.496174747475784 0.0 3 0.9931764389500464 14.931710687748545 30635.0 127.56213114754098 0.0 - - - - - - - 289.4 61 10 RGS7BP regulator of G-protein signaling 7 binding protein 747 95 B20140404_SF100_02 B20140404_SF100_02 TB154659.[MT7]-SIC[CAM]LLGSLQFHR.3b4_1.heavy 525.625 / 618.34 33683.0 34.73030090332031 50 20 10 10 10 6.062011437851786 16.496174747475784 0.0 3 0.9931764389500464 14.931710687748545 33683.0 45.93719036990849 0.0 - - - - - - - 304.8 67 5 RGS7BP regulator of G-protein signaling 7 binding protein 749 95 B20140404_SF100_02 B20140404_SF100_02 TB154659.[MT7]-SIC[CAM]LLGSLQFHR.3y4_1.heavy 525.625 / 587.305 25605.0 34.73030090332031 50 20 10 10 10 6.062011437851786 16.496174747475784 0.0 3 0.9931764389500464 14.931710687748545 25605.0 41.59042905635029 0.0 - - - - - - - 342.75 51 4 RGS7BP regulator of G-protein signaling 7 binding protein 751 95 B20140404_SF100_02 B20140404_SF100_02 TB154659.[MT7]-SIC[CAM]LLGSLQFHR.3b3_1.heavy 525.625 / 505.256 43437.0 34.73030090332031 50 20 10 10 10 6.062011437851786 16.496174747475784 0.0 3 0.9931764389500464 14.931710687748545 43437.0 37.13055881897144 0.0 - - - - - - - 406.3333333333333 86 3 RGS7BP regulator of G-protein signaling 7 binding protein 753 96 B20140404_SF100_02 B20140404_SF100_02 TB154794.[MT7]-QESEITYLVPWC[CAM]K[MT7].3b6_1.heavy 647.673 / 832.417 31951.0 36.07979965209961 43 13 10 10 10 2.3804629074875274 42.00863608731696 0.0 3 0.9267804084090738 4.53275772357511 31951.0 28.495195284844094 0.0 - - - - - - - 265.0 63 8 NIPSNAP3A nipsnap homolog 3A (C. elegans) 755 96 B20140404_SF100_02 B20140404_SF100_02 TB154794.[MT7]-QESEITYLVPWC[CAM]K[MT7].3b4_1.heavy 647.673 / 618.285 37182.0 36.07979965209961 43 13 10 10 10 2.3804629074875274 42.00863608731696 0.0 3 0.9267804084090738 4.53275772357511 37182.0 49.961669024045264 0.0 - - - - - - - 832.6666666666666 74 9 NIPSNAP3A nipsnap homolog 3A (C. elegans) 757 96 B20140404_SF100_02 B20140404_SF100_02 TB154794.[MT7]-QESEITYLVPWC[CAM]K[MT7].3b5_1.heavy 647.673 / 731.369 24741.0 36.07979965209961 43 13 10 10 10 2.3804629074875274 42.00863608731696 0.0 3 0.9267804084090738 4.53275772357511 24741.0 13.607943605576827 0.0 - - - - - - - 864.3333333333334 49 9 NIPSNAP3A nipsnap homolog 3A (C. elegans) 759 96 B20140404_SF100_02 B20140404_SF100_02 TB154794.[MT7]-QESEITYLVPWC[CAM]K[MT7].3y4_1.heavy 647.673 / 734.378 125967.0 36.07979965209961 43 13 10 10 10 2.3804629074875274 42.00863608731696 0.0 3 0.9267804084090738 4.53275772357511 125967.0 288.38604143706044 0.0 - - - - - - - 747.5714285714286 251 7 NIPSNAP3A nipsnap homolog 3A (C. elegans) 761 97 B20140404_SF100_02 B20140404_SF100_02 TB154782.[MT7]-AGGSPAPGPETPAISPSK[MT7].3y7_1.heavy 637.014 / 843.506 44102.0 24.95984935760498 44 18 10 6 10 6.322210503597931 15.817252516835783 0.03289985656738281 3 0.9872291415526634 10.90910308001716 44102.0 151.91936174289074 0.0 - - - - - - - 737.125 88 8 DUT deoxyuridine triphosphatase 763 97 B20140404_SF100_02 B20140404_SF100_02 TB154782.[MT7]-AGGSPAPGPETPAISPSK[MT7].3b6_1.heavy 637.014 / 585.311 117435.0 24.95984935760498 44 18 10 6 10 6.322210503597931 15.817252516835783 0.03289985656738281 3 0.9872291415526634 10.90910308001716 117435.0 124.30445682451253 0.0 - - - - - - - 1245.4285714285713 234 7 DUT deoxyuridine triphosphatase 765 97 B20140404_SF100_02 B20140404_SF100_02 TB154782.[MT7]-AGGSPAPGPETPAISPSK[MT7].3y4_1.heavy 637.014 / 562.332 57436.0 24.95984935760498 44 18 10 6 10 6.322210503597931 15.817252516835783 0.03289985656738281 3 0.9872291415526634 10.90910308001716 57436.0 82.38472509566228 0.0 - - - - - - - 726.625 114 8 DUT deoxyuridine triphosphatase 767 97 B20140404_SF100_02 B20140404_SF100_02 TB154782.[MT7]-AGGSPAPGPETPAISPSK[MT7].3b8_1.heavy 637.014 / 739.385 18889.0 24.95984935760498 44 18 10 6 10 6.322210503597931 15.817252516835783 0.03289985656738281 3 0.9872291415526634 10.90910308001716 18889.0 51.3648245614035 0.0 - - - - - - - 598.3333333333334 37 9 DUT deoxyuridine triphosphatase 769 98 B20140404_SF100_02 B20140404_SF100_02 TB154132.[MT7]-GNLSSK[MT7].2y4_1.heavy 447.268 / 578.363 6313.0 19.096599578857422 48 18 10 10 10 2.0345358138364396 37.76849668699621 0.0 3 0.9819980920259788 9.184371228508876 6313.0 24.530514285714283 0.0 - - - - - - - 687.6666666666666 12 9 TMEM145 transmembrane protein 145 771 98 B20140404_SF100_02 B20140404_SF100_02 TB154132.[MT7]-GNLSSK[MT7].2y5_1.heavy 447.268 / 692.406 9313.0 19.096599578857422 48 18 10 10 10 2.0345358138364396 37.76849668699621 0.0 3 0.9819980920259788 9.184371228508876 9313.0 40.106285662100454 0.0 - - - - - - - 258.53333333333336 18 15 TMEM145 transmembrane protein 145 773 98 B20140404_SF100_02 B20140404_SF100_02 TB154132.[MT7]-GNLSSK[MT7].2b4_1.heavy 447.268 / 516.29 2688.0 19.096599578857422 48 18 10 10 10 2.0345358138364396 37.76849668699621 0.0 3 0.9819980920259788 9.184371228508876 2688.0 2.411847628607277 1.0 - - - - - - - 604.4444444444445 6 9 TMEM145 transmembrane protein 145 775 98 B20140404_SF100_02 B20140404_SF100_02 TB154132.[MT7]-GNLSSK[MT7].2y3_1.heavy 447.268 / 465.279 20376.0 19.096599578857422 48 18 10 10 10 2.0345358138364396 37.76849668699621 0.0 3 0.9819980920259788 9.184371228508876 20376.0 65.28195342095914 0.0 - - - - - - - 243.22222222222223 40 9 TMEM145 transmembrane protein 145 777 99 B20140404_SF100_02 B20140404_SF100_02 TB154133.[MT7]-LEEFGR.2y4_1.heavy 447.744 / 508.251 26698.0 27.648799896240234 50 20 10 10 10 9.683602133729186 10.326735714563034 0.0 3 0.9956330386428315 18.668719181797027 26698.0 28.452541268659132 0.0 - - - - - - - 1318.0 53 8 HLA-DRA;VAV2 major histocompatibility complex, class II, DR alpha;vav 2 guanine nucleotide exchange factor 779 99 B20140404_SF100_02 B20140404_SF100_02 TB154133.[MT7]-LEEFGR.2b3_1.heavy 447.744 / 516.279 40580.0 27.648799896240234 50 20 10 10 10 9.683602133729186 10.326735714563034 0.0 3 0.9956330386428315 18.668719181797027 40580.0 25.759895653925007 0.0 - - - - - - - 1659.142857142857 81 7 HLA-DRA;VAV2 major histocompatibility complex, class II, DR alpha;vav 2 guanine nucleotide exchange factor 781 99 B20140404_SF100_02 B20140404_SF100_02 TB154133.[MT7]-LEEFGR.2y5_1.heavy 447.744 / 637.294 95978.0 27.648799896240234 50 20 10 10 10 9.683602133729186 10.326735714563034 0.0 3 0.9956330386428315 18.668719181797027 95978.0 103.4460288184438 0.0 - - - - - - - 1659.0 191 7 HLA-DRA;VAV2 major histocompatibility complex, class II, DR alpha;vav 2 guanine nucleotide exchange factor 783 99 B20140404_SF100_02 B20140404_SF100_02 TB154133.[MT7]-LEEFGR.2b4_1.heavy 447.744 / 663.347 15752.0 27.648799896240234 50 20 10 10 10 9.683602133729186 10.326735714563034 0.0 3 0.9956330386428315 18.668719181797027 15752.0 15.264368010371381 0.0 - - - - - - - 734.0 31 10 HLA-DRA;VAV2 major histocompatibility complex, class II, DR alpha;vav 2 guanine nucleotide exchange factor 785 100 B20140404_SF100_02 B20140404_SF100_02 TB501684.[MT7]-LTILPISR.2y6_1.heavy 528.849 / 698.456 28621.0 34.35929870605469 42 20 10 10 2 7.315697915850842 13.66923582004816 0.0 11 0.9987771692558255 35.28864067223542 28621.0 29.179830159045068 0.0 - - - - - - - 768.4285714285714 57 7 IQSEC3 IQ motif and Sec7 domain 3 787 100 B20140404_SF100_02 B20140404_SF100_02 TB501684.[MT7]-LTILPISR.2y7_2.heavy 528.849 / 400.255 2214.0 34.35929870605469 42 20 10 10 2 7.315697915850842 13.66923582004816 0.0 11 0.9987771692558255 35.28864067223542 2214.0 0.5991551486897231 23.0 - - - - - - - 158.0 13 2 IQSEC3 IQ motif and Sec7 domain 3 789 100 B20140404_SF100_02 B20140404_SF100_02 TB501684.[MT7]-LTILPISR.2y7_1.heavy 528.849 / 799.504 98989.0 34.35929870605469 42 20 10 10 2 7.315697915850842 13.66923582004816 0.0 11 0.9987771692558255 35.28864067223542 98989.0 98.99187937071935 0.0 - - - - - - - 395.0 197 6 IQSEC3 IQ motif and Sec7 domain 3 791 101 B20140404_SF100_02 B20140404_SF100_02 TB502017.[MT7]-NDGEESTDRTPLLPGAPR.3y10_2.heavy 690.351 / 539.33 20141.0 27.739999771118164 39 9 10 10 10 0.6402098795183251 89.7309275698302 0.0 3 0.8054652472179366 2.7514260494525677 20141.0 22.42623189469407 0.0 - - - - - - - 302.6 40 5 SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 793 101 B20140404_SF100_02 B20140404_SF100_02 TB502017.[MT7]-NDGEESTDRTPLLPGAPR.3b4_1.heavy 690.351 / 560.243 8150.0 27.739999771118164 39 9 10 10 10 0.6402098795183251 89.7309275698302 0.0 3 0.8054652472179366 2.7514260494525677 8150.0 11.459095183891879 0.0 - - - - - - - 232.66666666666666 16 3 SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 795 101 B20140404_SF100_02 B20140404_SF100_02 TB502017.[MT7]-NDGEESTDRTPLLPGAPR.3y8_1.heavy 690.351 / 820.504 10129.0 27.739999771118164 39 9 10 10 10 0.6402098795183251 89.7309275698302 0.0 3 0.8054652472179366 2.7514260494525677 10129.0 15.210429843092964 0.0 - - - - - - - 698.5 20 8 SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 797 101 B20140404_SF100_02 B20140404_SF100_02 TB502017.[MT7]-NDGEESTDRTPLLPGAPR.3y16_2.heavy 690.351 / 848.437 16649.0 27.739999771118164 39 9 10 10 10 0.6402098795183251 89.7309275698302 0.0 3 0.8054652472179366 2.7514260494525677 16649.0 22.103929127647095 0.0 - - - - - - - 302.6 33 5 SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 799 102 B20140404_SF100_02 B20140404_SF100_02 TB502016.[MT7]-SYVSSLLAHYLFQGGLR.3y7_1.heavy 685.71 / 790.457 156015.0 40.77470016479492 47 17 10 10 10 2.8866168041543623 28.162153879978682 0.0 3 0.9733440497570185 7.542161449854511 156015.0 78.78111147890918 0.0 - - - - - - - 317.25 312 4 TOR2A torsin family 2, member A 801 102 B20140404_SF100_02 B20140404_SF100_02 TB502016.[MT7]-SYVSSLLAHYLFQGGLR.3b5_1.heavy 685.71 / 668.337 54800.0 40.77470016479492 47 17 10 10 10 2.8866168041543623 28.162153879978682 0.0 3 0.9733440497570185 7.542161449854511 54800.0 33.62001110248188 0.0 - - - - - - - 1224.4444444444443 109 9 TOR2A torsin family 2, member A 803 102 B20140404_SF100_02 B20140404_SF100_02 TB502016.[MT7]-SYVSSLLAHYLFQGGLR.3y8_1.heavy 685.71 / 953.52 139341.0 40.77470016479492 47 17 10 10 10 2.8866168041543623 28.162153879978682 0.0 3 0.9733440497570185 7.542161449854511 139341.0 56.66198871573431 0.0 - - - - - - - 292.75 278 4 TOR2A torsin family 2, member A 805 102 B20140404_SF100_02 B20140404_SF100_02 TB502016.[MT7]-SYVSSLLAHYLFQGGLR.3b12_2.heavy 685.71 / 763.412 73717.0 40.77470016479492 47 17 10 10 10 2.8866168041543623 28.162153879978682 0.0 3 0.9733440497570185 7.542161449854511 73717.0 74.98053316507765 0.0 - - - - - - - 741.3 147 10 TOR2A torsin family 2, member A 807 103 B20140404_SF100_02 B20140404_SF100_02 TB501785.[MT7]-AAC[CAM]TIQTAFR.2y8_1.heavy 641.838 / 996.493 17271.0 28.637300491333008 50 20 10 10 10 9.329455852420704 10.718738754099267 0.0 3 0.9940159011543813 15.945795155082617 17271.0 41.57833333333333 0.0 - - - - - - - 233.1818181818182 34 11 IQSEC3 IQ motif and Sec7 domain 3 809 103 B20140404_SF100_02 B20140404_SF100_02 TB501785.[MT7]-AAC[CAM]TIQTAFR.2b4_1.heavy 641.838 / 548.262 8905.0 28.637300491333008 50 20 10 10 10 9.329455852420704 10.718738754099267 0.0 3 0.9940159011543813 15.945795155082617 8905.0 3.932692251866785 1.0 - - - - - - - 270.0 22 2 IQSEC3 IQ motif and Sec7 domain 3 811 103 B20140404_SF100_02 B20140404_SF100_02 TB501785.[MT7]-AAC[CAM]TIQTAFR.2y9_1.heavy 641.838 / 1067.53 31708.0 28.637300491333008 50 20 10 10 10 9.329455852420704 10.718738754099267 0.0 3 0.9940159011543813 15.945795155082617 31708.0 52.58554668693779 0.0 - - - - - - - 725.625 63 8 IQSEC3 IQ motif and Sec7 domain 3 813 103 B20140404_SF100_02 B20140404_SF100_02 TB501785.[MT7]-AAC[CAM]TIQTAFR.2y7_1.heavy 641.838 / 836.463 14842.0 28.637300491333008 50 20 10 10 10 9.329455852420704 10.718738754099267 0.0 3 0.9940159011543813 15.945795155082617 14842.0 39.6886074074074 0.0 - - - - - - - 321.9230769230769 29 13 IQSEC3 IQ motif and Sec7 domain 3 815 104 B20140404_SF100_02 B20140404_SF100_02 TB501905.[MT7]-RPIPHPAYNPK[MT7].3y3_1.heavy 526.643 / 502.311 16537.0 21.982999801635742 44 14 10 10 10 5.9034634465408855 16.93920880607716 0.0 3 0.9464760098894697 5.310455053749466 16537.0 15.814438875821239 0.0 - - - - - - - 1236.625 33 8 GZMH;GZMB granzyme H (cathepsin G-like 2, protein h-CCPX);granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 817 104 B20140404_SF100_02 B20140404_SF100_02 TB501905.[MT7]-RPIPHPAYNPK[MT7].3b5_1.heavy 526.643 / 745.459 52283.0 21.982999801635742 44 14 10 10 10 5.9034634465408855 16.93920880607716 0.0 3 0.9464760098894697 5.310455053749466 52283.0 250.8916024487623 0.0 - - - - - - - 335.14285714285717 104 14 GZMH;GZMB granzyme H (cathepsin G-like 2, protein h-CCPX);granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 819 104 B20140404_SF100_02 B20140404_SF100_02 TB501905.[MT7]-RPIPHPAYNPK[MT7].3y4_1.heavy 526.643 / 665.374 28236.0 21.982999801635742 44 14 10 10 10 5.9034634465408855 16.93920880607716 0.0 3 0.9464760098894697 5.310455053749466 28236.0 52.956452311767784 0.0 - - - - - - - 650.1428571428571 56 14 GZMH;GZMB granzyme H (cathepsin G-like 2, protein h-CCPX);granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 821 104 B20140404_SF100_02 B20140404_SF100_02 TB501905.[MT7]-RPIPHPAYNPK[MT7].3b3_1.heavy 526.643 / 511.347 11915.0 21.982999801635742 44 14 10 10 10 5.9034634465408855 16.93920880607716 0.0 3 0.9464760098894697 5.310455053749466 11915.0 10.27859446152527 0.0 - - - - - - - 1702.4285714285713 23 7 GZMH;GZMB granzyme H (cathepsin G-like 2, protein h-CCPX);granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 823 105 B20140404_SF100_02 B20140404_SF100_02 TB501789.[MT7]-AAPDSGLPLFR.2y4_1.heavy 644.362 / 532.324 15907.0 34.35929870605469 45 15 10 10 10 2.48958895278874 31.244468865498717 0.0 3 0.9562187732464766 5.87653107993538 15907.0 26.303916518628306 0.0 - - - - - - - 918.0 31 7 TMEM145 transmembrane protein 145 825 105 B20140404_SF100_02 B20140404_SF100_02 TB501789.[MT7]-AAPDSGLPLFR.2y9_1.heavy 644.362 / 1001.54 81144.0 34.35929870605469 45 15 10 10 10 2.48958895278874 31.244468865498717 0.0 3 0.9562187732464766 5.87653107993538 81144.0 73.02571565342268 0.0 - - - - - - - 401.5 162 4 TMEM145 transmembrane protein 145 827 105 B20140404_SF100_02 B20140404_SF100_02 TB501789.[MT7]-AAPDSGLPLFR.2y10_1.heavy 644.362 / 1072.58 25709.0 34.35929870605469 45 15 10 10 10 2.48958895278874 31.244468865498717 0.0 3 0.9562187732464766 5.87653107993538 25709.0 40.45949706874189 0.0 - - - - - - - 275.42857142857144 51 7 TMEM145 transmembrane protein 145 829 105 B20140404_SF100_02 B20140404_SF100_02 TB501789.[MT7]-AAPDSGLPLFR.2y7_1.heavy 644.362 / 789.462 44830.0 34.35929870605469 45 15 10 10 10 2.48958895278874 31.244468865498717 0.0 3 0.9562187732464766 5.87653107993538 44830.0 42.458743897421876 0.0 - - - - - - - 321.0 89 1 TMEM145 transmembrane protein 145 831 106 B20140404_SF100_02 B20140404_SF100_02 TB344518.[MT7]-ELLDTR.2y4_1.heavy 445.757 / 504.278 28637.0 26.224199295043945 41 11 10 10 10 2.2321479398526787 44.79989798821308 0.0 3 0.8758891502535702 3.4662503483219806 28637.0 13.859170024297974 1.0 - - - - - - - 2758.5714285714284 57 7 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 833 106 B20140404_SF100_02 B20140404_SF100_02 TB344518.[MT7]-ELLDTR.2b3_1.heavy 445.757 / 500.32 97944.0 26.224199295043945 41 11 10 10 10 2.2321479398526787 44.79989798821308 0.0 3 0.8758891502535702 3.4662503483219806 97944.0 51.66580535966149 0.0 - - - - - - - 1236.0 195 4 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 835 106 B20140404_SF100_02 B20140404_SF100_02 TB344518.[MT7]-ELLDTR.2y5_1.heavy 445.757 / 617.362 108392.0 26.224199295043945 41 11 10 10 10 2.2321479398526787 44.79989798821308 0.0 3 0.8758891502535702 3.4662503483219806 108392.0 51.68264525271611 0.0 - - - - - - - 653.0 216 1 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 837 106 B20140404_SF100_02 B20140404_SF100_02 TB344518.[MT7]-ELLDTR.2b4_1.heavy 445.757 / 615.347 1040950.0 26.224199295043945 41 11 10 10 10 2.2321479398526787 44.79989798821308 0.0 3 0.8758891502535702 3.4662503483219806 1040950.0 825.2512254532676 0.0 - - - - - - - 653.0 2081 1 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 839 107 B20140404_SF100_02 B20140404_SF100_02 TB501900.[MT7]-TPNAQEAEGQQTR.2y8_1.heavy 787.388 / 918.428 3992.0 19.71339988708496 47 17 10 10 10 7.544618484833706 13.254480687263555 0.0 3 0.9798971896011899 8.689679128384173 3992.0 50.13409365934521 0.0 - - - - - - - 146.15384615384616 7 13 SPIN2B;SPIN2A spindlin family, member 2B;spindlin family, member 2A 841 107 B20140404_SF100_02 B20140404_SF100_02 TB501900.[MT7]-TPNAQEAEGQQTR.2y5_1.heavy 787.388 / 589.305 9885.0 19.71339988708496 47 17 10 10 10 7.544618484833706 13.254480687263555 0.0 3 0.9798971896011899 8.689679128384173 9885.0 26.00289629398941 0.0 - - - - - - - 185.66666666666666 19 15 SPIN2B;SPIN2A spindlin family, member 2B;spindlin family, member 2A 843 107 B20140404_SF100_02 B20140404_SF100_02 TB501900.[MT7]-TPNAQEAEGQQTR.2y10_1.heavy 787.388 / 1117.52 3865.0 19.71339988708496 47 17 10 10 10 7.544618484833706 13.254480687263555 0.0 3 0.9798971896011899 8.689679128384173 3865.0 13.901293699068068 0.0 - - - - - - - 183.9 7 10 SPIN2B;SPIN2A spindlin family, member 2B;spindlin family, member 2A 845 107 B20140404_SF100_02 B20140404_SF100_02 TB501900.[MT7]-TPNAQEAEGQQTR.2y7_1.heavy 787.388 / 789.385 7033.0 19.71339988708496 47 17 10 10 10 7.544618484833706 13.254480687263555 0.0 3 0.9798971896011899 8.689679128384173 7033.0 37.090281667310876 0.0 - - - - - - - 171.71428571428572 14 14 SPIN2B;SPIN2A spindlin family, member 2B;spindlin family, member 2A 847 108 B20140404_SF100_02 B20140404_SF100_02 TB154645.[MT7]-FIPGK[MT7]PVLETR.3y10_2.heavy 515.652 / 627.388 184505.0 29.59819984436035 42 14 10 10 8 1.5296398391479 50.56695501866026 0.0 4 0.9475006327889904 5.362493308315338 184505.0 66.75837144069703 0.0 - - - - - - - 1445.0 369 1 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 849 108 B20140404_SF100_02 B20140404_SF100_02 TB154645.[MT7]-FIPGK[MT7]PVLETR.3y6_1.heavy 515.652 / 714.414 373025.0 29.59819984436035 42 14 10 10 8 1.5296398391479 50.56695501866026 0.0 4 0.9475006327889904 5.362493308315338 373025.0 255.54434963094627 0.0 - - - - - - - 321.0 746 2 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 851 108 B20140404_SF100_02 B20140404_SF100_02 TB154645.[MT7]-FIPGK[MT7]PVLETR.3y4_1.heavy 515.652 / 518.293 75793.0 29.59819984436035 42 14 10 10 8 1.5296398391479 50.56695501866026 0.0 4 0.9475006327889904 5.362493308315338 75793.0 52.50133124895044 1.0 - - - - - - - 802.6666666666666 199 3 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 853 108 B20140404_SF100_02 B20140404_SF100_02 TB154645.[MT7]-FIPGK[MT7]PVLETR.3y8_1.heavy 515.652 / 1043.63 N/A 29.59819984436035 42 14 10 10 8 1.5296398391479 50.56695501866026 0.0 4 0.9475006327889904 5.362493308315338 963.0 10.16832298136646 0.0 - - - - - - - 0.0 1 0 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 855 109 B20140404_SF100_02 B20140404_SF100_02 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1504810.0 31.967899322509766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1504810.0 205.01868022342308 0.0 - - - - - - - 4676.0 3009 1 857 109 B20140404_SF100_02 B20140404_SF100_02 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 402803.0 31.967899322509766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 402803.0 95.38705932912428 0.0 - - - - - - - 1837.0 805 1 859 109 B20140404_SF100_02 B20140404_SF100_02 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 571781.0 31.967899322509766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 571781.0 108.77885079199734 0.0 - - - - - - - 2797.25 1143 4 861 110 B20140404_SF100_02 B20140404_SF100_02 TB154649.[MT7]-DAPLEYDDSVQR.2y8_1.heavy 776.374 / 1011.44 7401.0 26.86359977722168 43 18 10 5 10 4.423245941952556 22.60783173993191 0.04380035400390625 3 0.9877006857652897 11.116697469374605 7401.0 10.459185298496504 0.0 - - - - - - - 738.4285714285714 14 7 ANGPT2 angiopoietin 2 863 110 B20140404_SF100_02 B20140404_SF100_02 TB154649.[MT7]-DAPLEYDDSVQR.2y5_1.heavy 776.374 / 604.305 10103.0 26.86359977722168 43 18 10 5 10 4.423245941952556 22.60783173993191 0.04380035400390625 3 0.9877006857652897 11.116697469374605 10103.0 7.875994623655915 0.0 - - - - - - - 293.5 20 2 ANGPT2 angiopoietin 2 865 110 B20140404_SF100_02 B20140404_SF100_02 TB154649.[MT7]-DAPLEYDDSVQR.2y10_1.heavy 776.374 / 1221.57 16447.0 26.86359977722168 43 18 10 5 10 4.423245941952556 22.60783173993191 0.04380035400390625 3 0.9877006857652897 11.116697469374605 16447.0 16.257326426028644 0.0 - - - - - - - 117.0 32 1 ANGPT2 angiopoietin 2 867 110 B20140404_SF100_02 B20140404_SF100_02 TB154649.[MT7]-DAPLEYDDSVQR.2y7_1.heavy 776.374 / 882.395 9868.0 26.86359977722168 43 18 10 5 10 4.423245941952556 22.60783173993191 0.04380035400390625 3 0.9877006857652897 11.116697469374605 9868.0 8.157407883968254 0.0 - - - - - - - 352.2 19 5 ANGPT2 angiopoietin 2 869 111 B20140404_SF100_02 B20140404_SF100_02 TB154785.[MT7]-LELQLLEHSLSTNK[MT7].4y4_1.heavy 479.029 / 593.338 36033.0 35.34749984741211 48 18 10 10 10 3.2331133089650623 27.421224306884145 0.0 3 0.9823878293945034 9.285738604450923 36033.0 44.77898807274218 0.0 - - - - - - - 729.2222222222222 72 9 ANGPT2 angiopoietin 2 871 111 B20140404_SF100_02 B20140404_SF100_02 TB154785.[MT7]-LELQLLEHSLSTNK[MT7].4b4_1.heavy 479.029 / 628.379 54122.0 35.34749984741211 48 18 10 10 10 3.2331133089650623 27.421224306884145 0.0 3 0.9823878293945034 9.285738604450923 54122.0 61.8490034163856 0.0 - - - - - - - 340.6666666666667 108 3 ANGPT2 angiopoietin 2 873 111 B20140404_SF100_02 B20140404_SF100_02 TB154785.[MT7]-LELQLLEHSLSTNK[MT7].4b5_1.heavy 479.029 / 741.463 16485.0 35.34749984741211 48 18 10 10 10 3.2331133089650623 27.421224306884145 0.0 3 0.9823878293945034 9.285738604450923 16485.0 35.637249410221415 0.0 - - - - - - - 237.25 32 8 ANGPT2 angiopoietin 2 875 111 B20140404_SF100_02 B20140404_SF100_02 TB154785.[MT7]-LELQLLEHSLSTNK[MT7].4b3_1.heavy 479.029 / 500.32 53684.0 35.34749984741211 48 18 10 10 10 3.2331133089650623 27.421224306884145 0.0 3 0.9823878293945034 9.285738604450923 53684.0 53.82112925194042 0.0 - - - - - - - 292.0 107 3 ANGPT2 angiopoietin 2 877 112 B20140404_SF100_02 B20140404_SF100_02 TB154783.[MT7]-QPPWEFLQVLEPGAR.3y7_1.heavy 637.68 / 741.425 23947.0 41.13370132446289 39 15 10 6 8 1.9641029009724127 40.49742895453064 0.03639984130859375 4 0.950768676660947 5.53915567011703 23947.0 9.404144355761675 1.0 - - - - - - - 1752.2 47 5 SPAG8 sperm associated antigen 8 879 112 B20140404_SF100_02 B20140404_SF100_02 TB154783.[MT7]-QPPWEFLQVLEPGAR.3y6_1.heavy 637.68 / 642.357 45307.0 41.13370132446289 39 15 10 6 8 1.9641029009724127 40.49742895453064 0.03639984130859375 4 0.950768676660947 5.53915567011703 45307.0 11.489740014494156 1.0 - - - - - - - 2253.0 90 1 SPAG8 sperm associated antigen 8 881 112 B20140404_SF100_02 B20140404_SF100_02 TB154783.[MT7]-QPPWEFLQVLEPGAR.3b5_1.heavy 637.68 / 782.395 28036.0 41.13370132446289 39 15 10 6 8 1.9641029009724127 40.49742895453064 0.03639984130859375 4 0.950768676660947 5.53915567011703 28036.0 7.592323797517919 1.0 - - - - - - - 1418.0 64 1 SPAG8 sperm associated antigen 8 883 112 B20140404_SF100_02 B20140404_SF100_02 TB154783.[MT7]-QPPWEFLQVLEPGAR.3y8_1.heavy 637.68 / 869.484 18857.0 41.13370132446289 39 15 10 6 8 1.9641029009724127 40.49742895453064 0.03639984130859375 4 0.950768676660947 5.53915567011703 18857.0 23.256970192651096 0.0 - - - - - - - 918.0 37 1 SPAG8 sperm associated antigen 8 885 113 B20140404_SF100_02 B20140404_SF100_02 TB344902.[MT7]-TFANFPSGSPVSASTLAR.2y9_1.heavy 977.511 / 901.51 4770.0 32.546600341796875 40 10 10 10 10 0.6147835851340344 84.77966702866638 0.0 3 0.8362922319372148 3.0075762301340943 4770.0 9.336570343471209 1.0 - - - - - - - 369.875 9 8 XIAP X-linked inhibitor of apoptosis 887 113 B20140404_SF100_02 B20140404_SF100_02 TB344902.[MT7]-TFANFPSGSPVSASTLAR.2b4_1.heavy 977.511 / 578.305 17765.0 32.546600341796875 40 10 10 10 10 0.6147835851340344 84.77966702866638 0.0 3 0.8362922319372148 3.0075762301340943 17765.0 28.18641337386018 0.0 - - - - - - - 427.4 35 5 XIAP X-linked inhibitor of apoptosis 889 113 B20140404_SF100_02 B20140404_SF100_02 TB344902.[MT7]-TFANFPSGSPVSASTLAR.2y13_1.heavy 977.511 / 1229.65 15298.0 32.546600341796875 40 10 10 10 10 0.6147835851340344 84.77966702866638 0.0 3 0.8362922319372148 3.0075762301340943 15298.0 22.19506775541832 0.0 - - - - - - - 328.5 30 2 XIAP X-linked inhibitor of apoptosis 891 113 B20140404_SF100_02 B20140404_SF100_02 TB344902.[MT7]-TFANFPSGSPVSASTLAR.2b5_1.heavy 977.511 / 725.374 23029.0 32.546600341796875 40 10 10 10 10 0.6147835851340344 84.77966702866638 0.0 3 0.8362922319372148 3.0075762301340943 23029.0 11.37115191683561 1.0 - - - - - - - 493.0 51 3 XIAP X-linked inhibitor of apoptosis 893 114 B20140404_SF100_02 B20140404_SF100_02 TB501653.[MT7]-LTNVAVVR.2b4_1.heavy 508.323 / 572.352 77655.0 27.786500930786133 50 20 10 10 10 5.045308999471392 15.538687254253102 0.0 3 0.9939350699675482 15.839071914112107 77655.0 71.9006864847023 0.0 - - - - - - - 1248.5714285714287 155 7 SBDS Shwachman-Bodian-Diamond syndrome 895 114 B20140404_SF100_02 B20140404_SF100_02 TB501653.[MT7]-LTNVAVVR.2y6_1.heavy 508.323 / 657.404 79902.0 27.786500930786133 50 20 10 10 10 5.045308999471392 15.538687254253102 0.0 3 0.9939350699675482 15.839071914112107 79902.0 48.91026315789473 0.0 - - - - - - - 811.5 159 6 SBDS Shwachman-Bodian-Diamond syndrome 897 114 B20140404_SF100_02 B20140404_SF100_02 TB501653.[MT7]-LTNVAVVR.2b5_1.heavy 508.323 / 643.39 77031.0 27.786500930786133 50 20 10 10 10 5.045308999471392 15.538687254253102 0.0 3 0.9939350699675482 15.839071914112107 77031.0 62.223552503137476 0.0 - - - - - - - 1426.5714285714287 154 7 SBDS Shwachman-Bodian-Diamond syndrome 899 114 B20140404_SF100_02 B20140404_SF100_02 TB501653.[MT7]-LTNVAVVR.2y7_1.heavy 508.323 / 758.452 289272.0 27.786500930786133 50 20 10 10 10 5.045308999471392 15.538687254253102 0.0 3 0.9939350699675482 15.839071914112107 289272.0 79.62251206369595 0.0 - - - - - - - 811.5 578 2 SBDS Shwachman-Bodian-Diamond syndrome 901 115 B20140404_SF100_02 B20140404_SF100_02 TB344900.[MT7]-EWGFTGVQEVLSALLR.3b6_1.heavy 650.359 / 822.39 6247.0 45.54789924621582 38 11 10 7 10 1.391831633256204 48.62571061964188 0.02320098876953125 3 0.8739856768742909 3.4393995057650284 6247.0 25.140841679050638 0.0 - - - - - - - 215.25 12 32 SPAG8 sperm associated antigen 8 903 115 B20140404_SF100_02 B20140404_SF100_02 TB344900.[MT7]-EWGFTGVQEVLSALLR.3y6_1.heavy 650.359 / 672.44 7334.0 45.54789924621582 38 11 10 7 10 1.391831633256204 48.62571061964188 0.02320098876953125 3 0.8739856768742909 3.4393995057650284 7334.0 20.63498777023229 0.0 - - - - - - - 587.1111111111111 14 9 SPAG8 sperm associated antigen 8 905 115 B20140404_SF100_02 B20140404_SF100_02 TB344900.[MT7]-EWGFTGVQEVLSALLR.3b3_1.heavy 650.359 / 517.253 1531.0 45.54789924621582 38 11 10 7 10 1.391831633256204 48.62571061964188 0.02320098876953125 3 0.8739856768742909 3.4393995057650284 1531.0 6.932549295013776 2.0 - - - - - - - 220.2 5 35 SPAG8 sperm associated antigen 8 907 115 B20140404_SF100_02 B20140404_SF100_02 TB344900.[MT7]-EWGFTGVQEVLSALLR.3y5_1.heavy 650.359 / 559.356 11507.0 45.54789924621582 38 11 10 7 10 1.391831633256204 48.62571061964188 0.02320098876953125 3 0.8739856768742909 3.4393995057650284 11507.0 47.53086634426735 0.0 - - - - - - - 710.6666666666666 23 9 SPAG8 sperm associated antigen 8 909 116 B20140404_SF100_02 B20140404_SF100_02 TB501797.[MT7]-FILPVNEGK[MT7].2b3_1.heavy 652.894 / 518.346 70209.0 32.71353403727213 32 11 10 5 6 0.5497068084552127 97.31881288185511 0.049297332763671875 5 0.8679902845479149 3.3586272532244363 70209.0 31.735936579683212 0.0 - - - - - - - 335.0 140 1 SBDS Shwachman-Bodian-Diamond syndrome 911 116 B20140404_SF100_02 B20140404_SF100_02 TB501797.