Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140404_SF100_04 B20140404_SF100_04 TB154269.[MT7]-VEQLEK[MT7].2y4_1.heavy 517.31 / 661.4 19023.0 23.883699417114258 45 17 10 10 8 5.4251257901605126 18.432752320945042 0.0 4 0.9716986202009527 7.3186157776710825 19023.0 28.801237392744245 2.0 - - - - - - - 441.6666666666667 52 3 RNF8 ring finger protein 8 3 1 B20140404_SF100_04 B20140404_SF100_04 TB154269.[MT7]-VEQLEK[MT7].2b3_1.heavy 517.31 / 501.279 18645.0 23.883699417114258 45 17 10 10 8 5.4251257901605126 18.432752320945042 0.0 4 0.9716986202009527 7.3186157776710825 18645.0 14.553448228110147 0.0 - - - - - - - 838.0 37 7 RNF8 ring finger protein 8 5 1 B20140404_SF100_04 B20140404_SF100_04 TB154269.[MT7]-VEQLEK[MT7].2y5_1.heavy 517.31 / 790.443 51581.0 23.883699417114258 45 17 10 10 8 5.4251257901605126 18.432752320945042 0.0 4 0.9716986202009527 7.3186157776710825 51581.0 27.793248811410457 0.0 - - - - - - - 284.0 103 1 RNF8 ring finger protein 8 7 1 B20140404_SF100_04 B20140404_SF100_04 TB154269.[MT7]-VEQLEK[MT7].2y3_1.heavy 517.31 / 533.341 19497.0 23.883699417114258 45 17 10 10 8 5.4251257901605126 18.432752320945042 0.0 4 0.9716986202009527 7.3186157776710825 19497.0 28.44622238549713 0.0 - - - - - - - 838.1428571428571 38 7 RNF8 ring finger protein 8 9 2 B20140404_SF100_04 B20140404_SF100_04 TB154411.[MT7]-GLQAQGYGVR.2y8_1.heavy 596.831 / 878.448 13229.0 25.120899200439453 50 20 10 10 10 6.7987381681915915 14.708611734432946 0.0 3 0.9928311494487382 14.567258110558052 13229.0 18.268367734862935 1.0 - - - - - - - 276.7142857142857 27 14 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 11 2 B20140404_SF100_04 B20140404_SF100_04 TB154411.[MT7]-GLQAQGYGVR.2y9_1.heavy 596.831 / 991.532 8711.0 25.120899200439453 50 20 10 10 10 6.7987381681915915 14.708611734432946 0.0 3 0.9928311494487382 14.567258110558052 8711.0 55.30472093023256 0.0 - - - - - - - 201.75 17 8 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 13 2 B20140404_SF100_04 B20140404_SF100_04 TB154411.[MT7]-GLQAQGYGVR.2b4_1.heavy 596.831 / 514.311 9787.0 25.120899200439453 50 20 10 10 10 6.7987381681915915 14.708611734432946 0.0 3 0.9928311494487382 14.567258110558052 9787.0 11.281757235749696 0.0 - - - - - - - 752.8571428571429 19 7 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 15 2 B20140404_SF100_04 B20140404_SF100_04 TB154411.[MT7]-GLQAQGYGVR.2y7_1.heavy 596.831 / 750.389 19036.0 25.120899200439453 50 20 10 10 10 6.7987381681915915 14.708611734432946 0.0 3 0.9928311494487382 14.567258110558052 19036.0 61.756325581395345 0.0 - - - - - - - 783.5714285714286 38 7 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 17 3 B20140404_SF100_04 B20140404_SF100_04 TB501931.[MT7]-SVSTQTGSMTGQIPR.3y7_1.heavy 565.294 / 802.424 14440.0 25.970199584960938 47 17 10 10 10 3.3393480711601535 24.213088566272578 0.0 3 0.9729835476829336 7.491444615758912 14440.0 22.64002370169453 0.0 - - - - - - - 648.7777777777778 28 9 CDADC1 cytidine and dCMP deaminase domain containing 1 19 3 B20140404_SF100_04 B20140404_SF100_04 TB501931.[MT7]-SVSTQTGSMTGQIPR.3y6_1.heavy 565.294 / 671.383 50645.0 25.970199584960938 47 17 10 10 10 3.3393480711601535 24.213088566272578 0.0 3 0.9729835476829336 7.491444615758912 50645.0 26.657885031341813 0.0 - - - - - - - 781.8181818181819 101 11 CDADC1 cytidine and dCMP deaminase domain containing 1 21 3 B20140404_SF100_04 B20140404_SF100_04 TB501931.[MT7]-SVSTQTGSMTGQIPR.3y5_1.heavy 565.294 / 570.336 53405.0 25.970199584960938 47 17 10 10 10 3.3393480711601535 24.213088566272578 0.0 3 0.9729835476829336 7.491444615758912 53405.0 68.71635736510275 0.0 - - - - - - - 1297.5555555555557 106 9 CDADC1 cytidine and dCMP deaminase domain containing 1 23 3 B20140404_SF100_04 B20140404_SF100_04 TB501931.[MT7]-SVSTQTGSMTGQIPR.3y9_1.heavy 565.294 / 946.477 11254.0 25.970199584960938 47 17 10 10 10 3.3393480711601535 24.213088566272578 0.0 3 0.9729835476829336 7.491444615758912 11254.0 58.2103448275862 0.0 - - - - - - - 230.0 22 18 CDADC1 cytidine and dCMP deaminase domain containing 1 25 4 B20140404_SF100_04 B20140404_SF100_04 TB154413.[MT7]-GFVVINQK[MT7].2y4_1.heavy 596.868 / 646.4 16636.0 28.802200317382812 38 20 0 10 8 6.3660296361195075 15.708378018321046 0.0 4 0.9929649302945782 14.70527771091226 16636.0 14.813172301913816 0.0 - - - - - - - 250.0 33 3 CCT6B;CCT6A chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin containing TCP1, subunit 6A (zeta 1) 27 4 B20140404_SF100_04 B20140404_SF100_04 TB154413.[MT7]-GFVVINQK[MT7].2y5_1.heavy 596.868 / 745.469 14388.0 28.802200317382812 38 20 0 10 8 6.3660296361195075 15.708378018321046 0.0 4 0.9929649302945782 14.70527771091226 14388.0 7.023859949807186 1.0 - - - - - - - 1241.857142857143 32 7 CCT6B;CCT6A chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin containing TCP1, subunit 6A (zeta 1) 29 4 B20140404_SF100_04 B20140404_SF100_04 TB154413.[MT7]-GFVVINQK[MT7].2b4_1.heavy 596.868 / 547.336 21432.0 28.802200317382812 38 20 0 10 8 6.3660296361195075 15.708378018321046 0.0 4 0.9929649302945782 14.70527771091226 21432.0 10.530176978268086 1.0 - - - - - - - 2740.8571428571427 179 7 CCT6B;CCT6A chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin containing TCP1, subunit 6A (zeta 1) 31 4 B20140404_SF100_04 B20140404_SF100_04 TB154413.[MT7]-GFVVINQK[MT7].2y3_1.heavy 596.868 / 533.316 14088.0 28.802200317382812 38 20 0 10 8 6.3660296361195075 15.708378018321046 0.0 4 0.9929649302945782 14.70527771091226 14088.0 26.301516597164305 1.0 - - - - - - - 375.0 28 2 CCT6B;CCT6A chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin containing TCP1, subunit 6A (zeta 1) 33 5 B20140404_SF100_04 B20140404_SF100_04 TB501730.[MT7]-EAHSEGVK[MT7].2y6_1.heavy 572.814 / 800.438 1046.0 17.88170051574707 42 14 10 10 8 2.7564855910919825 36.27807826137955 0.0 4 0.9330664084062703 4.74337664764471 1046.0 16.271111111111114 1.0 - - - - - - - 124.76923076923077 5 13 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 35 5 B20140404_SF100_04 B20140404_SF100_04 TB501730.[MT7]-EAHSEGVK[MT7].2y4_1.heavy 572.814 / 576.347 686.0 17.88170051574707 42 14 10 10 8 2.7564855910919825 36.27807826137955 0.0 4 0.9330664084062703 4.74337664764471 686.0 8.336805555555555 0.0 - - - - - - - 0.0 1 0 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 37 5 B20140404_SF100_04 B20140404_SF100_04 TB501730.[MT7]-EAHSEGVK[MT7].2y5_1.heavy 572.814 / 663.379 2778.0 17.88170051574707 42 14 10 10 8 2.7564855910919825 36.27807826137955 0.0 4 0.9330664084062703 4.74337664764471 2778.0 35.753888888888895 0.0 - - - - - - - 112.86666666666666 5 15 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 39 5 B20140404_SF100_04 B20140404_SF100_04 TB501730.[MT7]-EAHSEGVK[MT7].2y7_1.heavy 572.814 / 871.475 2562.0 17.88170051574707 42 14 10 10 8 2.7564855910919825 36.27807826137955 0.0 4 0.9330664084062703 4.74337664764471 2562.0 28.134555555555558 0.0 - - - - - - - 110.3125 5 16 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 41 6 B20140404_SF100_04 B20140404_SF100_04 TB501732.[MT7]-LLVTC[CAM]PFR.2y4_1.heavy 575.332 / 579.271 11811.0 33.652849197387695 43 18 10 5 10 4.34474182181195 23.01632734492278 0.044498443603515625 3 0.9809388381418989 8.92473676103207 11811.0 22.553949972885032 0.0 - - - - - - - 252.0 23 4 LNX1 ligand of numb-protein X 1 43 6 B20140404_SF100_04 B20140404_SF100_04 TB501732.[MT7]-LLVTC[CAM]PFR.2y5_1.heavy 575.332 / 680.318 38603.0 33.652849197387695 43 18 10 5 10 4.34474182181195 23.01632734492278 0.044498443603515625 3 0.9809388381418989 8.92473676103207 38603.0 51.82601458685561 0.0 - - - - - - - 1152.0 77 9 LNX1 ligand of numb-protein X 1 45 6 B20140404_SF100_04 B20140404_SF100_04 TB501732.[MT7]-LLVTC[CAM]PFR.2y6_1.heavy 575.332 / 779.387 44797.0 33.652849197387695 43 18 10 5 10 4.34474182181195 23.01632734492278 0.044498443603515625 3 0.9809388381418989 8.92473676103207 44797.0 54.23852244893347 0.0 - - - - - - - 264.0 89 6 LNX1 ligand of numb-protein X 1 47 6 B20140404_SF100_04 B20140404_SF100_04 TB501732.[MT7]-LLVTC[CAM]PFR.2y7_1.heavy 575.332 / 892.471 55312.0 33.652849197387695 43 18 10 5 10 4.34474182181195 23.01632734492278 0.044498443603515625 3 0.9809388381418989 8.92473676103207 55312.0 28.713688325253273 0.0 - - - - - - - 144.0 110 1 LNX1 ligand of numb-protein X 1 49 7 B20140404_SF100_04 B20140404_SF100_04 TB154559.[MT7]-VTEVHHEQK[MT7].3y3_1.heavy 465.593 / 548.316 28580.0 18.34510040283203 39 15 4 10 10 1.8056717312741728 38.059603214176256 0.0 3 0.958148078478414 6.011436159077961 28580.0 77.04207662427973 0.0 - - - - - - - 771.3333333333334 57 9 RNF8 ring finger protein 8 51 7 B20140404_SF100_04 B20140404_SF100_04 TB154559.[MT7]-VTEVHHEQK[MT7].3b4_1.heavy 465.593 / 573.336 31690.0 18.34510040283203 39 15 4 10 10 1.8056717312741728 38.059603214176256 0.0 3 0.958148078478414 6.011436159077961 31690.0 45.96306729834111 0.0 - - - - - - - 703.1 119 10 RNF8 ring finger protein 8 53 7 B20140404_SF100_04 B20140404_SF100_04 TB154559.[MT7]-VTEVHHEQK[MT7].3y4_1.heavy 465.593 / 685.375 12532.0 18.34510040283203 39 15 4 10 10 1.8056717312741728 38.059603214176256 0.0 3 0.958148078478414 6.011436159077961 12532.0 52.36002815909892 0.0 - - - - - - - 212.35714285714286 25 14 RNF8 ring finger protein 8 55 7 B20140404_SF100_04 B20140404_SF100_04 TB154559.[MT7]-VTEVHHEQK[MT7].3b3_1.heavy 465.593 / 474.268 24207.0 18.34510040283203 39 15 4 10 10 1.8056717312741728 38.059603214176256 0.0 3 0.958148078478414 6.011436159077961 24207.0 43.26718457943925 0.0 - - - - - - - 727.4285714285714 48 7 RNF8 ring finger protein 8 57 8 B20140404_SF100_04 B20140404_SF100_04 TB154368.[MT7]-TSQSWVER.2y4_1.heavy 568.794 / 589.309 N/A 24.846900939941406 41 18 9 10 4 5.003136250579646 19.98746286160293 0.0 8 0.984173762071179 9.797134824053277 4696.0 4.605192407476066 6.0 - - - - - - - 229.5 65 4 RANBP3 RAN binding protein 3 59 8 B20140404_SF100_04 B20140404_SF100_04 TB154368.[MT7]-TSQSWVER.2y5_1.heavy 568.794 / 676.341 7350.0 24.846900939941406 41 18 9 10 4 5.003136250579646 19.98746286160293 0.0 8 0.984173762071179 9.797134824053277 7350.0 17.04911764705882 0.0 - - - - - - - 238.0 14 9 RANBP3 RAN binding protein 3 61 8 B20140404_SF100_04 B20140404_SF100_04 TB154368.[MT7]-TSQSWVER.2b4_1.heavy 568.794 / 548.28 7350.0 24.846900939941406 41 18 9 10 4 5.003136250579646 19.98746286160293 0.0 8 0.984173762071179 9.797134824053277 7350.0 7.20799567535345 2.0 - - - - - - - 1212.25 14 8 RANBP3 RAN binding protein 3 63 8 B20140404_SF100_04 B20140404_SF100_04 TB154368.[MT7]-TSQSWVER.2y7_1.heavy 568.794 / 891.432 29094.0 24.846900939941406 41 18 9 10 4 5.003136250579646 19.98746286160293 0.0 8 0.984173762071179 9.797134824053277 29094.0 50.22095639125155 0.0 - - - - - - - 743.8571428571429 58 7 RANBP3 RAN binding protein 3 65 9 B20140404_SF100_04 B20140404_SF100_04 TB154367.[MT7]-TMDEVIER.2y5_1.heavy 568.791 / 645.357 14875.0 26.871700286865234 33 15 2 10 6 3.332807973711447 30.004728981921826 0.0 5 0.9529066036182523 5.664519645053405 14875.0 7.66352209492635 3.0 - - - - - - - 1232.142857142857 73 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 67 9 B20140404_SF100_04 B20140404_SF100_04 TB154367.