[MT7]-FILPVNEGK[MT7].2y4_1.heavy 652.894 / 591.322 11227.0 32.71353403727213 32 11 10 5 6 0.5497068084552127 97.31881288185511 0.049297332763671875 5 0.8679902845479149 3.3586272532244363 11227.0 5.939146196825942 2.0 - - - - - - - 770.8 84 5 SBDS Shwachman-Bodian-Diamond syndrome 913 116 B20140404_SF100_02 B20140404_SF100_02 TB501797.[MT7]-FILPVNEGK[MT7].2y5_1.heavy 652.894 / 690.39 N/A 32.71353403727213 32 11 10 5 6 0.5497068084552127 97.31881288185511 0.049297332763671875 5 0.8679902845479149 3.3586272532244363 4189.0 4.166976158986532 3.0 - - - - - - - 251.5 34 6 SBDS Shwachman-Bodian-Diamond syndrome 915 116 B20140404_SF100_02 B20140404_SF100_02 TB501797.[MT7]-FILPVNEGK[MT7].2y6_1.heavy 652.894 / 787.443 95846.0 32.71353403727213 32 11 10 5 6 0.5497068084552127 97.31881288185511 0.049297332763671875 5 0.8679902845479149 3.3586272532244363 95846.0 62.100558200401615 0.0 - - - - - - - 1627.7142857142858 191 7 SBDS Shwachman-Bodian-Diamond syndrome 917 117 B20140404_SF100_02 B20140404_SF100_02 TB344906.[MT7]-RLLPPLLLLLLSLPPR.3y6_1.heavy 656.779 / 682.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM145 transmembrane protein 145 919 117 B20140404_SF100_02 B20140404_SF100_02 TB344906.[MT7]-RLLPPLLLLLLSLPPR.3b8_1.heavy 656.779 / 1060.74 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM145 transmembrane protein 145 921 117 B20140404_SF100_02 B20140404_SF100_02 TB344906.[MT7]-RLLPPLLLLLLSLPPR.3y5_1.heavy 656.779 / 569.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM145 transmembrane protein 145 923 117 B20140404_SF100_02 B20140404_SF100_02 TB344906.[MT7]-RLLPPLLLLLLSLPPR.3b7_1.heavy 656.779 / 947.652 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM145 transmembrane protein 145 925 118 B20140404_SF100_02 B20140404_SF100_02 TB501798.[MT7]-FC[CAM]FLSDYGR.2b3_1.heavy 654.812 / 599.277 23561.0 34.81949996948242 47 17 10 10 10 3.3670508450316605 29.699581206965615 0.0 3 0.9754164840873888 7.855007927314651 23561.0 16.618752882019823 0.0 - - - - - - - 1310.142857142857 47 7 TMEM145 transmembrane protein 145 927 118 B20140404_SF100_02 B20140404_SF100_02 TB501798.[MT7]-FC[CAM]FLSDYGR.2y8_1.heavy 654.812 / 1017.45 45067.0 34.81949996948242 47 17 10 10 10 3.3670508450316605 29.699581206965615 0.0 3 0.9754164840873888 7.855007927314651 45067.0 86.11874633100643 0.0 - - - - - - - 745.8571428571429 90 7 TMEM145 transmembrane protein 145 929 118 B20140404_SF100_02 B20140404_SF100_02 TB501798.[MT7]-FC[CAM]FLSDYGR.2y5_1.heavy 654.812 / 597.263 22929.0 34.81949996948242 47 17 10 10 10 3.3670508450316605 29.699581206965615 0.0 3 0.9754164840873888 7.855007927314651 22929.0 10.68595206391478 0.0 - - - - - - - 843.6666666666666 45 3 TMEM145 transmembrane protein 145 931 118 B20140404_SF100_02 B20140404_SF100_02 TB501798.[MT7]-FC[CAM]FLSDYGR.2y7_1.heavy 654.812 / 857.415 20557.0 34.81949996948242 47 17 10 10 10 3.3670508450316605 29.699581206965615 0.0 3 0.9754164840873888 7.855007927314651 20557.0 21.28730051397145 0.0 - - - - - - - 813.5714285714286 41 7 TMEM145 transmembrane protein 145 933 119 B20140404_SF100_02 B20140404_SF100_02 TB344708.[MT7]-RVTLELGGK[MT7].3b4_1.heavy 420.934 / 614.411 44312.0 26.93000030517578 45 15 10 10 10 2.426921036410633 32.032889722553115 0.0 3 0.9530420823951374 5.672750312625916 44312.0 27.18648036345655 1.0 - - - - - - - 733.0 88 1 ALDH1A1;ALDH2;ALDH1B1;ALDH1A3;ALDH1A2 aldehyde dehydrogenase 1 family, member A1;aldehyde dehydrogenase 2 family (mitochondrial);aldehyde dehydrogenase 1 family, member B1;aldehyde dehydrogenase 1 family, member A3;aldehyde dehydrogenase 1 family, member A2 935 119 B20140404_SF100_02 B20140404_SF100_02 TB344708.[MT7]-RVTLELGGK[MT7].3b5_1.heavy 420.934 / 743.453 128850.0 26.93000030517578 45 15 10 10 10 2.426921036410633 32.032889722553115 0.0 3 0.9530420823951374 5.672750312625916 128850.0 60.02031586749666 2.0 - - - - - - - 750.8333333333334 262 6 ALDH1A1;ALDH2;ALDH1B1;ALDH1A3;ALDH1A2 aldehyde dehydrogenase 1 family, member A1;aldehyde dehydrogenase 2 family (mitochondrial);aldehyde dehydrogenase 1 family, member B1;aldehyde dehydrogenase 1 family, member A3;aldehyde dehydrogenase 1 family, member A2 937 119 B20140404_SF100_02 B20140404_SF100_02 TB344708.[MT7]-RVTLELGGK[MT7].3b3_1.heavy 420.934 / 501.327 43055.0 26.93000030517578 45 15 10 10 10 2.426921036410633 32.032889722553115 0.0 3 0.9530420823951374 5.672750312625916 43055.0 18.18853562513847 1.0 - - - - - - - 1467.0 101 1 ALDH1A1;ALDH2;ALDH1B1;ALDH1A3;ALDH1A2 aldehyde dehydrogenase 1 family, member A1;aldehyde dehydrogenase 2 family (mitochondrial);aldehyde dehydrogenase 1 family, member B1;aldehyde dehydrogenase 1 family, member A3;aldehyde dehydrogenase 1 family, member A2 939 119 B20140404_SF100_02 B20140404_SF100_02 TB344708.[MT7]-RVTLELGGK[MT7].3y4_1.heavy 420.934 / 518.342 138907.0 26.93000030517578 45 15 10 10 10 2.426921036410633 32.032889722553115 0.0 3 0.9530420823951374 5.672750312625916 138907.0 111.30012092375827 0.0 - - - - - - - 1735.857142857143 277 7 ALDH1A1;ALDH2;ALDH1B1;ALDH1A3;ALDH1A2 aldehyde dehydrogenase 1 family, member A1;aldehyde dehydrogenase 2 family (mitochondrial);aldehyde dehydrogenase 1 family, member B1;aldehyde dehydrogenase 1 family, member A3;aldehyde dehydrogenase 1 family, member A2 941 120 B20140404_SF100_02 B20140404_SF100_02 TB344707.[MT7]-GSLEVLNLK[MT7].2y5_1.heavy 630.892 / 730.494 11692.0 32.596500396728516 43 17 10 10 6 4.250834778740431 23.52479105989415 0.0 5 0.9752103304158389 7.822142565504292 11692.0 7.660560215448077 0.0 - - - - - - - 411.5 23 2 SBDS Shwachman-Bodian-Diamond syndrome 943 120 B20140404_SF100_02 B20140404_SF100_02 TB344707.[MT7]-GSLEVLNLK[MT7].2b4_1.heavy 630.892 / 531.289 26349.0 32.596500396728516 43 17 10 10 6 4.250834778740431 23.52479105989415 0.0 5 0.9752103304158389 7.822142565504292 26349.0 15.078186211527786 0.0 - - - - - - - 768.3333333333334 52 3 SBDS Shwachman-Bodian-Diamond syndrome 945 120 B20140404_SF100_02 B20140404_SF100_02 TB344707.[MT7]-GSLEVLNLK[MT7].2y3_1.heavy 630.892 / 518.342 14657.0 32.596500396728516 43 17 10 10 6 4.250834778740431 23.52479105989415 0.0 5 0.9752103304158389 7.822142565504292 14657.0 8.999395895543383 3.0 - - - - - - - 988.0 51 1 SBDS Shwachman-Bodian-Diamond syndrome 947 120 B20140404_SF100_02 B20140404_SF100_02 TB344707.[MT7]-GSLEVLNLK[MT7].2b5_1.heavy 630.892 / 630.358 N/A 32.596500396728516 43 17 10 10 6 4.250834778740431 23.52479105989415 0.0 5 0.9752103304158389 7.822142565504292 154965.0 2.066517092690243 3.0 - - - - - - - 35077.0 314 1 SBDS Shwachman-Bodian-Diamond syndrome 949 121 B20140404_SF100_02 B20140404_SF100_02 TB344522.[MT7]-REDGSVDFQR.3y7_1.heavy 451.561 / 808.395 13823.0 22.337600708007812 48 20 10 10 8 2.6582648146266044 27.431121619082443 0.0 4 0.9933745180491352 15.153521035301445 13823.0 15.760973830848675 0.0 - - - - - - - 235.8 27 15 ANGPT2 angiopoietin 2 951 121 B20140404_SF100_02 B20140404_SF100_02 TB344522.[MT7]-REDGSVDFQR.3b4_1.heavy 451.561 / 602.302 7967.0 22.337600708007812 48 20 10 10 8 2.6582648146266044 27.431121619082443 0.0 4 0.9933745180491352 15.153521035301445 7967.0 9.742603716786846 3.0 - - - - - - - 1225.6666666666667 19 9 ANGPT2 angiopoietin 2 953 121 B20140404_SF100_02 B20140404_SF100_02 TB344522.[MT7]-REDGSVDFQR.3y4_1.heavy 451.561 / 565.273 67683.0 22.337600708007812 48 20 10 10 8 2.6582648146266044 27.431121619082443 0.0 4 0.9933745180491352 15.153521035301445 67683.0 23.8821273631036 0.0 - - - - - - - 1255.888888888889 135 9 ANGPT2 angiopoietin 2 955 121 B20140404_SF100_02 B20140404_SF100_02 TB344522.[MT7]-REDGSVDFQR.3b7_1.heavy 451.561 / 903.429 N/A 22.337600708007812 48 20 10 10 8 2.6582648146266044 27.431121619082443 0.0 4 0.9933745180491352 15.153521035301445 817.0 2.4029411764705877 1.0 - - - - - - - 0.0 1 0 ANGPT2 angiopoietin 2 957 122 B20140404_SF100_02 B20140404_SF100_02 TB501915.[MT7]-EVQAEQEPTRK[MT7].3y10_2.heavy 534.961 / 665.366 59036.0 19.58300018310547 37 7 10 10 10 0.7264161050259614 79.48687459194048 0.0 3 0.7106516891239403 2.2365342177097363 59036.0 80.34363748863542 0.0 - - - - - - - 679.5555555555555 118 9 SPAG8 sperm associated antigen 8 959 122 B20140404_SF100_02 B20140404_SF100_02 TB501915.[MT7]-EVQAEQEPTRK[MT7].3y4_1.heavy 534.961 / 645.416 17962.0 19.58300018310547 37 7 10 10 10 0.7264161050259614 79.48687459194048 0.0 3 0.7106516891239403 2.2365342177097363 17962.0 65.91879611650485 0.0 - - - - - - - 271.5 35 14 SPAG8 sperm associated antigen 8 961 122 B20140404_SF100_02 B20140404_SF100_02 TB501915.[MT7]-EVQAEQEPTRK[MT7].3b3_1.heavy 534.961 / 501.279 26009.0 19.58300018310547 37 7 10 10 10 0.7264161050259614 79.48687459194048 0.0 3 0.7106516891239403 2.2365342177097363 26009.0 23.780697298945356 1.0 - - - - - - - 751.2222222222222 52 9 SPAG8 sperm associated antigen 8 963 122 B20140404_SF100_02 B20140404_SF100_02 TB501915.[MT7]-EVQAEQEPTRK[MT7].3y8_1.heavy 534.961 / 1102.6 129.0 19.58300018310547 37 7 10 10 10 0.7264161050259614 79.48687459194048 0.0 3 0.7106516891239403 2.2365342177097363 129.0 2.3784375 1.0 - - - - - - - 0.0 0 0 SPAG8 sperm associated antigen 8 965 123 B20140404_SF100_02 B20140404_SF100_02 TB501917.[MT7]-FSDEGGFTC[CAM]FFR.2y8_1.heavy 807.362 / 991.445 10481.0 37.31560134887695 31 13 0 10 8 1.197202398609415 58.40389228661581 0.0 4 0.9243304129144645 4.457838287615893 10481.0 17.667078592725105 1.0 - - - - - - - 283.55555555555554 95 9 MOG myelin oligodendrocyte glycoprotein 967 123 B20140404_SF100_02 B20140404_SF100_02 TB501917.[MT7]-FSDEGGFTC[CAM]FFR.2b4_1.heavy 807.362 / 623.279 10884.0 37.31560134887695 31 13 0 10 8 1.197202398609415 58.40389228661581 0.0 4 0.9243304129144645 4.457838287615893 10884.0 22.513035714285717 0.0 - - - - - - - 806.5714285714286 21 7 MOG myelin oligodendrocyte glycoprotein 969 123 B20140404_SF100_02 B20140404_SF100_02 TB501917.[MT7]-FSDEGGFTC[CAM]FFR.2y9_1.heavy 807.362 / 1120.49 11959.0 37.31560134887695 31 13 0 10 8 1.197202398609415 58.40389228661581 0.0 4 0.9243304129144645 4.457838287615893 11959.0 22.23689565142215 0.0 - - - - - - - 268.7 23 10 MOG myelin oligodendrocyte glycoprotein 971 123 B20140404_SF100_02 B20140404_SF100_02 TB501917.[MT7]-FSDEGGFTC[CAM]FFR.2b6_1.heavy 807.362 / 737.322 4166.0 37.31560134887695 31 13 0 10 8 1.197202398609415 58.40389228661581 0.0 4 0.9243304129144645 4.457838287615893 4166.0 4.105498857490448 0.0 - - - - - - - 779.5 8 10 MOG myelin oligodendrocyte glycoprotein 973 124 B20140404_SF100_02 B20140404_SF100_02 TB154772.[MT7]-AAIAQALAGEVSVVPPSR.2y12_1.heavy 940.54 / 1210.68 4444.0 34.497501373291016 44 14 10 10 10 2.351094220019264 28.955675921259484 0.0 3 0.9453863574358509 5.256723946977013 4444.0 11.021825553344563 0.0 - - - - - - - 255.22222222222223 8 9 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 975 124 B20140404_SF100_02 B20140404_SF100_02 TB154772.[MT7]-AAIAQALAGEVSVVPPSR.2y10_1.heavy 940.54 / 1026.56 13791.0 34.497501373291016 44 14 10 10 10 2.351094220019264 28.955675921259484 0.0 3 0.9453863574358509 5.256723946977013 13791.0 39.5413019642463 0.0 - - - - - - - 240.71428571428572 27 7 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 977 124 B20140404_SF100_02 B20140404_SF100_02 TB154772.[MT7]-AAIAQALAGEVSVVPPSR.2b5_1.heavy 940.54 / 599.363 11033.0 34.497501373291016 44 14 10 10 10 2.351094220019264 28.955675921259484 0.0 3 0.9453863574358509 5.256723946977013 11033.0 5.526636534331686 0.0 - - - - - - - 357.3333333333333 22 3 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 979 124 B20140404_SF100_02 B20140404_SF100_02 TB154772.[MT7]-AAIAQALAGEVSVVPPSR.2y11_1.heavy 940.54 / 1097.59 10726.0 34.497501373291016 44 14 10 10 10 2.351094220019264 28.955675921259484 0.0 3 0.9453863574358509 5.256723946977013 10726.0 19.978444076362123 0.0 - - - - - - - 284.42857142857144 21 7 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 981 125 B20140404_SF100_02 B20140404_SF100_02 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 932794.0 23.723800659179688 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 932794.0 313.8086444376705 0.0 - - - - - - - 1697.4285714285713 1865 7 983 125 B20140404_SF100_02 B20140404_SF100_02 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 1583360.0 23.723800659179688 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1583360.0 1048.6181351695259 0.0 - - - - - - - 258.3809523809524 3166 21 985 125 B20140404_SF100_02 B20140404_SF100_02 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 4807480.0 23.723800659179688 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 4807480.0 1049.0322489028185 0.0 - - - - - - - 706.5714285714286 9614 7 987 126 B20140404_SF100_02 B20140404_SF100_02 TB154356.[MT7]-LDEAQALAR.2y8_1.heavy 565.818 / 873.443 260985.0 27.152299880981445 48 18 10 10 10 8.98337803432143 11.131670026347013 0.0 3 0.9872153671439722 10.903212083346052 260985.0 265.09860542665535 0.0 - - - - - - - 223.5 521 4 C3orf70 chromosome 3 open reading frame 70 989 126 B20140404_SF100_02 B20140404_SF100_02 TB154356.[MT7]-LDEAQALAR.2y6_1.heavy 565.818 / 629.373 98013.0 27.152299880981445 48 18 10 10 10 8.98337803432143 11.131670026347013 0.0 3 0.9872153671439722 10.903212083346052 98013.0 92.5015464663224 0.0 - - - - - - - 1750.142857142857 196 7 C3orf70 chromosome 3 open reading frame 70 991 126 B20140404_SF100_02 B20140404_SF100_02 TB154356.[MT7]-LDEAQALAR.2b5_1.heavy 565.818 / 701.359 60748.0 27.152299880981445 48 18 10 10 10 8.98337803432143 11.131670026347013 0.0 3 0.9872153671439722 10.903212083346052 60748.0 39.350074937355124 1.0 - - - - - - - 255.0 121 1 C3orf70 chromosome 3 open reading frame 70 993 126 B20140404_SF100_02 B20140404_SF100_02 TB154356.[MT7]-LDEAQALAR.2y7_1.heavy 565.818 / 758.416 134513.0 27.152299880981445 48 18 10 10 10 8.98337803432143 11.131670026347013 0.0 3 0.9872153671439722 10.903212083346052 134513.0 207.5257354023356 0.0 - - - - - - - 287.0 269 4 C3orf70 chromosome 3 open reading frame 70 995 127 B20140404_SF100_02 B20140404_SF100_02 TB344914.[MT7]-IRPTVQEDGGDVIYK[MT7].4b8_2.heavy 495.277 / 542.299 89999.0 27.107799530029297 47 17 10 10 10 3.39188031600233 22.539390855560395 0.0 3 0.9770058171922318 8.123022610254912 89999.0 27.823109843550974 0.0 - - - - - - - 788.0 179 5 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 997 127 B20140404_SF100_02 B20140404_SF100_02 TB344914.[MT7]-IRPTVQEDGGDVIYK[MT7].4b11_2.heavy 495.277 / 656.834 488424.0 27.107799530029297 47 17 10 10 10 3.39188031600233 22.539390855560395 0.0 3 0.9770058171922318 8.123022610254912 488424.0 66.59697091824705 0.0 - - - - - - - 821.0 976 2 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 999 127 B20140404_SF100_02 B20140404_SF100_02 TB344914.[MT7]-IRPTVQEDGGDVIYK[MT7].4y3_1.heavy 495.277 / 567.362 111020.0 27.107799530029297 47 17 10 10 10 3.39188031600233 22.539390855560395 0.0 3 0.9770058171922318 8.123022610254912 111020.0 45.77732341831694 0.0 - - - - - - - 839.3333333333334 222 3 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1001 127 B20140404_SF100_02 B20140404_SF100_02 TB344914.[MT7]-IRPTVQEDGGDVIYK[MT7].4b6_1.heavy 495.277 / 839.522 24525.0 27.107799530029297 47 17 10 10 10 3.39188031600233 22.539390855560395 0.0 3 0.9770058171922318 8.123022610254912 24525.0 48.2589587874656 0.0 - - - - - - - 267.3333333333333 49 9 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1003 128 B20140404_SF100_02 B20140404_SF100_02 TB154211.[MT7]-DAIGEGK[MT7].2y4_1.heavy 489.279 / 534.3 109703.0 20.949199676513672 48 18 10 10 10 2.962910112721898 33.75060200801512 0.0 3 0.987820814450389 11.171499729242125 109703.0 218.07280381944446 0.0 - - - - - - - 732.1538461538462 219 13 MOG myelin oligodendrocyte glycoprotein 1005 128 B20140404_SF100_02 B20140404_SF100_02 TB154211.[MT7]-DAIGEGK[MT7].2y5_1.heavy 489.279 / 647.385 31091.0 20.949199676513672 48 18 10 10 10 2.962910112721898 33.75060200801512 0.0 3 0.987820814450389 11.171499729242125 31091.0 51.150312403070714 0.0 - - - - - - - 336.7692307692308 62 13 MOG myelin oligodendrocyte glycoprotein 1007 128 B20140404_SF100_02 B20140404_SF100_02 TB154211.[MT7]-DAIGEGK[MT7].2y6_1.heavy 489.279 / 718.422 41916.0 20.949199676513672 48 18 10 10 10 2.962910112721898 33.75060200801512 0.0 3 0.987820814450389 11.171499729242125 41916.0 45.580278301347946 0.0 - - - - - - - 1218.875 83 8 MOG myelin oligodendrocyte glycoprotein 1009 128 B20140404_SF100_02 B20140404_SF100_02 TB154211.[MT7]-DAIGEGK[MT7].2b5_1.heavy 489.279 / 630.321 31245.0 20.949199676513672 48 18 10 10 10 2.962910112721898 33.75060200801512 0.0 3 0.987820814450389 11.171499729242125 31245.0 38.78689655172414 0.0 - - - - - - - 710.0 62 12 MOG myelin oligodendrocyte glycoprotein 1011 129 B20140404_SF100_02 B20140404_SF100_02 TB501920.[MT7]-IGLNLFNINPDK[MT7].3y3_1.heavy 549.322 / 503.295 163904.0 37.84429931640625 41 11 10 10 10 0.9556408751314941 69.76121302627774 0.0 3 0.8701620821474813 3.387244714964865 163904.0 63.922540250242676 0.0 - - - - - - - 252.0 327 1 IQSEC3 IQ motif and Sec7 domain 3 1013 129 B20140404_SF100_02 B20140404_SF100_02 TB501920.[MT7]-IGLNLFNINPDK[MT7].3b4_1.heavy 549.322 / 542.342 90512.0 37.84429931640625 41 11 10 10 10 0.9556408751314941 69.76121302627774 0.0 3 0.8701620821474813 3.387244714964865 90512.0 56.598424300565625 0.0 - - - - - - - 1115.0 181 7 IQSEC3 IQ motif and Sec7 domain 3 1015 129 B20140404_SF100_02 B20140404_SF100_02 TB501920.[MT7]-IGLNLFNINPDK[MT7].3b5_1.heavy 549.322 / 655.426 104108.0 37.84429931640625 41 11 10 10 10 0.9556408751314941 69.76121302627774 0.0 3 0.8701620821474813 3.387244714964865 104108.0 46.971330546585264 0.0 - - - - - - - 504.0 208 1 IQSEC3 IQ motif and Sec7 domain 3 1017 129 B20140404_SF100_02 B20140404_SF100_02 TB501920.[MT7]-IGLNLFNINPDK[MT7].3b7_1.heavy 549.322 / 916.537 37136.0 37.84429931640625 41 11 10 10 10 0.9556408751314941 69.76121302627774 0.0 3 0.8701620821474813 3.387244714964865 37136.0 91.180231830516 1.0 - - - - - - - 283.5 79 8 IQSEC3 IQ motif and Sec7 domain 3 1019 130 B20140404_SF100_02 B20140404_SF100_02 TB501923.[MT7]-AAQHGIPRPLSSAGR.4y9_2.heavy 416.238 / 470.77 161235.0 23.05660057067871 27 9 0 10 8 1.7759134270964418 38.888356913936875 0.0 4 0.8186435088497245 2.8530046487710137 161235.0 53.93310375530618 0.0 - - - - - - - 791.2 322 15 DUT deoxyuridine triphosphatase 1021 130 B20140404_SF100_02 B20140404_SF100_02 TB501923.[MT7]-AAQHGIPRPLSSAGR.4y11_2.heavy 416.238 / 555.823 125700.0 23.05660057067871 27 9 0 10 8 1.7759134270964418 38.888356913936875 0.0 4 0.8186435088497245 2.8530046487710137 125700.0 67.59989492963524 0.0 - - - - - - - 718.2352941176471 251 17 DUT deoxyuridine triphosphatase 1023 130 B20140404_SF100_02 B20140404_SF100_02 TB501923.[MT7]-AAQHGIPRPLSSAGR.4y7_1.heavy 416.238 / 687.378 40923.0 23.05660057067871 27 9 0 10 8 1.7759134270964418 38.888356913936875 0.0 4 0.8186435088497245 2.8530046487710137 40923.0 2.1299501009941983 9.0 - - - - - - - 7843.0 1752 1 DUT deoxyuridine triphosphatase 1025 130 B20140404_SF100_02 B20140404_SF100_02 TB501923.[MT7]-AAQHGIPRPLSSAGR.4b3_1.heavy 416.238 / 415.242 81845.0 23.05660057067871 27 9 0 10 8 1.7759134270964418 38.888356913936875 0.0 4 0.8186435088497245 2.8530046487710137 81845.0 19.533954286439 1.0 - - - - - - - 955.0 236 1 DUT deoxyuridine triphosphatase 1027 131 B20140404_SF100_02 B20140404_SF100_02 TB154668.[MT7]-MNEFLENFEK[MT7].3y3_1.heavy 530.269 / 567.326 32451.0 35.81380081176758 46 16 10 10 10 2.96665337288863 26.510377848539676 0.0 3 0.9669520594139005 6.769971041542957 32451.0 13.342973534506669 0.0 - - - - - - - 360.5 64 2 NIPSNAP3A nipsnap homolog 3A (C. elegans) 1029 131 B20140404_SF100_02 B20140404_SF100_02 TB154668.[MT7]-MNEFLENFEK[MT7].3b4_1.heavy 530.269 / 666.304 76873.0 35.81380081176758 46 16 10 10 10 2.96665337288863 26.510377848539676 0.0 3 0.9669520594139005 6.769971041542957 76873.0 77.79431483371155 0.0 - - - - - - - 1731.0 153 7 NIPSNAP3A nipsnap homolog 3A (C. elegans) 1031 131 B20140404_SF100_02 B20140404_SF100_02 TB154668.[MT7]-MNEFLENFEK[MT7].3b5_1.heavy 530.269 / 779.388 18317.0 35.81380081176758 46 16 10 10 10 2.96665337288863 26.510377848539676 0.0 3 0.9669520594139005 6.769971041542957 18317.0 60.93962148740471 2.0 - - - - - - - 320.55555555555554 120 9 NIPSNAP3A nipsnap homolog 3A (C. elegans) 1033 131 B20140404_SF100_02 B20140404_SF100_02 TB154668.[MT7]-MNEFLENFEK[MT7].3b3_1.heavy 530.269 / 519.235 72835.0 35.81380081176758 46 16 10 10 10 2.96665337288863 26.510377848539676 0.0 3 0.9669520594139005 6.769971041542957 72835.0 14.432193849337192 0.0 - - - - - - - 433.0 145 1 NIPSNAP3A nipsnap homolog 3A (C. elegans) 1035 132 B20140404_SF100_02 B20140404_SF100_02 TB154902.[MT7]-ESGAYQLHQALQAAAGPPGLEAEGR.4y8_1.heavy 667.092 / 828.421 35354.0 31.780399322509766 41 11 10 10 10 0.8244817835219683 78.79287127859476 0.0 3 0.8590187137280061 3.2474472330936335 35354.0 68.83242608654959 0.0 - - - - - - - 279.3333333333333 70 6 IQSEC3 IQ motif and Sec7 domain 3 1037 132 B20140404_SF100_02 B20140404_SF100_02 TB154902.[MT7]-ESGAYQLHQALQAAAGPPGLEAEGR.4b7_1.heavy 667.092 / 893.448 4524.0 31.780399322509766 41 11 10 10 10 0.8244817835219683 78.79287127859476 0.0 3 0.8590187137280061 3.2474472330936335 4524.0 7.774398183471791 0.0 - - - - - - - 215.71428571428572 9 7 IQSEC3 IQ motif and Sec7 domain 3 1039 132 B20140404_SF100_02 B20140404_SF100_02 TB154902.[MT7]-ESGAYQLHQALQAAAGPPGLEAEGR.4b10_2.heavy 667.092 / 615.305 26473.0 31.780399322509766 41 11 10 10 10 0.8244817835219683 78.79287127859476 0.0 3 0.8590187137280061 3.2474472330936335 26473.0 21.17620685738719 0.0 - - - - - - - 335.0 52 1 IQSEC3 IQ motif and Sec7 domain 3 1041 132 B20140404_SF100_02 B20140404_SF100_02 TB154902.[MT7]-ESGAYQLHQALQAAAGPPGLEAEGR.4b6_1.heavy 667.092 / 780.364 4859.0 31.780399322509766 41 11 10 10 10 0.8244817835219683 78.79287127859476 0.0 3 0.8590187137280061 3.2474472330936335 4859.0 3.883758438995689 1.0 - - - - - - - 649.25 11 8 IQSEC3 IQ motif and Sec7 domain 3 1043 133 B20140404_SF100_02 B20140404_SF100_02 TB154666.[MT7]-RARPAEVGGMQLR.4y4_1.heavy 396.977 / 547.302 10474.0 23.644899368286133 47 17 10 10 10 4.479781512282685 22.322517231213077 0.0 3 0.9738467781889121 7.614627855331223 10474.0 17.380020452200018 3.0 - - - - - - - 1269.7 149 10 DUT deoxyuridine triphosphatase 1045 133 B20140404_SF100_02 B20140404_SF100_02 TB154666.[MT7]-RARPAEVGGMQLR.4y3_1.heavy 396.977 / 416.262 77406.0 23.644899368286133 47 17 10 10 10 4.479781512282685 22.322517231213077 0.0 3 0.9738467781889121 7.614627855331223 77406.0 57.53115021329597 0.0 - - - - - - - 1711.4285714285713 154 7 DUT deoxyuridine triphosphatase 1047 133 B20140404_SF100_02 B20140404_SF100_02 TB154666.[MT7]-RARPAEVGGMQLR.4b9_2.heavy 396.977 / 519.8 131424.0 23.644899368286133 47 17 10 10 10 4.479781512282685 22.322517231213077 0.0 3 0.9738467781889121 7.614627855331223 131424.0 124.28469688783778 0.0 - - - - - - - 1241.3 262 10 DUT deoxyuridine triphosphatase 1049 133 B20140404_SF100_02 B20140404_SF100_02 TB154666.[MT7]-RARPAEVGGMQLR.4b6_2.heavy 396.977 / 413.244 41967.0 23.644899368286133 47 17 10 10 10 4.479781512282685 22.322517231213077 0.0 3 0.9738467781889121 7.614627855331223 41967.0 27.785154891862597 0.0 - - - - - - - 2765.8888888888887 83 9 DUT deoxyuridine triphosphatase 1051 134 B20140404_SF100_02 B20140404_SF100_02 TB154769.[MT7]-DAHALLLLYDVTNK[MT7].3b6_1.heavy 625.359 / 765.438 51934.0 35.99089813232422 42 12 10 10 10 1.0168022835255806 65.56502453506684 0.0 3 0.8810079748633353 3.54160257043314 51934.0 30.115544865911154 0.0 - - - - - - - 815.625 103 8 RAB26 RAB26, member RAS oncogene family 1053 134 B20140404_SF100_02 B20140404_SF100_02 TB154769.[MT7]-DAHALLLLYDVTNK[MT7].3y3_1.heavy 625.359 / 506.306 90103.0 35.99089813232422 42 12 10 10 10 1.0168022835255806 65.56502453506684 0.0 3 0.8810079748633353 3.54160257043314 90103.0 88.56651173003928 0.0 - - - - - - - 1763.857142857143 180 7 RAB26 RAB26, member RAS oncogene family 1055 134 B20140404_SF100_02 B20140404_SF100_02 TB154769.[MT7]-DAHALLLLYDVTNK[MT7].3b4_1.heavy 625.359 / 539.269 56616.0 35.99089813232422 42 12 10 10 10 1.0168022835255806 65.56502453506684 0.0 3 0.8810079748633353 3.54160257043314 56616.0 45.16479273704249 0.0 - - - - - - - 851.25 113 4 RAB26 RAB26, member RAS oncogene family 1057 134 B20140404_SF100_02 B20140404_SF100_02 TB154769.[MT7]-DAHALLLLYDVTNK[MT7].3b5_1.heavy 625.359 / 652.354 57326.0 35.99089813232422 42 12 10 10 10 1.0168022835255806 65.56502453506684 0.0 3 0.8810079748633353 3.54160257043314 57326.0 66.66114938182065 0.0 - - - - - - - 868.75 114 8 RAB26 RAB26, member RAS oncogene family 1059 135 B20140404_SF100_02 B20140404_SF100_02 TB501922.[MT7]-ESIAEVTELEQIR.3y7_1.heavy 554.301 / 888.479 32916.0 33.543399810791016 48 18 10 10 10 5.8437505686387015 17.112297800091586 0.0 3 0.9866421891571957 10.666209302679098 32916.0 57.776638588586245 0.0 - - - - - - - 282.42857142857144 65 7 IQSEC3 IQ motif and Sec7 domain 3 1061 135 B20140404_SF100_02 B20140404_SF100_02 TB501922.[MT7]-ESIAEVTELEQIR.3y6_1.heavy 554.301 / 787.431 35878.0 33.543399810791016 48 18 10 10 10 5.8437505686387015 17.112297800091586 0.0 3 0.9866421891571957 10.666209302679098 35878.0 51.97246229335796 0.0 - - - - - - - 370.5 71 8 IQSEC3 IQ motif and Sec7 domain 3 1063 135 B20140404_SF100_02 B20140404_SF100_02 TB501922.[MT7]-ESIAEVTELEQIR.3b5_1.heavy 554.301 / 674.348 113888.0 33.543399810791016 48 18 10 10 10 5.8437505686387015 17.112297800091586 0.0 3 0.9866421891571957 10.666209302679098 113888.0 50.08814595114654 0.0 - - - - - - - 494.0 227 2 IQSEC3 IQ motif and Sec7 domain 3 1065 135 B20140404_SF100_02 B20140404_SF100_02 TB501922.[MT7]-ESIAEVTELEQIR.3y5_1.heavy 554.301 / 658.388 70933.0 33.543399810791016 48 18 10 10 10 5.8437505686387015 17.112297800091586 0.0 3 0.9866421891571957 10.666209302679098 70933.0 80.04592013888887 0.0 - - - - - - - 411.5 141 2 IQSEC3 IQ motif and Sec7 domain 3 1067 136 B20140404_SF100_02 B20140404_SF100_02 TB154664.[MT7]-GVVFNVTTVDLK[MT7].3b4_1.heavy 527.315 / 547.336 196684.0 34.543399810791016 48 18 10 10 10 3.217984322787178 23.816173988559306 0.0 3 0.9870658227748098 10.839861882250995 196684.0 156.13252631091197 0.0 - - - - - - - 924.0 393 1 CLIC5 chloride intracellular channel 5 1069 136 B20140404_SF100_02 B20140404_SF100_02 TB154664.[MT7]-GVVFNVTTVDLK[MT7].3b5_1.heavy 527.315 / 661.379 500258.0 34.543399810791016 48 18 10 10 10 3.217984322787178 23.816173988559306 0.0 3 0.9870658227748098 10.839861882250995 500258.0 338.64274693347556 0.0 - - - - - - - 462.0 1000 1 CLIC5 chloride intracellular channel 5 1071 136 B20140404_SF100_02 B20140404_SF100_02 TB154664.[MT7]-GVVFNVTTVDLK[MT7].3y4_1.heavy 527.315 / 618.394 161259.0 34.543399810791016 48 18 10 10 10 3.217984322787178 23.816173988559306 0.0 3 0.9870658227748098 10.839861882250995 161259.0 52.10903293326767 0.0 - - - - - - - 1386.0 322 2 CLIC5 chloride intracellular channel 5 1073 136 B20140404_SF100_02 B20140404_SF100_02 TB154664.[MT7]-GVVFNVTTVDLK[MT7].3y5_1.heavy 527.315 / 719.442 201612.0 34.543399810791016 48 18 10 10 10 3.217984322787178 23.816173988559306 0.0 3 0.9870658227748098 10.839861882250995 201612.0 136.52760667903524 0.0 - - - - - - - 462.0 403 3 CLIC5 chloride intracellular channel 5 1075 137 B20140404_SF100_02 B20140404_SF100_02 TB154905.[MT7]-C[CAM]C[CAM]QNILLYFDDPSQWPAVYK[MT7].3b4_1.heavy 935.792 / 707.272 10000.0 40.86055088043213 39 13 10 6 10 1.1811385867833164 53.964652973918135 0.038196563720703125 3 0.9079355329681795 4.035772853042229 10000.0 33.22506791850357 0.0 - - - - - - - 275.7857142857143 20 14 TMEM145 transmembrane protein 145 1077 137 B20140404_SF100_02 B20140404_SF100_02 TB154905.