[MT7]-TMDEVIER.2b4_1.heavy 568.791 / 621.267 8625.0 26.871700286865234 33 15 2 10 6 3.332807973711447 30.004728981921826 0.0 5 0.9529066036182523 5.664519645053405 8625.0 10.8054 1.0 - - - - - - - 1178.5714285714287 82 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 69 9 B20140404_SF100_04 B20140404_SF100_04 TB154367.[MT7]-TMDEVIER.2b5_1.heavy 568.791 / 720.336 9750.0 26.871700286865234 33 15 2 10 6 3.332807973711447 30.004728981921826 0.0 5 0.9529066036182523 5.664519645053405 9750.0 19.332857142857144 0.0 - - - - - - - 662.5 19 10 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 71 9 B20140404_SF100_04 B20140404_SF100_04 TB154367.[MT7]-TMDEVIER.2y7_1.heavy 568.791 / 891.424 13875.0 26.871700286865234 33 15 2 10 6 3.332807973711447 30.004728981921826 0.0 5 0.9529066036182523 5.664519645053405 13875.0 18.80392857142857 0.0 - - - - - - - 578.125 49 8 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 73 10 B20140404_SF100_04 B20140404_SF100_04 TB154364.[MT7]-VLEGDSVK[MT7].2y5_1.heavy 567.834 / 649.364 9686.0 24.98390007019043 41 17 6 10 8 3.1454255256565915 31.792200827621095 0.0 4 0.9791936436761534 8.54099480625645 9686.0 10.468320768645698 0.0 - - - - - - - 1170.625 19 8 MYOT myotilin 75 10 B20140404_SF100_04 B20140404_SF100_04 TB154364.[MT7]-VLEGDSVK[MT7].2y6_1.heavy 567.834 / 778.406 7983.0 24.98390007019043 41 17 6 10 8 3.1454255256565915 31.792200827621095 0.0 4 0.9791936436761534 8.54099480625645 7983.0 9.51020814188513 1.0 - - - - - - - 390.3333333333333 15 3 MYOT myotilin 77 10 B20140404_SF100_04 B20140404_SF100_04 TB154364.[MT7]-VLEGDSVK[MT7].2b5_1.heavy 567.834 / 658.353 8941.0 24.98390007019043 41 17 6 10 8 3.1454255256565915 31.792200827621095 0.0 4 0.9791936436761534 8.54099480625645 8941.0 13.441604140832247 0.0 - - - - - - - 1309.1 17 10 MYOT myotilin 79 10 B20140404_SF100_04 B20140404_SF100_04 TB154364.[MT7]-VLEGDSVK[MT7].2y7_1.heavy 567.834 / 891.49 13624.0 24.98390007019043 41 17 6 10 8 3.1454255256565915 31.792200827621095 0.0 4 0.9791936436761534 8.54099480625645 13624.0 15.258092485549131 3.0 - - - - - - - 1186.0 41 7 MYOT myotilin 81 11 B20140404_SF100_04 B20140404_SF100_04 TB344961.[MT7]-EWDLPIYVISVEPGGVISR.3y7_1.heavy 758.415 / 685.399 79247.0 41.388999938964844 40 10 10 10 10 0.7985539609257748 76.3414000694863 0.0 3 0.8350574132540785 2.995968947169341 79247.0 116.99349329123464 0.0 - - - - - - - 1303.2857142857142 158 7 LNX1 ligand of numb-protein X 1 83 11 B20140404_SF100_04 B20140404_SF100_04 TB344961.[MT7]-EWDLPIYVISVEPGGVISR.3b6_1.heavy 758.415 / 898.479 36483.0 41.388999938964844 40 10 10 10 10 0.7985539609257748 76.3414000694863 0.0 3 0.8350574132540785 2.995968947169341 36483.0 69.5923408896949 0.0 - - - - - - - 695.1666666666666 72 12 LNX1 ligand of numb-protein X 1 85 11 B20140404_SF100_04 B20140404_SF100_04 TB344961.[MT7]-EWDLPIYVISVEPGGVISR.3b5_1.heavy 758.415 / 785.395 5937.0 41.388999938964844 40 10 10 10 10 0.7985539609257748 76.3414000694863 0.0 3 0.8350574132540785 2.995968947169341 5937.0 40.96069767441861 0.0 - - - - - - - 602.0 13 8 LNX1 ligand of numb-protein X 1 87 11 B20140404_SF100_04 B20140404_SF100_04 TB344961.[MT7]-EWDLPIYVISVEPGGVISR.3b3_1.heavy 758.415 / 575.258 19360.0 41.388999938964844 40 10 10 10 10 0.7985539609257748 76.3414000694863 0.0 3 0.8350574132540785 2.995968947169341 19360.0 74.03608939255908 0.0 - - - - - - - 707.1111111111111 38 9 LNX1 ligand of numb-protein X 1 89 12 B20140404_SF100_04 B20140404_SF100_04 TB154754.[MT7]-LAPMLVEQC[CAM]VDFIR.3y6_1.heavy 612.327 / 809.397 33661.0 38.259700775146484 48 18 10 10 10 4.352887867671471 22.97325431759718 0.0 3 0.9806331515584324 8.853795387870957 33661.0 102.88844122217651 0.0 - - - - - - - 325.0 67 9 ARHGAP24 Rho GTPase activating protein 24 91 12 B20140404_SF100_04 B20140404_SF100_04 TB154754.[MT7]-LAPMLVEQC[CAM]VDFIR.3b4_1.heavy 612.327 / 557.324 56686.0 38.259700775146484 48 18 10 10 10 4.352887867671471 22.97325431759718 0.0 3 0.9806331515584324 8.853795387870957 56686.0 56.962647493781944 0.0 - - - - - - - 234.0 113 1 ARHGAP24 Rho GTPase activating protein 24 93 12 B20140404_SF100_04 B20140404_SF100_04 TB154754.[MT7]-LAPMLVEQC[CAM]VDFIR.3b5_1.heavy 612.327 / 670.408 55401.0 38.259700775146484 48 18 10 10 10 4.352887867671471 22.97325431759718 0.0 3 0.9806331515584324 8.853795387870957 55401.0 49.65277762844233 0.0 - - - - - - - 292.5 110 6 ARHGAP24 Rho GTPase activating protein 24 95 12 B20140404_SF100_04 B20140404_SF100_04 TB154754.[MT7]-LAPMLVEQC[CAM]VDFIR.3y5_1.heavy 612.327 / 649.367 21506.0 38.259700775146484 48 18 10 10 10 4.352887867671471 22.97325431759718 0.0 3 0.9806331515584324 8.853795387870957 21506.0 40.89759658933734 0.0 - - - - - - - 351.0 43 7 ARHGAP24 Rho GTPase activating protein 24 97 13 B20140404_SF100_04 B20140404_SF100_04 TB154550.[MT7]-EQAGELGQHNR.3y6_1.heavy 461.568 / 724.385 9548.0 19.470399856567383 46 16 10 10 10 2.7015239179615462 37.01614460458144 0.0 3 0.9672427978398526 6.800115072918377 9548.0 29.653424268258025 0.0 - - - - - - - 196.8095238095238 19 21 ARHGAP24 Rho GTPase activating protein 24 99 13 B20140404_SF100_04 B20140404_SF100_04 TB154550.[MT7]-EQAGELGQHNR.3b4_1.heavy 461.568 / 530.269 28365.0 19.470399856567383 46 16 10 10 10 2.7015239179615462 37.01614460458144 0.0 3 0.9672427978398526 6.800115072918377 28365.0 64.7596603498023 0.0 - - - - - - - 714.7333333333333 56 15 ARHGAP24 Rho GTPase activating protein 24 101 13 B20140404_SF100_04 B20140404_SF100_04 TB154550.[MT7]-EQAGELGQHNR.3b5_1.heavy 461.568 / 659.312 72756.0 19.470399856567383 46 16 10 10 10 2.7015239179615462 37.01614460458144 0.0 3 0.9672427978398526 6.800115072918377 72756.0 253.31387417430898 0.0 - - - - - - - 292.15384615384613 145 13 ARHGAP24 Rho GTPase activating protein 24 103 13 B20140404_SF100_04 B20140404_SF100_04 TB154550.[MT7]-EQAGELGQHNR.3y5_1.heavy 461.568 / 611.301 61310.0 19.470399856567383 46 16 10 10 10 2.7015239179615462 37.01614460458144 0.0 3 0.9672427978398526 6.800115072918377 61310.0 14.888343904870613 0.0 - - - - - - - 1643.888888888889 122 9 ARHGAP24 Rho GTPase activating protein 24 105 14 B20140404_SF100_04 B20140404_SF100_04 TB501635.[MT7]-MVTHTAASPALPR.3y7_1.heavy 499.277 / 711.415 28595.0 24.89259910583496 48 18 10 10 10 9.001691940961884 11.109022687718683 0.0 3 0.989607163780967 12.09535111867922 28595.0 69.92226476385503 0.0 - - - - - - - 800.4 57 10 LRP11 low density lipoprotein receptor-related protein 11 107 14 B20140404_SF100_04 B20140404_SF100_04 TB501635.[MT7]-MVTHTAASPALPR.3y6_1.heavy 499.277 / 640.378 22544.0 24.89259910583496 48 18 10 10 10 9.001691940961884 11.109022687718683 0.0 3 0.989607163780967 12.09535111867922 22544.0 35.056795482168795 0.0 - - - - - - - 829.5 45 8 LRP11 low density lipoprotein receptor-related protein 11 109 14 B20140404_SF100_04 B20140404_SF100_04 TB501635.[MT7]-MVTHTAASPALPR.3y8_1.heavy 499.277 / 782.452 20007.0 24.89259910583496 48 18 10 10 10 9.001691940961884 11.109022687718683 0.0 3 0.989607163780967 12.09535111867922 20007.0 24.77242534753818 0.0 - - - - - - - 1296.5714285714287 40 7 LRP11 low density lipoprotein receptor-related protein 11 111 14 B20140404_SF100_04 B20140404_SF100_04 TB501635.[MT7]-MVTHTAASPALPR.3y5_1.heavy 499.277 / 553.346 47821.0 24.89259910583496 48 18 10 10 10 9.001691940961884 11.109022687718683 0.0 3 0.989607163780967 12.09535111867922 47821.0 59.048139252678816 0.0 - - - - - - - 1310.7142857142858 95 7 LRP11 low density lipoprotein receptor-related protein 11 113 15 B20140404_SF100_04 B20140404_SF100_04 TB154619.[MT7]-GEGTLDLAWLK[MT7].3y3_1.heavy 497.62 / 590.378 64031.0 36.6442985534668 46 16 10 10 10 3.657598819378836 27.340341283515297 0.0 3 0.9666025865135697 6.734258618671622 64031.0 137.51370868733918 0.0 - - - - - - - 707.7142857142857 128 7 PLXNA4 plexin A4 115 15 B20140404_SF100_04 B20140404_SF100_04 TB154619.[MT7]-GEGTLDLAWLK[MT7].3b6_1.heavy 497.62 / 717.354 96695.0 36.6442985534668 46 16 10 10 10 3.657598819378836 27.340341283515297 0.0 3 0.9666025865135697 6.734258618671622 96695.0 106.0672604426447 0.0 - - - - - - - 383.5 193 4 PLXNA4 plexin A4 117 15 B20140404_SF100_04 B20140404_SF100_04 TB154619.[MT7]-GEGTLDLAWLK[MT7].3b5_1.heavy 497.62 / 602.327 9198.0 36.6442985534668 46 16 10 10 10 3.657598819378836 27.340341283515297 0.0 3 0.9666025865135697 6.734258618671622 9198.0 17.247652232424475 1.0 - - - - - - - 334.3333333333333 18 6 PLXNA4 plexin A4 119 15 B20140404_SF100_04 B20140404_SF100_04 TB154619.[MT7]-GEGTLDLAWLK[MT7].3b7_1.heavy 497.62 / 830.438 19221.0 36.6442985534668 46 16 10 10 10 3.657598819378836 27.340341283515297 0.0 3 0.9666025865135697 6.734258618671622 19221.0 92.86694761171032 0.0 - - - - - - - 222.88888888888889 38 9 PLXNA4 plexin A4 121 16 B20140404_SF100_04 B20140404_SF100_04 TB501937.[MT7]-YIIHAEQNALTFR.3y7_1.heavy 573.981 / 849.458 24581.0 31.57309913635254 46 18 10 10 8 4.617591896101372 18.04901921208623 0.0 4 0.9896083629082116 12.09605017427303 24581.0 48.27188370225827 0.0 - - - - - - - 289.55555555555554 49 9 CDADC1 cytidine and dCMP deaminase domain containing 1 123 16 B20140404_SF100_04 B20140404_SF100_04 TB501937.[MT7]-YIIHAEQNALTFR.3y6_1.heavy 573.981 / 721.399 33860.0 31.57309913635254 46 18 10 10 8 4.617591896101372 18.04901921208623 0.0 4 0.9896083629082116 12.09605017427303 33860.0 28.205340947774353 1.0 - - - - - - - 325.5 103 2 CDADC1 cytidine and dCMP deaminase domain containing 1 125 16 B20140404_SF100_04 B20140404_SF100_04 TB501937.[MT7]-YIIHAEQNALTFR.3b3_1.heavy 573.981 / 534.341 71300.0 31.57309913635254 46 18 10 10 8 4.617591896101372 18.04901921208623 0.0 4 0.9896083629082116 12.09605017427303 71300.0 39.98139897662505 0.0 - - - - - - - 488.0 142 1 CDADC1 cytidine and dCMP deaminase domain containing 1 127 16 B20140404_SF100_04 B20140404_SF100_04 TB501937.[MT7]-YIIHAEQNALTFR.3y5_1.heavy 573.981 / 607.356 26860.0 31.57309913635254 46 18 10 10 8 4.617591896101372 18.04901921208623 0.0 4 0.9896083629082116 12.09605017427303 26860.0 27.923645653868576 0.0 - - - - - - - 407.0 53 2 CDADC1 cytidine and dCMP deaminase domain containing 1 129 17 B20140404_SF100_04 B20140404_SF100_04 TB501936.[MT7]-ILELIQSGVAEGAK[MT7].3b4_1.heavy 572.676 / 613.404 454439.0 37.41469955444336 43 13 10 10 10 0.9255830402252461 71.55510752017766 0.0 3 0.9065314121001297 4.004859468375681 454439.0 132.79175967815405 0.0 - - - - - - - 353.25 908 4 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 131 17 B20140404_SF100_04 B20140404_SF100_04 TB501936.[MT7]-ILELIQSGVAEGAK[MT7].3b5_1.heavy 572.676 / 726.488 211789.0 37.41469955444336 43 13 10 10 10 0.9255830402252461 71.55510752017766 0.0 3 0.9065314121001297 4.004859468375681 211789.0 160.2746756703475 0.0 - - - - - - - 286.14285714285717 423 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 133 17 B20140404_SF100_04 B20140404_SF100_04 TB501936.[MT7]-ILELIQSGVAEGAK[MT7].3b3_1.heavy 572.676 / 500.32 212496.0 37.41469955444336 43 13 10 10 10 0.9255830402252461 71.55510752017766 0.0 3 0.9065314121001297 4.004859468375681 212496.0 113.48159389995428 0.0 - - - - - - - 854.0 424 4 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 135 17 B20140404_SF100_04 B20140404_SF100_04 TB501936.