[MT7]-C[CAM]C[CAM]QNILLYFDDPSQWPAVYK[MT7].3b5_1.heavy 935.792 / 820.356 10263.0 40.86055088043213 39 13 10 6 10 1.1811385867833164 53.964652973918135 0.038196563720703125 3 0.9079355329681795 4.035772853042229 10263.0 33.57932184392069 0.0 - - - - - - - 295.0 20 11 TMEM145 transmembrane protein 145 1079 137 B20140404_SF100_02 B20140404_SF100_02 TB154905.[MT7]-C[CAM]C[CAM]QNILLYFDDPSQWPAVYK[MT7].3b7_1.heavy 935.792 / 1046.52 5088.0 40.86055088043213 39 13 10 6 10 1.1811385867833164 53.964652973918135 0.038196563720703125 3 0.9079355329681795 4.035772853042229 5088.0 27.541880341880344 0.0 - - - - - - - 195.6153846153846 10 13 TMEM145 transmembrane protein 145 1081 137 B20140404_SF100_02 B20140404_SF100_02 TB154905.[MT7]-C[CAM]C[CAM]QNILLYFDDPSQWPAVYK[MT7].3y5_1.heavy 935.792 / 721.437 21579.0 40.86055088043213 39 13 10 6 10 1.1811385867833164 53.964652973918135 0.038196563720703125 3 0.9079355329681795 4.035772853042229 21579.0 31.008053319919515 0.0 - - - - - - - 745.5 43 8 TMEM145 transmembrane protein 145 1083 138 B20140404_SF100_02 B20140404_SF100_02 TB154662.[MT7]-QILDQTSEINK[MT7].3y3_1.heavy 526.298 / 518.342 108321.0 27.063400268554688 44 14 10 10 10 2.1871431583585483 36.73475277696276 0.0 3 0.9496992733615427 5.479460138585478 108321.0 43.76347350295804 0.0 - - - - - - - 2151.0 216 2 ANGPT2 angiopoietin 2 1085 138 B20140404_SF100_02 B20140404_SF100_02 TB154662.[MT7]-QILDQTSEINK[MT7].3b4_1.heavy 526.298 / 614.363 95414.0 27.063400268554688 44 14 10 10 10 2.1871431583585483 36.73475277696276 0.0 3 0.9496992733615427 5.479460138585478 95414.0 44.379638286226694 0.0 - - - - - - - 380.0 190 1 ANGPT2 angiopoietin 2 1087 138 B20140404_SF100_02 B20140404_SF100_02 TB154662.[MT7]-QILDQTSEINK[MT7].3b5_1.heavy 526.298 / 742.422 47327.0 27.063400268554688 44 14 10 10 10 2.1871431583585483 36.73475277696276 0.0 3 0.9496992733615427 5.479460138585478 47327.0 41.49842929942894 0.0 - - - - - - - 190.0 94 4 ANGPT2 angiopoietin 2 1089 138 B20140404_SF100_02 B20140404_SF100_02 TB154662.[MT7]-QILDQTSEINK[MT7].3y4_1.heavy 526.298 / 647.385 63019.0 27.063400268554688 44 14 10 10 10 2.1871431583585483 36.73475277696276 0.0 3 0.9496992733615427 5.479460138585478 63019.0 25.274010107035352 0.0 - - - - - - - 822.5 126 2 ANGPT2 angiopoietin 2 1091 139 B20140404_SF100_02 B20140404_SF100_02 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 970137.0 30.184900283813477 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 970137.0 483.8631648999035 0.0 - - - - - - - 1262.0 1940 1 1093 139 B20140404_SF100_02 B20140404_SF100_02 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 995529.0 30.184900283813477 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 995529.0 827.5137378172204 0.0 - - - - - - - 631.0 1991 1 1095 139 B20140404_SF100_02 B20140404_SF100_02 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1848250.0 30.184900283813477 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1848250.0 323.6081471264629 0.0 - - - - - - - 2367.0 3696 1 1097 140 B20140404_SF100_02 B20140404_SF100_02 TB154762.[MT7]-MLVQEFNTQVALYR.3b4_1.heavy 619.333 / 616.361 31913.0 36.21580123901367 41 17 6 10 8 2.7089870872833726 29.556076394448233 0.0 4 0.9727458281210981 7.4585524366880405 31913.0 11.738781521567546 2.0 - - - - - - - 279.0 66 1 RGS7BP regulator of G-protein signaling 7 binding protein 1099 140 B20140404_SF100_02 B20140404_SF100_02 TB154762.[MT7]-MLVQEFNTQVALYR.3b5_1.heavy 619.333 / 745.404 51005.0 36.21580123901367 41 17 6 10 8 2.7089870872833726 29.556076394448233 0.0 4 0.9727458281210981 7.4585524366880405 51005.0 109.15485606628064 0.0 - - - - - - - 724.5 102 10 RGS7BP regulator of G-protein signaling 7 binding protein 1101 140 B20140404_SF100_02 B20140404_SF100_02 TB154762.[MT7]-MLVQEFNTQVALYR.3y4_1.heavy 619.333 / 522.304 67449.0 36.21580123901367 41 17 6 10 8 2.7089870872833726 29.556076394448233 0.0 4 0.9727458281210981 7.4585524366880405 67449.0 66.85784079343452 1.0 - - - - - - - 1294.2857142857142 134 7 RGS7BP regulator of G-protein signaling 7 binding protein 1103 140 B20140404_SF100_02 B20140404_SF100_02 TB154762.[MT7]-MLVQEFNTQVALYR.3y5_1.heavy 619.333 / 621.372 45988.0 36.21580123901367 41 17 6 10 8 2.7089870872833726 29.556076394448233 0.0 4 0.9727458281210981 7.4585524366880405 45988.0 44.540315469990205 1.0 - - - - - - - 712.2222222222222 209 9 RGS7BP regulator of G-protein signaling 7 binding protein 1105 141 B20140404_SF100_02 B20140404_SF100_02 TB345002.[MT7]-APQLPTWWPLPTQVPAAEDYLTWK[MT7].4y5_1.heavy 774.916 / 854.489 11493.0 42.79010009765625 46 16 10 10 10 3.559372905239658 28.094836551908532 0.0 3 0.9669443260207807 6.769174660001601 11493.0 41.509164926931106 0.0 - - - - - - - 284.375 22 16 SPAG8 sperm associated antigen 8 1107 141 B20140404_SF100_02 B20140404_SF100_02 TB345002.[MT7]-APQLPTWWPLPTQVPAAEDYLTWK[MT7].4b4_1.heavy 774.916 / 554.342 79732.0 42.79010009765625 46 16 10 10 10 3.559372905239658 28.094836551908532 0.0 3 0.9669443260207807 6.769174660001601 79732.0 135.44220858057577 0.0 - - - - - - - 239.0 159 1 SPAG8 sperm associated antigen 8 1109 141 B20140404_SF100_02 B20140404_SF100_02 TB345002.[MT7]-APQLPTWWPLPTQVPAAEDYLTWK[MT7].4y3_1.heavy 774.916 / 578.342 77816.0 42.79010009765625 46 16 10 10 10 3.559372905239658 28.094836551908532 0.0 3 0.9669443260207807 6.769174660001601 77816.0 92.64221414423021 0.0 - - - - - - - 399.1666666666667 155 6 SPAG8 sperm associated antigen 8 1111 141 B20140404_SF100_02 B20140404_SF100_02 TB345002.[MT7]-APQLPTWWPLPTQVPAAEDYLTWK[MT7].4b6_1.heavy 774.916 / 752.442 18436.0 42.79010009765625 46 16 10 10 10 3.559372905239658 28.094836551908532 0.0 3 0.9669443260207807 6.769174660001601 18436.0 33.903132011257014 0.0 - - - - - - - 381.3333333333333 36 9 SPAG8 sperm associated antigen 8 1113 142 B20140404_SF100_02 B20140404_SF100_02 TB154765.[MT7]-IFTFGTWIYSVNK[MT7].3b6_1.heavy 622.013 / 811.447 39818.0 40.73659896850586 48 18 10 10 10 17.451705582520997 5.730098959505506 0.0 3 0.9893137446424688 11.927847760860518 39818.0 112.36893309148438 0.0 - - - - - - - 265.77777777777777 79 9 XIAP X-linked inhibitor of apoptosis 1115 142 B20140404_SF100_02 B20140404_SF100_02 TB154765.[MT7]-IFTFGTWIYSVNK[MT7].3b5_1.heavy 622.013 / 710.399 21334.0 40.73659896850586 48 18 10 10 10 17.451705582520997 5.730098959505506 0.0 3 0.9893137446424688 11.927847760860518 21334.0 30.835757322874073 0.0 - - - - - - - 391.0 42 8 XIAP X-linked inhibitor of apoptosis 1117 142 B20140404_SF100_02 B20140404_SF100_02 TB154765.[MT7]-IFTFGTWIYSVNK[MT7].3y4_1.heavy 622.013 / 591.358 79635.0 40.73659896850586 48 18 10 10 10 17.451705582520997 5.730098959505506 0.0 3 0.9893137446424688 11.927847760860518 79635.0 45.882689969908085 0.0 - - - - - - - 460.0 159 1 XIAP X-linked inhibitor of apoptosis 1119 142 B20140404_SF100_02 B20140404_SF100_02 TB154765.[MT7]-IFTFGTWIYSVNK[MT7].3y5_1.heavy 622.013 / 754.422 75129.0 40.73659896850586 48 18 10 10 10 17.451705582520997 5.730098959505506 0.0 3 0.9893137446424688 11.927847760860518 75129.0 102.8271891429525 0.0 - - - - - - - 315.42857142857144 150 7 XIAP X-linked inhibitor of apoptosis 1121 143 B20140404_SF100_02 B20140404_SF100_02 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 1069980.0 26.427400588989258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1069980.0 1159.440422489059 0.0 - - - - - - - 6969.0 2139 1 1123 143 B20140404_SF100_02 B20140404_SF100_02 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 1439710.0 26.427400588989258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1439710.0 1472.0807087397607 0.0 - - - - - - - 10835.5 2879 2 1125 143 B20140404_SF100_02 B20140404_SF100_02 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 1807370.0 26.427400588989258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1807370.0 2595.3813008774455 0.0 - - - - - - - 13238.333333333334 3614 3 1127 144 B20140404_SF100_02 B20140404_SF100_02 TB154697.[MT7]-IVTATVNNSVLQK[MT7].3y3_1.heavy 559.005 / 532.357 129431.0 29.507099151611328 44 16 10 10 8 25.933322607338884 3.8560427259598793 0.0 4 0.9669020610484235 6.76482715408866 129431.0 49.76875058190998 0.0 - - - - - - - 1280.0 258 1 ANGPT2 angiopoietin 2 1129 144 B20140404_SF100_02 B20140404_SF100_02 TB154697.[MT7]-IVTATVNNSVLQK[MT7].3b4_1.heavy 559.005 / 529.347 23358.0 29.507099151611328 44 16 10 10 8 25.933322607338884 3.8560427259598793 0.0 4 0.9669020610484235 6.76482715408866 23358.0 0.5623937783691573 1.0 - - - - - - - 1760.0 62 1 ANGPT2 angiopoietin 2 1131 144 B20140404_SF100_02 B20140404_SF100_02 TB154697.[MT7]-IVTATVNNSVLQK[MT7].3b5_1.heavy 559.005 / 630.394 38237.0 29.507099151611328 44 16 10 10 8 25.933322607338884 3.8560427259598793 0.0 4 0.9669020610484235 6.76482715408866 38237.0 15.53378125 0.0 - - - - - - - 960.0 76 1 ANGPT2 angiopoietin 2 1133 144 B20140404_SF100_02 B20140404_SF100_02 TB154697.[MT7]-IVTATVNNSVLQK[MT7].3y4_1.heavy 559.005 / 631.426 40957.0 29.507099151611328 44 16 10 10 8 25.933322607338884 3.8560427259598793 0.0 4 0.9669020610484235 6.76482715408866 40957.0 16.11202770432582 1.0 - - - - - - - 320.0 151 1 ANGPT2 angiopoietin 2 1135 145 B20140404_SF100_02 B20140404_SF100_02 TB154079.[MT7]-SGLAAK[MT7].2y5_1.heavy 417.768 / 603.395 63531.0 20.56679916381836 38 10 10 10 8 1.2109120613420021 68.03759971325086 0.0 4 0.8482567827991965 3.127205723034564 63531.0 41.92066772268912 0.0 - - - - - - - 1154.857142857143 127 7 DUT deoxyuridine triphosphatase 1137 145 B20140404_SF100_02 B20140404_SF100_02 TB154079.[MT7]-SGLAAK[MT7].2b4_1.heavy 417.768 / 473.284 12965.0 20.56679916381836 38 10 10 10 8 1.2109120613420021 68.03759971325086 0.0 4 0.8482567827991965 3.127205723034564 12965.0 6.473159549263066 1.0 - - - - - - - 800.5 27 2 DUT deoxyuridine triphosphatase 1139 145 B20140404_SF100_02 B20140404_SF100_02 TB154079.[MT7]-SGLAAK[MT7].2y3_1.heavy 417.768 / 433.289 32261.0 20.56679916381836 38 10 10 10 8 1.2109120613420021 68.03759971325086 0.0 4 0.8482567827991965 3.127205723034564 32261.0 20.761655889041116 0.0 - - - - - - - 729.7142857142857 64 7 DUT deoxyuridine triphosphatase 1141 145 B20140404_SF100_02 B20140404_SF100_02 TB154079.[MT7]-SGLAAK[MT7].2b5_1.heavy 417.768 / 544.321 6254.0 20.56679916381836 38 10 10 10 8 1.2109120613420021 68.03759971325086 0.0 4 0.8482567827991965 3.127205723034564 6254.0 2.391228273551376 10.0 - - - - - - - 1296.6666666666667 55 3 DUT deoxyuridine triphosphatase 1143 146 B20140404_SF100_02 B20140404_SF100_02 TB154493.[MT7]-FILPVNEGK[MT7].3y3_1.heavy 435.599 / 477.279 90145.0 32.721750259399414 33 20 0 5 8 5.8914722816003975 16.97368590060401 0.049297332763671875 4 0.9934410788644643 15.23030161585965 90145.0 61.71970886765922 0.0 - - - - - - - 330.0 180 4 SBDS Shwachman-Bodian-Diamond syndrome 1145 146 B20140404_SF100_02 B20140404_SF100_02 TB154493.[MT7]-FILPVNEGK[MT7].3b5_1.heavy 435.599 / 714.467 21793.0 32.721750259399414 33 20 0 5 8 5.8914722816003975 16.97368590060401 0.049297332763671875 4 0.9934410788644643 15.23030161585965 21793.0 15.490397886197476 1.0 - - - - - - - 802.1428571428571 282 7 SBDS Shwachman-Bodian-Diamond syndrome 1147 146 B20140404_SF100_02 B20140404_SF100_02 TB154493.[MT7]-FILPVNEGK[MT7].3y4_1.heavy 435.599 / 591.322 143473.0 32.721750259399414 33 20 0 5 8 5.8914722816003975 16.97368590060401 0.049297332763671875 4 0.9934410788644643 15.23030161585965 143473.0 16.758758771293078 1.0 - - - - - - - 1486.0 2317 1 SBDS Shwachman-Bodian-Diamond syndrome 1149 146 B20140404_SF100_02 B20140404_SF100_02 TB154493.[MT7]-FILPVNEGK[MT7].3b3_1.heavy 435.599 / 518.346 338292.0 32.721750259399414 33 20 0 5 8 5.8914722816003975 16.97368590060401 0.049297332763671875 4 0.9934410788644643 15.23030161585965 338292.0 115.79223148385692 0.0 - - - - - - - 991.0 676 2 SBDS Shwachman-Bodian-Diamond syndrome 1151 147 B20140404_SF100_02 B20140404_SF100_02 TB502053.[MT7]-EWQEQFLIPNLALIDK[MT7].4b5_1.heavy 562.067 / 845.391 29293.0 40.92729949951172 38 8 10 10 10 0.6781914428949622 77.2067467229197 0.0 3 0.7990642014172906 2.7056886758575582 29293.0 74.43303278688525 0.0 - - - - - - - 282.4166666666667 58 12 NIPSNAP3A nipsnap homolog 3A (C. elegans) 1153 147 B20140404_SF100_02 B20140404_SF100_02 TB502053.[MT7]-EWQEQFLIPNLALIDK[MT7].4y3_1.heavy 562.067 / 519.326 105639.0 40.92729949951172 38 8 10 10 10 0.6781914428949622 77.2067467229197 0.0 3 0.7990642014172906 2.7056886758575582 105639.0 134.1570282657321 0.0 - - - - - - - 755.0 211 8 NIPSNAP3A nipsnap homolog 3A (C. elegans) 1155 147 B20140404_SF100_02 B20140404_SF100_02 TB502053.[MT7]-EWQEQFLIPNLALIDK[MT7].4b6_1.heavy 562.067 / 992.459 21695.0 40.92729949951172 38 8 10 10 10 0.6781914428949622 77.2067467229197 0.0 3 0.7990642014172906 2.7056886758575582 21695.0 175.4568306010929 0.0 - - - - - - - 178.22222222222223 43 18 NIPSNAP3A nipsnap homolog 3A (C. elegans) 1157 147 B20140404_SF100_02 B20140404_SF100_02 TB502053.[MT7]-EWQEQFLIPNLALIDK[MT7].4b3_1.heavy 562.067 / 588.29 38081.0 40.92729949951172 38 8 10 10 10 0.6781914428949622 77.2067467229197 0.0 3 0.7990642014172906 2.7056886758575582 38081.0 56.79515225682434 0.0 - - - - - - - 640.7777777777778 76 9 NIPSNAP3A nipsnap homolog 3A (C. elegans) 1159 148 B20140404_SF100_02 B20140404_SF100_02 TB502057.[MT7]-WQQHQGLLPPGMTIDLFR.3b3_1.heavy 761.073 / 587.306 19014.0 38.37739944458008 48 18 10 10 10 3.59297137233381 27.83211710786472 0.0 3 0.9802956570740236 8.777395689327268 19014.0 24.025842391304348 0.0 - - - - - - - 827.875 38 8 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1161 148 B20140404_SF100_02 B20140404_SF100_02 TB502057.[MT7]-WQQHQGLLPPGMTIDLFR.3y8_1.heavy 761.073 / 952.492 14966.0 38.37739944458008 48 18 10 10 10 3.59297137233381 27.83211710786472 0.0 3 0.9802956570740236 8.777395689327268 14966.0 42.06585351710001 0.0 - - - - - - - 322.0 29 8 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1163 148 B20140404_SF100_02 B20140404_SF100_02 TB502057.[MT7]-WQQHQGLLPPGMTIDLFR.3y10_1.heavy 761.073 / 1146.6 47597.0 38.37739944458008 48 18 10 10 10 3.59297137233381 27.83211710786472 0.0 3 0.9802956570740236 8.777395689327268 47597.0 82.68065743526753 0.0 - - - - - - - 350.57142857142856 95 7 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1165 148 B20140404_SF100_02 B20140404_SF100_02 TB502057.[MT7]-WQQHQGLLPPGMTIDLFR.3y9_1.heavy 761.073 / 1049.54 33612.0 38.37739944458008 48 18 10 10 10 3.59297137233381 27.83211710786472 0.0 3 0.9802956570740236 8.777395689327268 33612.0 43.43518854180185 0.0 - - - - - - - 204.5 67 6 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1167 149 B20140404_SF100_02 B20140404_SF100_02 TB344765.[MT7]-GFEDGIVQLK[MT7].2y4_1.heavy 697.4 / 631.426 13538.0 32.44670104980469 42 12 10 10 10 0.9211674914209496 58.72260452914749 0.0 3 0.8978327828133821 3.827698811294549 13538.0 13.063696724979573 0.0 - - - - - - - 412.5 27 2 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1169 149 B20140404_SF100_02 B20140404_SF100_02 TB344765.[MT7]-GFEDGIVQLK[MT7].2b4_1.heavy 697.4 / 593.269 34341.0 32.44670104980469 42 12 10 10 10 0.9211674914209496 58.72260452914749 0.0 3 0.8978327828133821 3.827698811294549 34341.0 7.126535626385948 1.0 - - - - - - - 412.5 89 2 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1171 149 B20140404_SF100_02 B20140404_SF100_02 TB344765.[MT7]-GFEDGIVQLK[MT7].2b6_1.heavy 697.4 / 763.374 14694.0 32.44670104980469 42 12 10 10 10 0.9211674914209496 58.72260452914749 0.0 3 0.8978327828133821 3.827698811294549 14694.0 22.463594606038054 0.0 - - - - - - - 778.2857142857143 29 7 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1173 149 B20140404_SF100_02 B20140404_SF100_02 TB344765.[MT7]-GFEDGIVQLK[MT7].2b5_1.heavy 697.4 / 650.29 13868.0 32.44670104980469 42 12 10 10 10 0.9211674914209496 58.72260452914749 0.0 3 0.8978327828133821 3.827698811294549 13868.0 9.212398594236607 1.0 - - - - - - - 247.5 27 2 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1175 150 B20140404_SF100_02 B20140404_SF100_02 TB154895.[MT7]-SALAAATAAAAAAASAAAATAAFTTAK[MT7].3b9_1.heavy 851.469 / 872.496 31564.0 43.44879913330078 38 8 10 10 10 1.7412488698302295 57.43004445409916 0.0 3 0.7734183538767754 2.5420618665883112 31564.0 152.29507201991908 0.0 - - - - - - - 275.2352941176471 63 17 SPAG8 sperm associated antigen 8 1177 150 B20140404_SF100_02 B20140404_SF100_02 TB154895.[MT7]-SALAAATAAAAAAASAAAATAAFTTAK[MT7].3b11_2.heavy 851.469 / 507.789 245804.0 43.44879913330078 38 8 10 10 10 1.7412488698302295 57.43004445409916 0.0 3 0.7734183538767754 2.5420618665883112 245804.0 545.2916720546178 0.0 - - - - - - - 267.8333333333333 491 6 SPAG8 sperm associated antigen 8 1179 150 B20140404_SF100_02 B20140404_SF100_02 TB154895.[MT7]-SALAAATAAAAAAASAAAATAAFTTAK[MT7].3b6_1.heavy 851.469 / 629.374 36667.0 43.44879913330078 38 8 10 10 10 1.7412488698302295 57.43004445409916 0.0 3 0.7734183538767754 2.5420618665883112 36667.0 94.07817509775614 0.0 - - - - - - - 614.375 73 8 SPAG8 sperm associated antigen 8 1181 150 B20140404_SF100_02 B20140404_SF100_02 TB154895.[MT7]-SALAAATAAAAAAASAAAATAAFTTAK[MT7].3b5_1.heavy 851.469 / 558.337 30761.0 43.44879913330078 38 8 10 10 10 1.7412488698302295 57.43004445409916 0.0 3 0.7734183538767754 2.5420618665883112 30761.0 80.74136656995259 0.0 - - - - - - - 335.1818181818182 61 11 SPAG8 sperm associated antigen 8 1183 151 B20140404_SF100_02 B20140404_SF100_02 TB154898.[MT7]-TDVNK[MT7]IEEFLEETLTPEK[MT7].4y4_1.heavy 642.601 / 618.358 25215.0 40.936824798583984 40 16 10 6 8 7.041061739518307 14.202403515189342 0.0381011962890625 4 0.9690172089951148 6.993174612403868 25215.0 11.00091428039324 0.0 - - - - - - - 950.0 50 1 CLIC5 chloride intracellular channel 5 1185 151 B20140404_SF100_02 B20140404_SF100_02 TB154898.[MT7]-TDVNK[MT7]IEEFLEETLTPEK[MT7].4b8_2.heavy 642.601 / 609.334 22970.0 40.936824798583984 40 16 10 6 8 7.041061739518307 14.202403515189342 0.0381011962890625 4 0.9690172089951148 6.993174612403868 22970.0 13.563546482564124 1.0 - - - - - - - 892.3333333333334 45 3 CLIC5 chloride intracellular channel 5 1187 151 B20140404_SF100_02 B20140404_SF100_02 TB154898.[MT7]-TDVNK[MT7]IEEFLEETLTPEK[MT7].4y3_1.heavy 642.601 / 517.31 92572.0 40.936824798583984 40 16 10 6 8 7.041061739518307 14.202403515189342 0.0381011962890625 4 0.9690172089951148 6.993174612403868 92572.0 24.73465240910858 1.0 - - - - - - - 2936.0 205 1 CLIC5 chloride intracellular channel 5 1189 151 B20140404_SF100_02 B20140404_SF100_02 TB154898.[MT7]-TDVNK[MT7]IEEFLEETLTPEK[MT7].4b9_2.heavy 642.601 / 682.869 35492.0 40.936824798583984 40 16 10 6 8 7.041061739518307 14.202403515189342 0.0381011962890625 4 0.9690172089951148 6.993174612403868 35492.0 15.4793786116313 0.0 - - - - - - - 864.0 70 1 CLIC5 chloride intracellular channel 5 1191 152 B20140404_SF100_02 B20140404_SF100_02 TB344768.[MT7]-IAFTGSTEVGK[MT7].2y8_1.heavy 699.398 / 922.496 21888.0 28.68429946899414 48 18 10 10 10 2.6886178760379273 29.800802036580016 0.0 3 0.9800556974339574 8.724257600980176 21888.0 48.53601949634444 0.0 - - - - - - - 273.6 43 5 ALDH1A3;ALDH1A2 aldehyde dehydrogenase 1 family, member A3;aldehyde dehydrogenase 1 family, member A2 1193 152 B20140404_SF100_02 B20140404_SF100_02 TB344768.[MT7]-IAFTGSTEVGK[MT7].2y9_1.heavy 699.398 / 1069.56 12449.0 28.68429946899414 48 18 10 10 10 2.6886178760379273 29.800802036580016 0.0 3 0.9800556974339574 8.724257600980176 12449.0 26.51386654478976 0.0 - - - - - - - 273.6666666666667 24 9 ALDH1A3;ALDH1A2 aldehyde dehydrogenase 1 family, member A3;aldehyde dehydrogenase 1 family, member A2 1195 152 B20140404_SF100_02 B20140404_SF100_02 TB344768.[MT7]-IAFTGSTEVGK[MT7].2y10_1.heavy 699.398 / 1140.6 20383.0 28.68429946899414 48 18 10 10 10 2.6886178760379273 29.800802036580016 0.0 3 0.9800556974339574 8.724257600980176 20383.0 80.6737895609764 0.0 - - - - - - - 293.14285714285717 40 7 ALDH1A3;ALDH1A2 aldehyde dehydrogenase 1 family, member A3;aldehyde dehydrogenase 1 family, member A2 1197 152 B20140404_SF100_02 B20140404_SF100_02 TB344768.[MT7]-IAFTGSTEVGK[MT7].2y7_1.heavy 699.398 / 821.448 20657.0 28.68429946899414 48 18 10 10 10 2.6886178760379273 29.800802036580016 0.0 3 0.9800556974339574 8.724257600980176 20657.0 15.786210456008256 0.0 - - - - - - - 287.5 41 10 ALDH1A3;ALDH1A2 aldehyde dehydrogenase 1 family, member A3;aldehyde dehydrogenase 1 family, member A2 1199 153 B20140404_SF100_02 B20140404_SF100_02 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 498692.0 33.449798583984375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 498692.0 94.67763588062279 0.0 - - - - - - - 411.0 997 2 1201 153 B20140404_SF100_02 B20140404_SF100_02 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 1230020.0 33.449798583984375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1230020.0 96.08587434213125 0.0 - - - - - - - 328.6 2460 5 1203 153 B20140404_SF100_02 B20140404_SF100_02 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 1121840.0 33.449798583984375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1121840.0 157.5761932030692 0.0 - - - - - - - 493.0 2243 1 1205 154 B20140404_SF100_02 B20140404_SF100_02 TB501899.[MT7]-FTPPVVNVTWLR.2y8_1.heavy 786.955 / 986.578 N/A 38.1068000793457 50 20 10 10 10 11.771118415699565 8.495369468599211 0.0 3 0.998473080861929 31.579050953177003 1230.0 3.5 8.0 - - - - - - - 338.25 23 12 HLA-DRA major histocompatibility complex, class II, DR alpha 1207 154 B20140404_SF100_02 B20140404_SF100_02 TB501899.[MT7]-FTPPVVNVTWLR.2y10_1.heavy 786.955 / 1180.68 17965.0 38.1068000793457 50 20 10 10 10 11.771118415699565 8.495369468599211 0.0 3 0.998473080861929 31.579050953177003 17965.0 96.08110433604335 0.0 - - - - - - - 333.85714285714283 35 7 HLA-DRA major histocompatibility complex, class II, DR alpha 1209 154 B20140404_SF100_02 B20140404_SF100_02 TB501899.[MT7]-FTPPVVNVTWLR.2y9_1.heavy 786.955 / 1083.63 6768.0 38.1068000793457 50 20 10 10 10 11.771118415699565 8.495369468599211 0.0 3 0.998473080861929 31.579050953177003 6768.0 23.522926829268293 0.0 - - - - - - - 344.4 13 10 HLA-DRA major histocompatibility complex, class II, DR alpha 1211 154 B20140404_SF100_02 B20140404_SF100_02 TB501899.[MT7]-FTPPVVNVTWLR.2y7_1.heavy 786.955 / 887.51 4184.0 38.1068000793457 50 20 10 10 10 11.771118415699565 8.495369468599211 0.0 3 0.998473080861929 31.579050953177003 4184.0 2.5169873031995937 0.0 - - - - - - - 232.33333333333334 8 9 HLA-DRA major histocompatibility complex, class II, DR alpha 1213 155 B20140404_SF100_02 B20140404_SF100_02 TB154484.[MT7]-AAPDSGLPLFR.3b6_1.heavy 429.911 / 643.317 148198.0 34.35929870605469 48 18 10 10 10 2.753986239741777 36.311002051112766 0.0 3 0.9817608704332731 9.124267327834225 148198.0 130.20591054313098 0.0 - - - - - - - 156.0 296 1 TMEM145 transmembrane protein 145 1215 155 B20140404_SF100_02 B20140404_SF100_02 TB154484.[MT7]-AAPDSGLPLFR.3b4_1.heavy 429.911 / 499.263 53990.0 34.35929870605469 48 18 10 10 10 2.753986239741777 36.311002051112766 0.0 3 0.9817608704332731 9.124267327834225 53990.0 20.96615435956471 0.0 - - - - - - - 782.0 107 1 TMEM145 transmembrane protein 145 1217 155 B20140404_SF100_02 B20140404_SF100_02 TB154484.[MT7]-AAPDSGLPLFR.3b5_1.heavy 429.911 / 586.295 14397.0 34.35929870605469 48 18 10 10 10 2.753986239741777 36.311002051112766 0.0 3 0.9817608704332731 9.124267327834225 14397.0 7.363538936189491 2.0 - - - - - - - 312.75 49 4 TMEM145 transmembrane protein 145 1219 155 B20140404_SF100_02 B20140404_SF100_02 TB154484.[MT7]-AAPDSGLPLFR.3y4_1.heavy 429.911 / 532.324 270105.0 34.35929870605469 48 18 10 10 10 2.753986239741777 36.311002051112766 0.0 3 0.9817608704332731 9.124267327834225 270105.0 111.12345505923837 0.0 - - - - - - - 1252.0 540 1 TMEM145 transmembrane protein 145 1221 156 B20140404_SF100_02 B20140404_SF100_02 TB502042.[MT7]-RLLPPLLLLLLSLPPRAR.4y5_1.heavy 549.62 / 596.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM145 transmembrane protein 145 1223 156 B20140404_SF100_02 B20140404_SF100_02 TB502042.[MT7]-RLLPPLLLLLLSLPPRAR.4b7_1.heavy 549.62 / 947.652 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM145 transmembrane protein 145 1225 156 B20140404_SF100_02 B20140404_SF100_02 TB502042.[MT7]-RLLPPLLLLLLSLPPRAR.4b3_1.heavy 549.62 / 527.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM145 transmembrane protein 145 1227 156 B20140404_SF100_02 B20140404_SF100_02 TB502042.[MT7]-RLLPPLLLLLLSLPPRAR.4b6_1.heavy 549.62 / 834.568 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMEM145 transmembrane protein 145 1229 157 B20140404_SF100_02 B20140404_SF100_02 TB154680.[MT7]-SIDDALSTWSLK[MT7].3b6_1.heavy 541.966 / 759.401 25675.0 35.99089813232422 42 12 10 10 10 1.5666511832199457 51.334919231893984 0.0 3 0.899491194079687 3.859702494178948 25675.0 64.17349150784497 0.0 - - - - - - - 320.9166666666667 51 12 IQSEC3 IQ motif and Sec7 domain 3 1231 157 B20140404_SF100_02 B20140404_SF100_02 TB154680.[MT7]-SIDDALSTWSLK[MT7].3b4_1.heavy 541.966 / 575.279 51207.0 35.99089813232422 42 12 10 10 10 1.5666511832199457 51.334919231893984 0.0 3 0.899491194079687 3.859702494178948 51207.0 76.59806320535844 0.0 - - - - - - - 285.0 102 1 IQSEC3 IQ motif and Sec7 domain 3 1233 157 B20140404_SF100_02 B20140404_SF100_02 TB154680.[MT7]-SIDDALSTWSLK[MT7].3b5_1.heavy 541.966 / 646.316 97422.0 35.99089813232422 42 12 10 10 10 1.5666511832199457 51.334919231893984 0.0 3 0.899491194079687 3.859702494178948 97422.0 70.24567821595161 0.0 - - - - - - - 1324.2857142857142 194 7 IQSEC3 IQ motif and Sec7 domain 3 1235 157 B20140404_SF100_02 B20140404_SF100_02 TB154680.[MT7]-SIDDALSTWSLK[MT7].3y4_1.heavy 541.966 / 677.41 32807.0 35.99089813232422 42 12 10 10 10 1.5666511832199457 51.334919231893984 0.0 3 0.899491194079687 3.859702494178948 32807.0 50.942959263296466 0.0 - - - - - - - 693.0 65 7 IQSEC3 IQ motif and Sec7 domain 3 1237 158 B20140404_SF100_02 B20140404_SF100_02 TB154060.[MT7]-APSEPR.2y4_1.heavy 400.723 / 488.246 7706.0 18.688499450683594 43 13 10 10 10 1.9508905943591024 51.25864068910104 0.0 3 0.9032920247410702 3.9361123304762153 7706.0 10.03834896901541 0.0 - - - - - - - 301.1111111111111 15 9 RAB26 RAB26, member RAS oncogene family 1239 158 B20140404_SF100_02 B20140404_SF100_02 TB154060.[MT7]-APSEPR.2y5_1.heavy 400.723 / 585.299 172929.0 18.688499450683594 43 13 10 10 10 1.9508905943591024 51.25864068910104 0.0 3 0.9032920247410702 3.9361123304762153 172929.0 159.89876104443584 0.0 - - - - - - - 644.375 345 8 RAB26 RAB26, member RAS oncogene family 1241 158 B20140404_SF100_02 B20140404_SF100_02 TB154060.[MT7]-APSEPR.2b4_1.heavy 400.723 / 529.274 157039.0 18.688499450683594 43 13 10 10 10 1.9508905943591024 51.25864068910104 0.0 3 0.9032920247410702 3.9361123304762153 157039.0 91.57755920220426 0.0 - - - - - - - 372.0 314 1 RAB26 RAB26, member RAS oncogene family 1243 159 B20140404_SF100_02 B20140404_SF100_02 TB154062.[MT7]-ALSVLR.2y4_1.heavy 401.767 / 474.303 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZMYND10;LNX1 zinc finger, MYND-type containing 10;ligand of numb-protein X 1 1245 159 B20140404_SF100_02 B20140404_SF100_02 TB154062.[MT7]-ALSVLR.2b3_1.heavy 401.767 / 416.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZMYND10;LNX1 zinc finger, MYND-type containing 10;ligand of numb-protein X 1 1247 159 B20140404_SF100_02 B20140404_SF100_02 TB154062.[MT7]-ALSVLR.2y5_1.heavy 401.767 / 587.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZMYND10;LNX1 zinc finger, MYND-type containing 10;ligand of numb-protein X 1 1249 159 B20140404_SF100_02 B20140404_SF100_02 TB154062.[MT7]-ALSVLR.2b4_1.heavy 401.767 / 515.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZMYND10;LNX1 zinc finger, MYND-type containing 10;ligand of numb-protein X 1 1251 160 B20140404_SF100_02 B20140404_SF100_02 TB344760.