[MT7]-ILELIQSGVAEGAK[MT7].3y5_1.heavy 572.676 / 619.353 388241.0 37.41469955444336 43 13 10 10 10 0.9255830402252461 71.55510752017766 0.0 3 0.9065314121001297 4.004859468375681 388241.0 141.7683544813079 0.0 - - - - - - - 471.0 776 3 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 137 18 B20140404_SF100_04 B20140404_SF100_04 TB501734.[MT7]-LQVPTSQVR.2y8_1.heavy 586.349 / 914.505 106716.0 26.871700286865234 50 20 10 10 10 12.679672950661953 7.886638747632636 0.0 3 0.9965414179527438 20.97915920190946 106716.0 125.7201829404328 0.0 - - - - - - - 396.6666666666667 213 6 MYOT myotilin 139 18 B20140404_SF100_04 B20140404_SF100_04 TB501734.[MT7]-LQVPTSQVR.2y5_1.heavy 586.349 / 590.326 9518.0 26.871700286865234 50 20 10 10 10 12.679672950661953 7.886638747632636 0.0 3 0.9965414179527438 20.97915920190946 9518.0 15.196806722689075 0.0 - - - - - - - 758.625 19 8 MYOT myotilin 141 18 B20140404_SF100_04 B20140404_SF100_04 TB501734.[MT7]-LQVPTSQVR.2y6_1.heavy 586.349 / 687.378 262685.0 26.871700286865234 50 20 10 10 10 12.679672950661953 7.886638747632636 0.0 3 0.9965414179527438 20.97915920190946 262685.0 222.38028802450722 0.0 - - - - - - - 396.6666666666667 525 3 MYOT myotilin 143 18 B20140404_SF100_04 B20140404_SF100_04 TB501734.[MT7]-LQVPTSQVR.2y7_1.heavy 586.349 / 786.447 67337.0 26.871700286865234 50 20 10 10 10 12.679672950661953 7.886638747632636 0.0 3 0.9965414179527438 20.97915920190946 67337.0 103.29464935064935 0.0 - - - - - - - 342.125 134 8 MYOT myotilin 145 19 B20140404_SF100_04 B20140404_SF100_04 TB502107.[MT7]-GLILISPQNPLGDVYSPEELQEYLVFAK[MT7].3b6_1.heavy 1140.96 / 741.499 11890.0 42.94850158691406 45 15 10 10 10 2.6486284660403405 37.755389735540554 0.0 3 0.9570217232371749 5.931575079106798 11890.0 52.84891699027516 0.0 - - - - - - - 227.94444444444446 23 18 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 147 19 B20140404_SF100_04 B20140404_SF100_04 TB502107.[MT7]-GLILISPQNPLGDVYSPEELQEYLVFAK[MT7].3b4_1.heavy 1140.96 / 541.383 18017.0 42.94850158691406 45 15 10 10 10 2.6486284660403405 37.755389735540554 0.0 3 0.9570217232371749 5.931575079106798 18017.0 74.30898906609096 0.0 - - - - - - - 281.1666666666667 36 12 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 149 19 B20140404_SF100_04 B20140404_SF100_04 TB502107.[MT7]-GLILISPQNPLGDVYSPEELQEYLVFAK[MT7].3b5_1.heavy 1140.96 / 654.467 14175.0 42.94850158691406 45 15 10 10 10 2.6486284660403405 37.755389735540554 0.0 3 0.9570217232371749 5.931575079106798 14175.0 81.94255403687222 0.0 - - - - - - - 235.46666666666667 28 15 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 151 19 B20140404_SF100_04 B20140404_SF100_04 TB502107.[MT7]-GLILISPQNPLGDVYSPEELQEYLVFAK[MT7].3b3_1.heavy 1140.96 / 428.299 15213.0 42.94850158691406 45 15 10 10 10 2.6486284660403405 37.755389735540554 0.0 3 0.9570217232371749 5.931575079106798 15213.0 75.80766193357205 0.0 - - - - - - - 199.27777777777777 30 18 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 153 20 B20140404_SF100_04 B20140404_SF100_04 TB501533.[MT7]-EVNAPR.2b3_1.heavy 415.236 / 487.263 29143.0 19.507400512695312 42 12 10 10 10 1.1062832981111748 71.3622358875275 0.0 3 0.8933527165901533 3.7449844082484502 29143.0 50.50217806041336 0.0 - - - - - - - 792.7 58 10 SPATA9 spermatogenesis associated 9 155 20 B20140404_SF100_04 B20140404_SF100_04 TB501533.[MT7]-EVNAPR.2y5_1.heavy 415.236 / 556.32 96669.0 19.507400512695312 42 12 10 10 10 1.1062832981111748 71.3622358875275 0.0 3 0.8933527165901533 3.7449844082484502 96669.0 142.32995275162497 0.0 - - - - - - - 1212.909090909091 193 11 SPATA9 spermatogenesis associated 9 157 20 B20140404_SF100_04 B20140404_SF100_04 TB501533.[MT7]-EVNAPR.2b4_1.heavy 415.236 / 558.3 65339.0 19.507400512695312 42 12 10 10 10 1.1062832981111748 71.3622358875275 0.0 3 0.8933527165901533 3.7449844082484502 65339.0 103.98600007675353 0.0 - - - - - - - 1164.0 130 7 SPATA9 spermatogenesis associated 9 159 20 B20140404_SF100_04 B20140404_SF100_04 TB501533.[MT7]-EVNAPR.2y3_1.heavy 415.236 / 343.209 14489.0 19.507400512695312 42 12 10 10 10 1.1062832981111748 71.3622358875275 0.0 3 0.8933527165901533 3.7449844082484502 14489.0 4.627240905282783 1.0 - - - - - - - 2221.125 47 8 SPATA9 spermatogenesis associated 9 161 21 B20140404_SF100_04 B20140404_SF100_04 TB501933.[MT7]-EQLQTEQDAPAATR.3y7_1.heavy 567.956 / 701.358 74881.0 22.433425426483154 44 18 10 6 10 3.549793348106429 22.465982787104295 0.03830146789550781 3 0.9849772162576941 10.056386715876597 74881.0 99.1575905941064 0.0 - - - - - - - 735.4444444444445 149 9 RNF170 ring finger protein 170 163 21 B20140404_SF100_04 B20140404_SF100_04 TB501933.[MT7]-EQLQTEQDAPAATR.3y6_1.heavy 567.956 / 586.331 86696.0 22.433425426483154 44 18 10 6 10 3.549793348106429 22.465982787104295 0.03830146789550781 3 0.9849772162576941 10.056386715876597 86696.0 130.9371584836528 0.0 - - - - - - - 765.25 173 8 RNF170 ring finger protein 170 165 21 B20140404_SF100_04 B20140404_SF100_04 TB501933.[MT7]-EQLQTEQDAPAATR.3b4_1.heavy 567.956 / 643.353 101075.0 22.433425426483154 44 18 10 6 10 3.549793348106429 22.465982787104295 0.03830146789550781 3 0.9849772162576941 10.056386715876597 101075.0 166.8536727363629 0.0 - - - - - - - 802.0666666666667 202 15 RNF170 ring finger protein 170 167 21 B20140404_SF100_04 B20140404_SF100_04 TB501933.[MT7]-EQLQTEQDAPAATR.3y8_1.heavy 567.956 / 829.416 54950.0 22.433425426483154 44 18 10 6 10 3.549793348106429 22.465982787104295 0.03830146789550781 3 0.9849772162576941 10.056386715876597 54950.0 167.07117750439366 0.0 - - - - - - - 259.85 109 20 RNF170 ring finger protein 170 169 22 B20140404_SF100_04 B20140404_SF100_04 TB154614.[MT7]-GFGVTYQLVSK[MT7].3b4_1.heavy 496.288 / 505.289 88776.0 32.23970031738281 45 15 10 10 10 1.7294202315608818 39.98170833641519 0.0 3 0.954256843288319 5.7481718393140655 88776.0 73.39712772788066 0.0 - - - - - - - 840.5 177 2 RNF8 ring finger protein 8 171 22 B20140404_SF100_04 B20140404_SF100_04 TB154614.[MT7]-GFGVTYQLVSK[MT7].3b5_1.heavy 496.288 / 606.337 118419.0 32.23970031738281 45 15 10 10 10 1.7294202315608818 39.98170833641519 0.0 3 0.954256843288319 5.7481718393140655 118419.0 81.52617185055647 0.0 - - - - - - - 305.5 236 2 RNF8 ring finger protein 8 173 22 B20140404_SF100_04 B20140404_SF100_04 TB154614.[MT7]-GFGVTYQLVSK[MT7].3y4_1.heavy 496.288 / 590.399 100084.0 32.23970031738281 45 15 10 10 10 1.7294202315608818 39.98170833641519 0.0 3 0.954256843288319 5.7481718393140655 100084.0 140.33965137247046 0.0 - - - - - - - 306.0 200 1 RNF8 ring finger protein 8 175 22 B20140404_SF100_04 B20140404_SF100_04 TB154614.[MT7]-GFGVTYQLVSK[MT7].3b7_1.heavy 496.288 / 897.459 44617.0 32.23970031738281 45 15 10 10 10 1.7294202315608818 39.98170833641519 0.0 3 0.954256843288319 5.7481718393140655 44617.0 183.1440174672489 0.0 - - - - - - - 349.2857142857143 89 7 RNF8 ring finger protein 8 177 23 B20140404_SF100_04 B20140404_SF100_04 TB502103.[MT7]-AALPPAAPLSELHAQLSGVEQLLEEFRR.4y16_2.heavy 797.44 / 956.505 54083.0 43.72919845581055 44 14 10 10 10 1.4669382776500095 45.475107397041434 0.0 3 0.9366447458586138 4.876980742337516 54083.0 230.80997123893806 0.0 - - - - - - - 291.53333333333336 108 15 LRP11 low density lipoprotein receptor-related protein 11 179 23 B20140404_SF100_04 B20140404_SF100_04 TB502103.[MT7]-AALPPAAPLSELHAQLSGVEQLLEEFRR.4y15_2.heavy 797.44 / 887.976 53480.0 43.72919845581055 44 14 10 10 10 1.4669382776500095 45.475107397041434 0.0 3 0.9366447458586138 4.876980742337516 53480.0 192.34647980257859 0.0 - - - - - - - 226.25 106 16 LRP11 low density lipoprotein receptor-related protein 11 181 23 B20140404_SF100_04 B20140404_SF100_04 TB502103.[MT7]-AALPPAAPLSELHAQLSGVEQLLEEFRR.4y13_2.heavy 797.44 / 788.428 14325.0 43.72919845581055 44 14 10 10 10 1.4669382776500095 45.475107397041434 0.0 3 0.9366447458586138 4.876980742337516 14325.0 21.72124773960217 0.0 - - - - - - - 720.4444444444445 28 9 LRP11 low density lipoprotein receptor-related protein 11 183 23 B20140404_SF100_04 B20140404_SF100_04 TB502103.[MT7]-AALPPAAPLSELHAQLSGVEQLLEEFRR.4b6_1.heavy 797.44 / 665.41 22870.0 43.72919845581055 44 14 10 10 10 1.4669382776500095 45.475107397041434 0.0 3 0.9366447458586138 4.876980742337516 22870.0 103.1627445553949 0.0 - - - - - - - 295.7647058823529 45 17 LRP11 low density lipoprotein receptor-related protein 11 185 24 B20140404_SF100_04 B20140404_SF100_04 TB502102.[MT7]-RTYLQSEEIVAELVYSFLIPEVQK[MT7].3b8_1.heavy 1048.25 / 1151.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf15 chromosome 3 open reading frame 15 187 24 B20140404_SF100_04 B20140404_SF100_04 TB502102.[MT7]-RTYLQSEEIVAELVYSFLIPEVQK[MT7].3y5_1.heavy 1048.25 / 744.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf15 chromosome 3 open reading frame 15 189 24 B20140404_SF100_04 B20140404_SF100_04 TB502102.[MT7]-RTYLQSEEIVAELVYSFLIPEVQK[MT7].3b8_2.heavy 1048.25 / 576.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf15 chromosome 3 open reading frame 15 191 24 B20140404_SF100_04 B20140404_SF100_04 TB502102.[MT7]-RTYLQSEEIVAELVYSFLIPEVQK[MT7].3b12_2.heavy 1048.25 / 782.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf15 chromosome 3 open reading frame 15 193 25 B20140404_SF100_04 B20140404_SF100_04 TB154263.[MT7]-DFGMSGLR.2b4_1.heavy 513.762 / 595.267 6658.0 29.646400451660156 50 20 10 10 10 9.823058498361453 10.180128726371795 0.0 3 0.9971027678706803 22.922702253717297 6658.0 4.311844114800728 1.0 - - - - - - - 774.0 13 2 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 195 25 B20140404_SF100_04 B20140404_SF100_04 TB154263.[MT7]-DFGMSGLR.2b6_1.heavy 513.762 / 739.32 9755.0 29.646400451660156 50 20 10 10 10 9.823058498361453 10.180128726371795 0.0 3 0.9971027678706803 22.922702253717297 9755.0 23.588050450375263 0.0 - - - - - - - 751.8571428571429 19 7 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 197 25 B20140404_SF100_04 B20140404_SF100_04 TB154263.[MT7]-DFGMSGLR.2y6_1.heavy 513.762 / 620.318 13626.0 29.646400451660156 50 20 10 10 10 9.823058498361453 10.180128726371795 0.0 3 0.9971027678706803 22.922702253717297 13626.0 9.897820823244553 2.0 - - - - - - - 310.0 27 1 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 199 25 B20140404_SF100_04 B20140404_SF100_04 TB154263.[MT7]-DFGMSGLR.2y7_1.heavy 513.762 / 767.387 34066.0 29.646400451660156 50 20 10 10 10 9.823058498361453 10.180128726371795 0.0 3 0.9971027678706803 22.922702253717297 34066.0 53.79743345664176 0.0 - - - - - - - 774.0 68 8 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 201 26 B20140404_SF100_04 B20140404_SF100_04 TB501740.[MT7]-QSSIIIQPR.2y8_1.heavy 593.357 / 913.547 33690.0 26.93994951248169 43 17 10 6 10 4.664235760435246 21.439739570683376 0.03899955749511719 3 0.9749059885360025 7.7743651313330755 33690.0 46.93933149861918 0.0 - - - - - - - 361.0 67 4 MYOT myotilin 203 26 B20140404_SF100_04 B20140404_SF100_04 TB501740.[MT7]-QSSIIIQPR.2b4_1.heavy 593.357 / 560.316 9145.0 26.93994951248169 43 17 10 6 10 4.664235760435246 21.439739570683376 0.03899955749511719 3 0.9749059885360025 7.7743651313330755 9145.0 2.7362034574468086 2.0 - - - - - - - 1684.5714285714287 22 7 MYOT myotilin 205 26 B20140404_SF100_04 B20140404_SF100_04 TB501740.