[MT7]-YIHLENLLAR.2b3_1.heavy 693.405 / 558.316 11878.0 34.12289810180664 50 20 10 10 10 3.747085568262253 21.018919822621143 0.0 3 0.9925778633862421 14.316238191413062 11878.0 10.653301500872601 0.0 - - - - - - - 1741.2857142857142 23 7 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1253 160 B20140404_SF100_02 B20140404_SF100_02 TB344760.[MT7]-YIHLENLLAR.2y8_1.heavy 693.405 / 965.553 20943.0 34.12289810180664 50 20 10 10 10 3.747085568262253 21.018919822621143 0.0 3 0.9925778633862421 14.316238191413062 20943.0 37.4479297228145 0.0 - - - - - - - 625.0 41 7 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1255 160 B20140404_SF100_02 B20140404_SF100_02 TB344760.[MT7]-YIHLENLLAR.2y6_1.heavy 693.405 / 715.41 9534.0 34.12289810180664 50 20 10 10 10 3.747085568262253 21.018919822621143 0.0 3 0.9925778633862421 14.316238191413062 9534.0 9.20677137870855 0.0 - - - - - - - 364.8333333333333 19 6 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1257 160 B20140404_SF100_02 B20140404_SF100_02 TB344760.[MT7]-YIHLENLLAR.2y7_1.heavy 693.405 / 828.494 10940.0 34.12289810180664 50 20 10 10 10 3.747085568262253 21.018919822621143 0.0 3 0.9925778633862421 14.316238191413062 10940.0 26.478190078180525 0.0 - - - - - - - 273.5 21 8 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1259 161 B20140404_SF100_02 B20140404_SF100_02 TB154890.[MT7]-EINPLLFSYVEELVEIRK[MT7].3b6_1.heavy 827.14 / 824.5 5706.0 42.618900299072266 39 13 10 6 10 1.437224574236105 55.639908463381474 0.03800201416015625 3 0.9081268703637356 4.040039845925442 5706.0 13.469098712446353 0.0 - - - - - - - 296.9 11 20 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1261 161 B20140404_SF100_02 B20140404_SF100_02 TB154890.[MT7]-EINPLLFSYVEELVEIRK[MT7].3b4_1.heavy 827.14 / 598.332 1863.0 42.618900299072266 39 13 10 6 10 1.437224574236105 55.639908463381474 0.03800201416015625 3 0.9081268703637356 4.040039845925442 1863.0 3.2010309278350517 2.0 - - - - - - - 682.0 5 7 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1263 161 B20140404_SF100_02 B20140404_SF100_02 TB154890.[MT7]-EINPLLFSYVEELVEIRK[MT7].3b3_1.heavy 827.14 / 501.279 19506.0 42.618900299072266 39 13 10 6 10 1.437224574236105 55.639908463381474 0.03800201416015625 3 0.9081268703637356 4.040039845925442 19506.0 50.24601939521017 0.0 - - - - - - - 698.6 39 10 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1265 161 B20140404_SF100_02 B20140404_SF100_02 TB154890.[MT7]-EINPLLFSYVEELVEIRK[MT7].3y8_1.heavy 827.14 / 1159.68 3377.0 42.618900299072266 39 13 10 6 10 1.437224574236105 55.639908463381474 0.03800201416015625 3 0.9081268703637356 4.040039845925442 3377.0 27.51292213366033 0.0 - - - - - - - 159.9375 6 16 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1267 162 B20140404_SF100_02 B20140404_SF100_02 TB502048.[MT7]-FLDGDELTLADC[CAM]NLLPK[MT7].3y3_1.heavy 741.392 / 501.352 58793.0 37.655524253845215 37 11 10 6 10 0.5939127118491849 88.83969067971125 0.039699554443359375 3 0.8510063270913047 3.156694428180469 58793.0 21.50633437499735 0.0 - - - - - - - 1892.0 117 1 CLIC5;CLIC6 chloride intracellular channel 5;chloride intracellular channel 6 1269 162 B20140404_SF100_02 B20140404_SF100_02 TB502048.[MT7]-FLDGDELTLADC[CAM]NLLPK[MT7].3b6_1.heavy 741.392 / 821.38 58162.0 37.655524253845215 37 11 10 6 10 0.5939127118491849 88.83969067971125 0.039699554443359375 3 0.8510063270913047 3.156694428180469 58162.0 24.4707338040124 0.0 - - - - - - - 1262.0 116 1 CLIC5;CLIC6 chloride intracellular channel 5;chloride intracellular channel 6 1271 162 B20140404_SF100_02 B20140404_SF100_02 TB502048.[MT7]-FLDGDELTLADC[CAM]NLLPK[MT7].3b5_1.heavy 741.392 / 692.337 34821.0 37.655524253845215 37 11 10 6 10 0.5939127118491849 88.83969067971125 0.039699554443359375 3 0.8510063270913047 3.156694428180469 34821.0 17.837554602615157 0.0 - - - - - - - 1009.0 69 1 CLIC5;CLIC6 chloride intracellular channel 5;chloride intracellular channel 6 1273 162 B20140404_SF100_02 B20140404_SF100_02 TB502048.[MT7]-FLDGDELTLADC[CAM]NLLPK[MT7].3b7_1.heavy 741.392 / 934.464 25990.0 37.655524253845215 37 11 10 6 10 0.5939127118491849 88.83969067971125 0.039699554443359375 3 0.8510063270913047 3.156694428180469 25990.0 22.49047264797315 0.0 - - - - - - - 378.0 51 1 CLIC5;CLIC6 chloride intracellular channel 5;chloride intracellular channel 6 1275 163 B20140404_SF100_02 B20140404_SF100_02 TB502045.[MT7]-TLIDLYEQVVLELIELR.3y7_1.heavy 735.095 / 885.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1277 163 B20140404_SF100_02 B20140404_SF100_02 TB502045.[MT7]-TLIDLYEQVVLELIELR.3b4_1.heavy 735.095 / 587.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1279 163 B20140404_SF100_02 B20140404_SF100_02 TB502045.[MT7]-TLIDLYEQVVLELIELR.3b5_1.heavy 735.095 / 700.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1281 163 B20140404_SF100_02 B20140404_SF100_02 TB502045.[MT7]-TLIDLYEQVVLELIELR.3y8_1.heavy 735.095 / 984.609 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1283 164 B20140404_SF100_02 B20140404_SF100_02 TB154891.[MT7]-EINPLLFSYVEELVEIRK[MT7].4y8_1.heavy 620.607 / 1159.68 9291.0 42.59989929199219 48 18 10 10 10 3.4735607203081122 28.788902239523765 0.0 3 0.9834301048935531 9.574166494281812 9291.0 84.09956896551724 0.0 - - - - - - - 132.57142857142858 18 14 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1285 164 B20140404_SF100_02 B20140404_SF100_02 TB154891.[MT7]-EINPLLFSYVEELVEIRK[MT7].4b4_1.heavy 620.607 / 598.332 18640.0 42.59989929199219 48 18 10 10 10 3.4735607203081122 28.788902239523765 0.0 3 0.9834301048935531 9.574166494281812 18640.0 51.33218588640275 0.0 - - - - - - - 589.2857142857143 37 7 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1287 164 B20140404_SF100_02 B20140404_SF100_02 TB154891.[MT7]-EINPLLFSYVEELVEIRK[MT7].4y7_1.heavy 620.607 / 1030.64 6678.0 42.59989929199219 48 18 10 10 10 3.4735607203081122 28.788902239523765 0.0 3 0.9834301048935531 9.574166494281812 6678.0 164.18668965517242 0.0 - - - - - - - 138.30769230769232 13 13 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1289 164 B20140404_SF100_02 B20140404_SF100_02 TB154891.[MT7]-EINPLLFSYVEELVEIRK[MT7].4b3_1.heavy 620.607 / 501.279 140177.0 42.59989929199219 48 18 10 10 10 3.4735607203081122 28.788902239523765 0.0 3 0.9834301048935531 9.574166494281812 140177.0 340.07802336011406 0.0 - - - - - - - 813.0 280 9 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1291 165 B20140404_SF100_02 B20140404_SF100_02 TB501805.[MT7]-DQLQVLVSK[MT7].2b3_1.heavy 659.403 / 501.279 32023.0 30.62350082397461 46 17 9 10 10 6.185408571359418 16.16708077507355 0.0 3 0.9782433038711101 8.351708657780623 32023.0 21.87108050687546 0.0 - - - - - - - 1802.142857142857 64 7 ANGPT2 angiopoietin 2 1293 165 B20140404_SF100_02 B20140404_SF100_02 TB501805.[MT7]-DQLQVLVSK[MT7].2y5_1.heavy 659.403 / 689.468 24745.0 30.62350082397461 46 17 9 10 10 6.185408571359418 16.16708077507355 0.0 3 0.9782433038711101 8.351708657780623 24745.0 23.370359499464982 1.0 - - - - - - - 1340.2857142857142 76 7 ANGPT2 angiopoietin 2 1295 165 B20140404_SF100_02 B20140404_SF100_02 TB501805.[MT7]-DQLQVLVSK[MT7].2b4_1.heavy 659.403 / 629.338 34125.0 30.62350082397461 46 17 9 10 10 6.185408571359418 16.16708077507355 0.0 3 0.9782433038711101 8.351708657780623 34125.0 25.15515284827833 0.0 - - - - - - - 970.0 68 1 ANGPT2 angiopoietin 2 1297 165 B20140404_SF100_02 B20140404_SF100_02 TB501805.[MT7]-DQLQVLVSK[MT7].2b5_1.heavy 659.403 / 728.406 27009.0 30.62350082397461 46 17 9 10 10 6.185408571359418 16.16708077507355 0.0 3 0.9782433038711101 8.351708657780623 27009.0 36.698791353270266 0.0 - - - - - - - 323.1666666666667 54 6 ANGPT2 angiopoietin 2 1299 166 B20140404_SF100_02 B20140404_SF100_02 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 753457.0 35.391998291015625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 753457.0 162.87310164162884 0.0 - - - - - - - 2876.0 1506 1 1301 166 B20140404_SF100_02 B20140404_SF100_02 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 1466610.0 35.391998291015625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1466610.0 189.34797113046017 0.0 - - - - - - - 2725.0 2933 1 1303 166 B20140404_SF100_02 B20140404_SF100_02 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 1618830.0 35.391998291015625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1618830.0 162.73990178216823 0.0 - - - - - - - 2876.0 3237 1 1305 167 B20140404_SF100_02 B20140404_SF100_02 TB154191.[MT7]-LAEQAER.2y4_1.heavy 480.765 / 503.257 69758.0 21.13129997253418 50 20 10 10 10 17.606970731247856 5.6795687075531776 0.0 3 0.995627330698501 18.656521536302293 69758.0 92.12282837685797 0.0 - - - - - - - 753.1428571428571 139 7 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1307 167 B20140404_SF100_02 B20140404_SF100_02 TB154191.[MT7]-LAEQAER.2y5_1.heavy 480.765 / 632.3 55394.0 21.13129997253418 50 20 10 10 10 17.606970731247856 5.6795687075531776 0.0 3 0.995627330698501 18.656521536302293 55394.0 132.0649097157059 0.0 - - - - - - - 715.3636363636364 110 11 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1309 167 B20140404_SF100_02 B20140404_SF100_02 TB154191.[MT7]-LAEQAER.2b4_1.heavy 480.765 / 586.332 51268.0 21.13129997253418 50 20 10 10 10 17.606970731247856 5.6795687075531776 0.0 3 0.995627330698501 18.656521536302293 51268.0 38.87796419896176 0.0 - - - - - - - 1746.4285714285713 102 7 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1311 167 B20140404_SF100_02 B20140404_SF100_02 TB154191.[MT7]-LAEQAER.2y6_1.heavy 480.765 / 703.337 291409.0 21.13129997253418 50 20 10 10 10 17.606970731247856 5.6795687075531776 0.0 3 0.995627330698501 18.656521536302293 291409.0 195.4792337924734 0.0 - - - - - - - 687.5714285714286 582 7 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1313 168 B20140404_SF100_02 B20140404_SF100_02 TB501603.[MT7]-LVVLVK[MT7].2y4_1.heavy 479.849 / 602.436 112421.0 32.301300048828125 48 18 10 10 10 5.732868297819739 17.443275303922626 0.0 3 0.9874976358200426 11.025867794423837 112421.0 101.79471715020662 0.0 - - - - - - - 751.5 224 4 PCDHB5;PCDHB15;PCDHB14;PCDHB13;PCDHB12;PCDHB11;PCDHB10;PCDHB9;PCDHB8;PCDHB7;PCDHB6;PCDHB4;PCDHB3;PCDHB2;PCDHB16 protocadherin beta 5;protocadherin beta 15;protocadherin beta 14;protocadherin beta 13;protocadherin beta 12;protocadherin beta 11;protocadherin beta 10;protocadherin beta 9;protocadherin beta 8;protocadherin beta 7;protocadherin beta 6;protocadherin beta 4;protocadherin beta 3;protocadherin beta 2;protocadherin beta 16 1315 168 B20140404_SF100_02 B20140404_SF100_02 TB501603.[MT7]-LVVLVK[MT7].2y5_1.heavy 479.849 / 701.504 94547.0 32.301300048828125 48 18 10 10 10 5.732868297819739 17.443275303922626 0.0 3 0.9874976358200426 11.025867794423837 94547.0 61.98382293154346 0.0 - - - - - - - 250.5 189 2 PCDHB5;PCDHB15;PCDHB14;PCDHB13;PCDHB12;PCDHB11;PCDHB10;PCDHB9;PCDHB8;PCDHB7;PCDHB6;PCDHB4;PCDHB3;PCDHB2;PCDHB16 protocadherin beta 5;protocadherin beta 15;protocadherin beta 14;protocadherin beta 13;protocadherin beta 12;protocadherin beta 11;protocadherin beta 10;protocadherin beta 9;protocadherin beta 8;protocadherin beta 7;protocadherin beta 6;protocadherin beta 4;protocadherin beta 3;protocadherin beta 2;protocadherin beta 16 1317 168 B20140404_SF100_02 B20140404_SF100_02 TB501603.[MT7]-LVVLVK[MT7].2b4_1.heavy 479.849 / 569.414 43766.0 32.301300048828125 48 18 10 10 10 5.732868297819739 17.443275303922626 0.0 3 0.9874976358200426 11.025867794423837 43766.0 66.12634516680924 0.0 - - - - - - - 292.25 87 4 PCDHB5;PCDHB15;PCDHB14;PCDHB13;PCDHB12;PCDHB11;PCDHB10;PCDHB9;PCDHB8;PCDHB7;PCDHB6;PCDHB4;PCDHB3;PCDHB2;PCDHB16 protocadherin beta 5;protocadherin beta 15;protocadherin beta 14;protocadherin beta 13;protocadherin beta 12;protocadherin beta 11;protocadherin beta 10;protocadherin beta 9;protocadherin beta 8;protocadherin beta 7;protocadherin beta 6;protocadherin beta 4;protocadherin beta 3;protocadherin beta 2;protocadherin beta 16 1319 168 B20140404_SF100_02 B20140404_SF100_02 TB501603.[MT7]-LVVLVK[MT7].2y3_1.heavy 479.849 / 503.367 109581.0 32.301300048828125 48 18 10 10 10 5.732868297819739 17.443275303922626 0.0 3 0.9874976358200426 11.025867794423837 109581.0 45.73063301473785 1.0 - - - - - - - 167.0 219 1 PCDHB5;PCDHB15;PCDHB14;PCDHB13;PCDHB12;PCDHB11;PCDHB10;PCDHB9;PCDHB8;PCDHB7;PCDHB6;PCDHB4;PCDHB3;PCDHB2;PCDHB16 protocadherin beta 5;protocadherin beta 15;protocadherin beta 14;protocadherin beta 13;protocadherin beta 12;protocadherin beta 11;protocadherin beta 10;protocadherin beta 9;protocadherin beta 8;protocadherin beta 7;protocadherin beta 6;protocadherin beta 4;protocadherin beta 3;protocadherin beta 2;protocadherin beta 16 1321 169 B20140404_SF100_02 B20140404_SF100_02 TB154309.[MT7]-VLGYYC[CAM]R.2y5_1.heavy 537.78 / 718.298 80390.0 28.401399612426758 50 20 10 10 10 13.69969831886366 7.299430810261422 0.0 3 0.998801059914759 35.63856665285902 80390.0 113.07378136220467 0.0 - - - - - - - 294.0 160 1 ZCCHC24 zinc finger, CCHC domain containing 24 1323 169 B20140404_SF100_02 B20140404_SF100_02 TB154309.[MT7]-VLGYYC[CAM]R.2b4_1.heavy 537.78 / 577.347 29099.0 28.401399612426758 50 20 10 10 10 13.69969831886366 7.299430810261422 0.0 3 0.998801059914759 35.63856665285902 29099.0 23.602014652014653 0.0 - - - - - - - 343.0 58 3 ZCCHC24 zinc finger, CCHC domain containing 24 1325 169 B20140404_SF100_02 B20140404_SF100_02 TB154309.[MT7]-VLGYYC[CAM]R.2y6_1.heavy 537.78 / 831.382 138882.0 28.401399612426758 50 20 10 10 10 13.69969831886366 7.299430810261422 0.0 3 0.998801059914759 35.63856665285902 138882.0 150.08650733548558 0.0 - - - - - - - 245.0 277 3 ZCCHC24 zinc finger, CCHC domain containing 24 1327 169 B20140404_SF100_02 B20140404_SF100_02 TB154309.[MT7]-VLGYYC[CAM]R.2b5_1.heavy 537.78 / 740.41 16313.0 28.401399612426758 50 20 10 10 10 13.69969831886366 7.299430810261422 0.0 3 0.998801059914759 35.63856665285902 16313.0 21.86668367346939 0.0 - - - - - - - 735.0 32 8 ZCCHC24 zinc finger, CCHC domain containing 24 1329 170 B20140404_SF100_02 B20140404_SF100_02 TB344653.[MT7]-C[CAM]VNPETK[MT7].2b3_1.heavy 568.305 / 518.251 11440.0 20.24329948425293 46 16 10 10 10 3.6444834367567336 27.43873082024242 0.0 3 0.961219110516214 6.24654499679897 11440.0 23.253196930946295 0.0 - - - - - - - 732.7 22 10 SBDS Shwachman-Bodian-Diamond syndrome 1331 170 B20140404_SF100_02 B20140404_SF100_02 TB344653.[MT7]-C[CAM]VNPETK[MT7].2y4_1.heavy 568.305 / 618.358 14655.0 20.24329948425293 46 16 10 10 10 3.6444834367567336 27.43873082024242 0.0 3 0.961219110516214 6.24654499679897 14655.0 120.56484632516704 0.0 - - - - - - - 210.5 29 16 SBDS Shwachman-Bodian-Diamond syndrome 1333 170 B20140404_SF100_02 B20140404_SF100_02 TB344653.[MT7]-C[CAM]VNPETK[MT7].2y5_1.heavy 568.305 / 732.401 6056.0 20.24329948425293 46 16 10 10 10 3.6444834367567336 27.43873082024242 0.0 3 0.961219110516214 6.24654499679897 6056.0 36.05244147157191 0.0 - - - - - - - 215.0625 12 16 SBDS Shwachman-Bodian-Diamond syndrome 1335 170 B20140404_SF100_02 B20140404_SF100_02 TB344653.[MT7]-C[CAM]VNPETK[MT7].2y6_1.heavy 568.305 / 831.469 5010.0 20.24329948425293 46 16 10 10 10 3.6444834367567336 27.43873082024242 0.0 3 0.961219110516214 6.24654499679897 5010.0 65.1968 0.0 - - - - - - - 171.14285714285714 10 14 SBDS Shwachman-Bodian-Diamond syndrome 1337 171 B20140404_SF100_02 B20140404_SF100_02 TB154054.[MT7]-DLRPPGPLR.3y3_1.heavy 388.904 / 385.256 44081.0 26.0093994140625 46 20 10 6 10 6.388180376490235 15.653909893969143 0.03820037841796875 3 0.9908726633896522 12.908014738615503 44081.0 28.89212032411813 0.0 - - - - - - - 830.0 88 1 TMEM145 transmembrane protein 145 1339 171 B20140404_SF100_02 B20140404_SF100_02 TB154054.[MT7]-DLRPPGPLR.3y6_1.heavy 388.904 / 636.383 86710.0 26.0093994140625 46 20 10 6 10 6.388180376490235 15.653909893969143 0.03820037841796875 3 0.9908726633896522 12.908014738615503 86710.0 67.48935522191803 0.0 - - - - - - - 648.25 173 4 TMEM145 transmembrane protein 145 1341 171 B20140404_SF100_02 B20140404_SF100_02 TB154054.[MT7]-DLRPPGPLR.3y4_1.heavy 388.904 / 442.277 51238.0 26.0093994140625 46 20 10 6 10 6.388180376490235 15.653909893969143 0.03820037841796875 3 0.9908726633896522 12.908014738615503 51238.0 16.054627424134367 0.0 - - - - - - - 415.0 102 1 TMEM145 transmembrane protein 145 1343 171 B20140404_SF100_02 B20140404_SF100_02 TB154054.[MT7]-DLRPPGPLR.3y5_1.heavy 388.904 / 539.33 87851.0 26.0093994140625 46 20 10 6 10 6.388180376490235 15.653909893969143 0.03820037841796875 3 0.9908726633896522 12.908014738615503 87851.0 58.22950242121102 0.0 - - - - - - - 648.5 175 4 TMEM145 transmembrane protein 145 1345 172 B20140404_SF100_02 B20140404_SF100_02 TB344651.[MT7]-VLDVDGVK[MT7].2y4_1.heavy 566.844 / 562.332 38558.0 28.77589988708496 40 18 4 10 8 4.579947454629937 21.83431163580458 0.0 4 0.9874272382379495 10.994891568394692 38558.0 8.170486788324787 0.0 - - - - - - - 1670.5 77 2 RAB26 RAB26, member RAS oncogene family 1347 172 B20140404_SF100_02 B20140404_SF100_02 TB344651.[MT7]-VLDVDGVK[MT7].2y5_1.heavy 566.844 / 661.4 44822.0 28.77589988708496 40 18 4 10 8 4.579947454629937 21.83431163580458 0.0 4 0.9874272382379495 10.994891568394692 44822.0 39.29600565928174 0.0 - - - - - - - 1749.857142857143 89 7 RAB26 RAB26, member RAS oncogene family 1349 172 B20140404_SF100_02 B20140404_SF100_02 TB344651.[MT7]-VLDVDGVK[MT7].2y6_1.heavy 566.844 / 776.427 32433.0 28.77589988708496 40 18 4 10 8 4.579947454629937 21.83431163580458 0.0 4 0.9874272382379495 10.994891568394692 32433.0 21.349498619992875 1.0 - - - - - - - 278.0 149 1 RAB26 RAB26, member RAS oncogene family 1351 172 B20140404_SF100_02 B20140404_SF100_02 TB344651.[MT7]-VLDVDGVK[MT7].2y7_1.heavy 566.844 / 889.511 53870.0 28.77589988708496 40 18 4 10 8 4.579947454629937 21.83431163580458 0.0 4 0.9874272382379495 10.994891568394692 53870.0 47.25852521066549 1.0 - - - - - - - 139.0 202 1 RAB26 RAB26, member RAS oncogene family 1353 173 B20140404_SF100_02 B20140404_SF100_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 697879.0 32.01490020751953 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 697879.0 234.87210001472266 0.0 - - - - - - - 668.0 1395 3 1355 173 B20140404_SF100_02 B20140404_SF100_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 111501.0 32.01490020751953 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 111501.0 175.86587396445458 1.0 - - - - - - - 1144.5714285714287 300 7 1357 173 B20140404_SF100_02 B20140404_SF100_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 85128.0 32.01490020751953 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 85128.0 46.72622433530461 0.0 - - - - - - - 1223.6666666666667 170 3 1359 174 B20140404_SF100_02 B20140404_SF100_02 TB501693.[MT7]-GIQFLISR.2y5_1.heavy 539.331 / 635.388 43283.0 34.543399810791016 46 16 10 10 10 1.918701965316982 34.76300922538101 0.0 3 0.9619723475991542 6.3085078611002405 43283.0 44.07679144353029 0.0 - - - - - - - 796.0 86 7 IQSEC3 IQ motif and Sec7 domain 3 1361 174 B20140404_SF100_02 B20140404_SF100_02 TB501693.[MT7]-GIQFLISR.2b4_1.heavy 539.331 / 590.342 35167.0 34.543399810791016 46 16 10 10 10 1.918701965316982 34.76300922538101 0.0 3 0.9619723475991542 6.3085078611002405 35167.0 23.67616696588869 0.0 - - - - - - - 1341.142857142857 70 7 IQSEC3 IQ motif and Sec7 domain 3 1363 174 B20140404_SF100_02 B20140404_SF100_02 TB501693.[MT7]-GIQFLISR.2y6_1.heavy 539.331 / 763.446 50284.0 34.543399810791016 46 16 10 10 10 1.918701965316982 34.76300922538101 0.0 3 0.9619723475991542 6.3085078611002405 50284.0 74.63787784168288 0.0 - - - - - - - 743.0 100 9 IQSEC3 IQ motif and Sec7 domain 3 1365 174 B20140404_SF100_02 B20140404_SF100_02 TB501693.[MT7]-GIQFLISR.2y7_1.heavy 539.331 / 876.53 25301.0 34.543399810791016 46 16 10 10 10 1.918701965316982 34.76300922538101 0.0 3 0.9619723475991542 6.3085078611002405 25301.0 61.34538944723617 0.0 - - - - - - - 212.0 50 12 IQSEC3 IQ motif and Sec7 domain 3 1367 175 B20140404_SF100_02 B20140404_SF100_02 TB154196.[MT7]-ESNTPK[MT7].2b5_1.heavy 482.271 / 673.327 623.0 17.33930015563965 50 20 10 10 10 4.420356007701598 22.622612256969738 0.0 3 0.9919745838624247 13.766949252262112 623.0 0.7098013833992094 4.0 - - - - - - - 179.8235294117647 2 17 C3orf70 chromosome 3 open reading frame 70 1369 175 B20140404_SF100_02 B20140404_SF100_02 TB154196.[MT7]-ESNTPK[MT7].2y5_1.heavy 482.271 / 690.39 3032.0 17.33930015563965 50 20 10 10 10 4.420356007701598 22.622612256969738 0.0 3 0.9919745838624247 13.766949252262112 3032.0 28.962319368548876 0.0 - - - - - - - 131.9375 6 16 C3orf70 chromosome 3 open reading frame 70 1371 175 B20140404_SF100_02 B20140404_SF100_02 TB154196.[MT7]-ESNTPK[MT7].2b4_1.heavy 482.271 / 576.275 1705.0 17.33930015563965 50 20 10 10 10 4.420356007701598 22.622612256969738 0.0 3 0.9919745838624247 13.766949252262112 1705.0 10.458066881783513 1.0 - - - - - - - 262.1875 3 16 C3orf70 chromosome 3 open reading frame 70 1373 175 B20140404_SF100_02 B20140404_SF100_02 TB154196.[MT7]-ESNTPK[MT7].2y3_1.heavy 482.271 / 489.315 1218.0 17.33930015563965 50 20 10 10 10 4.420356007701598 22.622612256969738 0.0 3 0.9919745838624247 13.766949252262112 1218.0 11.244474272930649 1.0 - - - - - - - 213.2941176470588 2 17 C3orf70 chromosome 3 open reading frame 70 1375 176 B20140404_SF100_02 B20140404_SF100_02 TB501694.[MT7]-AEQGETSGR.2y8_1.heavy 539.766 / 863.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - IQSEC3 IQ motif and Sec7 domain 3 1377 176 B20140404_SF100_02 B20140404_SF100_02 TB501694.[MT7]-AEQGETSGR.2b4_1.heavy 539.766 / 530.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - IQSEC3 IQ motif and Sec7 domain 3 1379 176 B20140404_SF100_02 B20140404_SF100_02 TB501694.[MT7]-AEQGETSGR.2y6_1.heavy 539.766 / 606.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - IQSEC3 IQ motif and Sec7 domain 3 1381 176 B20140404_SF100_02 B20140404_SF100_02 TB501694.[MT7]-AEQGETSGR.2y7_1.heavy 539.766 / 734.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - IQSEC3 IQ motif and Sec7 domain 3 1383 177 B20140404_SF100_02 B20140404_SF100_02 TB154301.[MT7]-LQQDFK[MT7].2y4_1.heavy 533.81 / 681.369 21871.0 25.864032745361328 43 17 10 6 10 2.5173940023326096 32.06509401640426 0.0373992919921875 3 0.9736404127438936 7.5846306657170635 21871.0 28.643030869971938 0.0 - - - - - - - 1166.2857142857142 43 7 TSPAN11 tetraspanin 11 1385 177 B20140404_SF100_02 B20140404_SF100_02 TB154301.[MT7]-LQQDFK[MT7].2y5_1.heavy 533.81 / 809.427 N/A 25.864032745361328 43 17 10 6 10 2.5173940023326096 32.06509401640426 0.0373992919921875 3 0.9736404127438936 7.5846306657170635 37909.0 10.200031661849856 0.0 - - - - - - - 3888.0 75 2 TSPAN11 tetraspanin 11 1387 177 B20140404_SF100_02 B20140404_SF100_02 TB154301.[MT7]-LQQDFK[MT7].2b4_1.heavy 533.81 / 629.338 61141.0 25.864032745361328 43 17 10 6 10 2.5173940023326096 32.06509401640426 0.0373992919921875 3 0.9736404127438936 7.5846306657170635 61141.0 124.41697682159283 0.0 - - - - - - - 777.5714285714286 122 7 TSPAN11 tetraspanin 11 1389 177 B20140404_SF100_02 B20140404_SF100_02 TB154301.[MT7]-LQQDFK[MT7].2y3_1.heavy 533.81 / 553.31 17983.0 25.864032745361328 43 17 10 6 10 2.5173940023326096 32.06509401640426 0.0373992919921875 3 0.9736404127438936 7.5846306657170635 17983.0 15.109173525377228 0.0 - - - - - - - 694.2857142857143 35 7 TSPAN11 tetraspanin 11 1391 178 B20140404_SF100_02 B20140404_SF100_02 TB154195.[MT7]-NSLLESR.2y4_1.heavy 481.773 / 504.278 19167.0 25.46969985961914 35 13 6 10 6 0.8719059022655957 58.32214051474446 0.0 5 0.9029861241983849 3.929797944201331 19167.0 9.466646764120513 2.0 - - - - - - - 1094.0 150 2 IQSEC3 IQ motif and Sec7 domain 3 1393 178 B20140404_SF100_02 B20140404_SF100_02 TB154195.[MT7]-NSLLESR.2b4_1.heavy 481.773 / 572.352 22405.0 25.46969985961914 35 13 6 10 6 0.8719059022655957 58.32214051474446 0.0 5 0.9029861241983849 3.929797944201331 22405.0 17.0347172675856 3.0 - - - - - - - 787.5 52 2 IQSEC3 IQ motif and Sec7 domain 3 1395 178 B20140404_SF100_02 B20140404_SF100_02 TB154195.[MT7]-NSLLESR.2y6_1.heavy 481.773 / 704.394 41047.0 25.46969985961914 35 13 6 10 6 0.8719059022655957 58.32214051474446 0.0 5 0.9029861241983849 3.929797944201331 41047.0 56.82610649350649 0.0 - - - - - - - 438.0 82 1 IQSEC3 IQ motif and Sec7 domain 3 1397 178 B20140404_SF100_02 B20140404_SF100_02 TB154195.[MT7]-NSLLESR.2b5_1.heavy 481.773 / 701.395 45861.0 25.46969985961914 35 13 6 10 6 0.8719059022655957 58.32214051474446 0.0 5 0.9029861241983849 3.929797944201331 45861.0 33.1529908432071 0.0 - - - - - - - 263.0 91 2 IQSEC3 IQ motif and Sec7 domain 3 1399 179 B20140404_SF100_02 B20140404_SF100_02 TB154046.[MT7]-ELGAAR.2y4_1.heavy 380.725 / 374.215 85730.0 20.484899520874023 50 20 10 10 10 3.47536234778012 22.15302471505237 0.0 3 0.992533058921434 14.27316871202826 85730.0 12.938090626804188 0.0 - - - - - - - 3335.0 171 1 SMU1;C17orf85 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans);chromosome 17 open reading frame 85 1401 179 B20140404_SF100_02 B20140404_SF100_02 TB154046.[MT7]-ELGAAR.2y5_1.heavy 380.725 / 487.299 196625.0 20.484899520874023 50 20 10 10 10 3.47536234778012 22.15302471505237 0.0 3 0.992533058921434 14.27316871202826 196625.0 77.21345942134774 0.0 - - - - - - - 1289.0 393 1 SMU1;C17orf85 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans);chromosome 17 open reading frame 85 1403 179 B20140404_SF100_02 B20140404_SF100_02 TB154046.[MT7]-ELGAAR.2b4_1.heavy 380.725 / 515.295 80954.0 20.484899520874023 50 20 10 10 10 3.47536234778012 22.15302471505237 0.0 3 0.992533058921434 14.27316871202826 80954.0 31.658654629141935 1.0 - - - - - - - 910.0 161 1 SMU1;C17orf85 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans);chromosome 17 open reading frame 85 1405 179 B20140404_SF100_02 B20140404_SF100_02 TB154046.[MT7]-ELGAAR.2b5_1.heavy 380.725 / 586.332 N/A 20.484899520874023 50 20 10 10 10 3.47536234778012 22.15302471505237 0.0 3 0.992533058921434 14.27316871202826 53439.0 0.8489654790238661 3.0 - - - - - - - 2729.0 174 1 SMU1;C17orf85 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans);chromosome 17 open reading frame 85 1407 180 B20140404_SF100_02 B20140404_SF100_02 TB154049.[MT7]-VGATDR.2b3_1.heavy 381.715 / 372.236 18046.0 18.41029930114746 45 17 10 10 8 2.511296433678929 39.820070087665755 0.0 4 0.971389347582818 7.278762695436264 18046.0 6.575546379505999 3.0 - - - - - - - 1446.0 47 1 PCDHB5;PCDHB15;PCDHB14;PCDHB11;PCDHB10;PCDHB7;PCDHB6;PCDHB3 protocadherin beta 5;protocadherin beta 15;protocadherin beta 14;protocadherin beta 11;protocadherin beta 10;protocadherin beta 7;protocadherin beta 6;protocadherin beta 3 1409 180 B20140404_SF100_02 B20140404_SF100_02 TB154049.[MT7]-VGATDR.2y5_1.heavy 381.715 / 519.252 121522.0 18.41029930114746 45 17 10 10 8 2.511296433678929 39.820070087665755 0.0 4 0.971389347582818 7.278762695436264 121522.0 84.84620289680463 0.0 - - - - - - - 210.0 243 2 PCDHB5;PCDHB15;PCDHB14;PCDHB11;PCDHB10;PCDHB7;PCDHB6;PCDHB3 protocadherin beta 5;protocadherin beta 15;protocadherin beta 14;protocadherin beta 11;protocadherin beta 10;protocadherin beta 7;protocadherin beta 6;protocadherin beta 3 1411 180 B20140404_SF100_02 B20140404_SF100_02 TB154049.[MT7]-VGATDR.2b4_1.heavy 381.715 / 473.284 8021.0 18.41029930114746 45 17 10 10 8 2.511296433678929 39.820070087665755 0.0 4 0.971389347582818 7.278762695436264 8021.0 3.9423529290352857 1.0 - - - - - - - 816.0 16 4 PCDHB5;PCDHB15;PCDHB14;PCDHB11;PCDHB10;PCDHB7;PCDHB6;PCDHB3 protocadherin beta 5;protocadherin beta 15;protocadherin beta 14;protocadherin beta 11;protocadherin beta 10;protocadherin beta 7;protocadherin beta 6;protocadherin beta 3 1413 180 B20140404_SF100_02 B20140404_SF100_02 TB154049.[MT7]-VGATDR.2b5_1.heavy 381.715 / 588.311 67103.0 18.41029930114746 45 17 10 10 8 2.511296433678929 39.820070087665755 0.0 4 0.971389347582818 7.278762695436264 67103.0 55.277288746564864 0.0 - - - - - - - 766.6666666666666 134 9 PCDHB5;PCDHB15;PCDHB14;PCDHB11;PCDHB10;PCDHB7;PCDHB6;PCDHB3 protocadherin beta 5;protocadherin beta 15;protocadherin beta 14;protocadherin beta 11;protocadherin beta 10;protocadherin beta 7;protocadherin beta 6;protocadherin beta 3 1415 181 B20140404_SF100_02 B20140404_SF100_02 TB154318.[MT7]-DTEMLATGAQDGK[MT7].3b6_1.heavy 542.275 / 805.388 14482.0 25.28529930114746 48 18 10 10 10 3.118328251016771 32.068464879344795 0.0 3 0.9815193680597537 9.064270277920405 14482.0 26.359527104959632 0.0 - - - - - - - 677.9090909090909 28 11 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1417 181 B20140404_SF100_02 B20140404_SF100_02 TB154318.[MT7]-DTEMLATGAQDGK[MT7].3b4_1.heavy 542.275 / 621.267 63566.0 25.28529930114746 48 18 10 10 10 3.118328251016771 32.068464879344795 0.0 3 0.9815193680597537 9.064270277920405 63566.0 46.40452124592077 0.0 - - - - - - - 434.0 127 1 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1419 181 B20140404_SF100_02 B20140404_SF100_02 TB154318.[MT7]-DTEMLATGAQDGK[MT7].3b5_1.heavy 542.275 / 734.351 33301.0 25.28529930114746 48 18 10 10 10 3.118328251016771 32.068464879344795 0.0 3 0.9815193680597537 9.064270277920405 33301.0 38.40137288963797 0.0 - - - - - - - 706.0 66 7 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1421 181 B20140404_SF100_02 B20140404_SF100_02 TB154318.[MT7]-DTEMLATGAQDGK[MT7].3y4_1.heavy 542.275 / 591.322 25583.0 25.28529930114746 48 18 10 10 10 3.118328251016771 32.068464879344795 0.0 3 0.9815193680597537 9.064270277920405 25583.0 29.02663651889629 0.0 - - - - - - - 1268.5 51 8 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1423 182 B20140404_SF100_02 B20140404_SF100_02 TB154042.[MT7]-VVAAVR.2b3_1.heavy 379.754 / 414.283 88398.0 23.049650192260742 44 17 10 7 10 2.8444411496469812 35.15629072248896 0.027801513671875 3 0.9778335284121384 8.27386773272335 88398.0 60.69840531784416 0.0 - - - - - - - 1754.7777777777778 176 9 NIPSNAP3A;NIPSNAP3B nipsnap homolog 3A (C. elegans);nipsnap homolog 3B (C. elegans) 1425 182 B20140404_SF100_02 B20140404_SF100_02 TB154042.[MT7]-VVAAVR.2y5_1.heavy 379.754 / 515.33 504135.0 23.049650192260742 44 17 10 7 10 2.8444411496469812 35.15629072248896 0.027801513671875 3 0.9778335284121384 8.27386773272335 504135.0 221.9742021342753 0.0 - - - - - - - 1207.6666666666667 1008 3 NIPSNAP3A;NIPSNAP3B nipsnap homolog 3A (C. elegans);nipsnap homolog 3B (C. elegans) 1427 182 B20140404_SF100_02 B20140404_SF100_02 TB154042.[MT7]-VVAAVR.2b4_1.heavy 379.754 / 485.32 236070.0 23.049650192260742 44 17 10 7 10 2.8444411496469812 35.15629072248896 0.027801513671875 3 0.9778335284121384 8.27386773272335 236070.0 251.1135466434501 0.0 - - - - - - - 479.0 472 1 NIPSNAP3A;NIPSNAP3B nipsnap homolog 3A (C. elegans);nipsnap homolog 3B (C. elegans) 1429 182 B20140404_SF100_02 B20140404_SF100_02 TB154042.[MT7]-VVAAVR.2b5_1.heavy 379.754 / 584.389 46763.0 23.049650192260742 44 17 10 7 10 2.8444411496469812 35.15629072248896 0.027801513671875 3 0.9778335284121384 8.27386773272335 46763.0 39.35696458955208 0.0 - - - - - - - 1623.6666666666667 93 12 NIPSNAP3A;NIPSNAP3B nipsnap homolog 3A (C. elegans);nipsnap homolog 3B (C. elegans) 1431 183 B20140404_SF100_02 B20140404_SF100_02 TB154188.[MT7]-LADLVER.2y4_1.heavy 480.286 / 516.314 188823.0 30.476499557495117 46 16 10 10 10 2.893844981089416 27.4970955084783 0.0 3 0.9685540077124812 6.9412075585547495 188823.0 86.20634971705711 0.0 - - - - - - - 1356.3333333333333 377 3 ALDH1B1;ALDH1A2 aldehyde dehydrogenase 1 family, member B1;aldehyde dehydrogenase 1 family, member A2 1433 183 B20140404_SF100_02 B20140404_SF100_02 TB154188.[MT7]-LADLVER.2y5_1.heavy 480.286 / 631.341 50624.0 30.476499557495117 46 16 10 10 10 2.893844981089416 27.4970955084783 0.0 3 0.9685540077124812 6.9412075585547495 50624.0 18.30432525590977 0.0 - - - - - - - 488.0 101 1 ALDH1B1;ALDH1A2 aldehyde dehydrogenase 1 family, member B1;aldehyde dehydrogenase 1 family, member A2 1435 183 B20140404_SF100_02 B20140404_SF100_02 TB154188.[MT7]-LADLVER.2b4_1.heavy 480.286 / 557.341 76180.0 30.476499557495117 46 16 10 10 10 2.893844981089416 27.4970955084783 0.0 3 0.9685540077124812 6.9412075585547495 76180.0 62.499955365990544 0.0 - - - - - - - 1813.857142857143 152 7 ALDH1B1;ALDH1A2 aldehyde dehydrogenase 1 family, member B1;aldehyde dehydrogenase 1 family, member A2 1437 183 B20140404_SF100_02 B20140404_SF100_02 TB154188.[MT7]-LADLVER.2y6_1.heavy 480.286 / 702.378 256377.0 30.476499557495117 46 16 10 10 10 2.893844981089416 27.4970955084783 0.0 3 0.9685540077124812 6.9412075585547495 256377.0 103.67556629736787 0.0 - - - - - - - 488.0 512 1 ALDH1B1;ALDH1A2 aldehyde dehydrogenase 1 family, member B1;aldehyde dehydrogenase 1 family, member A2 1439 184 B20140404_SF100_02 B20140404_SF100_02 TB344741.[MT7]-GSPALSSEALVR.2y8_1.heavy 665.876 / 874.499 9431.0 28.401399612426758 50 20 10 10 10 6.836675795630098 14.626991682700314 0.0 3 0.9927786327552507 14.514128280723174 9431.0 17.278167938931297 0.0 - - - - - - - 720.5 18 8 PCDHB5;PCDHB14;PCDHB11;PCDHB9;PCDHB8;PCDHB7;PCDHB6;PCDHB4;PCDHB3;PCDHB2;PCDHB16 protocadherin beta 5;protocadherin beta 14;protocadherin beta 11;protocadherin beta 9;protocadherin beta 8;protocadherin beta 7;protocadherin beta 6;protocadherin beta 4;protocadherin beta 3;protocadherin beta 2;protocadherin beta 16 1441 184 B20140404_SF100_02 B20140404_SF100_02 TB344741.[MT7]-GSPALSSEALVR.2y10_1.heavy 665.876 / 1042.59 26065.0 28.401399612426758 50 20 10 10 10 6.836675795630098 14.626991682700314 0.0 3 0.9927786327552507 14.514128280723174 26065.0 116.79507633587787 0.0 - - - - - - - 694.3 52 10 PCDHB5;PCDHB14;PCDHB11;PCDHB9;PCDHB8;PCDHB7;PCDHB6;PCDHB4;PCDHB3;PCDHB2;PCDHB16 protocadherin beta 5;protocadherin beta 14;protocadherin beta 11;protocadherin beta 9;protocadherin beta 8;protocadherin beta 7;protocadherin beta 6;protocadherin beta 4;protocadherin beta 3;protocadherin beta 2;protocadherin beta 16 1443 184 B20140404_SF100_02 B20140404_SF100_02 TB344741.[MT7]-GSPALSSEALVR.2y11_1.heavy 665.876 / 1129.62 8383.0 28.401399612426758 50 20 10 10 10 6.836675795630098 14.626991682700314 0.0 3 0.9927786327552507 14.514128280723174 8383.0 23.037251908396946 0.0 - - - - - - - 180.125 16 8 PCDHB5;PCDHB14;PCDHB11;PCDHB9;PCDHB8;PCDHB7;PCDHB6;PCDHB4;PCDHB3;PCDHB2;PCDHB16 protocadherin beta 5;protocadherin beta 14;protocadherin beta 11;protocadherin beta 9;protocadherin beta 8;protocadherin beta 7;protocadherin beta 6;protocadherin beta 4;protocadherin beta 3;protocadherin beta 2;protocadherin beta 16 1445 184 B20140404_SF100_02 B20140404_SF100_02 TB344741.[MT7]-GSPALSSEALVR.2y7_1.heavy 665.876 / 761.415 18075.0 28.401399612426758 50 20 10 10 10 6.836675795630098 14.626991682700314 0.0 3 0.9927786327552507 14.514128280723174 18075.0 25.249809160305343 0.0 - - - - - - - 641.9 36 10 PCDHB5;PCDHB14;PCDHB11;PCDHB9;PCDHB8;PCDHB7;PCDHB6;PCDHB4;PCDHB3;PCDHB2;PCDHB16 protocadherin beta 5;protocadherin beta 14;protocadherin beta 11;protocadherin beta 9;protocadherin beta 8;protocadherin beta 7;protocadherin beta 6;protocadherin beta 4;protocadherin beta 3;protocadherin beta 2;protocadherin beta 16 1447 185 B20140404_SF100_02 B20140404_SF100_02 TB502023.[MT7]-LAAISGPEDGEIHPEIC[CAM]R.3b6_1.heavy 703.357 / 657.405 31032.0 29.93440055847168 50 20 10 10 10 2.4703559100250487 30.246855053109847 0.0 3 0.9908789453383624 12.912465827678481 31032.0 18.63783783783784 0.0 - - - - - - - 783.5 62 2 RGS7BP regulator of G-protein signaling 7 binding protein 1449 185 B20140404_SF100_02 B20140404_SF100_02 TB502023.[MT7]-LAAISGPEDGEIHPEIC[CAM]R.3y6_1.heavy 703.357 / 811.388 42316.0 29.93440055847168 50 20 10 10 10 2.4703559100250487 30.246855053109847 0.0 3 0.9908789453383624 12.912465827678481 42316.0 23.469925434117588 0.0 - - - - - - - 716.5714285714286 84 7 RGS7BP regulator of G-protein signaling 7 binding protein 1451 185 B20140404_SF100_02 B20140404_SF100_02 TB502023.[MT7]-LAAISGPEDGEIHPEIC[CAM]R.3b4_1.heavy 703.357 / 513.352 60966.0 29.93440055847168 50 20 10 10 10 2.4703559100250487 30.246855053109847 0.0 3 0.9908789453383624 12.912465827678481 60966.0 52.360071517286386 0.0 - - - - - - - 470.0 121 2 RGS7BP regulator of G-protein signaling 7 binding protein 1453 185 B20140404_SF100_02 B20140404_SF100_02 TB502023.[MT7]-LAAISGPEDGEIHPEIC[CAM]R.3y5_1.heavy 703.357 / 674.329 198728.0 29.93440055847168 50 20 10 10 10 2.4703559100250487 30.246855053109847 0.0 3 0.9908789453383624 12.912465827678481 198728.0 65.46768243516416 0.0 - - - - - - - 627.0 397 1 RGS7BP regulator of G-protein signaling 7 binding protein 1455 186 B20140404_SF100_02 B20140404_SF100_02 TB502028.[MT7]-GTVLDQVPINPSLYLVK[MT7].3b6_1.heavy 715.424 / 758.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPIN2B;SPIN2A spindlin family, member 2B;spindlin family, member 2A 1457 186 B20140404_SF100_02 B20140404_SF100_02 TB502028.[MT7]-GTVLDQVPINPSLYLVK[MT7].3b4_1.heavy 715.424 / 515.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPIN2B;SPIN2A spindlin family, member 2B;spindlin family, member 2A 1459 186 B20140404_SF100_02 B20140404_SF100_02 TB502028.[MT7]-GTVLDQVPINPSLYLVK[MT7].3b5_1.heavy 715.424 / 630.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPIN2B;SPIN2A spindlin family, member 2B;spindlin family, member 2A 1461 186 B20140404_SF100_02 B20140404_SF100_02 TB502028.[MT7]-GTVLDQVPINPSLYLVK[MT7].3b7_1.heavy 715.424 / 857.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPIN2B;SPIN2A spindlin family, member 2B;spindlin family, member 2A 1463 187 B20140404_SF100_02 B20140404_SF100_02 TB501867.[MT7]-DALQAMILSLPR.2y8_1.heavy 736.425 / 900.534 5551.0 40.5160493850708 26 14 0 6 6 1.183382014079516 56.0426218778578 0.039798736572265625 5 0.9301472878968358 4.64204842332436 5551.0 15.135130314242325 0.0 - - - - - - - 265.8421052631579 11 19 IQSEC3 IQ motif and Sec7 domain 3 1465 187 B20140404_SF100_02 B20140404_SF100_02 TB501867.[MT7]-DALQAMILSLPR.2b4_1.heavy 736.425 / 572.316 6046.0 40.5160493850708 26 14 0 6 6 1.183382014079516 56.0426218778578 0.039798736572265625 5 0.9301472878968358 4.64204842332436 6046.0 21.649285515707533 0.0 - - - - - - - 793.0 12 8 IQSEC3 IQ motif and Sec7 domain 3 1467 187 B20140404_SF100_02 B20140404_SF100_02 TB501867.[MT7]-DALQAMILSLPR.2b5_1.heavy 736.425 / 643.353 4758.0 40.5160493850708 26 14 0 6 6 1.183382014079516 56.0426218778578 0.039798736572265625 5 0.9301472878968358 4.64204842332436 4758.0 6.7071202691278735 2.0 - - - - - - - 807.1428571428571 41 7 IQSEC3 IQ motif and Sec7 domain 3 1469 187 B20140404_SF100_02 B20140404_SF100_02 TB501867.[MT7]-DALQAMILSLPR.2y7_1.heavy 736.425 / 829.496 3767.0 40.5160493850708 26 14 0 6 6 1.183382014079516 56.0426218778578 0.039798736572265625 5 0.9301472878968358 4.64204842332436 3767.0 12.026228662774534 0.0 - - - - - - - 274.3076923076923 7 13 IQSEC3 IQ motif and Sec7 domain 3 1471 188 B20140404_SF100_02 B20140404_SF100_02 TB501572.[MT7]-QTQPER.2y4_1.heavy 451.744 / 529.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1473 188 B20140404_SF100_02 B20140404_SF100_02 TB501572.[MT7]-QTQPER.2b3_1.heavy 451.744 / 502.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1475 188 B20140404_SF100_02 B20140404_SF100_02 TB501572.[MT7]-QTQPER.2y5_1.heavy 451.744 / 630.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1477 188 B20140404_SF100_02 B20140404_SF100_02 TB501572.[MT7]-QTQPER.2b5_1.heavy 451.744 / 728.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1479 189 B20140404_SF100_02 B20140404_SF100_02 TB154847.[MT7]-YMFIQTQDTPNPNSLK[MT7].3y7_1.heavy 729.045 / 913.522 26125.0 32.842201232910156 50 20 10 10 10 7.800804898013567 12.819189981980507 0.0 3 0.991868916139211 13.677081544465988 26125.0 40.35585589558161 0.0 - - - - - - - 352.14285714285717 52 7 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1481 189 B20140404_SF100_02 B20140404_SF100_02 TB154847.[MT7]-YMFIQTQDTPNPNSLK[MT7].3b4_1.heavy 729.045 / 699.366 32532.0 32.842201232910156 50 20 10 10 10 7.800804898013567 12.819189981980507 0.0 3 0.991868916139211 13.677081544465988 32532.0 28.920744298439015 0.0 - - - - - - - 493.0 65 1 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1483 189 B20140404_SF100_02 B20140404_SF100_02 TB154847.[MT7]-YMFIQTQDTPNPNSLK[MT7].3b5_1.heavy 729.045 / 827.424 18895.0 32.842201232910156 50 20 10 10 10 7.800804898013567 12.819189981980507 0.0 3 0.991868916139211 13.677081544465988 18895.0 8.055792901328722 0.0 - - - - - - - 438.3333333333333 37 3 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1485 189 B20140404_SF100_02 B20140404_SF100_02 TB154847.[MT7]-YMFIQTQDTPNPNSLK[MT7].3y5_1.heavy 729.045 / 702.427 55207.0 32.842201232910156 50 20 10 10 10 7.800804898013567 12.819189981980507 0.0 3 0.991868916139211 13.677081544465988 55207.0 26.645825047372398 0.0 - - - - - - - 329.0 110 1 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1487 190 B20140404_SF100_02 B20140404_SF100_02 TB154829.[MT7]-NQDDSSLLNLTPYPLVR.3b6_1.heavy 697.04 / 791.329 61600.0 37.442901611328125 48 18 10 10 10 24.32603102755789 4.110822677432024 0.0 3 0.9831513154871935 9.494403921900968 61600.0 34.871668508478585 0.0 - - - - - - - 383.0 123 1 RGS7BP regulator of G-protein signaling 7 binding protein 1489 190 B20140404_SF100_02 B20140404_SF100_02 TB154829.[MT7]-NQDDSSLLNLTPYPLVR.3y6_1.heavy 697.04 / 744.44 227868.0 37.442901611328125 48 18 10 10 10 24.32603102755789 4.110822677432024 0.0 3 0.9831513154871935 9.494403921900968 227868.0 36.53915238636618 0.0 - - - - - - - 1917.0 455 1 RGS7BP regulator of G-protein signaling 7 binding protein 1491 190 B20140404_SF100_02 B20140404_SF100_02 TB154829.[MT7]-NQDDSSLLNLTPYPLVR.3b4_1.heavy 697.04 / 617.265 36934.0 37.442901611328125 48 18 10 10 10 24.32603102755789 4.110822677432024 0.0 3 0.9831513154871935 9.494403921900968 36934.0 31.490019901929525 0.0 - - - - - - - 383.0 73 1 RGS7BP regulator of G-protein signaling 7 binding protein 1493 190 B20140404_SF100_02 B20140404_SF100_02 TB154829.[MT7]-NQDDSSLLNLTPYPLVR.3b7_1.heavy 697.04 / 904.413 64028.0 37.442901611328125 48 18 10 10 10 24.32603102755789 4.110822677432024 0.0 3 0.9831513154871935 9.494403921900968 64028.0 33.090728701855255 0.0 - - - - - - - 664.6 128 5 RGS7BP regulator of G-protein signaling 7 binding protein 1495 191 B20140404_SF100_02 B20140404_SF100_02 TB501723.[MT7]-LQNQTEPR.2b3_1.heavy 565.308 / 500.295 6860.0 20.484899520874023 41 11 10 10 10 0.8566962047683729 61.1888471408327 0.0 3 0.8736479366680479 3.4346982661879033 6860.0 14.221951219512196 0.0 - - - - - - - 692.4285714285714 13 7 SLC25A45 solute carrier family 25, member 45 1497 191 B20140404_SF100_02 B20140404_SF100_02 TB501723.[MT7]-LQNQTEPR.2b6_1.heavy 565.308 / 858.444 38925.0 20.484899520874023 41 11 10 10 10 0.8566962047683729 61.1888471408327 0.0 3 0.8736479366680479 3.4346982661879033 38925.0 154.06601426849238 0.0 - - - - - - - 288.26666666666665 77 15 SLC25A45 solute carrier family 25, member 45 1499 191 B20140404_SF100_02 B20140404_SF100_02 TB501723.[MT7]-LQNQTEPR.2y6_1.heavy 565.308 / 744.364 19015.0 20.484899520874023 41 11 10 10 10 0.8566962047683729 61.1888471408327 0.0 3 0.8736479366680479 3.4346982661879033 19015.0 89.18281453359003 0.0 - - - - - - - 253.6 38 15 SLC25A45 solute carrier family 25, member 45 1501 191 B20140404_SF100_02 B20140404_SF100_02 TB501723.[MT7]-LQNQTEPR.2y7_1.heavy 565.308 / 872.422 34003.0 20.484899520874023 41 11 10 10 10 0.8566962047683729 61.1888471408327 0.0 3 0.8736479366680479 3.4346982661879033 34003.0 482.8426 0.0 - - - - - - - 216.4 68 10 SLC25A45 solute carrier family 25, member 45 1503 192 B20140404_SF100_02 B20140404_SF100_02 TB154593.[MT7]-LREADSQDLK[MT7].3y3_1.heavy 488.275 / 519.326 48561.0 22.88610076904297 39 11 10 10 8 2.003073026415571 39.83762079432057 0.0 4 0.8648344126506716 3.318268694251856 48561.0 39.850269212790636 0.0 - - - - - - - 1229.2857142857142 97 7 OLFML2B olfactomedin-like 2B 1505 192 B20140404_SF100_02 B20140404_SF100_02 TB154593.[MT7]-LREADSQDLK[MT7].3b5_1.heavy 488.275 / 729.401 16802.0 22.88610076904297 39 11 10 10 8 2.003073026415571 39.83762079432057 0.0 4 0.8648344126506716 3.318268694251856 16802.0 15.689335541100675 0.0 - - - - - - - 634.1428571428571 33 7 OLFML2B olfactomedin-like 2B 1507 192 B20140404_SF100_02 B20140404_SF100_02 TB154593.[MT7]-LREADSQDLK[MT7].3y5_1.heavy 488.275 / 734.417 20285.0 22.88610076904297 39 11 10 10 8 2.003073026415571 39.83762079432057 0.0 4 0.8648344126506716 3.318268694251856 20285.0 4.526613015528286 2.0 - - - - - - - 623.0 92 8 OLFML2B olfactomedin-like 2B 1509 192 B20140404_SF100_02 B20140404_SF100_02 TB154593.[MT7]-LREADSQDLK[MT7].3b8_2.heavy 488.275 / 530.263 63996.0 22.88610076904297 39 11 10 10 8 2.003073026415571 39.83762079432057 0.0 4 0.8648344126506716 3.318268694251856 63996.0 44.12930691544793 0.0 - - - - - - - 1680.1 127 10 OLFML2B olfactomedin-like 2B 1511 193 B20140404_SF100_02 B20140404_SF100_02 TB154844.[MT7]-DSYQPPGNVYWPLRGK[MT7].3y7_1.heavy 722.384 / 1063.62 3664.0 32.301300048828125 38 8 10 10 10 0.7054311142649035 79.29688078784682 0.0 3 0.7876067740681694 2.628979019384997 3664.0 5.118488361610443 1.0 - - - - - - - 200.2 8 5 SPAG8 sperm associated antigen 8 1513 193 B20140404_SF100_02 B20140404_SF100_02 TB154844.[MT7]-DSYQPPGNVYWPLRGK[MT7].3b4_1.heavy 722.384 / 638.29 43635.0 32.301300048828125 38 8 10 10 10 0.7054311142649035 79.29688078784682 0.0 3 0.7876067740681694 2.628979019384997 43635.0 55.0286977752862 0.0 - - - - - - - 333.0 87 1 SPAG8 sperm associated antigen 8 1515 193 B20140404_SF100_02 B20140404_SF100_02 TB154844.[MT7]-DSYQPPGNVYWPLRGK[MT7].3y12_2.heavy 722.384 / 764.431 78609.0 32.301300048828125 38 8 10 10 10 0.7054311142649035 79.29688078784682 0.0 3 0.7876067740681694 2.628979019384997 78609.0 64.73562739246685 0.0 - - - - - - - 333.0 157 2 SPAG8 sperm associated antigen 8 1517 193 B20140404_SF100_02 B20140404_SF100_02 TB154844.[MT7]-DSYQPPGNVYWPLRGK[MT7].3y5_1.heavy 722.384 / 714.474 13823.0 32.301300048828125 38 8 10 10 10 0.7054311142649035 79.29688078784682 0.0 3 0.7876067740681694 2.628979019384997 13823.0 7.124001259725942 0.0 - - - - - - - 250.0 27 2 SPAG8 sperm associated antigen 8 1519 194 B20140404_SF100_02 B20140404_SF100_02 TB501720.[MT7]-EYILSSLR.2b3_1.heavy 562.825 / 550.299 25428.0 32.74639892578125 44 14 10 10 10 1.8847576786830789 45.98496899838196 0.0 3 0.9448534543412498 5.23102628621032 25428.0 16.543235120484162 0.0 - - - - - - - 669.0 50 1 SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 1521 194 B20140404_SF100_02 B20140404_SF100_02 TB501720.[MT7]-EYILSSLR.2y5_1.heavy 562.825 / 575.351 28941.0 32.74639892578125 44 14 10 10 10 1.8847576786830789 45.98496899838196 0.0 3 0.9448534543412498 5.23102628621032 28941.0 28.88209531439459 0.0 - - - - - - - 167.0 57 1 SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 1523 194 B20140404_SF100_02 B20140404_SF100_02 TB501720.[MT7]-EYILSSLR.2y6_1.heavy 562.825 / 688.435 38142.0 32.74639892578125 44 14 10 10 10 1.8847576786830789 45.98496899838196 0.0 3 0.9448534543412498 5.23102628621032 38142.0 30.193690754852973 0.0 - - - - - - - 335.0 76 1 SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 1525 194 B20140404_SF100_02 B20140404_SF100_02 TB501720.[MT7]-EYILSSLR.2y7_1.heavy 562.825 / 851.498 46506.0 32.74639892578125 44 14 10 10 10 1.8847576786830789 45.98496899838196 0.0 3 0.9448534543412498 5.23102628621032 46506.0 0.6057870570908774 1.0 - - - - - - - 167.0 93 1 SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 1527 195 B20140404_SF100_02 B20140404_SF100_02 TB154599.[MT7]-TMDFPTPAAAFR.2y8_1.heavy 734.872 / 830.452 31209.0 34.4286994934082 40 15 10 5 10 2.1376071650245487 46.78128031950696 0.04579925537109375 3 0.9504469851102342 5.520995922073106 31209.0 41.573042742875245 0.0 - - - - - - - 362.3333333333333 62 3 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1529 195 B20140404_SF100_02 B20140404_SF100_02 TB154599.[MT7]-TMDFPTPAAAFR.2b4_1.heavy 734.872 / 639.293 24998.0 34.4286994934082 40 15 10 5 10 2.1376071650245487 46.78128031950696 0.04579925537109375 3 0.9504469851102342 5.520995922073106 24998.0 38.748898375758465 0.0 - - - - - - - 388.5 49 2 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1531 195 B20140404_SF100_02 B20140404_SF100_02 TB154599.[MT7]-TMDFPTPAAAFR.2y9_1.heavy 734.872 / 977.52 28414.0 34.4286994934082 40 15 10 5 10 2.1376071650245487 46.78128031950696 0.04579925537109375 3 0.9504469851102342 5.520995922073106 28414.0 39.984417277660086 0.0 - - - - - - - 310.6666666666667 56 6 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1533 195 B20140404_SF100_02 B20140404_SF100_02 TB154599.[MT7]-TMDFPTPAAAFR.2y11_1.heavy 734.872 / 1223.59 5124.0 34.4286994934082 40 15 10 5 10 2.1376071650245487 46.78128031950696 0.04579925537109375 3 0.9504469851102342 5.520995922073106 5124.0 16.487117801812335 0.0 - - - - - - - 266.2857142857143 10 7 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1535 196 B20140404_SF100_02 B20140404_SF100_02 TB154596.[MT7]-EHPQHLC[CAM]EK[MT7].3y3_1.heavy 489.254 / 580.288 26246.0 18.86840057373047 50 20 10 10 10 3.8348643421030157 20.497708555834787 0.0 3 0.9929048767248226 14.642838796257127 26246.0 78.93884116255738 0.0 - - - - - - - 272.92857142857144 52 14 ZCCHC24 zinc finger, CCHC domain containing 24 1537 196 B20140404_SF100_02 B20140404_SF100_02 TB154596.[MT7]-EHPQHLC[CAM]EK[MT7].3b4_1.heavy 489.254 / 636.322 12815.0 18.86840057373047 50 20 10 10 10 3.8348643421030157 20.497708555834787 0.0 3 0.9929048767248226 14.642838796257127 12815.0 66.56872972972974 0.0 - - - - - - - 196.375 25 16 ZCCHC24 zinc finger, CCHC domain containing 24 1539 196 B20140404_SF100_02 B20140404_SF100_02 TB154596.[MT7]-EHPQHLC[CAM]EK[MT7].3y4_1.heavy 489.254 / 693.372 14725.0 18.86840057373047 50 20 10 10 10 3.8348643421030157 20.497708555834787 0.0 3 0.9929048767248226 14.642838796257127 14725.0 120.54051307404967 0.0 - - - - - - - 205.33333333333334 29 18 ZCCHC24 zinc finger, CCHC domain containing 24 1541 196 B20140404_SF100_02 B20140404_SF100_02 TB154596.[MT7]-EHPQHLC[CAM]EK[MT7].3y5_1.heavy 489.254 / 830.431 5360.0 18.86840057373047 50 20 10 10 10 3.8348643421030157 20.497708555834787 0.0 3 0.9929048767248226 14.642838796257127 5360.0 31.30258844210063 0.0 - - - - - - - 159.25 10 12 ZCCHC24 zinc finger, CCHC domain containing 24 1543 197 B20140404_SF100_02 B20140404_SF100_02 TB344674.[MT7]-GFVC[CAM]ELC[CAM]R.2b4_1.heavy 592.787 / 608.298 7771.0 29.837600708007812 43 13 10 10 10 6.03308773265313 16.57526036937369 0.0 3 0.9169083021037513 4.251375601424563 7771.0 18.10285238967483 0.0 - - - - - - - 396.5 15 4 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1545 197 B20140404_SF100_02 B20140404_SF100_02 TB344674.[MT7]-GFVC[CAM]ELC[CAM]R.2b6_1.heavy 592.787 / 850.425 13163.0 29.837600708007812 43 13 10 10 10 6.03308773265313 16.57526036937369 0.0 3 0.9169083021037513 4.251375601424563 13163.0 32.05255896305558 0.0 - - - - - - - 317.2 26 10 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1547 197 B20140404_SF100_02 B20140404_SF100_02 TB344674.[MT7]-GFVC[CAM]ELC[CAM]R.2y6_1.heavy 592.787 / 836.375 27754.0 29.837600708007812 43 13 10 10 10 6.03308773265313 16.57526036937369 0.0 3 0.9169083021037513 4.251375601424563 27754.0 51.407619123325006 0.0 - - - - - - - 249.28571428571428 55 7 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1549 197 B20140404_SF100_02 B20140404_SF100_02 TB344674.[MT7]-GFVC[CAM]ELC[CAM]R.2y7_1.heavy 592.787 / 983.444 19665.0 29.837600708007812 43 13 10 10 10 6.03308773265313 16.57526036937369 0.0 3 0.9169083021037513 4.251375601424563 19665.0 23.403400861456902 0.0 - - - - - - - 282.0 39 9 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1551 198 B20140404_SF100_02 B20140404_SF100_02 TB501821.[MT7]-LFMILWLK[MT7].3y3_1.heavy 451.285 / 590.378 44879.0 44.718400955200195 40 14 10 6 10 2.23482070673459 44.7463188875295 0.032001495361328125 3 0.9333306279083153 4.752873951713848 44879.0 247.38926720250413 0.0 - - - - - - - 114.66666666666667 89 6 CLIC2;CLIC4;CLIC5;CLIC6 chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5;chloride intracellular channel 6 1553 198 B20140404_SF100_02 B20140404_SF100_02 TB501821.[MT7]-LFMILWLK[MT7].3b4_1.heavy 451.285 / 649.386 40757.0 44.718400955200195 40 14 10 6 10 2.23482070673459 44.7463188875295 0.032001495361328125 3 0.9333306279083153 4.752873951713848 40757.0 218.39757243363138 0.0 - - - - - - - 157.0 81 7 CLIC2;CLIC4;CLIC5;CLIC6 chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5;chloride intracellular channel 6 1555 198 B20140404_SF100_02 B20140404_SF100_02 TB501821.[MT7]-LFMILWLK[MT7].3b5_1.heavy 451.285 / 762.47 11311.0 44.718400955200195 40 14 10 6 10 2.23482070673459 44.7463188875295 0.032001495361328125 3 0.9333306279083153 4.752873951713848 11311.0 -14.75347826086957 0.0 - - - - - - - 168.16666666666666 22 6 CLIC2;CLIC4;CLIC5;CLIC6 chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5;chloride intracellular channel 6 1557 198 B20140404_SF100_02 B20140404_SF100_02 TB501821.[MT7]-LFMILWLK[MT7].3b3_1.heavy 451.285 / 536.302 45245.0 44.718400955200195 40 14 10 6 10 2.23482070673459 44.7463188875295 0.032001495361328125 3 0.9333306279083153 4.752873951713848 45245.0 200.29579276939154 0.0 - - - - - - - 142.55555555555554 90 9 CLIC2;CLIC4;CLIC5;CLIC6 chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5;chloride intracellular channel 6 1559 199 B20140404_SF100_02 B20140404_SF100_02 TB501820.[MT7]-LFMILWLK[MT7].2y4_1.heavy 676.424 / 703.462 5915.0 44.73440170288086 47 17 10 10 10 2.70238291236263 29.517009594160815 0.0 3 0.9767318720460874 8.07487728413027 5915.0 -2.2023936170212792 0.0 - - - - - - - 206.8 11 15 CLIC2;CLIC4;CLIC5;CLIC6 chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5;chloride intracellular channel 6 1561 199 B20140404_SF100_02 B20140404_SF100_02 TB501820.[MT7]-LFMILWLK[MT7].2b3_1.heavy 676.424 / 536.302 6807.0 44.73440170288086 47 17 10 10 10 2.70238291236263 29.517009594160815 0.0 3 0.9767318720460874 8.07487728413027 6807.0 -0.9234302325581396 0.0 - - - - - - - 213.0 13 15 CLIC2;CLIC4;CLIC5;CLIC6 chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5;chloride intracellular channel 6 1563 199 B20140404_SF100_02 B20140404_SF100_02 TB501820.[MT7]-LFMILWLK[MT7].2b4_1.heavy 676.424 / 649.386 6244.0 44.73440170288086 47 17 10 10 10 2.70238291236263 29.517009594160815 0.0 3 0.9767318720460874 8.07487728413027 6244.0 16.575311839323465 0.0 - - - - - - - 168.41666666666666 12 12 CLIC2;CLIC4;CLIC5;CLIC6 chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5;chloride intracellular channel 6 1565 199 B20140404_SF100_02 B20140404_SF100_02 TB501820.[MT7]-LFMILWLK[MT7].2y3_1.heavy 676.424 / 590.378 8497.0 44.73440170288086 47 17 10 10 10 2.70238291236263 29.517009594160815 0.0 3 0.9767318720460874 8.07487728413027 8497.0 19.962192012716894 0.0 - - - - - - - 285.8333333333333 16 12 CLIC2;CLIC4;CLIC5;CLIC6 chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5;chloride intracellular channel 6 1567 200 B20140404_SF100_02 B20140404_SF100_02 TB502093.[MT7]-LREINPLLFSYVEELVEIRK[MT7].4y5_1.heavy 687.903 / 788.511 3409.0 41.388099670410156 48 20 10 10 8 4.961154273274532 20.156599551579063 0.0 4 0.9955127318503323 18.41657325894329 3409.0 5.7541515666381855 1.0 - - - - - - - 637.9 6 10 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1569 200 B20140404_SF100_02 B20140404_SF100_02 TB502093.