[MT7]-QSSIIIQPR.2b5_1.heavy 593.357 / 673.4 16605.0 26.93994951248169 43 17 10 6 10 4.664235760435246 21.439739570683376 0.03899955749511719 3 0.9749059885360025 7.7743651313330755 16605.0 17.18482993799489 0.0 - - - - - - - 802.3333333333334 33 9 MYOT myotilin 207 26 B20140404_SF100_04 B20140404_SF100_04 TB501740.[MT7]-QSSIIIQPR.2y7_1.heavy 593.357 / 826.515 11070.0 26.93994951248169 43 17 10 6 10 4.664235760435246 21.439739570683376 0.03899955749511719 3 0.9749059885360025 7.7743651313330755 11070.0 4.074040364068065 0.0 - - - - - - - 223.14285714285714 22 7 MYOT myotilin 209 27 B20140404_SF100_04 B20140404_SF100_04 TB154279.[MT7]-VQGEAQK[MT7].2y4_1.heavy 524.305 / 619.353 579.0 18.763900756835938 38 16 2 10 10 3.1142818921841773 32.11013115125098 0.0 3 0.9668667088184578 6.76119709300655 579.0 2.738465619261375 8.0 - - - - - - - 225.22222222222223 57 18 IQSEC2;IQSEC3;IQSEC1 IQ motif and Sec7 domain 2;IQ motif and Sec7 domain 3;IQ motif and Sec7 domain 1 211 27 B20140404_SF100_04 B20140404_SF100_04 TB154279.[MT7]-VQGEAQK[MT7].2y5_1.heavy 524.305 / 676.375 5552.0 18.763900756835938 38 16 2 10 10 3.1142818921841773 32.11013115125098 0.0 3 0.9668667088184578 6.76119709300655 5552.0 34.1366493955095 0.0 - - - - - - - 217.125 11 16 IQSEC2;IQSEC3;IQSEC1 IQ motif and Sec7 domain 2;IQ motif and Sec7 domain 3;IQ motif and Sec7 domain 1 213 27 B20140404_SF100_04 B20140404_SF100_04 TB154279.[MT7]-VQGEAQK[MT7].2b4_1.heavy 524.305 / 558.3 2607.0 18.763900756835938 38 16 2 10 10 3.1142818921841773 32.11013115125098 0.0 3 0.9668667088184578 6.76119709300655 2607.0 10.33188940092166 0.0 - - - - - - - 195.45 5 20 IQSEC2;IQSEC3;IQSEC1 IQ motif and Sec7 domain 2;IQ motif and Sec7 domain 3;IQ motif and Sec7 domain 1 215 27 B20140404_SF100_04 B20140404_SF100_04 TB154279.[MT7]-VQGEAQK[MT7].2y6_1.heavy 524.305 / 804.433 9800.0 18.763900756835938 38 16 2 10 10 3.1142818921841773 32.11013115125098 0.0 3 0.9668667088184578 6.76119709300655 9800.0 38.02960779497257 0.0 - - - - - - - 214.66666666666666 19 18 IQSEC2;IQSEC3;IQSEC1 IQ motif and Sec7 domain 2;IQ motif and Sec7 domain 3;IQ motif and Sec7 domain 1 217 28 B20140404_SF100_04 B20140404_SF100_04 TB344832.[MT7]-GLLLLC[CAM]LWLPSGR.3y6_1.heavy 547.993 / 715.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - LRP11 low density lipoprotein receptor-related protein 11 219 28 B20140404_SF100_04 B20140404_SF100_04 TB344832.[MT7]-GLLLLC[CAM]LWLPSGR.3b4_1.heavy 547.993 / 541.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - LRP11 low density lipoprotein receptor-related protein 11 221 28 B20140404_SF100_04 B20140404_SF100_04 TB344832.[MT7]-GLLLLC[CAM]LWLPSGR.3b5_1.heavy 547.993 / 654.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - LRP11 low density lipoprotein receptor-related protein 11 223 28 B20140404_SF100_04 B20140404_SF100_04 TB344832.[MT7]-GLLLLC[CAM]LWLPSGR.3y5_1.heavy 547.993 / 529.309 N/A N/A - - - - - - - - - 0.0 - - - - - - - LRP11 low density lipoprotein receptor-related protein 11 225 29 B20140404_SF100_04 B20140404_SF100_04 TB344835.[MT7]-FLFEVVPGGDRDR.3y7_1.heavy 550.962 / 772.37 97696.0 34.98360061645508 45 15 10 10 10 11.9456906058686 8.37121965563654 0.0 3 0.9546771696242791 5.774970470425701 97696.0 84.79143216178264 0.0 - - - - - - - 666.0 195 9 ARHGAP24 Rho GTPase activating protein 24 227 29 B20140404_SF100_04 B20140404_SF100_04 TB344835.[MT7]-FLFEVVPGGDRDR.3y11_2.heavy 550.962 / 623.812 101522.0 34.98360061645508 45 15 10 10 10 11.9456906058686 8.37121965563654 0.0 3 0.9546771696242791 5.774970470425701 101522.0 140.29253299082143 0.0 - - - - - - - 625.0 203 10 ARHGAP24 Rho GTPase activating protein 24 229 29 B20140404_SF100_04 B20140404_SF100_04 TB344835.[MT7]-FLFEVVPGGDRDR.3b5_1.heavy 550.962 / 780.441 107517.0 34.98360061645508 45 15 10 10 10 11.9456906058686 8.37121965563654 0.0 3 0.9546771696242791 5.774970470425701 107517.0 143.71773507705663 0.0 - - - - - - - 276.5 215 6 ARHGAP24 Rho GTPase activating protein 24 231 29 B20140404_SF100_04 B20140404_SF100_04 TB344835.[MT7]-FLFEVVPGGDRDR.3b3_1.heavy 550.962 / 552.33 59562.0 34.98360061645508 45 15 10 10 10 11.9456906058686 8.37121965563654 0.0 3 0.9546771696242791 5.774970470425701 59562.0 66.04239514123798 0.0 - - - - - - - 1184.142857142857 119 7 ARHGAP24 Rho GTPase activating protein 24 233 30 B20140404_SF100_04 B20140404_SF100_04 TB154549.[MT7]-FLFEVVPGGDR.2y8_1.heavy 690.376 / 828.421 10238.0 37.26860046386719 45 15 10 10 10 3.6344123272885325 27.514764697764875 0.0 3 0.9504771379136335 5.522690574947737 10238.0 12.299992776423355 1.0 - - - - - - - 739.4285714285714 20 7 ARHGAP24 Rho GTPase activating protein 24 235 30 B20140404_SF100_04 B20140404_SF100_04 TB154549.[MT7]-FLFEVVPGGDR.2y5_1.heavy 690.376 / 501.242 17652.0 37.26860046386719 45 15 10 10 10 3.6344123272885325 27.514764697764875 0.0 3 0.9504771379136335 5.522690574947737 17652.0 18.779370090165383 0.0 - - - - - - - 794.375 35 8 ARHGAP24 Rho GTPase activating protein 24 237 30 B20140404_SF100_04 B20140404_SF100_04 TB154549.[MT7]-FLFEVVPGGDR.2y9_1.heavy 690.376 / 975.489 9767.0 37.26860046386719 45 15 10 10 10 3.6344123272885325 27.514764697764875 0.0 3 0.9504771379136335 5.522690574947737 9767.0 17.436132014403043 0.0 - - - - - - - 274.55555555555554 19 9 ARHGAP24 Rho GTPase activating protein 24 239 30 B20140404_SF100_04 B20140404_SF100_04 TB154549.[MT7]-FLFEVVPGGDR.2y10_1.heavy 690.376 / 1088.57 7884.0 37.26860046386719 45 15 10 10 10 3.6344123272885325 27.514764697764875 0.0 3 0.9504771379136335 5.522690574947737 7884.0 19.83757281553398 0.0 - - - - - - - 255.0 15 12 ARHGAP24 Rho GTPase activating protein 24 241 31 B20140404_SF100_04 B20140404_SF100_04 TB344839.[MT7]-EQLQTEQDAPAATR.2y8_1.heavy 851.43 / 829.416 7958.0 22.423850059509277 43 17 10 6 10 2.3125686656227273 33.07909851443814 0.03830146789550781 3 0.9776470614636943 8.239156309280016 7958.0 32.605694444444445 0.0 - - - - - - - 253.8125 15 16 RNF170 ring finger protein 170 243 31 B20140404_SF100_04 B20140404_SF100_04 TB344839.[MT7]-EQLQTEQDAPAATR.2b4_1.heavy 851.43 / 643.353 15050.0 22.423850059509277 43 17 10 6 10 2.3125686656227273 33.07909851443814 0.03830146789550781 3 0.9776470614636943 8.239156309280016 15050.0 106.9189189189189 0.0 - - - - - - - 207.35 30 20 RNF170 ring finger protein 170 245 31 B20140404_SF100_04 B20140404_SF100_04 TB344839.[MT7]-EQLQTEQDAPAATR.2y6_1.heavy 851.43 / 586.331 32782.0 22.423850059509277 43 17 10 6 10 2.3125686656227273 33.07909851443814 0.03830146789550781 3 0.9776470614636943 8.239156309280016 32782.0 160.69690782225487 0.0 - - - - - - - 172.64285714285714 65 14 RNF170 ring finger protein 170 247 31 B20140404_SF100_04 B20140404_SF100_04 TB344839.[MT7]-EQLQTEQDAPAATR.2y10_1.heavy 851.43 / 1059.51 11850.0 22.423850059509277 43 17 10 6 10 2.3125686656227273 33.07909851443814 0.03830146789550781 3 0.9776470614636943 8.239156309280016 11850.0 79.94855714508894 0.0 - - - - - - - 172.72727272727272 23 11 RNF170 ring finger protein 170 249 32 B20140404_SF100_04 B20140404_SF100_04 TB154547.[MT7]-VSC[CAM]ESGQPVK[MT7].3y3_1.heavy 460.246 / 487.336 115786.0 20.966549396514893 38 16 10 6 6 4.156130021984851 24.06084493772473 0.03339958190917969 5 0.9644349651367092 6.524618649272037 115786.0 112.82855242600343 1.0 - - - - - - - 870.1428571428571 232 7 RNF8 ring finger protein 8 251 32 B20140404_SF100_04 B20140404_SF100_04 TB154547.[MT7]-VSC[CAM]ESGQPVK[MT7].3b4_1.heavy 460.246 / 620.283 30041.0 20.966549396514893 38 16 10 6 6 4.156130021984851 24.06084493772473 0.03339958190917969 5 0.9644349651367092 6.524618649272037 30041.0 62.35571975233414 0.0 - - - - - - - 342.25 60 8 RNF8 ring finger protein 8 253 32 B20140404_SF100_04 B20140404_SF100_04 TB154547.[MT7]-VSC[CAM]ESGQPVK[MT7].3b5_1.heavy 460.246 / 707.315 16218.0 20.966549396514893 38 16 10 6 6 4.156130021984851 24.06084493772473 0.03339958190917969 5 0.9644349651367092 6.524618649272037 16218.0 56.03659963436928 0.0 - - - - - - - 230.875 32 16 RNF8 ring finger protein 8 255 32 B20140404_SF100_04 B20140404_SF100_04 TB154547.[MT7]-VSC[CAM]ESGQPVK[MT7].3b3_1.heavy 460.246 / 491.24 21898.0 20.966549396514893 38 16 10 6 6 4.156130021984851 24.06084493772473 0.03339958190917969 5 0.9644349651367092 6.524618649272037 21898.0 24.615914605199187 1.0 - - - - - - - 731.6923076923077 195 13 RNF8 ring finger protein 8 257 33 B20140404_SF100_04 B20140404_SF100_04 TB344979.[MT7]-AIMDLVDEFK[MT7]DEFPTILR.4y4_1.heavy 610.831 / 502.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPATA9 spermatogenesis associated 9 259 33 B20140404_SF100_04 B20140404_SF100_04 TB344979.[MT7]-AIMDLVDEFK[MT7]DEFPTILR.4y5_1.heavy 610.831 / 599.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPATA9 spermatogenesis associated 9 261 33 B20140404_SF100_04 B20140404_SF100_04 TB344979.[MT7]-AIMDLVDEFK[MT7]DEFPTILR.4b4_1.heavy 610.831 / 575.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPATA9 spermatogenesis associated 9 263 33 B20140404_SF100_04 B20140404_SF100_04 TB344979.[MT7]-AIMDLVDEFK[MT7]DEFPTILR.4b5_1.heavy 610.831 / 688.382 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPATA9 spermatogenesis associated 9 265 34 B20140404_SF100_04 B20140404_SF100_04 TB501643.[MT7]-MAIALAK[MT7].2y4_1.heavy 503.322 / 546.373 N/A 29.694900512695312 43 17 8 10 8 2.6709978352387775 31.446025003603058 0.0 4 0.9730766704350217 7.504448002204425 36335.0 9.227722677582397 1.0 - - - - - - - 380.0 75 2 SPATA9 spermatogenesis associated 9 267 34 B20140404_SF100_04 B20140404_SF100_04 TB501643.[MT7]-MAIALAK[MT7].2y5_1.heavy 503.322 / 659.457 13378.0 29.694900512695312 43 17 8 10 8 2.6709978352387775 31.446025003603058 0.0 4 0.9730766704350217 7.504448002204425 13378.0 13.852005503955969 0.0 - - - - - - - 1715.4285714285713 26 7 SPATA9 spermatogenesis associated 9 269 34 B20140404_SF100_04 B20140404_SF100_04 TB501643.[MT7]-MAIALAK[MT7].2b4_1.heavy 503.322 / 531.308 16267.0 29.694900512695312 43 17 8 10 8 2.6709978352387775 31.446025003603058 0.0 4 0.9730766704350217 7.504448002204425 16267.0 8.177085183328781 0.0 - - - - - - - 608.0 32 1 SPATA9 spermatogenesis associated 9 271 34 B20140404_SF100_04 B20140404_SF100_04 TB501643.[MT7]-MAIALAK[MT7].2y6_1.heavy 503.322 / 730.494 21892.0 29.694900512695312 43 17 8 10 8 2.6709978352387775 31.446025003603058 0.0 4 0.9730766704350217 7.504448002204425 21892.0 37.80690789473684 1.0 - - - - - - - 152.0 98 1 SPATA9 spermatogenesis associated 9 273 35 B20140404_SF100_04 B20140404_SF100_04 TB154543.[MT7]-LLRQPC[CAM]QVLWLTVMR.3y7_1.heavy 686.393 / 918.523 5755.0 38.91419982910156 41 11 10 10 10 1.0653137766744523 54.341438848595715 0.0 3 0.8610818731949776 3.272066443796503 5755.0 23.991371681415927 1.0 - - - - - - - 269.2307692307692 11 13 LNX1 ligand of numb-protein X 1 275 35 B20140404_SF100_04 B20140404_SF100_04 TB154543.[MT7]-LLRQPC[CAM]QVLWLTVMR.3y6_1.heavy 686.393 / 805.439 12978.0 38.91419982910156 41 11 10 10 10 1.0653137766744523 54.341438848595715 0.0 3 0.8610818731949776 3.272066443796503 12978.0 27.104130114807184 0.0 - - - - - - - 662.875 25 8 LNX1 ligand of numb-protein X 1 277 35 B20140404_SF100_04 B20140404_SF100_04 TB154543.[MT7]-LLRQPC[CAM]QVLWLTVMR.3y4_1.heavy 686.393 / 506.276 7900.0 38.91419982910156 41 11 10 10 10 1.0653137766744523 54.341438848595715 0.0 3 0.8610818731949776 3.272066443796503 7900.0 21.991463414634143 0.0 - - - - - - - 361.2 15 5 LNX1 ligand of numb-protein X 1 279 35 B20140404_SF100_04 B20140404_SF100_04 TB154543.