[MT7]-LREINPLLFSYVEELVEIRK[MT7].4y8_1.heavy 687.903 / 1159.68 4370.0 41.388099670410156 48 20 10 10 8 4.961154273274532 20.156599551579063 0.0 4 0.9955127318503323 18.41657325894329 4370.0 56.29686725264819 1.0 - - - - - - - 192.3 13 10 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1571 200 B20140404_SF100_02 B20140404_SF100_02 TB502093.[MT7]-LREINPLLFSYVEELVEIRK[MT7].4b7_1.heavy 687.903 / 980.601 3933.0 41.388099670410156 48 20 10 10 8 4.961154273274532 20.156599551579063 0.0 4 0.9955127318503323 18.41657325894329 3933.0 17.41053435114504 0.0 - - - - - - - 210.7058823529412 7 17 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1573 200 B20140404_SF100_02 B20140404_SF100_02 TB502093.[MT7]-LREINPLLFSYVEELVEIRK[MT7].4b5_1.heavy 687.903 / 770.464 23511.0 41.388099670410156 48 20 10 10 8 4.961154273274532 20.156599551579063 0.0 4 0.9955127318503323 18.41657325894329 23511.0 66.75115776081425 0.0 - - - - - - - 611.7142857142857 47 7 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1575 201 B20140404_SF100_02 B20140404_SF100_02 TB501817.[MT7]-LMALLGQALK[MT7].2y5_1.heavy 673.428 / 660.416 36638.0 39.80659866333008 48 18 10 10 10 7.435682397890258 13.448664782720307 0.0 3 0.9883406041260414 11.41830062664242 36638.0 49.07146511545419 0.0 - - - - - - - 233.2 73 5 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1577 201 B20140404_SF100_02 B20140404_SF100_02 TB501817.[MT7]-LMALLGQALK[MT7].2y9_1.heavy 673.428 / 1088.66 7836.0 39.80659866333008 48 18 10 10 10 7.435682397890258 13.448664782720307 0.0 3 0.9883406041260414 11.41830062664242 7836.0 43.20444733022687 0.0 - - - - - - - 212.0 15 11 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1579 201 B20140404_SF100_02 B20140404_SF100_02 TB501817.[MT7]-LMALLGQALK[MT7].2b4_1.heavy 673.428 / 573.355 31767.0 39.80659866333008 48 18 10 10 10 7.435682397890258 13.448664782720307 0.0 3 0.9883406041260414 11.41830062664242 31767.0 37.000638142820634 0.0 - - - - - - - 1270.888888888889 63 9 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1581 201 B20140404_SF100_02 B20140404_SF100_02 TB501817.[MT7]-LMALLGQALK[MT7].2y6_1.heavy 673.428 / 773.5 21178.0 39.80659866333008 48 18 10 10 10 7.435682397890258 13.448664782720307 0.0 3 0.9883406041260414 11.41830062664242 21178.0 45.503560247822385 0.0 - - - - - - - 816.7142857142857 42 7 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1583 202 B20140404_SF100_02 B20140404_SF100_02 TB154859.[MT7]-EWQEQFLIPNLALIDK[MT7].3b6_1.heavy 749.087 / 992.459 105755.0 40.92729949951172 46 16 10 10 10 2.281908997715349 35.08489110314524 0.0 3 0.9602532456224051 6.16967735122708 105755.0 203.02139755878778 0.0 - - - - - - - 314.8 211 5 NIPSNAP3A nipsnap homolog 3A (C. elegans) 1585 202 B20140404_SF100_02 B20140404_SF100_02 TB154859.[MT7]-EWQEQFLIPNLALIDK[MT7].3b5_1.heavy 749.087 / 845.391 131888.0 40.92729949951172 46 16 10 10 10 2.281908997715349 35.08489110314524 0.0 3 0.9602532456224051 6.16967735122708 131888.0 62.134084357111746 0.0 - - - - - - - 736.4285714285714 263 7 NIPSNAP3A nipsnap homolog 3A (C. elegans) 1587 202 B20140404_SF100_02 B20140404_SF100_02 TB154859.[MT7]-EWQEQFLIPNLALIDK[MT7].3b3_1.heavy 749.087 / 588.29 49819.0 40.92729949951172 46 16 10 10 10 2.281908997715349 35.08489110314524 0.0 3 0.9602532456224051 6.16967735122708 49819.0 42.69166046816129 0.0 - - - - - - - 1234.625 99 8 NIPSNAP3A nipsnap homolog 3A (C. elegans) 1589 202 B20140404_SF100_02 B20140404_SF100_02 TB154859.[MT7]-EWQEQFLIPNLALIDK[MT7].3y8_1.heavy 749.087 / 1027.63 119914.0 40.92729949951172 46 16 10 10 10 2.281908997715349 35.08489110314524 0.0 3 0.9602532456224051 6.16967735122708 119914.0 136.8410427052177 0.0 - - - - - - - 679.8888888888889 239 9 NIPSNAP3A nipsnap homolog 3A (C. elegans) 1591 203 B20140404_SF100_02 B20140404_SF100_02 TB501585.[MT7]-SYFDPR.2b4_1.heavy 464.736 / 657.3 645890.0 26.885499954223633 48 18 10 10 10 10.802872223382066 9.256797445364294 0.0 2 0.9869772894318212 10.802872207678 645890.0 123.08304194862502 0.0 - - - - - - - 759.0 1291 1 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1593 203 B20140404_SF100_02 B20140404_SF100_02 TB501585.[MT7]-SYFDPR.2b3_1.heavy 464.736 / 542.273 51908.0 26.885499954223633 48 18 10 10 10 10.802872223382066 9.256797445364294 0.0 2 0.9869772894318212 10.802872207678 51908.0 31.181999296900422 0.0 - - - - - - - 474.0 103 1 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1595 204 B20140404_SF100_02 B20140404_SF100_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 1151700.0 37.645599365234375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1151700.0 458.7869633178991 0.0 - - - - - - - 1531.0 2303 1 1597 204 B20140404_SF100_02 B20140404_SF100_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 2101780.0 37.645599365234375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2101780.0 354.07945367741786 0.0 - - - - - - - 1403.0 4203 1 1599 204 B20140404_SF100_02 B20140404_SF100_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 1803720.0 37.645599365234375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1803720.0 500.91717731453326 0.0 - - - - - - - 3700.0 3607 2 1601 205 B20140404_SF100_02 B20140404_SF100_02 TB344665.[MT7]-GVDDGADIPR.2b4_1.heavy 579.797 / 531.253 49686.0 24.297500610351562 39 13 10 6 10 1.284151288693762 53.076232672821746 0.031200408935546875 3 0.9208145527474494 4.356435913879737 49686.0 24.579349824196917 0.0 - - - - - - - 1687.142857142857 99 7 IQSEC3 IQ motif and Sec7 domain 3 1603 205 B20140404_SF100_02 B20140404_SF100_02 TB344665.[MT7]-GVDDGADIPR.2y6_1.heavy 579.797 / 628.341 39718.0 24.297500610351562 39 13 10 6 10 1.284151288693762 53.076232672821746 0.031200408935546875 3 0.9208145527474494 4.356435913879737 39718.0 30.474168797953965 0.0 - - - - - - - 1665.0 79 7 IQSEC3 IQ motif and Sec7 domain 3 1605 205 B20140404_SF100_02 B20140404_SF100_02 TB344665.[MT7]-GVDDGADIPR.2b7_1.heavy 579.797 / 774.339 67628.0 24.297500610351562 39 13 10 6 10 1.284151288693762 53.076232672821746 0.031200408935546875 3 0.9208145527474494 4.356435913879737 67628.0 94.26935282220995 0.0 - - - - - - - 319.5 135 6 IQSEC3 IQ motif and Sec7 domain 3 1607 205 B20140404_SF100_02 B20140404_SF100_02 TB344665.[MT7]-GVDDGADIPR.2y7_1.heavy 579.797 / 743.368 35348.0 24.297500610351562 39 13 10 6 10 1.284151288693762 53.076232672821746 0.031200408935546875 3 0.9208145527474494 4.356435913879737 35348.0 57.562470716497316 0.0 - - - - - - - 660.5384615384615 70 13 IQSEC3 IQ motif and Sec7 domain 3 1609 206 B20140404_SF100_02 B20140404_SF100_02 TB501812.[MT7]-AAEPGYLVTK[MT7].2b6_1.heavy 668.889 / 733.364 6011.0 27.423999786376953 50 20 10 10 10 9.466536522587607 10.563525504961106 0.0 3 0.9907308303817688 12.808725575157135 6011.0 5.448949548678376 1.0 - - - - - - - 263.1818181818182 18 11 PCDHB5;PCDHGB5;PCDHGB2;PCDHGB1;PCDHB15;PCDHB14;PCDHB13;PCDHB11;PCDHB10;PCDHB9;PCDHB8;PCDHB7;PCDHB6;PCDHB4;PCDHB3;PCDHB2;PCDHB16 protocadherin beta 5;protocadherin gamma subfamily B, 5;protocadherin gamma subfamily B, 2;protocadherin gamma subfamily B, 1;protocadherin beta 15;protocadherin beta 14;protocadherin beta 13;protocadherin beta 11;protocadherin beta 10;protocadherin beta 9;protocadherin beta 8;protocadherin beta 7;protocadherin beta 6;protocadherin beta 4;protocadherin beta 3;protocadherin beta 2;protocadherin beta 16 1611 206 B20140404_SF100_02 B20140404_SF100_02 TB501812.[MT7]-AAEPGYLVTK[MT7].2y6_1.heavy 668.889 / 824.5 8015.0 27.423999786376953 50 20 10 10 10 9.466536522587607 10.563525504961106 0.0 3 0.9907308303817688 12.808725575157135 8015.0 27.909057222633383 0.0 - - - - - - - 246.42857142857142 16 14 PCDHB5;PCDHGB5;PCDHGB2;PCDHGB1;PCDHB15;PCDHB14;PCDHB13;PCDHB11;PCDHB10;PCDHB9;PCDHB8;PCDHB7;PCDHB6;PCDHB4;PCDHB3;PCDHB2;PCDHB16 protocadherin beta 5;protocadherin gamma subfamily B, 5;protocadherin gamma subfamily B, 2;protocadherin gamma subfamily B, 1;protocadherin beta 15;protocadherin beta 14;protocadherin beta 13;protocadherin beta 11;protocadherin beta 10;protocadherin beta 9;protocadherin beta 8;protocadherin beta 7;protocadherin beta 6;protocadherin beta 4;protocadherin beta 3;protocadherin beta 2;protocadherin beta 16 1613 206 B20140404_SF100_02 B20140404_SF100_02 TB501812.[MT7]-AAEPGYLVTK[MT7].2b5_1.heavy 668.889 / 570.3 4898.0 27.423999786376953 50 20 10 10 10 9.466536522587607 10.563525504961106 0.0 3 0.9907308303817688 12.808725575157135 4898.0 3.849887745564458 1.0 - - - - - - - 389.5 32 2 PCDHB5;PCDHGB5;PCDHGB2;PCDHGB1;PCDHB15;PCDHB14;PCDHB13;PCDHB11;PCDHB10;PCDHB9;PCDHB8;PCDHB7;PCDHB6;PCDHB4;PCDHB3;PCDHB2;PCDHB16 protocadherin beta 5;protocadherin gamma subfamily B, 5;protocadherin gamma subfamily B, 2;protocadherin gamma subfamily B, 1;protocadherin beta 15;protocadherin beta 14;protocadherin beta 13;protocadherin beta 11;protocadherin beta 10;protocadherin beta 9;protocadherin beta 8;protocadherin beta 7;protocadherin beta 6;protocadherin beta 4;protocadherin beta 3;protocadherin beta 2;protocadherin beta 16 1615 206 B20140404_SF100_02 B20140404_SF100_02 TB501812.[MT7]-AAEPGYLVTK[MT7].2y7_1.heavy 668.889 / 921.553 94952.0 27.423999786376953 50 20 10 10 10 9.466536522587607 10.563525504961106 0.0 3 0.9907308303817688 12.808725575157135 94952.0 168.88108917477956 0.0 - - - - - - - 278.0 189 2 PCDHB5;PCDHGB5;PCDHGB2;PCDHGB1;PCDHB15;PCDHB14;PCDHB13;PCDHB11;PCDHB10;PCDHB9;PCDHB8;PCDHB7;PCDHB6;PCDHB4;PCDHB3;PCDHB2;PCDHB16 protocadherin beta 5;protocadherin gamma subfamily B, 5;protocadherin gamma subfamily B, 2;protocadherin gamma subfamily B, 1;protocadherin beta 15;protocadherin beta 14;protocadherin beta 13;protocadherin beta 11;protocadherin beta 10;protocadherin beta 9;protocadherin beta 8;protocadherin beta 7;protocadherin beta 6;protocadherin beta 4;protocadherin beta 3;protocadherin beta 2;protocadherin beta 16 1617 207 B20140404_SF100_02 B20140404_SF100_02 TB154583.[MT7]-VVHNWDFEPR.3y6_1.heavy 481.581 / 849.389 19217.0 29.64539909362793 48 18 10 10 10 8.65156815788844 11.558598184170888 0.0 3 0.9868784522745255 10.762020286987445 19217.0 60.26454798689139 0.0 - - - - - - - 320.0 38 7 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1619 207 B20140404_SF100_02 B20140404_SF100_02 TB154583.[MT7]-VVHNWDFEPR.3b4_1.heavy 481.581 / 594.348 34271.0 29.64539909362793 48 18 10 10 10 8.65156815788844 11.558598184170888 0.0 3 0.9868784522745255 10.762020286987445 34271.0 32.27280011515484 0.0 - - - - - - - 320.0 68 1 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1621 207 B20140404_SF100_02 B20140404_SF100_02 TB154583.[MT7]-VVHNWDFEPR.3y4_1.heavy 481.581 / 548.283 118667.0 29.64539909362793 48 18 10 10 10 8.65156815788844 11.558598184170888 0.0 3 0.9868784522745255 10.762020286987445 118667.0 65.19059966506572 0.0 - - - - - - - 961.0 237 1 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1623 207 B20140404_SF100_02 B20140404_SF100_02 TB154583.[MT7]-VVHNWDFEPR.3y5_1.heavy 481.581 / 663.31 111620.0 29.64539909362793 48 18 10 10 10 8.65156815788844 11.558598184170888 0.0 3 0.9868784522745255 10.762020286987445 111620.0 103.38061397165642 0.0 - - - - - - - 240.0 223 2 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1625 208 B20140404_SF100_02 B20140404_SF100_02 TB154855.[MT7]-IFYPEIEEVQALDDTER.3y7_1.heavy 737.703 / 819.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 1627 208 B20140404_SF100_02 B20140404_SF100_02 TB154855.[MT7]-IFYPEIEEVQALDDTER.3y6_1.heavy 737.703 / 748.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 1629 208 B20140404_SF100_02 B20140404_SF100_02 TB154855.[MT7]-IFYPEIEEVQALDDTER.3b5_1.heavy 737.703 / 794.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 1631 208 B20140404_SF100_02 B20140404_SF100_02 TB154855.[MT7]-IFYPEIEEVQALDDTER.3b3_1.heavy 737.703 / 568.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUT deoxyuridine triphosphatase 1633 209 B20140404_SF100_02 B20140404_SF100_02 TB154832.[MT7]-TSQIASAGVPGPGGSQSADK[MT7].3y11_1.heavy 701.702 / 1144.57 24237.0 24.30530071258545 44 18 10 6 10 5.691570866238624 17.569841850372455 0.031200408935546875 3 0.9803322968411595 8.785594789810029 24237.0 70.40128888241115 0.0 - - - - - - - 274.3125 48 16 TMEM145 transmembrane protein 145 1635 209 B20140404_SF100_02 B20140404_SF100_02 TB154832.[MT7]-TSQIASAGVPGPGGSQSADK[MT7].3b5_1.heavy 701.702 / 645.369 27699.0 24.30530071258545 44 18 10 6 10 5.691570866238624 17.569841850372455 0.031200408935546875 3 0.9803322968411595 8.785594789810029 27699.0 40.26917348138305 0.0 - - - - - - - 1132.0 55 7 TMEM145 transmembrane protein 145 1637 209 B20140404_SF100_02 B20140404_SF100_02 TB154832.[MT7]-TSQIASAGVPGPGGSQSADK[MT7].3y8_1.heavy 701.702 / 893.445 9464.0 24.30530071258545 44 18 10 6 10 5.691570866238624 17.569841850372455 0.031200408935546875 3 0.9803322968411595 8.785594789810029 9464.0 22.419636935998057 0.0 - - - - - - - 681.5714285714286 18 7 TMEM145 transmembrane protein 145 1639 209 B20140404_SF100_02 B20140404_SF100_02 TB154832.[MT7]-TSQIASAGVPGPGGSQSADK[MT7].3b8_1.heavy 701.702 / 860.459 56552.0 24.30530071258545 44 18 10 6 10 5.691570866238624 17.569841850372455 0.031200408935546875 3 0.9803322968411595 8.785594789810029 56552.0 58.95520457502218 0.0 - - - - - - - 273.77777777777777 113 9 TMEM145 transmembrane protein 145 1641 210 B20140404_SF100_02 B20140404_SF100_02 TB501996.[MT7]-TFANFPSGSPVSASTLAR.3y7_1.heavy 652.01 / 705.389 116833.0 32.546600341796875 48 18 10 10 10 4.568409935078559 21.889454191085058 0.0 3 0.9888750517584346 11.689876451267972 116833.0 12.195390662565238 1.0 - - - - - - - 2682.0 247 1 XIAP X-linked inhibitor of apoptosis 1643 210 B20140404_SF100_02 B20140404_SF100_02 TB501996.[MT7]-TFANFPSGSPVSASTLAR.3b4_1.heavy 652.01 / 578.305 136445.0 32.546600341796875 48 18 10 10 10 4.568409935078559 21.889454191085058 0.0 3 0.9888750517584346 11.689876451267972 136445.0 50.70476634352474 0.0 - - - - - - - 2514.0 272 1 XIAP X-linked inhibitor of apoptosis 1645 210 B20140404_SF100_02 B20140404_SF100_02 TB501996.[MT7]-TFANFPSGSPVSASTLAR.3b5_1.heavy 652.01 / 725.374 122364.0 32.546600341796875 48 18 10 10 10 4.568409935078559 21.889454191085058 0.0 3 0.9888750517584346 11.689876451267972 122364.0 81.18224242134514 0.0 - - - - - - - 2347.0 244 1 XIAP X-linked inhibitor of apoptosis 1647 210 B20140404_SF100_02 B20140404_SF100_02 TB501996.[MT7]-TFANFPSGSPVSASTLAR.3y9_1.heavy 652.01 / 901.51 92360.0 32.546600341796875 48 18 10 10 10 4.568409935078559 21.889454191085058 0.0 3 0.9888750517584346 11.689876451267972 92360.0 9.248109670907764 1.0 - - - - - - - 1564.6666666666667 184 3 XIAP X-linked inhibitor of apoptosis 1649 211 B20140404_SF100_02 B20140404_SF100_02 TB501810.[MT7]-DSTLIMQLLR.2b4_1.heavy 667.385 / 561.3 42284.0 39.5093994140625 48 18 10 10 10 2.6802025152606266 26.30945882232334 0.0 3 0.983855430974384 9.699807447605407 42284.0 56.72762104878494 0.0 - - - - - - - 831.7142857142857 84 7 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1651 211 B20140404_SF100_02 B20140404_SF100_02 TB501810.[MT7]-DSTLIMQLLR.2y9_1.heavy 667.385 / 1074.63 39428.0 39.5093994140625 48 18 10 10 10 2.6802025152606266 26.30945882232334 0.0 3 0.983855430974384 9.699807447605407 39428.0 92.19853439451089 0.0 - - - - - - - 307.4 78 10 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1653 211 B20140404_SF100_02 B20140404_SF100_02 TB501810.[MT7]-DSTLIMQLLR.2y6_1.heavy 667.385 / 773.47 47775.0 39.5093994140625 48 18 10 10 10 2.6802025152606266 26.30945882232334 0.0 3 0.983855430974384 9.699807447605407 47775.0 30.37966219828771 0.0 - - - - - - - 366.0 95 3 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1655 211 B20140404_SF100_02 B20140404_SF100_02 TB501810.[MT7]-DSTLIMQLLR.2b5_1.heavy 667.385 / 674.384 33278.0 39.5093994140625 48 18 10 10 10 2.6802025152606266 26.30945882232334 0.0 3 0.983855430974384 9.699807447605407 33278.0 45.594705574843566 0.0 - - - - - - - 778.9090909090909 66 11 YWHAQ;SFN;YWHAB;YWHAE;YWHAG;YWHAH;YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 1657 212 B20140404_SF100_02 B20140404_SF100_02 TB502087.[MT7]-TC[CAM]VPADINK[MT7]EEEFVEEFNR.4y4_1.heavy 654.323 / 565.273 40854.0 34.07500076293945 48 18 10 10 10 6.445758117511137 15.514078899164838 0.0 3 0.9896596155798065 12.12604247021041 40854.0 35.99131247283789 0.0 - - - - - - - 939.25 81 4 XIAP X-linked inhibitor of apoptosis 1659 212 B20140404_SF100_02 B20140404_SF100_02 TB502087.[MT7]-TC[CAM]VPADINK[MT7]EEEFVEEFNR.4y5_1.heavy 654.323 / 694.315 76479.0 34.07500076293945 48 18 10 10 10 6.445758117511137 15.514078899164838 0.0 3 0.9896596155798065 12.12604247021041 76479.0 40.59266433988087 0.0 - - - - - - - 1307.2 152 5 XIAP X-linked inhibitor of apoptosis 1661 212 B20140404_SF100_02 B20140404_SF100_02 TB502087.[MT7]-TC[CAM]VPADINK[MT7]EEEFVEEFNR.4b6_1.heavy 654.323 / 788.373 21408.0 34.07500076293945 48 18 10 10 10 6.445758117511137 15.514078899164838 0.0 3 0.9896596155798065 12.12604247021041 21408.0 24.496007297981286 0.0 - - - - - - - 327.0 42 1 XIAP X-linked inhibitor of apoptosis 1663 212 B20140404_SF100_02 B20140404_SF100_02 TB502087.[MT7]-TC[CAM]VPADINK[MT7]EEEFVEEFNR.4b3_1.heavy 654.323 / 505.256 62915.0 34.07500076293945 48 18 10 10 10 6.445758117511137 15.514078899164838 0.0 3 0.9896596155798065 12.12604247021041 62915.0 35.539637680393156 0.0 - - - - - - - 1838.5 125 4 XIAP X-linked inhibitor of apoptosis 1665 213 B20140404_SF100_02 B20140404_SF100_02 TB502086.[MT7]-TC[CAM]VPADINK[MT7]EEEFVEEFNR.3y7_1.heavy 872.095 / 940.452 2280.0 34.07500076293945 41 11 10 10 10 0.883393680933883 74.26373451903673 0.0 3 0.8544965595106895 3.195312989914926 2280.0 4.663053921168469 0.0 - - - - - - - 279.42857142857144 4 14 XIAP X-linked inhibitor of apoptosis 1667 213 B20140404_SF100_02 B20140404_SF100_02 TB502086.[MT7]-TC[CAM]VPADINK[MT7]EEEFVEEFNR.3b3_1.heavy 872.095 / 505.256 24593.0 34.07500076293945 41 11 10 10 10 0.883393680933883 74.26373451903673 0.0 3 0.8544965595106895 3.195312989914926 24593.0 33.87283992350374 0.0 - - - - - - - 777.7777777777778 49 9 XIAP X-linked inhibitor of apoptosis 1669 213 B20140404_SF100_02 B20140404_SF100_02 TB502086.[MT7]-TC[CAM]VPADINK[MT7]EEEFVEEFNR.3y16_2.heavy 872.095 / 1055.51 21010.0 34.07500076293945 41 11 10 10 10 0.883393680933883 74.26373451903673 0.0 3 0.8544965595106895 3.195312989914926 21010.0 24.616113935993454 1.0 - - - - - - - 289.77777777777777 51 9 XIAP X-linked inhibitor of apoptosis 1671 213 B20140404_SF100_02 B20140404_SF100_02 TB502086.[MT7]-TC[CAM]VPADINK[MT7]EEEFVEEFNR.3y9_1.heavy 872.095 / 1198.54 2280.0 34.07500076293945 41 11 10 10 10 0.883393680933883 74.26373451903673 0.0 3 0.8544965595106895 3.195312989914926 2280.0 15.248773320104739 0.0 - - - - - - - 344.1111111111111 4 9 XIAP X-linked inhibitor of apoptosis 1673 214 B20140404_SF100_02 B20140404_SF100_02 TB154445.[MT7]-EAYPDGSSK[MT7].2b3_1.heavy 621.316 / 508.252 35541.0 20.596050262451172 38 12 10 6 10 0.9034522294203841 72.0424323385577 0.03900146484375 3 0.8967669933991268 3.8075372612371576 35541.0 52.040344751829785 1.0 - - - - - - - 724.6 71 10 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1675 214 B20140404_SF100_02 B20140404_SF100_02 TB154445.[MT7]-EAYPDGSSK[MT7].2y4_1.heavy 621.316 / 522.3 16474.0 20.596050262451172 38 12 10 6 10 0.9034522294203841 72.0424323385577 0.03900146484375 3 0.8967669933991268 3.8075372612371576 16474.0 15.148980551406648 0.0 - - - - - - - 228.9 32 10 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1677 214 B20140404_SF100_02 B20140404_SF100_02 TB154445.[MT7]-EAYPDGSSK[MT7].2y8_1.heavy 621.316 / 968.481 6864.0 20.596050262451172 38 12 10 6 10 0.9034522294203841 72.0424323385577 0.03900146484375 3 0.8967669933991268 3.8075372612371576 6864.0 35.982011759447104 0.0 - - - - - - - 217.92857142857142 13 14 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1679 214 B20140404_SF100_02 B20140404_SF100_02 TB154445.[MT7]-EAYPDGSSK[MT7].2y6_1.heavy 621.316 / 734.38 40117.0 20.596050262451172 38 12 10 6 10 0.9034522294203841 72.0424323385577 0.03900146484375 3 0.8967669933991268 3.8075372612371576 40117.0 118.52108794138331 0.0 - - - - - - - 219.5 80 16 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1681 215 B20140404_SF100_02 B20140404_SF100_02 TB344490.[MT7]-TPSLTR.2y4_1.heavy 409.746 / 476.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - XIAP X-linked inhibitor of apoptosis 1683 215 B20140404_SF100_02 B20140404_SF100_02 TB344490.[MT7]-TPSLTR.2y5_1.heavy 409.746 / 573.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - XIAP X-linked inhibitor of apoptosis 1685 215 B20140404_SF100_02 B20140404_SF100_02 TB344490.[MT7]-TPSLTR.2y3_1.heavy 409.746 / 389.251 N/A N/A - - - - - - - - - 0.0 - - - - - - - XIAP X-linked inhibitor of apoptosis 1687 216 B20140404_SF100_02 B20140404_SF100_02 TB154447.[MT7]-EISTEEQLR.2y4_1.heavy 624.831 / 545.304 9631.0 24.639400482177734 50 20 10 10 10 9.133065841309108 10.949225784368842 0.0 3 0.9979467051433228 27.230923550651983 9631.0 20.403762218747875 0.0 - - - - - - - 1129.857142857143 19 7 XIAP X-linked inhibitor of apoptosis 1689 216 B20140404_SF100_02 B20140404_SF100_02 TB154447.[MT7]-EISTEEQLR.2y8_1.heavy 624.831 / 975.511 26936.0 24.639400482177734 50 20 10 10 10 9.133065841309108 10.949225784368842 0.0 3 0.9979467051433228 27.230923550651983 26936.0 49.81018908730321 0.0 - - - - - - - 239.64705882352942 53 17 XIAP X-linked inhibitor of apoptosis 1691 216 B20140404_SF100_02 B20140404_SF100_02 TB154447.[MT7]-EISTEEQLR.2y6_1.heavy 624.831 / 775.394 6891.0 24.639400482177734 50 20 10 10 10 9.133065841309108 10.949225784368842 0.0 3 0.9979467051433228 27.230923550651983 6891.0 24.12311932072099 1.0 - - - - - - - 671.1428571428571 13 7 XIAP X-linked inhibitor of apoptosis 1693 216 B20140404_SF100_02 B20140404_SF100_02 TB154447.[MT7]-EISTEEQLR.2y7_1.heavy 624.831 / 862.427 22003.0 24.639400482177734 50 20 10 10 10 9.133065841309108 10.949225784368842 0.0 3 0.9979467051433228 27.230923550651983 22003.0 70.31012270966781 0.0 - - - - - - - 251.47368421052633 44 19 XIAP X-linked inhibitor of apoptosis 1695 217 B20140404_SF100_02 B20140404_SF100_02 TB344593.[MT7]-FSAYIK[MT7].2y4_1.heavy 508.805 / 638.399 33225.0 29.461999893188477 50 20 10 10 10 3.2857945717364574 23.44013149000319 0.0 3 0.9933269077709543 15.099306566787654 33225.0 14.068610885283537 1.0 - - - - - - - 411.5 66 4 CLIC1;CLIC2;CLIC4;CLIC5 chloride intracellular channel 1;chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5 1697 217 B20140404_SF100_02 B20140404_SF100_02 TB344593.[MT7]-FSAYIK[MT7].2y5_1.heavy 508.805 / 725.431 110900.0 29.461999893188477 50 20 10 10 10 3.2857945717364574 23.44013149000319 0.0 3 0.9933269077709543 15.099306566787654 110900.0 137.45273255080147 0.0 - - - - - - - 349.3333333333333 221 3 CLIC1;CLIC2;CLIC4;CLIC5 chloride intracellular channel 1;chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5 1699 217 B20140404_SF100_02 B20140404_SF100_02 TB344593.[MT7]-FSAYIK[MT7].2b4_1.heavy 508.805 / 613.31 34722.0 29.461999893188477 50 20 10 10 10 3.2857945717364574 23.44013149000319 0.0 3 0.9933269077709543 15.099306566787654 34722.0 26.099498886414253 0.0 - - - - - - - 449.0 69 1 CLIC1;CLIC2;CLIC4;CLIC5 chloride intracellular channel 1;chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5 1701 217 B20140404_SF100_02 B20140404_SF100_02 TB344593.[MT7]-FSAYIK[MT7].2y3_1.heavy 508.805 / 567.362 51334.0 29.461999893188477 50 20 10 10 10 3.2857945717364574 23.44013149000319 0.0 3 0.9933269077709543 15.099306566787654 51334.0 59.00603159173755 0.0 - - - - - - - 449.0 102 1 CLIC1;CLIC2;CLIC4;CLIC5 chloride intracellular channel 1;chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5 1703 218 B20140404_SF100_02 B20140404_SF100_02 TB154293.[MT7]-QYQLSK[MT7].2b3_1.heavy 527.81 / 564.29 14204.0 23.457000732421875 46 18 10 10 8 4.477822836443512 22.33228147977031 0.0 4 0.980280260805324 8.77395718686633 14204.0 24.76594871794872 0.0 - - - - - - - 744.25 28 16 IQSEC3 IQ motif and Sec7 domain 3 1705 218 B20140404_SF100_02 B20140404_SF100_02 TB154293.[MT7]-QYQLSK[MT7].2y4_1.heavy 527.81 / 619.39 13368.0 23.457000732421875 46 18 10 10 8 4.477822836443512 22.33228147977031 0.0 4 0.980280260805324 8.77395718686633 13368.0 14.512741632771473 1.0 - - - - - - - 796.9444444444445 31 18 IQSEC3 IQ motif and Sec7 domain 3 1707 218 B20140404_SF100_02 B20140404_SF100_02 TB154293.[MT7]-QYQLSK[MT7].2y5_1.heavy 527.81 / 782.453 47207.0 23.457000732421875 46 18 10 10 8 4.477822836443512 22.33228147977031 0.0 4 0.980280260805324 8.77395718686633 47207.0 101.91657377473166 0.0 - - - - - - - 1233.2857142857142 94 7 IQSEC3 IQ motif and Sec7 domain 3 1709 218 B20140404_SF100_02 B20140404_SF100_02 TB154293.[MT7]-QYQLSK[MT7].2b4_1.heavy 527.81 / 677.374 9608.0 23.457000732421875 46 18 10 10 8 4.477822836443512 22.33228147977031 0.0 4 0.980280260805324 8.77395718686633 9608.0 22.08735632183908 0.0 - - - - - - - 1133.857142857143 19 7 IQSEC3 IQ motif and Sec7 domain 3 1711 219 B20140404_SF100_02 B20140404_SF100_02 TB154807.[MT7]-IRPTVQEDGGDVIYK[MT7].3b11_2.heavy 660.033 / 656.834 204324.0 27.107799530029297 43 13 10 10 10 1.702810583047036 49.537015682913335 0.0 3 0.9214021459926316 4.37291035206595 204324.0 66.15057527187336 0.0 - - - - - - - 259.3333333333333 408 3 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1713 219 B20140404_SF100_02 B20140404_SF100_02 TB154807.[MT7]-IRPTVQEDGGDVIYK[MT7].3y3_1.heavy 660.033 / 567.362 170638.0 27.107799530029297 43 13 10 10 10 1.702810583047036 49.537015682913335 0.0 3 0.9214021459926316 4.37291035206595 170638.0 54.287738963508644 0.0 - - - - - - - 259.0 341 1 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1715 219 B20140404_SF100_02 B20140404_SF100_02 TB154807.[MT7]-IRPTVQEDGGDVIYK[MT7].3b5_1.heavy 660.033 / 711.463 29541.0 27.107799530029297 43 13 10 10 10 1.702810583047036 49.537015682913335 0.0 3 0.9214021459926316 4.37291035206595 29541.0 24.60642074009251 0.0 - - - - - - - 703.2857142857143 59 7 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1717 219 B20140404_SF100_02 B20140404_SF100_02 TB154807.[MT7]-IRPTVQEDGGDVIYK[MT7].3y4_1.heavy 660.033 / 666.431 50142.0 27.107799530029297 43 13 10 10 10 1.702810583047036 49.537015682913335 0.0 3 0.9214021459926316 4.37291035206595 50142.0 20.98226321803149 0.0 - - - - - - - 233.4 100 5 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1719 220 B20140404_SF100_02 B20140404_SF100_02 TB501845.[MT7]-RGWGAAAVAAGLR.3b6_1.heavy 467.273 / 743.407 78772.0 29.693199157714844 44 14 10 10 10 3.0236669220638235 33.07242582517797 0.0 3 0.9482001354832175 5.398900160374998 78772.0 64.10023976097449 0.0 - - - - - - - 337.5 157 4 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1721 220 B20140404_SF100_02 B20140404_SF100_02 TB501845.[MT7]-RGWGAAAVAAGLR.3b5_1.heavy 467.273 / 672.37 72470.0 29.693199157714844 44 14 10 10 10 3.0236669220638235 33.07242582517797 0.0 3 0.9482001354832175 5.398900160374998 72470.0 105.79246364578705 0.0 - - - - - - - 450.0 144 1 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1723 220 B20140404_SF100_02 B20140404_SF100_02 TB501845.[MT7]-RGWGAAAVAAGLR.3b7_1.heavy 467.273 / 814.444 123035.0 29.693199157714844 44 14 10 10 10 3.0236669220638235 33.07242582517797 0.0 3 0.9482001354832175 5.398900160374998 123035.0 113.36673182771813 0.0 - - - - - - - 270.0 246 5 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1725 220 B20140404_SF100_02 B20140404_SF100_02 TB501845.[MT7]-RGWGAAAVAAGLR.3y5_1.heavy 467.273 / 487.299 405715.0 29.693199157714844 44 14 10 10 10 3.0236669220638235 33.07242582517797 0.0 3 0.9482001354832175 5.398900160374998 405715.0 123.46397061588436 0.0 - - - - - - - 1851.0 811 3 NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) 1727 221 B20140404_SF100_02 B20140404_SF100_02 TB501846.[MT7]-RPYTVILIER.3b4_1.heavy 468.621 / 662.374 108282.0 30.81920051574707 43 13 10 10 10 1.683939209467975 46.37297217807239 0.0 3 0.9090776296595342 4.061440889692861 108282.0 35.618122589001494 0.0 - - - - - - - 1376.0 216 2 SBDS Shwachman-Bodian-Diamond syndrome 1729 221 B20140404_SF100_02 B20140404_SF100_02 TB501846.[MT7]-RPYTVILIER.3b5_1.heavy 468.621 / 761.443 167845.0 30.81920051574707 43 13 10 10 10 1.683939209467975 46.37297217807239 0.0 3 0.9090776296595342 4.061440889692861 167845.0 176.26307014707163 0.0 - - - - - - - 405.0 335 2 SBDS Shwachman-Bodian-Diamond syndrome 1731 221 B20140404_SF100_02 B20140404_SF100_02 TB501846.[MT7]-RPYTVILIER.3y4_1.heavy 468.621 / 530.33 542737.0 30.81920051574707 43 13 10 10 10 1.683939209467975 46.37297217807239 0.0 3 0.9090776296595342 4.061440889692861 542737.0 269.4217210706089 0.0 - - - - - - - 486.0 1085 1 SBDS Shwachman-Bodian-Diamond syndrome 1733 221 B20140404_SF100_02 B20140404_SF100_02 TB501846.[MT7]-RPYTVILIER.3y5_1.heavy 468.621 / 643.414 264311.0 30.81920051574707 43 13 10 10 10 1.683939209467975 46.37297217807239 0.0 3 0.9090776296595342 4.061440889692861 264311.0 167.80709622339924 0.0 - - - - - - - 324.0 528 3 SBDS Shwachman-Bodian-Diamond syndrome 1735 222 B20140404_SF100_02 B20140404_SF100_02 TB501596.[MT7]-AAALSTK[MT7].2y4_1.heavy 475.3 / 592.379 55171.0 21.665300369262695 47 17 10 10 10 4.285028061286351 23.337070042425893 0.0 3 0.97977112746476 8.662468994745323 55171.0 43.557044070652864 0.0 - - - - - - - 773.1538461538462 110 13 SPAG8 sperm associated antigen 8 1737 222 B20140404_SF100_02 B20140404_SF100_02 TB501596.[MT7]-AAALSTK[MT7].2y5_1.heavy 475.3 / 663.416 38791.0 21.665300369262695 47 17 10 10 10 4.285028061286351 23.337070042425893 0.0 3 0.97977112746476 8.662468994745323 38791.0 51.92681847146057 0.0 - - - - - - - 794.2222222222222 77 9 SPAG8 sperm associated antigen 8 1739 222 B20140404_SF100_02 B20140404_SF100_02 TB501596.[MT7]-AAALSTK[MT7].2y3_1.heavy 475.3 / 479.295 81529.0 21.665300369262695 47 17 10 10 10 4.285028061286351 23.337070042425893 0.0 3 0.97977112746476 8.662468994745323 81529.0 60.07546664137671 0.0 - - - - - - - 731.1818181818181 163 11 SPAG8 sperm associated antigen 8 1741 222 B20140404_SF100_02 B20140404_SF100_02 TB501596.[MT7]-AAALSTK[MT7].2y6_1.heavy 475.3 / 734.453 65521.0 21.665300369262695 47 17 10 10 10 4.285028061286351 23.337070042425893 0.0 3 0.97977112746476 8.662468994745323 65521.0 36.78898313815161 0.0 - - - - - - - 1361.4285714285713 131 7 SPAG8 sperm associated antigen 8 1743 223 B20140404_SF100_02 B20140404_SF100_02 TB501888.[MT7]-Y[MT7]IHLENLLAR.3b6_2.heavy 510.64 / 529.797 17213.0 31.537799835205078 47 17 10 10 10 3.9202389070898307 20.772671166015144 0.0 3 0.9797045040786347 8.648190925860492 17213.0 35.16070121951219 0.0 - - - - - - - 328.0 34 7 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1745 223 B20140404_SF100_02 B20140404_SF100_02 TB501888.[MT7]-Y[MT7]IHLENLLAR.3y7_1.heavy 510.64 / 828.494 37049.0 31.537799835205078 47 17 10 10 10 3.9202389070898307 20.772671166015144 0.0 3 0.9797045040786347 8.648190925860492 37049.0 83.10206881533101 0.0 - - - - - - - 328.0 74 10 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1747 223 B20140404_SF100_02 B20140404_SF100_02 TB501888.[MT7]-Y[MT7]IHLENLLAR.3y6_1.heavy 510.64 / 715.41 41147.0 31.537799835205078 47 17 10 10 10 3.9202389070898307 20.772671166015144 0.0 3 0.9797045040786347 8.648190925860492 41147.0 41.838048117938314 0.0 - - - - - - - 861.0 82 8 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1749 223 B20140404_SF100_02 B20140404_SF100_02 TB501888.[MT7]-Y[MT7]IHLENLLAR.3y8_1.heavy 510.64 / 965.553 9016.0 31.537799835205078 47 17 10 10 10 3.9202389070898307 20.772671166015144 0.0 3 0.9797045040786347 8.648190925860492 9016.0 62.30569105691057 0.0 - - - - - - - 278.8 18 10 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1751 224 B20140404_SF100_02 B20140404_SF100_02 TB154702.[MT7]-TDIQIALPSGC[CAM]YGR.2y9_1.heavy 847.936 / 980.462 25311.0 31.921600341796875 45 15 10 10 10 2.4893913900926083 34.39079027128986 0.0 3 0.9574233914959873 5.959691342979385 25311.0 51.60436811964037 0.0 - - - - - - - 670.1428571428571 50 7 DUT deoxyuridine triphosphatase 1753 224 B20140404_SF100_02 B20140404_SF100_02 TB154702.[MT7]-TDIQIALPSGC[CAM]YGR.2b4_1.heavy 847.936 / 602.327 40565.0 31.921600341796875 45 15 10 10 10 2.4893913900926083 34.39079027128986 0.0 3 0.9574233914959873 5.959691342979385 40565.0 112.61328358208954 0.0 - - - - - - - 622.4285714285714 81 7 DUT deoxyuridine triphosphatase 1755 224 B20140404_SF100_02 B20140404_SF100_02 TB154702.[MT7]-TDIQIALPSGC[CAM]YGR.2y10_1.heavy 847.936 / 1093.55 12236.0 31.921600341796875 45 15 10 10 10 2.4893913900926083 34.39079027128986 0.0 3 0.9574233914959873 5.959691342979385 12236.0 22.485057067603158 0.0 - - - - - - - 251.5 24 6 DUT deoxyuridine triphosphatase 1757 224 B20140404_SF100_02 B20140404_SF100_02 TB154702.[MT7]-TDIQIALPSGC[CAM]YGR.2y7_1.heavy 847.936 / 796.341 52969.0 31.921600341796875 45 15 10 10 10 2.4893913900926083 34.39079027128986 0.0 3 0.9574233914959873 5.959691342979385 52969.0 61.40221323647164 0.0 - - - - - - - 335.0 105 2 DUT deoxyuridine triphosphatase 1759 225 B20140404_SF100_02 B20140404_SF100_02 TB501987.[MT7]-LELQLLEHSLSTNK[MT7].3y6_1.heavy 638.37 / 793.454 67144.0 35.34749984741211 44 14 10 10 10 1.9841780353755327 40.438648950669396 0.0 3 0.9350805045339243 4.817223673545588 67144.0 56.879775673785566 0.0 - - - - - - - 795.7142857142857 134 7 ANGPT2 angiopoietin 2 1761 225 B20140404_SF100_02 B20140404_SF100_02 TB501987.[MT7]-LELQLLEHSLSTNK[MT7].3b4_1.heavy 638.37 / 628.379 63121.0 35.34749984741211 44 14 10 10 10 1.9841780353755327 40.438648950669396 0.0 3 0.9350805045339243 4.817223673545588 63121.0 37.3917607403304 0.0 - - - - - - - 812.25 126 4 ANGPT2 angiopoietin 2 1763 225 B20140404_SF100_02 B20140404_SF100_02 TB501987.[MT7]-LELQLLEHSLSTNK[MT7].3b5_1.heavy 638.37 / 741.463 59563.0 35.34749984741211 44 14 10 10 10 1.9841780353755327 40.438648950669396 0.0 3 0.9350805045339243 4.817223673545588 59563.0 55.81584039357013 0.0 - - - - - - - 397.7142857142857 119 7 ANGPT2 angiopoietin 2 1765 225 B20140404_SF100_02 B20140404_SF100_02 TB501987.[MT7]-LELQLLEHSLSTNK[MT7].3b3_1.heavy 638.37 / 500.32 21505.0 35.34749984741211 44 14 10 10 10 1.9841780353755327 40.438648950669396 0.0 3 0.9350805045339243 4.817223673545588 21505.0 19.11341695792069 2.0 - - - - - - - 464.0 52 1 ANGPT2 angiopoietin 2 1767 226 B20140404_SF100_02 B20140404_SF100_02 TB154800.[MT7]-GASTVGAAGWK[MT7]GELPK[MT7].4y8_2.heavy 491.035 / 601.86 76683.0 28.354299545288086 39 9 10 10 10 0.9387027460553536 70.1545006901563 0.0 3 0.8003212774554299 2.714499260049759 76683.0 79.92829809627253 0.0 - - - - - - - 1283.7142857142858 153 7 DUT deoxyuridine triphosphatase 1769 226 B20140404_SF100_02 B20140404_SF100_02 TB154800.[MT7]-GASTVGAAGWK[MT7]GELPK[MT7].4b7_1.heavy 491.035 / 688.375 20668.0 28.354299545288086 39 9 10 10 10 0.9387027460553536 70.1545006901563 0.0 3 0.8003212774554299 2.714499260049759 20668.0 20.127434613244294 0.0 - - - - - - - 749.0 41 8 DUT deoxyuridine triphosphatase 1771 226 B20140404_SF100_02 B20140404_SF100_02 TB154800.[MT7]-GASTVGAAGWK[MT7]GELPK[MT7].4y9_2.heavy 491.035 / 637.379 50323.0 28.354299545288086 39 9 10 10 10 0.9387027460553536 70.1545006901563 0.0 3 0.8003212774554299 2.714499260049759 50323.0 36.46007126013303 0.0 - - - - - - - 374.5 100 2 DUT deoxyuridine triphosphatase 1773 226 B20140404_SF100_02 B20140404_SF100_02 TB154800.[MT7]-GASTVGAAGWK[MT7]GELPK[MT7].4b6_1.heavy 491.035 / 617.338 56464.0 28.354299545288086 39 9 10 10 10 0.9387027460553536 70.1545006901563 0.0 3 0.8003212774554299 2.714499260049759 56464.0 78.84389092121761 0.0 - - - - - - - 839.0 112 5 DUT deoxyuridine triphosphatase 1775 227 B20140404_SF100_02 B20140404_SF100_02 TB154708.[MT7]-TGQVVDISDTIYPR.3y7_1.heavy 569.973 / 851.426 72165.0 31.875200271606445 50 20 10 10 10 8.130251638002559 12.299742302265077 0.0 3 0.9964621806432596 20.742754236309153 72165.0 278.37038463595997 0.0 - - - - - - - 648.75 144 8 XIAP X-linked inhibitor of apoptosis 1777 227 B20140404_SF100_02 B20140404_SF100_02 TB154708.[MT7]-TGQVVDISDTIYPR.3y6_1.heavy 569.973 / 764.394 45375.0 31.875200271606445 50 20 10 10 10 8.130251638002559 12.299742302265077 0.0 3 0.9964621806432596 20.742754236309153 45375.0 54.59203060854483 0.0 - - - - - - - 628.0 90 4 XIAP X-linked inhibitor of apoptosis 1779 227 B20140404_SF100_02 B20140404_SF100_02 TB154708.[MT7]-TGQVVDISDTIYPR.3b6_1.heavy 569.973 / 744.401 139139.0 31.875200271606445 50 20 10 10 10 8.130251638002559 12.299742302265077 0.0 3 0.9964621806432596 20.742754236309153 139139.0 131.40020424453314 0.0 - - - - - - - 167.0 278 1 XIAP X-linked inhibitor of apoptosis 1781 227 B20140404_SF100_02 B20140404_SF100_02 TB154708.[MT7]-TGQVVDISDTIYPR.3y5_1.heavy 569.973 / 649.367 54584.0 31.875200271606445 50 20 10 10 10 8.130251638002559 12.299742302265077 0.0 3 0.9964621806432596 20.742754236309153 54584.0 33.486706479903376 1.0 - - - - - - - 335.0 110 1 XIAP X-linked inhibitor of apoptosis 1783 228 B20140404_SF100_02 B20140404_SF100_02 TB154573.[MT7]-LMVC[CAM]YETLPR.2b4_1.heavy 713.371 / 648.333 4439.0 32.93659973144531 44 16 10 10 8 2.999371156421723 33.34032194911846 0.0 4 0.9669325513472942 6.767962644661172 4439.0 5.834075667034598 1.0 - - - - - - - 1315.2857142857142 13 7 SPAG8 sperm associated antigen 8 1785 228 B20140404_SF100_02 B20140404_SF100_02 TB154573.[MT7]-LMVC[CAM]YETLPR.2y9_1.heavy 713.371 / 1168.55 7892.0 32.93659973144531 44 16 10 10 8 2.999371156421723 33.34032194911846 0.0 4 0.9669325513472942 6.767962644661172 7892.0 12.475460691694735 0.0 - - - - - - - 328.6666666666667 15 9 SPAG8 sperm associated antigen 8 1787 228 B20140404_SF100_02 B20140404_SF100_02 TB154573.[MT7]-LMVC[CAM]YETLPR.2y6_1.heavy 713.371 / 778.409 4439.0 32.93659973144531 44 16 10 10 8 2.999371156421723 33.34032194911846 0.0 4 0.9669325513472942 6.767962644661172 4439.0 4.522340425531914 1.0 - - - - - - - 798.8571428571429 8 7 SPAG8 sperm associated antigen 8 1789 228 B20140404_SF100_02 B20140404_SF100_02 TB154573.[MT7]-LMVC[CAM]YETLPR.2y7_1.heavy 713.371 / 938.44 7399.0 32.93659973144531 44 16 10 10 8 2.999371156421723 33.34032194911846 0.0 4 0.9669325513472942 6.767962644661172 7399.0 9.987863244447743 1.0 - - - - - - - 310.22222222222223 22 9 SPAG8 sperm associated antigen 8 1791 229 B20140404_SF100_02 B20140404_SF100_02 TB344998.[MT7]-VGFGNPSGEYWLGNEFVSQLTNQQR.3b9_1.heavy 991.153 / 989.481 16076.0 39.88959884643555 47 17 10 10 10 4.5151675159253255 22.147572520242647 0.0 3 0.9705364350269161 7.17212076854214 16076.0 25.350454567902048 0.0 - - - - - - - 256.6666666666667 32 9 ANGPT2 angiopoietin 2 1793 229 B20140404_SF100_02 B20140404_SF100_02 TB344998.[MT7]-VGFGNPSGEYWLGNEFVSQLTNQQR.3b10_1.heavy 991.153 / 1152.54 17862.0 39.88959884643555 47 17 10 10 10 4.5151675159253255 22.147572520242647 0.0 3 0.9705364350269161 7.17212076854214 17862.0 25.534647736596156 0.0 - - - - - - - 257.72727272727275 35 11 ANGPT2 angiopoietin 2 1795 229 B20140404_SF100_02 B20140404_SF100_02 TB344998.[MT7]-VGFGNPSGEYWLGNEFVSQLTNQQR.3b5_1.heavy 991.153 / 619.332 27950.0 39.88959884643555 47 17 10 10 10 4.5151675159253255 22.147572520242647 0.0 3 0.9705364350269161 7.17212076854214 27950.0 23.06564155673425 0.0 - - - - - - - 378.0 55 5 ANGPT2 angiopoietin 2 1797 229 B20140404_SF100_02 B20140404_SF100_02 TB344998.[MT7]-VGFGNPSGEYWLGNEFVSQLTNQQR.3y8_1.heavy 991.153 / 974.501 24482.0 39.88959884643555 47 17 10 10 10 4.5151675159253255 22.147572520242647 0.0 3 0.9705364350269161 7.17212076854214 24482.0 23.6717512306496 0.0 - - - - - - - 794.0 48 9 ANGPT2 angiopoietin 2 1799 230 B20140404_SF100_02 B20140404_SF100_02 TB154579.[MT7]-RAAC[CAM]TIQTAFR.3b6_1.heavy 480.262 / 817.447 20346.0 26.2541241645813 44 18 10 6 10 4.605746690077356 21.712006050059266 0.03989982604980469 3 0.9899489239324928 12.29961895571836 20346.0 37.662929392446635 0.0 - - - - - - - 668.4285714285714 40 7 IQSEC3 IQ motif and Sec7 domain 3 1801 230 B20140404_SF100_02 B20140404_SF100_02 TB154579.[MT7]-RAAC[CAM]TIQTAFR.3b5_1.heavy 480.262 / 704.363 72898.0 26.2541241645813 44 18 10 6 10 4.605746690077356 21.712006050059266 0.03989982604980469 3 0.9899489239324928 12.29961895571836 72898.0 239.5439397540373 0.0 - - - - - - - 290.0 145 9 IQSEC3 IQ motif and Sec7 domain 3 1803 230 B20140404_SF100_02 B20140404_SF100_02 TB154579.[MT7]-RAAC[CAM]TIQTAFR.3y4_1.heavy 480.262 / 494.272 165163.0 26.2541241645813 44 18 10 6 10 4.605746690077356 21.712006050059266 0.03989982604980469 3 0.9899489239324928 12.29961895571836 165163.0 141.89182213831475 0.0 - - - - - - - 734.25 330 4 IQSEC3 IQ motif and Sec7 domain 3 1805 230 B20140404_SF100_02 B20140404_SF100_02 TB154579.[MT7]-RAAC[CAM]TIQTAFR.3y5_1.heavy 480.262 / 622.331 245678.0 26.2541241645813 44 18 10 6 10 4.605746690077356 21.712006050059266 0.03989982604980469 3 0.9899489239324928 12.29961895571836 245678.0 117.95592080168754 0.0 - - - - - - - 435.0 491 1 IQSEC3 IQ motif and Sec7 domain 3 1807 231 B20140404_SF100_02 B20140404_SF100_02 TB501887.[MT7]-AGFLYTGEGDTVR.2y8_1.heavy 765.389 / 834.395 19799.0 30.917400360107422 48 18 10 10 10 3.8437569308625137 20.785743995930407 0.0 3 0.985833686581916 10.356664651112128 19799.0 67.90799601661693 0.0 - - - - - - - 348.14285714285717 39 7 XIAP X-linked inhibitor of apoptosis 1809 231 B20140404_SF100_02 B20140404_SF100_02 TB501887.[MT7]-AGFLYTGEGDTVR.2y9_1.heavy 765.389 / 997.458 18825.0 30.917400360107422 48 18 10 10 10 3.8437569308625137 20.785743995930407 0.0 3 0.985833686581916 10.356664651112128 18825.0 56.049794661190965 0.0 - - - - - - - 342.6666666666667 37 9 XIAP X-linked inhibitor of apoptosis 1811 231 B20140404_SF100_02 B20140404_SF100_02 TB501887.[MT7]-AGFLYTGEGDTVR.2b4_1.heavy 765.389 / 533.32 23532.0 30.917400360107422 48 18 10 10 10 3.8437569308625137 20.785743995930407 0.0 3 0.985833686581916 10.356664651112128 23532.0 35.70672628108426 1.0 - - - - - - - 739.1111111111111 49 9 XIAP X-linked inhibitor of apoptosis 1813 231 B20140404_SF100_02 B20140404_SF100_02 TB501887.[MT7]-AGFLYTGEGDTVR.2y10_1.heavy 765.389 / 1110.54 11360.0 30.917400360107422 48 18 10 10 10 3.8437569308625137 20.785743995930407 0.0 3 0.985833686581916 10.356664651112128 11360.0 62.91692307692307 0.0 - - - - - - - 308.5 22 10 XIAP X-linked inhibitor of apoptosis 1815 232 B20140404_SF100_02 B20140404_SF100_02 TB154299.[MT7]-TPLLPGAPR.2b3_1.heavy 533.331 / 456.294 6665.0 29.093900680541992 48 20 10 10 8 13.976518081915726 7.154857841839049 0.0 4 0.9977260831760862 25.87573842159843 6665.0 3.978167701863354 4.0 - - - - - - - 775.0 21 2 SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 1817 232 B20140404_SF100_02 B20140404_SF100_02 TB154299.[MT7]-TPLLPGAPR.2y8_1.heavy 533.331 / 820.504 38287.0 29.093900680541992 48 20 10 10 8 13.976518081915726 7.154857841839049 0.0 4 0.9977260831760862 25.87573842159843 38287.0 80.78444721407624 0.0 - - - - - - - 434.0 76 5 SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 1819 232 B20140404_SF100_02 B20140404_SF100_02 TB154299.[MT7]-TPLLPGAPR.2y5_1.heavy 533.331 / 497.283 19066.0 29.093900680541992 48 20 10 10 8 13.976518081915726 7.154857841839049 0.0 4 0.9977260831760862 25.87573842159843 19066.0 7.288132258064516 2.0 - - - - - - - 1860.0 38 1 SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 1821 232 B20140404_SF100_02 B20140404_SF100_02 TB154299.[MT7]-TPLLPGAPR.2y6_1.heavy 533.331 / 610.367 5425.0 29.093900680541992 48 20 10 10 8 13.976518081915726 7.154857841839049 0.0 4 0.9977260831760862 25.87573842159843 5425.0 5.9208333333333325 1.0 - - - - - - - 413.3333333333333 61 3 SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 1823 233 B20140404_SF100_02 B20140404_SF100_02 TB154479.[MT7]-GVTC[CAM]LSFSK[MT7].2y4_1.heavy 643.854 / 612.347 27686.0 29.484549522399902 36 14 9 5 8 2.193498144883458 35.716596651297564 0.04509925842285156 4 0.9469559553798236 5.334643221311507 27686.0 15.552327451288754 0.0 - - - - - - - 716.0 55 2 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1825 233 B20140404_SF100_02 B20140404_SF100_02 TB154479.[MT7]-GVTC[CAM]LSFSK[MT7].2y5_1.heavy 643.854 / 725.431 4614.0 29.484549522399902 36 14 9 5 8 2.193498144883458 35.716596651297564 0.04509925842285156 4 0.9469559553798236 5.334643221311507 4614.0 3.3344875735976256 1.0 - - - - - - - 750.1428571428571 63 7 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1827 233 B20140404_SF100_02 B20140404_SF100_02 TB154479.[MT7]-GVTC[CAM]LSFSK[MT7].2y3_1.heavy 643.854 / 525.315 6365.0 29.484549522399902 36 14 9 5 8 2.193498144883458 35.716596651297564 0.04509925842285156 4 0.9469559553798236 5.334643221311507 6365.0 3.4048817034578986 0.0 - - - - - - - 811.9 12 10 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1829 233 B20140404_SF100_02 B20140404_SF100_02 TB154479.[MT7]-GVTC[CAM]LSFSK[MT7].2y7_1.heavy 643.854 / 986.51 12093.0 29.484549522399902 36 14 9 5 8 2.193498144883458 35.716596651297564 0.04509925842285156 4 0.9469559553798236 5.334643221311507 12093.0 13.928756281407034 2.0 - - - - - - - 300.3333333333333 34 9 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1831 234 B20140404_SF100_02 B20140404_SF100_02 TB501880.[MT7]-ALVGDEVELPC[CAM]R.2y4_1.heavy 751.394 / 545.286 22883.0 30.67289924621582 50 20 10 10 10 15.381831883354876 6.501176242097204 0.0 3 0.9952960175660425 17.98701655206475 22883.0 35.97186262085842 0.0 - - - - - - - 324.6 45 5 MOG myelin oligodendrocyte glycoprotein 1833 234 B20140404_SF100_02 B20140404_SF100_02 TB501880.[MT7]-ALVGDEVELPC[CAM]R.2y9_1.heavy 751.394 / 1074.49 35216.0 30.67289924621582 50 20 10 10 10 15.381831883354876 6.501176242097204 0.0 3 0.9952960175660425 17.98701655206475 35216.0 266.2151138503681 0.0 - - - - - - - 342.6666666666667 70 9 MOG myelin oligodendrocyte glycoprotein 1835 234 B20140404_SF100_02 B20140404_SF100_02 TB501880.[MT7]-ALVGDEVELPC[CAM]R.2y10_1.heavy 751.394 / 1173.56 20124.0 30.67289924621582 50 20 10 10 10 15.381831883354876 6.501176242097204 0.0 3 0.9952960175660425 17.98701655206475 20124.0 27.50459786453699 0.0 - - - - - - - 270.55555555555554 40 9 MOG myelin oligodendrocyte glycoprotein 1837 234 B20140404_SF100_02 B20140404_SF100_02 TB501880.[MT7]-ALVGDEVELPC[CAM]R.2y7_1.heavy 751.394 / 902.44 17202.0 30.67289924621582 50 20 10 10 10 15.381831883354876 6.501176242097204 0.0 3 0.9952960175660425 17.98701655206475 17202.0 34.62708736388739 0.0 - - - - - - - 306.6666666666667 34 9 MOG myelin oligodendrocyte glycoprotein 1839 235 B20140404_SF100_02 B20140404_SF100_02 TB154477.[MT7]-WQYGDSAVGR.2b3_1.heavy 641.818 / 622.311 7072.0 27.290599822998047 43 15 10 10 8 1.425835130534964 55.123490207120646 0.0 4 0.9504730250768035 5.522459333722263 7072.0 16.78225729345057 2.0 - - - - - - - 1230.5714285714287 29 7 XIAP X-linked inhibitor of apoptosis 1841 235 B20140404_SF100_02 B20140404_SF100_02 TB154477.[MT7]-WQYGDSAVGR.2y8_1.heavy 641.818 / 824.39 23015.0 27.290599822998047 43 15 10 10 8 1.425835130534964 55.123490207120646 0.0 4 0.9504730250768035 5.522459333722263 23015.0 34.11087869362364 0.0 - - - - - - - 690.875 46 8 XIAP X-linked inhibitor of apoptosis 1843 235 B20140404_SF100_02 B20140404_SF100_02 TB154477.[MT7]-WQYGDSAVGR.2b5_1.heavy 641.818 / 794.359 15943.0 27.290599822998047 43 15 10 10 8 1.425835130534964 55.123490207120646 0.0 4 0.9504730250768035 5.522459333722263 15943.0 25.7268044458075 0.0 - - - - - - - 716.2857142857143 31 7 XIAP X-linked inhibitor of apoptosis 1845 235 B20140404_SF100_02 B20140404_SF100_02 TB154477.[MT7]-WQYGDSAVGR.2y7_1.heavy 641.818 / 661.326 10286.0 27.290599822998047 43 15 10 10 8 1.425835130534964 55.123490207120646 0.0 4 0.9504730250768035 5.522459333722263 10286.0 11.19782270606532 1.0 - - - - - - - 642.7142857142857 21 7 XIAP X-linked inhibitor of apoptosis 1847 236 B20140404_SF100_02 B20140404_SF100_02 TB501883.[MT7]-AVQPLRLPSNK[MT7].3y10_2.heavy 504.315 / 648.399 65588.0 27.243999481201172 37 7 10 10 10 0.6184941282403997 83.60656312745957 0.0 3 0.7473830627745492 2.401779028256491 65588.0 66.92782293927263 0.0 - - - - - - - 691.8333333333334 131 6 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 1849 236 B20140404_SF100_02 B20140404_SF100_02 TB501883.[MT7]-AVQPLRLPSNK[MT7].3y4_1.heavy 504.315 / 589.343 50043.0 27.243999481201172 37 7 10 10 10 0.6184941282403997 83.60656312745957 0.0 3 0.7473830627745492 2.401779028256491 50043.0 42.213616690235206 0.0 - - - - - - - 639.0 100 2 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 1851 236 B20140404_SF100_02 B20140404_SF100_02 TB501883.[MT7]-AVQPLRLPSNK[MT7].3y8_1.heavy 504.315 / 1068.66 N/A 27.243999481201172 37 7 10 10 10 0.6184941282403997 83.60656312745957 0.0 3 0.7473830627745492 2.401779028256491 0.0 0.0 12.0 - - - - - - - 0.0 0 0 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 1853 236 B20140404_SF100_02 B20140404_SF100_02 TB501883.[MT7]-AVQPLRLPSNK[MT7].3y8_2.heavy 504.315 / 534.836 86990.0 27.243999481201172 37 7 10 10 10 0.6184941282403997 83.60656312745957 0.0 3 0.7473830627745492 2.401779028256491 86990.0 102.15072831933432 0.0 - - - - - - - 319.25 173 4 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 1855 237 B20140404_SF100_02 B20140404_SF100_02 TB154097.[MT7]-EAMEAR.2y4_1.heavy 425.714 / 506.239 2670.0 19.450899124145508 41 11 10 10 10 1.36637931757985 57.7322724558771 0.0 3 0.8685990002818902 3.3665771852651716 2670.0 2.28797691224294 6.0 - - - - - - - 793.4444444444445 8 9 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1857 237 B20140404_SF100_02 B20140404_SF100_02 TB154097.[MT7]-EAMEAR.2b3_1.heavy 425.714 / 476.229 6408.0 19.450899124145508 41 11 10 10 10 1.36637931757985 57.7322724558771 0.0 3 0.8685990002818902 3.3665771852651716 6408.0 6.993527613613205 0.0 - - - - - - - 767.5 12 10 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1859 237 B20140404_SF100_02 B20140404_SF100_02 TB154097.[MT7]-EAMEAR.2y5_1.heavy 425.714 / 577.276 9612.0 19.450899124145508 41 11 10 10 10 1.36637931757985 57.7322724558771 0.0 3 0.8685990002818902 3.3665771852651716 9612.0 13.313986175115208 0.0 - - - - - - - 1182.2857142857142 19 7 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1861 237 B20140404_SF100_02 B20140404_SF100_02 TB154097.[MT7]-EAMEAR.2b4_1.heavy 425.714 / 605.272 19290.0 19.450899124145508 41 11 10 10 10 1.36637931757985 57.7322724558771 0.0 3 0.8685990002818902 3.3665771852651716 19290.0 29.384205063460175 0.0 - - - - - - - 708.875 38 8 DEF8 differentially expressed in FDCP 8 homolog (mouse) 1863 238 B20140404_SF100_02 B20140404_SF100_02 TB501882.[MT7]-AWFYITYEK[MT7].2b3_1.heavy 754.905 / 549.294 21537.0 36.50559997558594 43 18 10 5 10 5.600939509398316 17.854147475115752 0.04380035400390625 3 0.9849474347512904 10.046408436283695 21537.0 42.824233969525196 0.0 - - - - - - - 717.5714285714286 43 7 SPIN2B;SPIN2A spindlin family, member 2B;spindlin family, member 2A 1865 238 B20140404_SF100_02 B20140404_SF100_02 TB501882.[MT7]-AWFYITYEK[MT7].2y4_1.heavy 754.905 / 684.369 24840.0 36.50559997558594 43 18 10 5 10 5.600939509398316 17.854147475115752 0.04380035400390625 3 0.9849474347512904 10.046408436283695 24840.0 17.20051552820854 0.0 - - - - - - - 287.5 49 2 SPIN2B;SPIN2A spindlin family, member 2B;spindlin family, member 2A 1867 238 B20140404_SF100_02 B20140404_SF100_02 TB501882.[MT7]-AWFYITYEK[MT7].2y5_1.heavy 754.905 / 797.453 18235.0 36.50559997558594 43 18 10 5 10 5.600939509398316 17.854147475115752 0.04380035400390625 3 0.9849474347512904 10.046408436283695 18235.0 45.14097353318735 0.0 - - - - - - - 664.0 36 8 SPIN2B;SPIN2A spindlin family, member 2B;spindlin family, member 2A 1869 238 B20140404_SF100_02 B20140404_SF100_02 TB501882.[MT7]-AWFYITYEK[MT7].2y3_1.heavy 754.905 / 583.321 10482.0 36.50559997558594 43 18 10 5 10 5.600939509398316 17.854147475115752 0.04380035400390625 3 0.9849474347512904 10.046408436283695 10482.0 17.628480690597186 0.0 - - - - - - - 335.0 20 3 SPIN2B;SPIN2A spindlin family, member 2B;spindlin family, member 2A 1871 239 B20140404_SF100_02 B20140404_SF100_02 TB154460.[MT7]-GSLEVLNLK[MT7].3y3_1.heavy 420.93 / 518.342 216546.0 32.596500396728516 46 16 10 10 10 2.4472609777002883 33.47657409621932 0.0 3 0.9693112322618914 7.02676903418002 216546.0 202.1032898031333 0.0 - - - - - - - 165.0 433 1 SBDS Shwachman-Bodian-Diamond syndrome 1873 239 B20140404_SF100_02 B20140404_SF100_02 TB154460.[MT7]-GSLEVLNLK[MT7].3b4_1.heavy 420.93 / 531.289 313504.0 32.596500396728516 46 16 10 10 10 2.4472609777002883 33.47657409621932 0.0 3 0.9693112322618914 7.02676903418002 313504.0 237.79099644138822 0.0 - - - - - - - 330.3333333333333 627 3 SBDS Shwachman-Bodian-Diamond syndrome 1875 239 B20140404_SF100_02 B20140404_SF100_02 TB154460.[MT7]-GSLEVLNLK[MT7].3b5_1.heavy 420.93 / 630.358 177399.0 32.596500396728516 46 16 10 10 10 2.4472609777002883 33.47657409621932 0.0 3 0.9693112322618914 7.02676903418002 177399.0 483.6207128212012 1.0 - - - - - - - 330.2 364 5 SBDS Shwachman-Bodian-Diamond syndrome 1877 239 B20140404_SF100_02 B20140404_SF100_02 TB154460.[MT7]-GSLEVLNLK[MT7].3y4_1.heavy 420.93 / 631.426 58307.0 32.596500396728516 46 16 10 10 10 2.4472609777002883 33.47657409621932 0.0 3 0.9693112322618914 7.02676903418002 58307.0 107.12818922781358 0.0 - - - - - - - 377.57142857142856 116 7 SBDS Shwachman-Bodian-Diamond syndrome 1879 240 B20140404_SF100_02 B20140404_SF100_02 TB501833.[MT7]-VRLQNQTEPR.3b5_1.heavy 462.264 / 755.464 16385.0 21.519100189208984 35 5 10 10 10 0.48076665634534343 101.66668212094763 0.0 3 0.6622303795804432 2.060589442513852 16385.0 79.64916310920266 0.0 - - - - - - - 244.52941176470588 32 17 SLC25A45 solute carrier family 25, member 45 1881 240 B20140404_SF100_02 B20140404_SF100_02 TB501833.[MT7]-VRLQNQTEPR.3b3_1.heavy 462.264 / 513.363 14044.0 21.519100189208984 35 5 10 10 10 0.48076665634534343 101.66668212094763 0.0 3 0.6622303795804432 2.060589442513852 14044.0 8.359024131328297 1.0 - - - - - - - 1165.2857142857142 28 7 SLC25A45 solute carrier family 25, member 45 1883 240 B20140404_SF100_02 B20140404_SF100_02 TB501833.[MT7]-VRLQNQTEPR.3y4_1.heavy 462.264 / 502.262 35186.0 21.519100189208984 35 5 10 10 10 0.48076665634534343 101.66668212094763 0.0 3 0.6622303795804432 2.060589442513852 35186.0 41.41072202380154 0.0 - - - - - - - 717.375 70 8 SLC25A45 solute carrier family 25, member 45 1885 240 B20140404_SF100_02 B20140404_SF100_02 TB501833.[MT7]-VRLQNQTEPR.3b8_2.heavy 462.264 / 557.31 124887.0 21.519100189208984 35 5 10 10 10 0.48076665634534343 101.66668212094763 0.0 3 0.6622303795804432 2.060589442513852 124887.0 89.08192466887417 0.0 - - - - - - - 831.0 249 1 SLC25A45 solute carrier family 25, member 45 1887 241 B20140404_SF100_02 B20140404_SF100_02 TB154818.[MT7]-GFIPDTPIGVAHFLLQR.3y7_1.heavy 675.718 / 884.51 13948.0 41.22042655944824 44 18 10 6 10 4.706580268120381 21.246848944092477 0.03910064697265625 3 0.9893057871098869 11.923401258812314 13948.0 26.154020052310376 0.0 - - - - - - - 372.0 27 5 IQSEC3 IQ motif and Sec7 domain 3 1889 241 B20140404_SF100_02 B20140404_SF100_02 TB154818.[MT7]-GFIPDTPIGVAHFLLQR.3y6_1.heavy 675.718 / 813.473 16653.0 41.22042655944824 44 18 10 6 10 4.706580268120381 21.246848944092477 0.03910064697265625 3 0.9893057871098869 11.923401258812314 16653.0 52.32392307692308 0.0 - - - - - - - 686.75 33 8 IQSEC3 IQ motif and Sec7 domain 3 1891 241 B20140404_SF100_02 B20140404_SF100_02 TB154818.[MT7]-GFIPDTPIGVAHFLLQR.3b5_1.heavy 675.718 / 674.363 13694.0 41.22042655944824 44 18 10 6 10 4.706580268120381 21.246848944092477 0.03910064697265625 3 0.9893057871098869 11.923401258812314 13694.0 37.7184509435471 0.0 - - - - - - - 655.0 27 8 IQSEC3 IQ motif and Sec7 domain 3 1893 241 B20140404_SF100_02 B20140404_SF100_02 TB154818.