[MT7]-LLRQPC[CAM]QVLWLTVMR.3b7_2.heavy 686.393 / 520.793 20652.0 38.91419982910156 41 11 10 10 10 1.0653137766744523 54.341438848595715 0.0 3 0.8610818731949776 3.272066443796503 20652.0 53.81459491801133 0.0 - - - - - - - 688.3 41 10 LNX1 ligand of numb-protein X 1 281 36 B20140404_SF100_04 B20140404_SF100_04 TB154377.[MT7]-FFTSQVK[MT7].2y4_1.heavy 572.834 / 605.374 20752.0 29.45479965209961 50 20 10 10 10 4.193823683881719 18.92550429792785 0.0 3 0.9900598422815561 12.368166651830256 20752.0 25.757224932249322 1.0 - - - - - - - 307.25 41 4 MRO maestro 283 36 B20140404_SF100_04 B20140404_SF100_04 TB154377.[MT7]-FFTSQVK[MT7].2y5_1.heavy 572.834 / 706.422 27515.0 29.45479965209961 50 20 10 10 10 4.193823683881719 18.92550429792785 0.0 3 0.9900598422815561 12.368166651830256 27515.0 21.456886335298197 0.0 - - - - - - - 307.0 55 1 MRO maestro 285 36 B20140404_SF100_04 B20140404_SF100_04 TB154377.[MT7]-FFTSQVK[MT7].2y6_1.heavy 572.834 / 853.49 37507.0 29.45479965209961 50 20 10 10 10 4.193823683881719 18.92550429792785 0.0 3 0.9900598422815561 12.368166651830256 37507.0 51.52805495300072 0.0 - - - - - - - 345.75 75 4 MRO maestro 287 36 B20140404_SF100_04 B20140404_SF100_04 TB154377.[MT7]-FFTSQVK[MT7].2b5_1.heavy 572.834 / 755.385 11375.0 29.45479965209961 50 20 10 10 10 4.193823683881719 18.92550429792785 0.0 3 0.9900598422815561 12.368166651830256 11375.0 17.88007994043443 0.0 - - - - - - - 281.5 22 6 MRO maestro 289 37 B20140404_SF100_04 B20140404_SF100_04 TB501640.[MT7]-LDYELAEVHK[MT7].3b6_1.heavy 502.28 / 849.447 20280.0 29.309600830078125 48 18 10 10 10 5.267615397816368 18.983922030726447 0.0 3 0.9852362324944003 10.144438189486218 20280.0 55.00139082058415 0.0 - - - - - - - 698.4285714285714 40 7 C3orf15 chromosome 3 open reading frame 15 291 37 B20140404_SF100_04 B20140404_SF100_04 TB501640.[MT7]-LDYELAEVHK[MT7].3b4_1.heavy 502.28 / 665.326 51635.0 29.309600830078125 48 18 10 10 10 5.267615397816368 18.983922030726447 0.0 3 0.9852362324944003 10.144438189486218 51635.0 45.92334273211345 0.0 - - - - - - - 359.5 103 2 C3orf15 chromosome 3 open reading frame 15 293 37 B20140404_SF100_04 B20140404_SF100_04 TB501640.[MT7]-LDYELAEVHK[MT7].3b5_1.heavy 502.28 / 778.41 26465.0 29.309600830078125 48 18 10 10 10 5.267615397816368 18.983922030726447 0.0 3 0.9852362324944003 10.144438189486218 26465.0 52.999351004114445 0.0 - - - - - - - 299.6666666666667 52 12 C3orf15 chromosome 3 open reading frame 15 295 37 B20140404_SF100_04 B20140404_SF100_04 TB501640.[MT7]-LDYELAEVHK[MT7].3b3_1.heavy 502.28 / 536.284 15965.0 29.309600830078125 48 18 10 10 10 5.267615397816368 18.983922030726447 0.0 3 0.9852362324944003 10.144438189486218 15965.0 11.02321561132111 0.0 - - - - - - - 747.8 31 5 C3orf15 chromosome 3 open reading frame 15 297 38 B20140404_SF100_04 B20140404_SF100_04 TB154379.[MT7]-LTALEPSK[MT7].2b4_1.heavy 573.852 / 543.362 24485.0 28.105600357055664 20 13 0 3 4 1.6232305481351417 49.045642634927276 0.078399658203125 7 0.9271560314077303 4.544575554535576 24485.0 10.407125869366233 2.0 - - - - - - - 1432.0 101 1 RNF8 ring finger protein 8 299 38 B20140404_SF100_04 B20140404_SF100_04 TB154379.[MT7]-LTALEPSK[MT7].2y6_1.heavy 573.852 / 788.463 17755.0 28.105600357055664 20 13 0 3 4 1.6232305481351417 49.045642634927276 0.078399658203125 7 0.9271560314077303 4.544575554535576 17755.0 7.909394153762893 3.0 - - - - - - - 1765.6666666666667 128 3 RNF8 ring finger protein 8 301 38 B20140404_SF100_04 B20140404_SF100_04 TB154379.[MT7]-LTALEPSK[MT7].2b5_1.heavy 573.852 / 672.405 44101.0 28.105600357055664 20 13 0 3 4 1.6232305481351417 49.045642634927276 0.078399658203125 7 0.9271560314077303 4.544575554535576 44101.0 40.13071206829647 0.0 - - - - - - - 1677.142857142857 88 7 RNF8 ring finger protein 8 303 38 B20140404_SF100_04 B20140404_SF100_04 TB154379.[MT7]-LTALEPSK[MT7].2y7_1.heavy 573.852 / 889.511 26346.0 28.105600357055664 20 13 0 3 4 1.6232305481351417 49.045642634927276 0.078399658203125 7 0.9271560314077303 4.544575554535576 26346.0 18.395190069821567 4.0 - - - - - - - 777.2857142857143 389 7 RNF8 ring finger protein 8 305 39 B20140404_SF100_04 B20140404_SF100_04 TB154746.[MT7]-SLDESALC[CAM]IFILK[MT7].3y3_1.heavy 599.674 / 517.383 114374.0 40.29880142211914 43 13 10 10 10 1.3405226318246357 43.83053097776849 0.0 3 0.9176644062212821 4.271129164684525 114374.0 120.58800206649106 1.0 - - - - - - - 359.0 228 1 PLXNA4 plexin A4 307 39 B20140404_SF100_04 B20140404_SF100_04 TB154746.[MT7]-SLDESALC[CAM]IFILK[MT7].3b6_1.heavy 599.674 / 747.364 107102.0 40.29880142211914 43 13 10 10 10 1.3405226318246357 43.83053097776849 0.0 3 0.9176644062212821 4.271129164684525 107102.0 196.2085929033433 0.0 - - - - - - - 269.4 214 5 PLXNA4 plexin A4 309 39 B20140404_SF100_04 B20140404_SF100_04 TB154746.[MT7]-SLDESALC[CAM]IFILK[MT7].3b5_1.heavy 599.674 / 676.327 35012.0 40.29880142211914 43 13 10 10 10 1.3405226318246357 43.83053097776849 0.0 3 0.9176644062212821 4.271129164684525 35012.0 62.18786529608374 0.0 - - - - - - - 303.0 70 8 PLXNA4 plexin A4 311 39 B20140404_SF100_04 B20140404_SF100_04 TB154746.[MT7]-SLDESALC[CAM]IFILK[MT7].3y4_1.heavy 599.674 / 664.451 145885.0 40.29880142211914 43 13 10 10 10 1.3405226318246357 43.83053097776849 0.0 3 0.9176644062212821 4.271129164684525 145885.0 109.9771888637355 0.0 - - - - - - - 291.75 291 4 PLXNA4 plexin A4 313 40 B20140404_SF100_04 B20140404_SF100_04 TB154920.[MT7]-GLILISPQNPLGDVYSPEELQEYLVFAK[MT7].4b4_1.heavy 855.969 / 541.383 97200.0 42.94850158691406 45 15 10 10 10 2.733630735202916 36.58138559543853 0.0 3 0.9540248019474441 5.733534926449842 97200.0 115.9246474951178 0.0 - - - - - - - 1241.125 194 8 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 315 40 B20140404_SF100_04 B20140404_SF100_04 TB154920.[MT7]-GLILISPQNPLGDVYSPEELQEYLVFAK[MT7].4b5_1.heavy 855.969 / 654.467 80265.0 42.94850158691406 45 15 10 10 10 2.733630735202916 36.58138559543853 0.0 3 0.9540248019474441 5.733534926449842 80265.0 76.07985821545614 0.0 - - - - - - - 1185.5714285714287 160 7 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 317 40 B20140404_SF100_04 B20140404_SF100_04 TB154920.[MT7]-GLILISPQNPLGDVYSPEELQEYLVFAK[MT7].4y6_1.heavy 855.969 / 884.536 23556.0 42.94850158691406 45 15 10 10 10 2.733630735202916 36.58138559543853 0.0 3 0.9540248019474441 5.733534926449842 23556.0 82.83265151515153 0.0 - - - - - - - 315.42857142857144 47 14 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 319 40 B20140404_SF100_04 B20140404_SF100_04 TB154920.[MT7]-GLILISPQNPLGDVYSPEELQEYLVFAK[MT7].4b6_1.heavy 855.969 / 741.499 59395.0 42.94850158691406 45 15 10 10 10 2.733630735202916 36.58138559543853 0.0 3 0.9540248019474441 5.733534926449842 59395.0 112.6004915209327 0.0 - - - - - - - 744.0 118 8 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 321 41 B20140404_SF100_04 B20140404_SF100_04 TB502110.[MT7]-DADVQTDPYSPEYVVC[CAM]QDSIPELLTLATLTWGR.4b7_1.heavy 974.981 / 889.402 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf15 chromosome 3 open reading frame 15 323 41 B20140404_SF100_04 B20140404_SF100_04 TB502110.[MT7]-DADVQTDPYSPEYVVC[CAM]QDSIPELLTLATLTWGR.4y9_1.heavy 974.981 / 1018.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf15 chromosome 3 open reading frame 15 325 41 B20140404_SF100_04 B20140404_SF100_04 TB502110.[MT7]-DADVQTDPYSPEYVVC[CAM]QDSIPELLTLATLTWGR.4b4_1.heavy 974.981 / 545.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf15 chromosome 3 open reading frame 15 327 41 B20140404_SF100_04 B20140404_SF100_04 TB502110.[MT7]-DADVQTDPYSPEYVVC[CAM]QDSIPELLTLATLTWGR.4y7_1.heavy 974.981 / 804.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf15 chromosome 3 open reading frame 15 329 42 B20140404_SF100_04 B20140404_SF100_04 TB154921.[MT7]-TPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLR.4b7_1.heavy 890.75 / 800.442 177196.0 42.86869812011719 47 17 10 10 10 3.1482159118704423 25.268941779296057 0.0 3 0.9777847409385865 8.264743640229424 177196.0 362.79365391801025 0.0 - - - - - - - 318.6666666666667 354 6 MYOZ3 myozenin 3 331 42 B20140404_SF100_04 B20140404_SF100_04 TB154921.[MT7]-TPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLR.4y9_1.heavy 890.75 / 997.604 169035.0 42.86869812011719 47 17 10 10 10 3.1482159118704423 25.268941779296057 0.0 3 0.9777847409385865 8.264743640229424 169035.0 346.342876984127 0.0 - - - - - - - 217.66666666666666 338 6 MYOZ3 myozenin 3 333 42 B20140404_SF100_04 B20140404_SF100_04 TB154921.[MT7]-TPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLR.4y7_1.heavy 890.75 / 787.467 117042.0 42.86869812011719 47 17 10 10 10 3.1482159118704423 25.268941779296057 0.0 3 0.9777847409385865 8.264743640229424 117042.0 285.5053697351994 0.0 - - - - - - - 335.6 234 5 MYOZ3 myozenin 3 335 42 B20140404_SF100_04 B20140404_SF100_04 TB154921.[MT7]-TPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLR.4y23_2.heavy 890.75 / 1226.17 63184.0 42.86869812011719 47 17 10 10 10 3.1482159118704423 25.268941779296057 0.0 3 0.9777847409385865 8.264743640229424 63184.0 228.85984533445082 0.0 - - - - - - - 214.4 126 10 MYOZ3 myozenin 3 337 43 B20140404_SF100_04 B20140404_SF100_04 TB154608.[MT7]-TEVNSGFFYK[MT7].3b6_1.heavy 493.929 / 732.364 50802.0 30.906200408935547 46 18 10 10 8 4.077043568624612 24.527576984843193 0.0 4 0.9853312105159295 10.177307980379318 50802.0 28.2869714917084 0.0 - - - - - - - 359.4 101 5 CCT6B;CCT6A chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin containing TCP1, subunit 6A (zeta 1) 339 43 B20140404_SF100_04 B20140404_SF100_04 TB154608.[MT7]-TEVNSGFFYK[MT7].3y3_1.heavy 493.929 / 601.347 69914.0 30.906200408935547 46 18 10 10 8 4.077043568624612 24.527576984843193 0.0 4 0.9853312105159295 10.177307980379318 69914.0 12.617767189067418 0.0 - - - - - - - 327.0 139 1 CCT6B;CCT6A chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin containing TCP1, subunit 6A (zeta 1) 341 43 B20140404_SF100_04 B20140404_SF100_04 TB154608.[MT7]-TEVNSGFFYK[MT7].3b4_1.heavy 493.929 / 588.311 24503.0 30.906200408935547 46 18 10 10 8 4.077043568624612 24.527576984843193 0.0 4 0.9853312105159295 10.177307980379318 24503.0 12.04757472023825 1.0 - - - - - - - 490.0 131 1 CCT6B;CCT6A chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin containing TCP1, subunit 6A (zeta 1) 343 43 B20140404_SF100_04 B20140404_SF100_04 TB154608.[MT7]-TEVNSGFFYK[MT7].3b7_1.heavy 493.929 / 879.433 14212.0 30.906200408935547 46 18 10 10 8 4.077043568624612 24.527576984843193 0.0 4 0.9853312105159295 10.177307980379318 14212.0 50.72609873307121 0.0 - - - - - - - 306.25 28 8 CCT6B;CCT6A chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin containing TCP1, subunit 6A (zeta 1) 345 44 B20140404_SF100_04 B20140404_SF100_04 TB501949.[MT7]-ILGQPLSIPTSQPK[MT7].3y6_1.heavy 589.692 / 801.459 118855.0 32.436500549316406 48 18 10 10 10 7.654505946342971 13.064200446245149 0.0 3 0.9864278977609958 10.581479403778616 118855.0 86.824534390818 0.0 - - - - - - - 236.0 237 2 MRO maestro 347 44 B20140404_SF100_04 B20140404_SF100_04 TB501949.