[MT7]-GFIPDTPIGVAHFLLQR.3y9_1.heavy 675.718 / 1040.6 13863.0 41.22042655944824 44 18 10 6 10 4.706580268120381 21.246848944092477 0.03910064697265625 3 0.9893057871098869 11.923401258812314 13863.0 40.70302504797697 0.0 - - - - - - - 202.9 27 10 IQSEC3 IQ motif and Sec7 domain 3 1895 242 B20140404_SF100_02 B20140404_SF100_02 TB154463.[MT7]-GK[MT7]EPGGGTK[MT7].3y6_1.heavy 421.586 / 660.38 48641.0 17.407999992370605 45 20 10 5 10 12.382065736256301 8.076196826123041 0.04580116271972656 3 0.9968816845927656 22.094767165401084 48641.0 226.71652542372883 0.0 - - - - - - - 189.92857142857142 97 14 RGS7BP regulator of G-protein signaling 7 binding protein 1897 242 B20140404_SF100_02 B20140404_SF100_02 TB154463.[MT7]-GK[MT7]EPGGGTK[MT7].3b3_1.heavy 421.586 / 603.37 9622.0 17.407999992370605 45 20 10 5 10 12.382065736256301 8.076196826123041 0.04580116271972656 3 0.9968816845927656 22.094767165401084 9622.0 88.82449922958398 0.0 - - - - - - - 142.47058823529412 19 17 RGS7BP regulator of G-protein signaling 7 binding protein 1899 242 B20140404_SF100_02 B20140404_SF100_02 TB154463.[MT7]-GK[MT7]EPGGGTK[MT7].3y4_1.heavy 421.586 / 506.306 13075.0 17.407999992370605 45 20 10 5 10 12.382065736256301 8.076196826123041 0.04580116271972656 3 0.9968816845927656 22.094767165401084 13075.0 81.10932203389831 0.0 - - - - - - - 225.3684210526316 26 19 RGS7BP regulator of G-protein signaling 7 binding protein 1901 242 B20140404_SF100_02 B20140404_SF100_02 TB154463.[MT7]-GK[MT7]EPGGGTK[MT7].3y5_1.heavy 421.586 / 563.327 21841.0 17.407999992370605 45 20 10 5 10 12.382065736256301 8.076196826123041 0.04580116271972656 3 0.9968816845927656 22.094767165401084 21841.0 101.0205845258307 0.0 - - - - - - - 183.57142857142858 43 14 RGS7BP regulator of G-protein signaling 7 binding protein 1903 243 B20140404_SF100_02 B20140404_SF100_02 TB154879.[MT7]-SSIFQISK[MT7]PPLQSGDWER.3b4_1.heavy 788.425 / 579.326 12298.0 33.40299987792969 47 17 10 10 10 4.034307371405762 24.787402345388177 0.0 3 0.9771720849111836 8.152664981872348 12298.0 23.227645423167267 0.0 - - - - - - - 319.3333333333333 24 6 RGS7BP regulator of G-protein signaling 7 binding protein 1905 243 B20140404_SF100_02 B20140404_SF100_02 TB154879.[MT7]-SSIFQISK[MT7]PPLQSGDWER.3b5_1.heavy 788.425 / 707.385 17409.0 33.40299987792969 47 17 10 10 10 4.034307371405762 24.787402345388177 0.0 3 0.9771720849111836 8.152664981872348 17409.0 20.081616686263516 1.0 - - - - - - - 830.6 38 10 RGS7BP regulator of G-protein signaling 7 binding protein 1907 243 B20140404_SF100_02 B20140404_SF100_02 TB154879.[MT7]-SSIFQISK[MT7]PPLQSGDWER.3y10_1.heavy 788.425 / 1184.57 35296.0 33.40299987792969 47 17 10 10 10 4.034307371405762 24.787402345388177 0.0 3 0.9771720849111836 8.152664981872348 35296.0 77.33430044340395 0.0 - - - - - - - 730.2857142857143 70 7 RGS7BP regulator of G-protein signaling 7 binding protein 1909 243 B20140404_SF100_02 B20140404_SF100_02 TB154879.[MT7]-SSIFQISK[MT7]PPLQSGDWER.3y9_1.heavy 788.425 / 1087.52 9742.0 33.40299987792969 47 17 10 10 10 4.034307371405762 24.787402345388177 0.0 3 0.9771720849111836 8.152664981872348 9742.0 22.282308028253 0.0 - - - - - - - 342.14285714285717 19 7 RGS7BP regulator of G-protein signaling 7 binding protein 1911 244 B20140404_SF100_02 B20140404_SF100_02 TB154815.[MT7]-NFSNDIMLLQLERK[MT7].3y7_1.heavy 670.375 / 1043.67 2439.0 34.622633616129555 37 16 6 5 10 2.758167488777245 36.25595632132266 0.04759979248046875 3 0.9682109531626016 6.903452934244367 2439.0 9.838591957527711 0.0 - - - - - - - 276.90909090909093 4 11 GZMH;GZMB granzyme H (cathepsin G-like 2, protein h-CCPX);granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 1913 244 B20140404_SF100_02 B20140404_SF100_02 TB154815.[MT7]-NFSNDIMLLQLERK[MT7].3y6_1.heavy 670.375 / 930.585 4877.0 34.622633616129555 37 16 6 5 10 2.758167488777245 36.25595632132266 0.04759979248046875 3 0.9682109531626016 6.903452934244367 4877.0 6.880675933760945 0.0 - - - - - - - 342.875 9 8 GZMH;GZMB granzyme H (cathepsin G-like 2, protein h-CCPX);granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 1915 244 B20140404_SF100_02 B20140404_SF100_02 TB154815.[MT7]-NFSNDIMLLQLERK[MT7].3b5_1.heavy 670.375 / 722.323 N/A 34.622633616129555 37 16 6 5 10 2.758167488777245 36.25595632132266 0.04759979248046875 3 0.9682109531626016 6.903452934244367 8535.0 9.773720714668665 2.0 - - - - - - - 1143.0 25 8 GZMH;GZMB granzyme H (cathepsin G-like 2, protein h-CCPX);granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 1917 244 B20140404_SF100_02 B20140404_SF100_02 TB154815.[MT7]-NFSNDIMLLQLERK[MT7].3y8_1.heavy 670.375 / 1174.71 4268.0 34.622633616129555 37 16 6 5 10 2.758167488777245 36.25595632132266 0.04759979248046875 3 0.9682109531626016 6.903452934244367 4268.0 15.169259245973382 0.0 - - - - - - - 291.9166666666667 8 12 GZMH;GZMB granzyme H (cathepsin G-like 2, protein h-CCPX);granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 1919 245 B20140404_SF100_02 B20140404_SF100_02 TB501838.[MT7]-VSSFVHWIK[MT7].3y3_1.heavy 464.274 / 590.378 183670.0 33.26559829711914 50 20 10 10 10 8.205630320228552 12.186754228188857 0.0 3 0.9929488450232731 14.688475370328968 183670.0 129.34071882865607 0.0 - - - - - - - 752.5 367 4 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 1921 245 B20140404_SF100_02 B20140404_SF100_02 TB501838.[MT7]-VSSFVHWIK[MT7].3b4_1.heavy 464.274 / 565.31 138338.0 33.26559829711914 50 20 10 10 10 8.205630320228552 12.186754228188857 0.0 3 0.9929488450232731 14.688475370328968 138338.0 121.9897614880795 0.0 - - - - - - - 1696.5714285714287 276 7 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 1923 245 B20140404_SF100_02 B20140404_SF100_02 TB501838.[MT7]-VSSFVHWIK[MT7].3b5_1.heavy 464.274 / 664.379 135494.0 33.26559829711914 50 20 10 10 10 8.205630320228552 12.186754228188857 0.0 3 0.9929488450232731 14.688475370328968 135494.0 203.72071737647042 0.0 - - - - - - - 702.4 270 10 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 1925 245 B20140404_SF100_02 B20140404_SF100_02 TB501838.[MT7]-VSSFVHWIK[MT7].3y4_1.heavy 464.274 / 727.437 20575.0 33.26559829711914 50 20 10 10 10 8.205630320228552 12.186754228188857 0.0 3 0.9929488450232731 14.688475370328968 20575.0 79.26877633364279 0.0 - - - - - - - 209.0 41 8 GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) 1927 246 B20140404_SF100_02 B20140404_SF100_02 TB344883.[MT7]-IEEFLEETLTPEK[MT7].2b3_1.heavy 933.503 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLIC5 chloride intracellular channel 5 1929 246 B20140404_SF100_02 B20140404_SF100_02 TB344883.[MT7]-IEEFLEETLTPEK[MT7].2b4_1.heavy 933.503 / 663.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLIC5 chloride intracellular channel 5 1931 246 B20140404_SF100_02 B20140404_SF100_02 TB344883.[MT7]-IEEFLEETLTPEK[MT7].2y3_1.heavy 933.503 / 517.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLIC5 chloride intracellular channel 5 1933 246 B20140404_SF100_02 B20140404_SF100_02 TB344883.[MT7]-IEEFLEETLTPEK[MT7].2b7_1.heavy 933.503 / 1034.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLIC5 chloride intracellular channel 5 1935 247 B20140404_SF100_02 B20140404_SF100_02 TB344981.[MT7]-LREINPLLFSYVEELVEIR.3y7_1.heavy 826.136 / 887.483 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEF8 differentially expressed in FDCP 8 homolog (mouse) 1937 247 B20140404_SF100_02 B20140404_SF100_02 TB344981.[MT7]-LREINPLLFSYVEELVEIR.3b5_1.heavy 826.136 / 770.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEF8 differentially expressed in FDCP 8 homolog (mouse) 1939 247 B20140404_SF100_02 B20140404_SF100_02 TB344981.[MT7]-LREINPLLFSYVEELVEIR.3y8_1.heavy 826.136 / 986.552 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEF8 differentially expressed in FDCP 8 homolog (mouse) 1941 247 B20140404_SF100_02 B20140404_SF100_02 TB344981.[MT7]-LREINPLLFSYVEELVEIR.3y5_1.heavy 826.136 / 629.398 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEF8 differentially expressed in FDCP 8 homolog (mouse) 1943 248 B20140404_SF100_02 B20140404_SF100_02 TB501979.[MT7]-AAIAQALAGEVSVVPPSR.3y7_1.heavy 627.362 / 741.425 232718.0 34.497501373291016 44 14 10 10 10 2.7506635267466595 36.35486457272175 0.0 3 0.9317530577991027 4.696986732452568 232718.0 103.460386578734 0.0 - - - - - - - 785.0 465 4 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1945 248 B20140404_SF100_02 B20140404_SF100_02 TB501979.[MT7]-AAIAQALAGEVSVVPPSR.3b6_1.heavy 627.362 / 670.4 309820.0 34.497501373291016 44 14 10 10 10 2.7506635267466595 36.35486457272175 0.0 3 0.9317530577991027 4.696986732452568 309820.0 127.32451586593976 0.0 - - - - - - - 628.0 619 1 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1947 248 B20140404_SF100_02 B20140404_SF100_02 TB501979.[MT7]-AAIAQALAGEVSVVPPSR.3b5_1.heavy 627.362 / 599.363 146666.0 34.497501373291016 44 14 10 10 10 2.7506635267466595 36.35486457272175 0.0 3 0.9317530577991027 4.696986732452568 146666.0 25.450577325198545 0.0 - - - - - - - 2355.0 293 1 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1949 248 B20140404_SF100_02 B20140404_SF100_02 TB501979.[MT7]-AAIAQALAGEVSVVPPSR.3y5_1.heavy 627.362 / 555.325 181684.0 34.497501373291016 44 14 10 10 10 2.7506635267466595 36.35486457272175 0.0 3 0.9317530577991027 4.696986732452568 181684.0 78.49647960944341 0.0 - - - - - - - 942.0 363 2 SMU1 smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) 1951 249 B20140404_SF100_02 B20140404_SF100_02 TB501976.[MT7]-IEEFLEETLTPEK[MT7].3y3_1.heavy 622.671 / 517.31 86694.0 39.15409851074219 42 12 10 10 10 2.339458705264414 42.744930600815046 0.0 3 0.8941022220296347 3.758458160470784 86694.0 14.07415718465795 1.0 - - - - - - - 2863.0 179 1 CLIC5 chloride intracellular channel 5 1953 249 B20140404_SF100_02 B20140404_SF100_02 TB501976.[MT7]-IEEFLEETLTPEK[MT7].3b4_1.heavy 622.671 / 663.347 32296.0 39.15409851074219 42 12 10 10 10 2.339458705264414 42.744930600815046 0.0 3 0.8941022220296347 3.758458160470784 32296.0 13.311573498814479 0.0 - - - - - - - 1145.0 64 1 CLIC5 chloride intracellular channel 5 1955 249 B20140404_SF100_02 B20140404_SF100_02 TB501976.[MT7]-IEEFLEETLTPEK[MT7].3b5_1.heavy 622.671 / 776.431 23935.0 39.15409851074219 42 12 10 10 10 2.339458705264414 42.744930600815046 0.0 3 0.8941022220296347 3.758458160470784 23935.0 8.894471751639367 0.0 - - - - - - - 1947.0 47 1 CLIC5 chloride intracellular channel 5 1957 249 B20140404_SF100_02 B20140404_SF100_02 TB501976.[MT7]-IEEFLEETLTPEK[MT7].3b3_1.heavy 622.671 / 516.279 15346.0 39.15409851074219 42 12 10 10 10 2.339458705264414 42.744930600815046 0.0 3 0.8941022220296347 3.758458160470784 15346.0 3.6042750541896886 2.0 - - - - - - - 1282.6 31 5 CLIC5 chloride intracellular channel 5 1959 250 B20140404_SF100_02 B20140404_SF100_02 TB501977.[MT7]-DAHALLLLYDVTNK[MT7].4b4_1.heavy 469.271 / 539.269 39755.0 35.99089813232422 37 7 10 10 10 0.5431625581296807 96.5498032594839 0.0 3 0.72767273996764 2.3090232714392247 39755.0 70.91114188090444 0.0 - - - - - - - 220.2 79 10 RAB26 RAB26, member RAS oncogene family 1961 250 B20140404_SF100_02 B20140404_SF100_02 TB501977.[MT7]-DAHALLLLYDVTNK[MT7].4b5_1.heavy 469.271 / 652.354 45183.0 35.99089813232422 37 7 10 10 10 0.5431625581296807 96.5498032594839 0.0 3 0.72767273996764 2.3090232714392247 45183.0 131.29275720148675 0.0 - - - - - - - 319.8181818181818 90 11 RAB26 RAB26, member RAS oncogene family 1963 250 B20140404_SF100_02 B20140404_SF100_02 TB501977.[MT7]-DAHALLLLYDVTNK[MT7].4y3_1.heavy 469.271 / 506.306 141271.0 35.99089813232422 37 7 10 10 10 0.5431625581296807 96.5498032594839 0.0 3 0.72767273996764 2.3090232714392247 141271.0 198.76981012658229 0.0 - - - - - - - 256.75 282 4 RAB26 RAB26, member RAS oncogene family 1965 250 B20140404_SF100_02 B20140404_SF100_02 TB501977.[MT7]-DAHALLLLYDVTNK[MT7].4b6_1.heavy 469.271 / 765.438 33594.0 35.99089813232422 37 7 10 10 10 0.5431625581296807 96.5498032594839 0.0 3 0.72767273996764 2.3090232714392247 33594.0 57.03299368498579 0.0 - - - - - - - 305.5833333333333 67 12 RAB26 RAB26, member RAS oncogene family 1967 251 B20140404_SF100_02 B20140404_SF100_02 TB154715.[MT7]-TGLNVDLAFTAIAK[MT7].3b6_1.heavy 574.673 / 744.401 210403.0 36.922401428222656 50 20 10 10 10 12.09180610193759 8.270063144990061 0.0 3 0.9929686800981953 14.709202959582486 210403.0 169.57730926175526 0.0 - - - - - - - 627.0 420 4 RAB26 RAB26, member RAS oncogene family 1969 251 B20140404_SF100_02 B20140404_SF100_02 TB154715.[MT7]-TGLNVDLAFTAIAK[MT7].3b4_1.heavy 574.673 / 530.305 74889.0 36.922401428222656 50 20 10 10 10 12.09180610193759 8.270063144990061 0.0 3 0.9929686800981953 14.709202959582486 74889.0 56.65884554945127 0.0 - - - - - - - 925.0 149 2 RAB26 RAB26, member RAS oncogene family 1971 251 B20140404_SF100_02 B20140404_SF100_02 TB154715.[MT7]-TGLNVDLAFTAIAK[MT7].3b8_1.heavy 574.673 / 928.522 80965.0 36.922401428222656 50 20 10 10 10 12.09180610193759 8.270063144990061 0.0 3 0.9929686800981953 14.709202959582486 80965.0 232.55177514616108 0.0 - - - - - - - 242.0 161 6 RAB26 RAB26, member RAS oncogene family 1973 251 B20140404_SF100_02 B20140404_SF100_02 TB154715.[MT7]-TGLNVDLAFTAIAK[MT7].3b7_1.heavy 574.673 / 857.485 75946.0 36.922401428222656 50 20 10 10 10 12.09180610193759 8.270063144990061 0.0 3 0.9929686800981953 14.709202959582486 75946.0 145.10760682535133 0.0 - - - - - - - 679.1428571428571 151 7 RAB26 RAB26, member RAS oncogene family 1975 252 B20140404_SF100_02 B20140404_SF100_02 TB154878.[MT7]-QRPLEK[MT7]PDGLDVSDQSK[MT7].4y4_1.heavy 586.826 / 621.332 28838.0 24.51610040664673 44 18 10 6 10 12.466048017878832 8.021788449441217 0.03280067443847656 3 0.9829008644182569 9.424417223502536 28838.0 28.721669216859095 0.0 - - - - - - - 718.9 57 10 ZCCHC24 zinc finger, CCHC domain containing 24 1977 252 B20140404_SF100_02 B20140404_SF100_02 TB154878.[MT7]-QRPLEK[MT7]PDGLDVSDQSK[MT7].4y5_1.heavy 586.826 / 708.364 35396.0 24.51610040664673 44 18 10 6 10 12.466048017878832 8.021788449441217 0.03280067443847656 3 0.9829008644182569 9.424417223502536 35396.0 28.519785251839423 0.0 - - - - - - - 689.4545454545455 70 11 ZCCHC24 zinc finger, CCHC domain containing 24 1979 252 B20140404_SF100_02 B20140404_SF100_02 TB154878.[MT7]-QRPLEK[MT7]PDGLDVSDQSK[MT7].4b8_2.heavy 586.826 / 626.866 19752.0 24.51610040664673 44 18 10 6 10 12.466048017878832 8.021788449441217 0.03280067443847656 3 0.9829008644182569 9.424417223502536 19752.0 26.160056258790437 0.0 - - - - - - - 732.5454545454545 39 11 ZCCHC24 zinc finger, CCHC domain containing 24 1981 252 B20140404_SF100_02 B20140404_SF100_02 TB154878.[MT7]-QRPLEK[MT7]PDGLDVSDQSK[MT7].4b11_2.heavy 586.826 / 769.432 77350.0 24.51610040664673 44 18 10 6 10 12.466048017878832 8.021788449441217 0.03280067443847656 3 0.9829008644182569 9.424417223502536 77350.0 25.74924334218464 0.0 - - - - - - - 671.5 154 8 ZCCHC24 zinc finger, CCHC domain containing 24 1983 253 B20140404_SF100_02 B20140404_SF100_02 TB154560.[MT7]-AC[CAM]PEHSAPIK[MT7].3y3_1.heavy 466.586 / 501.352 177314.0 20.837099075317383 44 14 10 10 10 2.28250369461143 33.24070253682357 0.0 3 0.9345502663978223 4.797453533605392 177314.0 112.52707906386158 0.0 - - - - - - - 920.0 354 2 SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 1985 253 B20140404_SF100_02 B20140404_SF100_02 TB154560.[MT7]-AC[CAM]PEHSAPIK[MT7].3b4_1.heavy 466.586 / 602.273 94675.0 20.837099075317383 44 14 10 10 10 2.28250369461143 33.24070253682357 0.0 3 0.9345502663978223 4.797453533605392 94675.0 192.5653770660607 0.0 - - - - - - - 651.75 189 8 SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 1987 253 B20140404_SF100_02 B20140404_SF100_02 TB154560.[MT7]-AC[CAM]PEHSAPIK[MT7].3y4_1.heavy 466.586 / 572.389 40016.0 20.837099075317383 44 14 10 10 10 2.28250369461143 33.24070253682357 0.0 3 0.9345502663978223 4.797453533605392 40016.0 64.29416492957131 0.0 - - - - - - - 734.0 80 7 SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 1989 253 B20140404_SF100_02 B20140404_SF100_02 TB154560.[MT7]-AC[CAM]PEHSAPIK[MT7].3y5_1.heavy 466.586 / 659.421 35263.0 20.837099075317383 44 14 10 10 10 2.28250369461143 33.24070253682357 0.0 3 0.9345502663978223 4.797453533605392 35263.0 18.070506790038287 0.0 - - - - - - - 1249.6 70 10 SLC17A5 solute carrier family 17 (anion/sugar transporter), member 5 1991 254 B20140404_SF100_02 B20140404_SF100_02 TB154718.[MT7]-LTDVEAQVLNQTTR.3y6_1.heavy 577.983 / 732.4 406470.0 33.031700134277344 47 17 10 10 10 3.472087963544514 24.922347247587652 0.0 3 0.9761282800643202 7.97173332419267 406470.0 412.0550839694657 0.0 - - - - - - - 327.5 812 2 ANGPT2 angiopoietin 2 1993 254 B20140404_SF100_02 B20140404_SF100_02 TB154718.[MT7]-LTDVEAQVLNQTTR.3b4_1.heavy 577.983 / 573.336 314269.0 33.031700134277344 47 17 10 10 10 3.472087963544514 24.922347247587652 0.0 3 0.9761282800643202 7.97173332419267 314269.0 162.38604509159228 0.0 - - - - - - - 164.0 628 1 ANGPT2 angiopoietin 2 1995 254 B20140404_SF100_02 B20140404_SF100_02 TB154718.[MT7]-LTDVEAQVLNQTTR.3b5_1.heavy 577.983 / 702.379 488027.0 33.031700134277344 47 17 10 10 10 3.472087963544514 24.922347247587652 0.0 3 0.9761282800643202 7.97173332419267 488027.0 327.04137673150603 0.0 - - - - - - - 328.0 976 2 ANGPT2 angiopoietin 2 1997 254 B20140404_SF100_02 B20140404_SF100_02 TB154718.[MT7]-LTDVEAQVLNQTTR.3y5_1.heavy 577.983 / 619.316 416460.0 33.031700134277344 47 17 10 10 10 3.472087963544514 24.922347247587652 0.0 3 0.9761282800643202 7.97173332419267 416460.0 416.57730625743443 0.0 - - - - - - - 901.0 832 4 ANGPT2 angiopoietin 2 1999 255 B20140404_SF100_02 B20140404_SF100_02 TB154561.[MT7]-IAFTGSTEVGK[MT7].3b6_1.heavy 466.601 / 721.4 22810.0 28.68429946899414 41 15 10 10 6 1.9699666076765376 35.079417479806445 0.0 5 0.9588938223103763 6.066103274613516 22810.0 0.9443903231043999 1.0 - - - - - - - 364.8 54 5 ALDH1A3;ALDH1A2 aldehyde dehydrogenase 1 family, member A3;aldehyde dehydrogenase 1 family, member A2 2001 255 B20140404_SF100_02 B20140404_SF100_02 TB154561.[MT7]-IAFTGSTEVGK[MT7].3b4_1.heavy 466.601 / 577.347 46532.0 28.68429946899414 41 15 10 10 6 1.9699666076765376 35.079417479806445 0.0 5 0.9588938223103763 6.066103274613516 46532.0 21.68147619751388 1.0 - - - - - - - 760.0 125 2 ALDH1A3;ALDH1A2 aldehyde dehydrogenase 1 family, member A3;aldehyde dehydrogenase 1 family, member A2 2003 255 B20140404_SF100_02 B20140404_SF100_02 TB154561.[MT7]-IAFTGSTEVGK[MT7].3b5_1.heavy 466.601 / 634.368 65084.0 28.68429946899414 41 15 10 10 6 1.9699666076765376 35.079417479806445 0.0 5 0.9588938223103763 6.066103274613516 65084.0 63.74164546805984 1.0 - - - - - - - 1216.7142857142858 135 7 ALDH1A3;ALDH1A2 aldehyde dehydrogenase 1 family, member A3;aldehyde dehydrogenase 1 family, member A2 2005 255 B20140404_SF100_02 B20140404_SF100_02 TB154561.[MT7]-IAFTGSTEVGK[MT7].3y4_1.heavy 466.601 / 576.347 68582.0 28.68429946899414 41 15 10 10 6 1.9699666076765376 35.079417479806445 0.0 5 0.9588938223103763 6.066103274613516 68582.0 32.396356141560425 0.0 - - - - - - - 456.0 137 1 ALDH1A3;ALDH1A2 aldehyde dehydrogenase 1 family, member A3;aldehyde dehydrogenase 1 family, member A2 2007 256 B20140404_SF100_02 B20140404_SF100_02 TB501971.[MT7]-EVFLFNDLLVILK[MT7].3y3_1.heavy 617.713 / 517.383 115561.0 46.522074699401855 39 11 10 8 10 0.9978461537071205 66.8105663573406 0.017498016357421875 3 0.8587002937006273 3.24369529102612 115561.0 -92.8200803212851 0.0 - - - - - - - 218.27777777777777 231 18 IQSEC3 IQ motif and Sec7 domain 3 2009 256 B20140404_SF100_02 B20140404_SF100_02 TB501971.[MT7]-EVFLFNDLLVILK[MT7].3b4_1.heavy 617.713 / 633.373 71743.0 46.522074699401855 39 11 10 8 10 0.9978461537071205 66.8105663573406 0.017498016357421875 3 0.8587002937006273 3.24369529102612 71743.0 -39.58234482758621 0.0 - - - - - - - 123.5 143 18 IQSEC3 IQ motif and Sec7 domain 3 2011 256 B20140404_SF100_02 B20140404_SF100_02 TB501971.[MT7]-EVFLFNDLLVILK[MT7].3b3_1.heavy 617.713 / 520.289 40037.0 46.522074699401855 39 11 10 8 10 0.9978461537071205 66.8105663573406 0.017498016357421875 3 0.8587002937006273 3.24369529102612 40037.0 -48.237349397590364 0.0 - - - - - - - 150.05555555555554 80 18 IQSEC3 IQ motif and Sec7 domain 3 2013 256 B20140404_SF100_02 B20140404_SF100_02 TB501971.[MT7]-EVFLFNDLLVILK[MT7].3b7_1.heavy 617.713 / 1009.51 64886.0 46.522074699401855 39 11 10 8 10 0.9978461537071205 66.8105663573406 0.017498016357421875 3 0.8587002937006273 3.24369529102612 64886.0 -104.65483870967739 0.0 - - - - - - - 74.0 129 9 IQSEC3 IQ motif and Sec7 domain 3 2015 257 B20140404_SF100_02 B20140404_SF100_02 TB502067.[MT7]-LQVLENIMENNTQWLMK[MT7].3y3_1.heavy 798.092 / 535.339 7381.0 42.82809829711914 46 16 10 10 10 2.494860656083065 31.75623801437754 0.0 3 0.9639225205819295 6.47783475780915 7381.0 13.426790824122397 0.0 - - - - - - - 766.7142857142857 14 7 ANGPT2 angiopoietin 2 2017 257 B20140404_SF100_02 B20140404_SF100_02 TB502067.[MT7]-LQVLENIMENNTQWLMK[MT7].3b6_1.heavy 798.092 / 841.49 9059.0 42.82809829711914 46 16 10 10 10 2.494860656083065 31.75623801437754 0.0 3 0.9639225205819295 6.47783475780915 9059.0 32.117977445534635 0.0 - - - - - - - 259.2 18 15 ANGPT2 angiopoietin 2 2019 257 B20140404_SF100_02 B20140404_SF100_02 TB502067.[MT7]-LQVLENIMENNTQWLMK[MT7].3b4_1.heavy 798.092 / 598.404 4496.0 42.82809829711914 46 16 10 10 10 2.494860656083065 31.75623801437754 0.0 3 0.9639225205819295 6.47783475780915 4496.0 10.506390516419131 0.0 - - - - - - - 662.625 8 8 ANGPT2 angiopoietin 2 2021 257 B20140404_SF100_02 B20140404_SF100_02 TB502067.[MT7]-LQVLENIMENNTQWLMK[MT7].3b5_1.heavy 798.092 / 727.447 4026.0 42.82809829711914 46 16 10 10 10 2.494860656083065 31.75623801437754 0.0 3 0.9639225205819295 6.47783475780915 4026.0 6.71 1.0 - - - - - - - 330.46153846153845 8 13 ANGPT2 angiopoietin 2 2023 258 B20140404_SF100_02 B20140404_SF100_02 TB344985.[MT7]-SALAAATAAAAAAASAAAATAAFTTAK[MT7].4y5_1.heavy 638.854 / 711.416 274761.0 43.44879913330078 38 8 10 10 10 0.564878939055951 94.06514528247342 0.0 3 0.7949407282853527 2.6773516302180163 274761.0 -7.538024691358032 0.0 - - - - - - - 233.2 549 5 SPAG8 sperm associated antigen 8 2025 258 B20140404_SF100_02 B20140404_SF100_02 TB344985.[MT7]-SALAAATAAAAAAASAAAATAAFTTAK[MT7].4b5_1.heavy 638.854 / 558.337 163356.0 43.44879913330078 38 8 10 10 10 0.564878939055951 94.06514528247342 0.0 3 0.7949407282853527 2.6773516302180163 163356.0 -28.019897084048026 0.0 - - - - - - - 243.0 326 3 SPAG8 sperm associated antigen 8 2027 258 B20140404_SF100_02 B20140404_SF100_02 TB344985.[MT7]-SALAAATAAAAAAASAAAATAAFTTAK[MT7].4y6_1.heavy 638.854 / 782.453 200952.0 43.44879913330078 38 8 10 10 10 0.564878939055951 94.06514528247342 0.0 3 0.7949407282853527 2.6773516302180163 200952.0 -15.760941176470624 0.0 - - - - - - - 247.8 401 5 SPAG8 sperm associated antigen 8 2029 258 B20140404_SF100_02 B20140404_SF100_02 TB344985.[MT7]-SALAAATAAAAAAASAAAATAAFTTAK[MT7].4b6_1.heavy 638.854 / 629.374 160514.0 43.44879913330078 38 8 10 10 10 0.564878939055951 94.06514528247342 0.0 3 0.7949407282853527 2.6773516302180163 160514.0 -4.40367626886146 0.0 - - - - - - - 218.66666666666666 321 3 SPAG8 sperm associated antigen 8 2031 259 B20140404_SF100_02 B20140404_SF100_02 TB154569.[MT7]-AGFYALGEGDK[MT7].2y5_1.heavy 708.374 / 649.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - XIAP X-linked inhibitor of apoptosis 2033 259 B20140404_SF100_02 B20140404_SF100_02 TB154569.[MT7]-AGFYALGEGDK[MT7].2b4_1.heavy 708.374 / 583.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - XIAP X-linked inhibitor of apoptosis 2035 259 B20140404_SF100_02 B20140404_SF100_02 TB154569.[MT7]-AGFYALGEGDK[MT7].2y6_1.heavy 708.374 / 762.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - XIAP X-linked inhibitor of apoptosis 2037 259 B20140404_SF100_02 B20140404_SF100_02 TB154569.[MT7]-AGFYALGEGDK[MT7].2b5_1.heavy 708.374 / 654.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - XIAP X-linked inhibitor of apoptosis 2039 260 B20140404_SF100_02 B20140404_SF100_02 TB344987.[MT7]-TDVNK[MT7]IEEFLEETLTPEK[MT7].3y3_1.heavy 856.465 / 517.31 12242.0 40.92729949951172 46 16 10 10 10 1.6546608830699918 47.28838316781773 0.0 3 0.9654980357026312 6.624968491241551 12242.0 5.055532859680285 1.0 - - - - - - - 979.0 24 1 CLIC5 chloride intracellular channel 5 2041 260 B20140404_SF100_02 B20140404_SF100_02 TB344987.[MT7]-TDVNK[MT7]IEEFLEETLTPEK[MT7].3y4_1.heavy 856.465 / 618.358 7443.0 40.92729949951172 46 16 10 10 10 1.6546608830699918 47.28838316781773 0.0 3 0.9654980357026312 6.624968491241551 7443.0 9.181425091491471 0.0 - - - - - - - 839.4285714285714 14 7 CLIC5 chloride intracellular channel 5 2043 260 B20140404_SF100_02 B20140404_SF100_02 TB344987.[MT7]-TDVNK[MT7]IEEFLEETLTPEK[MT7].3b8_1.heavy 856.465 / 1217.66 N/A 40.92729949951172 46 16 10 10 10 1.6546608830699918 47.28838316781773 0.0 3 0.9654980357026312 6.624968491241551 490.0 0.0 7.0 - - - - - - - 0.0 0 0 CLIC5 chloride intracellular channel 5 2045 260 B20140404_SF100_02 B20140404_SF100_02 TB344987.[MT7]-TDVNK[MT7]IEEFLEETLTPEK[MT7].3b8_2.heavy 856.465 / 609.334 4701.0 40.92729949951172 46 16 10 10 10 1.6546608830699918 47.28838316781773 0.0 3 0.9654980357026312 6.624968491241551 4701.0 6.312871579819947 0.0 - - - - - - - 797.2857142857143 9 7 CLIC5 chloride intracellular channel 5 2047 261 B20140404_SF100_02 B20140404_SF100_02 TB501876.[MT7]-QNSIIEELEK[MT7].3y3_1.heavy 497.615 / 533.341 64806.0 33.124900817871094 47 17 10 10 10 4.4193543931965085 22.62773950736959 0.0 3 0.9784768236423448 8.397057863314318 64806.0 27.94471448491575 0.0 - - - - - - - 502.0 129 1 ANGPT2 angiopoietin 2 2049 261 B20140404_SF100_02 B20140404_SF100_02 TB501876.[MT7]-QNSIIEELEK[MT7].3b4_1.heavy 497.615 / 587.327 75859.0 33.124900817871094 47 17 10 10 10 4.4193543931965085 22.62773950736959 0.0 3 0.9784768236423448 8.397057863314318 75859.0 81.81300150423692 0.0 - - - - - - - 1196.2857142857142 151 7 ANGPT2 angiopoietin 2 2051 261 B20140404_SF100_02 B20140404_SF100_02 TB501876.[MT7]-QNSIIEELEK[MT7].3b5_1.heavy 497.615 / 700.411 41865.0 33.124900817871094 47 17 10 10 10 4.4193543931965085 22.62773950736959 0.0 3 0.9784768236423448 8.397057863314318 41865.0 74.85677290836654 1.0 - - - - - - - 209.0 83 4 ANGPT2 angiopoietin 2 2053 261 B20140404_SF100_02 B20140404_SF100_02 TB501876.[MT7]-QNSIIEELEK[MT7].3y4_1.heavy 497.615 / 662.384 41195.0 33.124900817871094 47 17 10 10 10 4.4193543931965085 22.62773950736959 0.0 3 0.9784768236423448 8.397057863314318 41195.0 42.14909984747794 0.0 - - - - - - - 167.0 82 1 ANGPT2 angiopoietin 2 2055 262 B20140404_SF100_02 B20140404_SF100_02 TB154288.[MT7]-EEQISFR.2b3_1.heavy 526.778 / 531.253 19514.0 26.93000030517578 45 15 10 10 10 3.094814845424503 32.312110738335114 0.0 3 0.9503638995085335 5.516334300850496 19514.0 9.912040367007883 1.0 - - - - - - - 476.0 43 1 ANGPT2 angiopoietin 2 2057 262 B20140404_SF100_02 B20140404_SF100_02 TB154288.[MT7]-EEQISFR.2y5_1.heavy 526.778 / 650.362 18086.0 26.93000030517578 45 15 10 10 10 3.094814845424503 32.312110738335114 0.0 3 0.9503638995085335 5.516334300850496 18086.0 21.73532372039725 0.0 - - - - - - - 386.75 36 4 ANGPT2 angiopoietin 2 2059 262 B20140404_SF100_02 B20140404_SF100_02 TB154288.[MT7]-EEQISFR.2b4_1.heavy 526.778 / 644.337 16658.0 26.93000030517578 45 15 10 10 10 3.094814845424503 32.312110738335114 0.0 3 0.9503638995085335 5.516334300850496 16658.0 12.88460688890941 0.0 - - - - - - - 476.0 33 1 ANGPT2 angiopoietin 2 2061 262 B20140404_SF100_02 B20140404_SF100_02 TB154288.[MT7]-EEQISFR.2y6_1.heavy 526.778 / 779.405 36768.0 26.93000030517578 45 15 10 10 10 3.094814845424503 32.312110738335114 0.0 3 0.9503638995085335 5.516334300850496 36768.0 56.98868347338936 0.0 - - - - - - - 816.0 73 7 ANGPT2 angiopoietin 2