[MT7]-ILGQPLSIPTSQPK[MT7].3b4_1.heavy 589.692 / 556.357 211735.0 32.436500549316406 48 18 10 10 10 7.654505946342971 13.064200446245149 0.0 3 0.9864278977609958 10.581479403778616 211735.0 97.77159784998778 0.0 - - - - - - - 945.0 423 1 MRO maestro 349 44 B20140404_SF100_04 B20140404_SF100_04 TB501949.[MT7]-ILGQPLSIPTSQPK[MT7].3y4_1.heavy 589.692 / 603.358 36680.0 32.436500549316406 48 18 10 10 10 7.654505946342971 13.064200446245149 0.0 3 0.9864278977609958 10.581479403778616 36680.0 28.5103355077587 0.0 - - - - - - - 315.0 73 1 MRO maestro 351 44 B20140404_SF100_04 B20140404_SF100_04 TB501949.[MT7]-ILGQPLSIPTSQPK[MT7].3y5_1.heavy 589.692 / 704.406 20937.0 32.436500549316406 48 18 10 10 10 7.654505946342971 13.064200446245149 0.0 3 0.9864278977609958 10.581479403778616 20937.0 22.32268536284233 0.0 - - - - - - - 747.875 41 8 MRO maestro 353 45 B20140404_SF100_04 B20140404_SF100_04 TB154270.[MT7]-ELEQTK[MT7].2b3_1.heavy 518.3 / 516.279 12610.0 20.769800186157227 50 20 10 10 10 13.398639806745946 7.463444158686317 0.0 3 0.9981682319390547 28.83107344467432 12610.0 57.572652543907296 0.0 - - - - - - - 709.1 25 10 SUN1;RNF8 Sad1 and UNC84 domain containing 1;ring finger protein 8 355 45 B20140404_SF100_04 B20140404_SF100_04 TB154270.[MT7]-ELEQTK[MT7].2y4_1.heavy 518.3 / 649.364 11362.0 20.769800186157227 50 20 10 10 10 13.398639806745946 7.463444158686317 0.0 3 0.9981682319390547 28.83107344467432 11362.0 40.30166880616175 0.0 - - - - - - - 664.75 22 8 SUN1;RNF8 Sad1 and UNC84 domain containing 1;ring finger protein 8 357 45 B20140404_SF100_04 B20140404_SF100_04 TB154270.[MT7]-ELEQTK[MT7].2y5_1.heavy 518.3 / 762.448 21148.0 20.769800186157227 50 20 10 10 10 13.398639806745946 7.463444158686317 0.0 3 0.9981682319390547 28.83107344467432 21148.0 42.64106273095342 0.0 - - - - - - - 656.5 42 12 SUN1;RNF8 Sad1 and UNC84 domain containing 1;ring finger protein 8 359 45 B20140404_SF100_04 B20140404_SF100_04 TB154270.[MT7]-ELEQTK[MT7].2y3_1.heavy 518.3 / 520.321 9983.0 20.769800186157227 50 20 10 10 10 13.398639806745946 7.463444158686317 0.0 3 0.9981682319390547 28.83107344467432 9983.0 36.444872154265425 0.0 - - - - - - - 620.7272727272727 19 11 SUN1;RNF8 Sad1 and UNC84 domain containing 1;ring finger protein 8 361 46 B20140404_SF100_04 B20140404_SF100_04 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 2184330.0 28.842599868774414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2184330.0 350.21779017614926 0.0 - - - - - - - 422.0 4368 1 363 46 B20140404_SF100_04 B20140404_SF100_04 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 689050.0 28.842599868774414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 689050.0 195.69175144935227 0.0 - - - - - - - 986.0 1378 1 365 46 B20140404_SF100_04 B20140404_SF100_04 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 551012.0 28.842599868774414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 551012.0 236.65476344898318 0.0 - - - - - - - 563.0 1102 1 367 47 B20140404_SF100_04 B20140404_SF100_04 TB154924.[MT7]-SPNIIFADADLDYAVEQAHQGVFFNQGQC[CAM]C[CAM]TAGSR.4y9_1.heavy 1008.47 / 996.399 10702.0 38.22617530822754 43 18 10 5 10 4.2499470758074995 23.529704774264694 0.04470062255859375 3 0.9853240066689167 10.17480371971978 10702.0 16.919228832983894 0.0 - - - - - - - 222.0909090909091 21 11 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 369 47 B20140404_SF100_04 B20140404_SF100_04 TB154924.[MT7]-SPNIIFADADLDYAVEQAHQGVFFNQGQC[CAM]C[CAM]TAGSR.4b4_1.heavy 1008.47 / 556.321 30362.0 38.22617530822754 43 18 10 5 10 4.2499470758074995 23.529704774264694 0.04470062255859375 3 0.9853240066689167 10.17480371971978 30362.0 18.55278368849631 0.0 - - - - - - - 310.1666666666667 60 12 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 371 47 B20140404_SF100_04 B20140404_SF100_04 TB154924.[MT7]-SPNIIFADADLDYAVEQAHQGVFFNQGQC[CAM]C[CAM]TAGSR.4y11_1.heavy 1008.47 / 1238.5 2094.0 38.22617530822754 43 18 10 5 10 4.2499470758074995 23.529704774264694 0.04470062255859375 3 0.9853240066689167 10.17480371971978 2094.0 31.951551724137932 0.0 - - - - - - - 215.92857142857142 4 14 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 373 47 B20140404_SF100_04 B20140404_SF100_04 TB154924.[MT7]-SPNIIFADADLDYAVEQAHQGVFFNQGQC[CAM]C[CAM]TAGSR.4b5_1.heavy 1008.47 / 669.405 23848.0 38.22617530822754 43 18 10 5 10 4.2499470758074995 23.529704774264694 0.04470062255859375 3 0.9853240066689167 10.17480371971978 23848.0 54.64359475772703 0.0 - - - - - - - 648.2857142857143 47 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 375 48 B20140404_SF100_04 B20140404_SF100_04 TB501945.[MT7]-VIWGPFGGGIFGQK[MT7].3b9_1.heavy 584.334 / 1015.55 16213.0 40.110801696777344 46 16 10 10 10 3.0739085608434014 24.77976368242186 0.0 3 0.9628590395441936 6.383845691881295 16213.0 25.441209591474244 1.0 - - - - - - - 245.375 34 8 ARHGAP24 Rho GTPase activating protein 24 377 48 B20140404_SF100_04 B20140404_SF100_04 TB501945.[MT7]-VIWGPFGGGIFGQK[MT7].3b4_1.heavy 584.334 / 600.363 50705.0 40.110801696777344 46 16 10 10 10 3.0739085608434014 24.77976368242186 0.0 3 0.9628590395441936 6.383845691881295 50705.0 71.83362577180061 0.0 - - - - - - - 344.3333333333333 101 3 ARHGAP24 Rho GTPase activating protein 24 379 48 B20140404_SF100_04 B20140404_SF100_04 TB501945.[MT7]-VIWGPFGGGIFGQK[MT7].3b3_1.heavy 584.334 / 543.341 11153.0 40.110801696777344 46 16 10 10 10 3.0739085608434014 24.77976368242186 0.0 3 0.9628590395441936 6.383845691881295 11153.0 22.17867787231866 0.0 - - - - - - - 351.2 22 5 ARHGAP24 Rho GTPase activating protein 24 381 48 B20140404_SF100_04 B20140404_SF100_04 TB501945.[MT7]-VIWGPFGGGIFGQK[MT7].3y4_1.heavy 584.334 / 623.363 83442.0 40.110801696777344 46 16 10 10 10 3.0739085608434014 24.77976368242186 0.0 3 0.9628590395441936 6.383845691881295 83442.0 122.95195631415612 0.0 - - - - - - - 206.6 166 5 ARHGAP24 Rho GTPase activating protein 24 383 49 B20140404_SF100_04 B20140404_SF100_04 TB154274.[MT7]-SLQMFK[MT7].2y4_1.heavy 521.304 / 697.382 7850.0 30.323999404907227 47 17 10 10 10 2.590092810262188 38.60865510447762 0.0 3 0.9700491308092616 7.1132438137873235 7850.0 8.271407418946783 0.0 - - - - - - - 709.5714285714286 15 7 RNF8 ring finger protein 8 385 49 B20140404_SF100_04 B20140404_SF100_04 TB154274.[MT7]-SLQMFK[MT7].2y5_1.heavy 521.304 / 810.466 9132.0 30.323999404907227 47 17 10 10 10 2.590092810262188 38.60865510447762 0.0 3 0.9700491308092616 7.1132438137873235 9132.0 30.692954119850185 0.0 - - - - - - - 732.4285714285714 18 7 RNF8 ring finger protein 8 387 49 B20140404_SF100_04 B20140404_SF100_04 TB154274.[MT7]-SLQMFK[MT7].2b4_1.heavy 521.304 / 604.325 8812.0 30.323999404907227 47 17 10 10 10 2.590092810262188 38.60865510447762 0.0 3 0.9700491308092616 7.1132438137873235 8812.0 5.7804270737790535 0.0 - - - - - - - 481.0 17 1 RNF8 ring finger protein 8 389 49 B20140404_SF100_04 B20140404_SF100_04 TB154274.[MT7]-SLQMFK[MT7].2y3_1.heavy 521.304 / 569.324 12176.0 30.323999404907227 47 17 10 10 10 2.590092810262188 38.60865510447762 0.0 3 0.9700491308092616 7.1132438137873235 12176.0 12.46481897627965 0.0 - - - - - - - 373.6666666666667 24 3 RNF8 ring finger protein 8 391 50 B20140404_SF100_04 B20140404_SF100_04 TB344557.[MT7]-NPIPQPR.2b3_1.heavy 483.286 / 469.289 15454.0 23.244632720947266 40 18 10 6 6 3.4788894273870823 28.744805515450892 0.033199310302734375 5 0.9890247861157336 11.769495999490482 15454.0 3.610747663551402 3.0 - - - - - - - 925.0 34 1 C3orf15 chromosome 3 open reading frame 15 393 50 B20140404_SF100_04 B20140404_SF100_04 TB344557.[MT7]-NPIPQPR.2y4_1.heavy 483.286 / 497.283 24892.0 23.244632720947266 40 18 10 6 6 3.4788894273870823 28.744805515450892 0.033199310302734375 5 0.9890247861157336 11.769495999490482 24892.0 26.938711239918224 0.0 - - - - - - - 381.875 49 8 C3orf15 chromosome 3 open reading frame 15 395 50 B20140404_SF100_04 B20140404_SF100_04 TB344557.[MT7]-NPIPQPR.2y6_1.heavy 483.286 / 707.42 60149.0 23.244632720947266 40 18 10 6 6 3.4788894273870823 28.744805515450892 0.033199310302734375 5 0.9890247861157336 11.769495999490482 60149.0 23.435905532517573 1.0 - - - - - - - 324.0 150 2 C3orf15 chromosome 3 open reading frame 15 397 51 B20140404_SF100_04 B20140404_SF100_04 TB154601.[MT7]-AIMDLVDEFK[MT7].3y3_1.heavy 490.27 / 567.326 45472.0 39.68009948730469 43 13 10 10 10 2.3934223093493467 41.78117652257744 0.0 3 0.9290931522931845 4.606998269219459 45472.0 75.93322134144242 0.0 - - - - - - - 644.75 90 8 SPATA9 spermatogenesis associated 9 399 51 B20140404_SF100_04 B20140404_SF100_04 TB154601.[MT7]-AIMDLVDEFK[MT7].3b4_1.heavy 490.27 / 575.298 164625.0 39.68009948730469 43 13 10 10 10 2.3934223093493467 41.78117652257744 0.0 3 0.9290931522931845 4.606998269219459 164625.0 170.0623253576643 0.0 - - - - - - - 1353.4285714285713 329 7 SPATA9 spermatogenesis associated 9 401 51 B20140404_SF100_04 B20140404_SF100_04 TB154601.[MT7]-AIMDLVDEFK[MT7].3b5_1.heavy 490.27 / 688.382 111680.0 39.68009948730469 43 13 10 10 10 2.3934223093493467 41.78117652257744 0.0 3 0.9290931522931845 4.606998269219459 111680.0 344.6986637432243 0.0 - - - - - - - 255.71428571428572 223 7 SPATA9 spermatogenesis associated 9 403 51 B20140404_SF100_04 B20140404_SF100_04 TB154601.[MT7]-AIMDLVDEFK[MT7].3y4_1.heavy 490.27 / 682.353 115364.0 39.68009948730469 43 13 10 10 10 2.3934223093493467 41.78117652257744 0.0 3 0.9290931522931845 4.606998269219459 115364.0 159.18440354354928 0.0 - - - - - - - 281.0 230 3 SPATA9 spermatogenesis associated 9 405 52 B20140404_SF100_04 B20140404_SF100_04 TB154248.[MT7]-TMFSNLIHYPR.3b6_1.heavy 508.27 / 838.425 6342.0 34.15629959106445 46 16 10 10 10 3.4620475458591433 28.884640859310892 0.0 3 0.9625386895193336 6.356319342974105 6342.0 13.293496344407204 0.0 - - - - - - - 244.22222222222223 12 9 C3orf15 chromosome 3 open reading frame 15 407 52 B20140404_SF100_04 B20140404_SF100_04 TB154248.[MT7]-TMFSNLIHYPR.3b5_1.heavy 508.27 / 725.341 12036.0 34.15629959106445 46 16 10 10 10 3.4620475458591433 28.884640859310892 0.0 3 0.9625386895193336 6.356319342974105 12036.0 14.86248131126537 1.0 - - - - - - - 232.8 29 5 C3orf15 chromosome 3 open reading frame 15 409 52 B20140404_SF100_04 B20140404_SF100_04 TB154248.[MT7]-TMFSNLIHYPR.3b3_1.heavy 508.27 / 524.266 5436.0 34.15629959106445 46 16 10 10 10 3.4620475458591433 28.884640859310892 0.0 3 0.9625386895193336 6.356319342974105 5436.0 13.789484536082474 1.0 - - - - - - - 1308.7777777777778 29 9 C3orf15 chromosome 3 open reading frame 15 411 52 B20140404_SF100_04 B20140404_SF100_04 TB154248.[MT7]-TMFSNLIHYPR.3y4_1.heavy 508.27 / 572.294 23166.0 34.15629959106445 46 16 10 10 10 3.4620475458591433 28.884640859310892 0.0 3 0.9625386895193336 6.356319342974105 23166.0 20.81768101081147 0.0 - - - - - - - 690.3333333333334 46 3 C3orf15 chromosome 3 open reading frame 15 413 53 B20140404_SF100_04 B20140404_SF100_04 TB154432.[MT7]-NC[CAM]DLYFSR.2b3_1.heavy 609.788 / 534.21 26693.0 28.37969970703125 45 15 10 10 10 1.7636826037705804 45.22986027965703 0.0 3 0.9597905949132569 6.133840391963597 26693.0 13.57514701811583 0.0 - - - - - - - 717.8571428571429 53 7 CDADC1 cytidine and dCMP deaminase domain containing 1 415 53 B20140404_SF100_04 B20140404_SF100_04 TB154432.[MT7]-NC[CAM]DLYFSR.2y5_1.heavy 609.788 / 685.367 17365.0 28.37969970703125 45 15 10 10 10 1.7636826037705804 45.22986027965703 0.0 3 0.9597905949132569 6.133840391963597 17365.0 21.378513356562138 0.0 - - - - - - - 383.0 34 3 CDADC1 cytidine and dCMP deaminase domain containing 1 417 53 B20140404_SF100_04 B20140404_SF100_04 TB154432.[MT7]-NC[CAM]DLYFSR.2b4_1.heavy 609.788 / 647.294 10763.0 28.37969970703125 45 15 10 10 10 1.7636826037705804 45.22986027965703 0.0 3 0.9597905949132569 6.133840391963597 10763.0 22.50104529616725 0.0 - - - - - - - 665.3636363636364 21 11 CDADC1 cytidine and dCMP deaminase domain containing 1 419 53 B20140404_SF100_04 B20140404_SF100_04 TB154432.[MT7]-NC[CAM]DLYFSR.2y7_1.heavy 609.788 / 960.424 21383.0 28.37969970703125 45 15 10 10 10 1.7636826037705804 45.22986027965703 0.0 3 0.9597905949132569 6.133840391963597 21383.0 34.82885225635687 1.0 - - - - - - - 287.3 45 10 CDADC1 cytidine and dCMP deaminase domain containing 1 421 54 B20140404_SF100_04 B20140404_SF100_04 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 1357160.0 19.026500701904297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1357160.0 1849.7812919964326 0.0 - - - - - - - 256.0 2714 2 423 54 B20140404_SF100_04 B20140404_SF100_04 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 2741450.0 19.026500701904297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2741450.0 3397.882854268353 0.0 - - - - - - - 680.1428571428571 5482 7 425 54 B20140404_SF100_04 B20140404_SF100_04 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 976941.0 19.026500701904297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 976941.0 1632.1012065376567 0.0 - - - - - - - 358.5 1953 4 427 55 B20140404_SF100_04 B20140404_SF100_04 TB501613.[MT7]-TIAFVK[MT7].2y4_1.heavy 483.815 / 608.389 79721.0 29.1289005279541 48 18 10 10 10 6.622840872596227 15.099260562604893 0.0 3 0.9848227294522729 10.004945178359723 79721.0 56.26400921658986 0.0 - - - - - - - 868.0 159 2 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 429 55 B20140404_SF100_04 B20140404_SF100_04 TB501613.[MT7]-TIAFVK[MT7].2y5_1.heavy 483.815 / 721.473 48903.0 29.1289005279541 48 18 10 10 10 6.622840872596227 15.099260562604893 0.0 3 0.9848227294522729 10.004945178359723 48903.0 72.79110138248848 0.0 - - - - - - - 785.1428571428571 97 7 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 431 55 B20140404_SF100_04 B20140404_SF100_04 TB501613.[MT7]-TIAFVK[MT7].2b4_1.heavy 483.815 / 577.347 27490.0 29.1289005279541 48 18 10 10 10 6.622840872596227 15.099260562604893 0.0 3 0.9848227294522729 10.004945178359723 27490.0 18.69611913057906 0.0 - - - - - - - 217.0 54 2 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 433 55 B20140404_SF100_04 B20140404_SF100_04 TB501613.[MT7]-TIAFVK[MT7].2y3_1.heavy 483.815 / 537.352 64384.0 29.1289005279541 48 18 10 10 10 6.622840872596227 15.099260562604893 0.0 3 0.9848227294522729 10.004945178359723 64384.0 56.712173798551675 0.0 - - - - - - - 868.0 128 1 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 435 56 B20140404_SF100_04 B20140404_SF100_04 TB154637.[MT7]-TTGAPIYPGFPK[MT7].3b6_1.heavy 512.96 / 685.4 196299.0 31.01110076904297 48 18 10 10 10 10.767516287416527 9.287192824297385 0.0 3 0.9897807244647756 12.197807423375735 196299.0 102.35556821713459 0.0 - - - - - - - 328.0 392 1 RNF8 ring finger protein 8 437 56 B20140404_SF100_04 B20140404_SF100_04 TB154637.[MT7]-TTGAPIYPGFPK[MT7].3b5_1.heavy 512.96 / 572.316 61549.0 31.01110076904297 48 18 10 10 10 10.767516287416527 9.287192824297385 0.0 3 0.9897807244647756 12.197807423375735 61549.0 21.998530407316366 0.0 - - - - - - - 985.0 123 1 RNF8 ring finger protein 8 439 56 B20140404_SF100_04 B20140404_SF100_04 TB154637.[MT7]-TTGAPIYPGFPK[MT7].3y4_1.heavy 512.96 / 592.357 94375.0 31.01110076904297 48 18 10 10 10 10.767516287416527 9.287192824297385 0.0 3 0.9897807244647756 12.197807423375735 94375.0 40.78728201776382 0.0 - - - - - - - 492.0 188 1 RNF8 ring finger protein 8 441 56 B20140404_SF100_04 B20140404_SF100_04 TB154637.[MT7]-TTGAPIYPGFPK[MT7].3y5_1.heavy 512.96 / 689.41 181035.0 31.01110076904297 48 18 10 10 10 10.767516287416527 9.287192824297385 0.0 3 0.9897807244647756 12.197807423375735 181035.0 77.34564497294164 0.0 - - - - - - - 492.0 362 1 RNF8 ring finger protein 8 443 57 B20140404_SF100_04 B20140404_SF100_04 TB154430.[MT7]-IMDLPTLLR.2b3_1.heavy 608.366 / 504.261 5729.0 38.259700775146484 33 17 0 10 6 2.176687859416715 36.685166995564146 0.0 5 0.9700293478777954 7.110883929473935 5729.0 6.533946153915627 1.0 - - - - - - - 832.75 16 8 RNF170 ring finger protein 170 445 57 B20140404_SF100_04 B20140404_SF100_04 TB154430.[MT7]-IMDLPTLLR.2y8_1.heavy 608.366 / 958.539 3040.0 38.259700775146484 33 17 0 10 6 2.176687859416715 36.685166995564146 0.0 5 0.9700293478777954 7.110883929473935 3040.0 13.256672866428962 3.0 - - - - - - - 286.0 6 9 RNF170 ring finger protein 170 447 57 B20140404_SF100_04 B20140404_SF100_04 TB154430.[MT7]-IMDLPTLLR.2y5_1.heavy 608.366 / 599.388 N/A 38.259700775146484 33 17 0 10 6 2.176687859416715 36.685166995564146 0.0 5 0.9700293478777954 7.110883929473935 5028.0 2.676962395456634 15.0 - - - - - - - 1403.0 67 1 RNF170 ring finger protein 170 449 57 B20140404_SF100_04 B20140404_SF100_04 TB154430.[MT7]-IMDLPTLLR.2y6_1.heavy 608.366 / 712.472 6080.0 38.259700775146484 33 17 0 10 6 2.176687859416715 36.685166995564146 0.0 5 0.9700293478777954 7.110883929473935 6080.0 7.022220189109939 0.0 - - - - - - - 768.4285714285714 12 7 RNF170 ring finger protein 170 451 58 B20140404_SF100_04 B20140404_SF100_04 TB501957.[MT7]-SLDESALC[CAM]IFILK[MT7].2y4_1.heavy 899.007 / 664.451 7099.0 40.29880142211914 46 16 10 10 10 1.9226880265959916 36.67668057772258 0.0 3 0.9645069370612945 6.531270216614806 7099.0 28.730428265524623 0.0 - - - - - - - 273.93333333333334 14 15 PLXNA4 plexin A4 453 58 B20140404_SF100_04 B20140404_SF100_04 TB501957.[MT7]-SLDESALC[CAM]IFILK[MT7].2b4_1.heavy 899.007 / 589.295 7099.0 40.29880142211914 46 16 10 10 10 1.9226880265959916 36.67668057772258 0.0 3 0.9645069370612945 6.531270216614806 7099.0 16.444183878370623 0.0 - - - - - - - 280.1666666666667 14 12 PLXNA4 plexin A4 455 58 B20140404_SF100_04 B20140404_SF100_04 TB501957.[MT7]-SLDESALC[CAM]IFILK[MT7].2b6_1.heavy 899.007 / 747.364 5511.0 40.29880142211914 46 16 10 10 10 1.9226880265959916 36.67668057772258 0.0 3 0.9645069370612945 6.531270216614806 5511.0 10.681248513674197 0.0 - - - - - - - 680.4285714285714 11 7 PLXNA4 plexin A4 457 58 B20140404_SF100_04 B20140404_SF100_04 TB501957.[MT7]-SLDESALC[CAM]IFILK[MT7].2y6_1.heavy 899.007 / 937.566 4203.0 40.29880142211914 46 16 10 10 10 1.9226880265959916 36.67668057772258 0.0 3 0.9645069370612945 6.531270216614806 4203.0 10.466859930546706 1.0 - - - - - - - 249.08333333333334 8 12 PLXNA4 plexin A4 459 59 B20140404_SF100_04 B20140404_SF100_04 TB501556.[MT7]-LEMALR.2b3_1.heavy 438.758 / 518.276 11718.0 29.935400009155273 42 16 10 10 6 2.0607920207297137 38.353955107533494 0.0 5 0.9633731137885015 6.428768792627001 11718.0 5.442460783736404 0.0 - - - - - - - 793.0 23 7 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 461 59 B20140404_SF100_04 B20140404_SF100_04 TB501556.[MT7]-LEMALR.2y4_1.heavy 438.758 / 490.281 20353.0 29.935400009155273 42 16 10 10 6 2.0607920207297137 38.353955107533494 0.0 5 0.9633731137885015 6.428768792627001 20353.0 11.007694422532037 1.0 - - - - - - - 385.5 61 2 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 463 59 B20140404_SF100_04 B20140404_SF100_04 TB501556.[MT7]-LEMALR.2y5_1.heavy 438.758 / 619.323 46873.0 29.935400009155273 42 16 10 10 6 2.0607920207297137 38.353955107533494 0.0 5 0.9633731137885015 6.428768792627001 46873.0 30.012763318111293 0.0 - - - - - - - 463.0 93 1 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 465 59 B20140404_SF100_04 B20140404_SF100_04 TB501556.[MT7]-LEMALR.2b4_1.heavy 438.758 / 589.314 31300.0 29.935400009155273 42 16 10 10 6 2.0607920207297137 38.353955107533494 0.0 5 0.9633731137885015 6.428768792627001 31300.0 27.254777431712498 1.0 - - - - - - - 308.3333333333333 66 3 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 467 60 B20140404_SF100_04 B20140404_SF100_04 TB501759.[MT7]-EALIQDLER.2y8_1.heavy 615.844 / 957.536 51925.0 32.28860092163086 47 17 10 10 10 3.8619991702120466 25.893325086993585 0.0 3 0.9782354500577297 8.350196141212653 51925.0 54.858654634946674 0.0 - - - - - - - 410.875 103 8 MYOT myotilin 469 60 B20140404_SF100_04 B20140404_SF100_04 TB501759.[MT7]-EALIQDLER.2y5_1.heavy 615.844 / 660.331 32207.0 32.28860092163086 47 17 10 10 10 3.8619991702120466 25.893325086993585 0.0 3 0.9782354500577297 8.350196141212653 32207.0 28.634984705656024 0.0 - - - - - - - 780.375 64 8 MYOT myotilin 471 60 B20140404_SF100_04 B20140404_SF100_04 TB501759.[MT7]-EALIQDLER.2y6_1.heavy 615.844 / 773.415 43052.0 32.28860092163086 47 17 10 10 10 3.8619991702120466 25.893325086993585 0.0 3 0.9782354500577297 8.350196141212653 43052.0 33.40621060058206 0.0 - - - - - - - 1831.142857142857 86 7 MYOT myotilin 473 60 B20140404_SF100_04 B20140404_SF100_04 TB501759.[MT7]-EALIQDLER.2y7_1.heavy 615.844 / 886.499 21690.0 32.28860092163086 47 17 10 10 10 3.8619991702120466 25.893325086993585 0.0 3 0.9782354500577297 8.350196141212653 21690.0 29.65244238717143 0.0 - - - - - - - 365.3333333333333 43 9 MYOT myotilin 475 61 B20140404_SF100_04 B20140404_SF100_04 TB501765.[MT7]-DSLAAGASFLR.2y8_1.heavy 626.344 / 792.436 55390.0 32.436500549316406 45 15 10 10 10 2.2966256513632186 36.543798556883075 0.0 3 0.9510257802778387 5.553797474325397 55390.0 33.55383256733562 0.0 - - - - - - - 359.4 110 5 LRP11 low density lipoprotein receptor-related protein 11 477 61 B20140404_SF100_04 B20140404_SF100_04 TB501765.[MT7]-DSLAAGASFLR.2b4_1.heavy 626.344 / 531.289 54900.0 32.436500549316406 45 15 10 10 10 2.2966256513632186 36.543798556883075 0.0 3 0.9510257802778387 5.553797474325397 54900.0 33.577486775354174 0.0 - - - - - - - 490.0 109 1 LRP11 low density lipoprotein receptor-related protein 11 479 61 B20140404_SF100_04 B20140404_SF100_04 TB501765.[MT7]-DSLAAGASFLR.2y10_1.heavy 626.344 / 992.552 37744.0 32.436500549316406 45 15 10 10 10 2.2966256513632186 36.543798556883075 0.0 3 0.9510257802778387 5.553797474325397 37744.0 53.81291771450847 0.0 - - - - - - - 871.3333333333334 75 9 LRP11 low density lipoprotein receptor-related protein 11 481 61 B20140404_SF100_04 B20140404_SF100_04 TB501765.[MT7]-DSLAAGASFLR.2y7_1.heavy 626.344 / 721.399 53593.0 32.436500549316406 45 15 10 10 10 2.2966256513632186 36.543798556883075 0.0 3 0.9510257802778387 5.553797474325397 53593.0 63.29902805313243 0.0 - - - - - - - 326.6666666666667 107 3 LRP11 low density lipoprotein receptor-related protein 11 483 62 B20140404_SF100_04 B20140404_SF100_04 TB344856.[MT7]-VIWGPFGGGIFGQK[MT7].2b3_1.heavy 875.998 / 543.341 3852.0 40.134700775146484 32 7 10 5 10 0.9135227821785953 63.2394353680578 0.04779815673828125 3 0.7136602052809178 2.2488842673271376 3852.0 11.648447999999998 0.0 - - - - - - - 580.4285714285714 7 7 ARHGAP24 Rho GTPase activating protein 24 485 62 B20140404_SF100_04 B20140404_SF100_04 TB344856.[MT7]-VIWGPFGGGIFGQK[MT7].2y4_1.heavy 875.998 / 623.363 2186.0 40.134700775146484 32 7 10 5 10 0.9135227821785953 63.2394353680578 0.04779815673828125 3 0.7136602052809178 2.2488842673271376 2186.0 4.3393383137673425 1.0 - - - - - - - 758.7142857142857 5 7 ARHGAP24 Rho GTPase activating protein 24 487 62 B20140404_SF100_04 B20140404_SF100_04 TB344856.[MT7]-VIWGPFGGGIFGQK[MT7].2y8_1.heavy 875.998 / 907.512 3332.0 40.134700775146484 32 7 10 5 10 0.9135227821785953 63.2394353680578 0.04779815673828125 3 0.7136602052809178 2.2488842673271376 3332.0 7.941113651857743 0.0 - - - - - - - 265.77777777777777 6 9 ARHGAP24 Rho GTPase activating protein 24 489 62 B20140404_SF100_04 B20140404_SF100_04 TB344856.[MT7]-VIWGPFGGGIFGQK[MT7].2b4_1.heavy 875.998 / 600.363 6664.0 40.134700775146484 32 7 10 5 10 0.9135227821785953 63.2394353680578 0.04779815673828125 3 0.7136602052809178 2.2488842673271376 6664.0 7.727953128269512 0.0 - - - - - - - 338.0 13 8 ARHGAP24 Rho GTPase activating protein 24 491 63 B20140404_SF100_04 B20140404_SF100_04 TB501766.[MT7]-LLHPQLAC[CAM]R.3y6_1.heavy 417.909 / 744.382 81079.0 26.528800010681152 40 15 10 5 10 2.5327055054903607 39.48346927158389 0.04139900207519531 3 0.9534488008632003 5.697674352626028 81079.0 177.59328416086993 0.0 - - - - - - - 698.5714285714286 162 7 SPATA9 spermatogenesis associated 9 493 63 B20140404_SF100_04 B20140404_SF100_04 TB501766.[MT7]-LLHPQLAC[CAM]R.3b3_1.heavy 417.909 / 508.336 151924.0 26.528800010681152 40 15 10 5 10 2.5327055054903607 39.48346927158389 0.04139900207519531 3 0.9534488008632003 5.697674352626028 151924.0 57.84700905930757 0.0 - - - - - - - 227.0 303 1 SPATA9 spermatogenesis associated 9 495 63 B20140404_SF100_04 B20140404_SF100_04 TB501766.[MT7]-LLHPQLAC[CAM]R.3y4_1.heavy 417.909 / 519.271 450995.0 26.528800010681152 40 15 10 5 10 2.5327055054903607 39.48346927158389 0.04139900207519531 3 0.9534488008632003 5.697674352626028 450995.0 215.02166235468735 0.0 - - - - - - - 569.0 901 1 SPATA9 spermatogenesis associated 9 497 63 B20140404_SF100_04 B20140404_SF100_04 TB501766.[MT7]-LLHPQLAC[CAM]R.3y5_1.heavy 417.909 / 647.329 217879.0 26.528800010681152 40 15 10 5 10 2.5327055054903607 39.48346927158389 0.04139900207519531 3 0.9534488008632003 5.697674352626028 217879.0 213.34517605487343 0.0 - - - - - - - 341.0 435 2 SPATA9 spermatogenesis associated 9 499 64 B20140404_SF100_04 B20140404_SF100_04 TB344859.[MT7]-ILGQPLSIPTSQPK[MT7].2b4_1.heavy 884.035 / 556.357 43019.0 32.436500549316406 44 14 10 10 10 2.2062094075509324 35.12793388798383 0.0 3 0.9418708657057789 5.093764855662523 43019.0 98.48706905755492 0.0 - - - - - - - 713.0 86 7 MRO maestro 501 64 B20140404_SF100_04 B20140404_SF100_04 TB344859.[MT7]-ILGQPLSIPTSQPK[MT7].2b6_1.heavy 884.035 / 766.494 4698.0 32.436500549316406 44 14 10 10 10 2.2062094075509324 35.12793388798383 0.0 3 0.9418708657057789 5.093764855662523 4698.0 2.3333979342137363 1.0 - - - - - - - 293.57142857142856 12 7 MRO maestro 503 64 B20140404_SF100_04 B20140404_SF100_04 TB344859.[MT7]-ILGQPLSIPTSQPK[MT7].2y6_1.heavy 884.035 / 801.459 24666.0 32.436500549316406 44 14 10 10 10 2.2062094075509324 35.12793388798383 0.0 3 0.9418708657057789 5.093764855662523 24666.0 112.4353813601735 0.0 - - - - - - - 293.75 49 8 MRO maestro 505 64 B20140404_SF100_04 B20140404_SF100_04 TB344859.[MT7]-ILGQPLSIPTSQPK[MT7].2y10_1.heavy 884.035 / 1211.71 13508.0 32.436500549316406 44 14 10 10 10 2.2062094075509324 35.12793388798383 0.0 3 0.9418708657057789 5.093764855662523 13508.0 72.04684353741496 0.0 - - - - - - - 251.85714285714286 27 7 MRO maestro 507 65 B20140404_SF100_04 B20140404_SF100_04 TB154255.[MT7]-EEC[CAM]LLGR.2b3_1.heavy 510.767 / 563.225 15338.0 26.559849739074707 33 8 10 5 10 0.7777016370840001 64.4727015302885 0.041400909423828125 3 0.7940228047573606 2.671158079659842 15338.0 21.678484422932446 0.0 - - - - - - - 743.7777777777778 30 9 TSPAN18 tetraspanin 18 509 65 B20140404_SF100_04 B20140404_SF100_04 TB154255.[MT7]-EEC[CAM]LLGR.2y5_1.heavy 510.767 / 618.339 20450.0 26.559849739074707 33 8 10 5 10 0.7777016370840001 64.4727015302885 0.041400909423828125 3 0.7940228047573606 2.671158079659842 20450.0 17.179783788508693 0.0 - - - - - - - 840.0 40 10 TSPAN18 tetraspanin 18 511 65 B20140404_SF100_04 B20140404_SF100_04 TB154255.[MT7]-EEC[CAM]LLGR.2b4_1.heavy 510.767 / 676.309 65125.0 26.559849739074707 33 8 10 5 10 0.7777016370840001 64.4727015302885 0.041400909423828125 3 0.7940228047573606 2.671158079659842 65125.0 66.6159816817859 1.0 - - - - - - - 365.0 130 4 TSPAN18 tetraspanin 18 513 65 B20140404_SF100_04 B20140404_SF100_04 TB154255.[MT7]-EEC[CAM]LLGR.2y6_1.heavy 510.767 / 747.382 40779.0 26.559849739074707 33 8 10 5 10 0.7777016370840001 64.4727015302885 0.041400909423828125 3 0.7940228047573606 2.671158079659842 40779.0 49.167371856230744 0.0 - - - - - - - 1232.75 81 8 TSPAN18 tetraspanin 18 515 66 B20140404_SF100_04 B20140404_SF100_04 TB501964.[MT7]-DSLAAGASFLRAPAAVR.3y6_1.heavy 606.343 / 584.352 25962.0 32.23970031738281 44 14 10 10 10 2.7751478448275573 36.03411623145931 0.0 3 0.9309921667568075 4.670716265905665 25962.0 11.618644324893392 0.0 - - - - - - - 986.0 51 1 LRP11 low density lipoprotein receptor-related protein 11 517 66 B20140404_SF100_04 B20140404_SF100_04 TB501964.[MT7]-DSLAAGASFLRAPAAVR.3b4_1.heavy 606.343 / 531.289 28099.0 32.23970031738281 44 14 10 10 10 2.7751478448275573 36.03411623145931 0.0 3 0.9309921667568075 4.670716265905665 28099.0 17.514758661548168 0.0 - - - - - - - 657.0 56 1 LRP11 low density lipoprotein receptor-related protein 11 519 66 B20140404_SF100_04 B20140404_SF100_04 TB501964.[MT7]-DSLAAGASFLRAPAAVR.3y5_1.heavy 606.343 / 513.314 19718.0 32.23970031738281 44 14 10 10 10 2.7751478448275573 36.03411623145931 0.0 3 0.9309921667568075 4.670716265905665 19718.0 12.048268350472066 0.0 - - - - - - - 164.0 39 1 LRP11 low density lipoprotein receptor-related protein 11 521 66 B20140404_SF100_04 B20140404_SF100_04 TB501964.[MT7]-DSLAAGASFLRAPAAVR.3y16_2.heavy 606.343 / 779.447 58169.0 32.23970031738281 44 14 10 10 10 2.7751478448275573 36.03411623145931 0.0 3 0.9309921667568075 4.670716265905665 58169.0 43.51414994162424 0.0 - - - - - - - 329.0 116 1 LRP11 low density lipoprotein receptor-related protein 11 523 67 B20140404_SF100_04 B20140404_SF100_04 TB501962.[MT7]-IFVEESIYEEFVR.3y6_1.heavy 601.981 / 842.404 158191.0 39.920101165771484 50 20 10 10 10 9.081000641092414 11.012002305945256 0.0 3 0.9952506577451282 17.900847868425373 158191.0 512.4950686611503 0.0 - - - - - - - 241.5 316 4 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 525 67 B20140404_SF100_04 B20140404_SF100_04 TB501962.[MT7]-IFVEESIYEEFVR.3b4_1.heavy 601.981 / 633.373 86188.0 39.920101165771484 50 20 10 10 10 9.081000641092414 11.012002305945256 0.0 3 0.9952506577451282 17.900847868425373 86188.0 125.2266184074457 0.0 - - - - - - - 279.4 172 5 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 527 67 B20140404_SF100_04 B20140404_SF100_04 TB501962.[MT7]-IFVEESIYEEFVR.3b3_1.heavy 601.981 / 504.33 88660.0 39.920101165771484 50 20 10 10 10 9.081000641092414 11.012002305945256 0.0 3 0.9952506577451282 17.900847868425373 88660.0 137.3788172757475 0.0 - - - - - - - 322.0 177 2 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 529 67 B20140404_SF100_04 B20140404_SF100_04 TB501962.[MT7]-IFVEESIYEEFVR.3y5_1.heavy 601.981 / 679.341 113592.0 39.920101165771484 50 20 10 10 10 9.081000641092414 11.012002305945256 0.0 3 0.9952506577451282 17.900847868425373 113592.0 134.44882953033363 0.0 - - - - - - - 236.4 227 5 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 531 68 B20140404_SF100_04 B20140404_SF100_04 TB501623.[MT7]-DYQSDGR.2b3_1.heavy 492.729 / 551.258 6095.0 18.20949935913086 38 10 10 10 8 1.3395148055952188 57.19907092394668 0.0 4 0.8259388686292748 2.9140750533390847 6095.0 26.204932656371202 1.0 - - - - - - - 273.93333333333334 16 15 MYOZ3 myozenin 3 533 68 B20140404_SF100_04 B20140404_SF100_04 TB501623.[MT7]-DYQSDGR.2y5_1.heavy 492.729 / 562.258 3422.0 18.20949935913086 38 10 10 10 8 1.3395148055952188 57.19907092394668 0.0 4 0.8259388686292748 2.9140750533390847 3422.0 8.63735041199271 0.0 - - - - - - - 238.47368421052633 6 19 MYOZ3 myozenin 3 535 68 B20140404_SF100_04 B20140404_SF100_04 TB501623.[MT7]-DYQSDGR.2y6_1.heavy 492.729 / 725.321 14862.0 18.20949935913086 38 10 10 10 8 1.3395148055952188 57.19907092394668 0.0 4 0.8259388686292748 2.9140750533390847 14862.0 33.480487002122246 0.0 - - - - - - - 235.21428571428572 29 14 MYOZ3 myozenin 3 537 68 B20140404_SF100_04 B20140404_SF100_04 TB501623.[MT7]-DYQSDGR.2b5_1.heavy 492.729 / 753.317 31842.0 18.20949935913086 38 10 10 10 8 1.3395148055952188 57.19907092394668 0.0 4 0.8259388686292748 2.9140750533390847 31842.0 84.00656468836473 0.0 - - - - - - - 311.27272727272725 63 11 MYOZ3 myozenin 3 539 69 B20140404_SF100_04 B20140404_SF100_04 TB154523.[MT7]-TGHIYLGAVNR.3y7_1.heavy 448.922 / 792.436 73287.0 26.122400283813477 48 18 10 10 10 8.431441672367459 11.860367880825422 0.0 3 0.9842617201712183 9.824546224920073 73287.0 663.6272658862877 0.0 - - - - - - - 251.3 146 10 PLXNA4 plexin A4 541 69 B20140404_SF100_04 B20140404_SF100_04 TB154523.[MT7]-TGHIYLGAVNR.3y6_1.heavy 448.922 / 629.373 196786.0 26.122400283813477 48 18 10 10 10 8.431441672367459 11.860367880825422 0.0 3 0.9842617201712183 9.824546224920073 196786.0 221.84158700338315 0.0 - - - - - - - 1229.7142857142858 393 7 PLXNA4 plexin A4 543 69 B20140404_SF100_04 B20140404_SF100_04 TB154523.[MT7]-TGHIYLGAVNR.3b4_1.heavy 448.922 / 553.321 136531.0 26.122400283813477 48 18 10 10 10 8.431441672367459 11.860367880825422 0.0 3 0.9842617201712183 9.824546224920073 136531.0 104.66233057653201 0.0 - - - - - - - 299.0 273 4 PLXNA4 plexin A4 545 69 B20140404_SF100_04 B20140404_SF100_04 TB154523.[MT7]-TGHIYLGAVNR.3y5_1.heavy 448.922 / 516.289 354359.0 26.122400283813477 48 18 10 10 10 8.431441672367459 11.860367880825422 0.0 3 0.9842617201712183 9.824546224920073 354359.0 77.89599510099025 0.0 - - - - - - - 1295.5 708 6 PLXNA4 plexin A4 547 70 B20140404_SF100_04 B20140404_SF100_04 TB344958.[MT7]-IVQTC[CAM]NEPLTTTNNVNK[MT7].3y7_1.heavy 745.394 / 934.507 19877.0 26.508100509643555 50 20 10 10 10 11.932924377158693 8.380175457360155 0.0 3 0.9956635424616388 18.73431223401992 19877.0 48.62110998764184 0.0 - - - - - - - 262.07142857142856 39 14 PLXNA4 plexin A4 549 70 B20140404_SF100_04 B20140404_SF100_04 TB344958.[MT7]-IVQTC[CAM]NEPLTTTNNVNK[MT7].3y3_1.heavy 745.394 / 504.326 16683.0 26.508100509643555 50 20 10 10 10 11.932924377158693 8.380175457360155 0.0 3 0.9956635424616388 18.73431223401992 16683.0 14.094676258857998 0.0 - - - - - - - 845.2857142857143 33 7 PLXNA4 plexin A4 551 70 B20140404_SF100_04 B20140404_SF100_04 TB344958.[MT7]-IVQTC[CAM]NEPLTTTNNVNK[MT7].3b4_1.heavy 745.394 / 586.368 19286.0 26.508100509643555 50 20 10 10 10 11.932924377158693 8.380175457360155 0.0 3 0.9956635424616388 18.73431223401992 19286.0 18.170628780798207 0.0 - - - - - - - 335.1666666666667 38 6 PLXNA4 plexin A4 553 70 B20140404_SF100_04 B20140404_SF100_04 TB344958.[MT7]-IVQTC[CAM]NEPLTTTNNVNK[MT7].3b7_1.heavy 745.394 / 989.484 38453.0 26.508100509643555 50 20 10 10 10 11.932924377158693 8.380175457360155 0.0 3 0.9956635424616388 18.73431223401992 38453.0 63.57831214447285 0.0 - - - - - - - 276.1666666666667 76 6 PLXNA4 plexin A4 555 71 B20140404_SF100_04 B20140404_SF100_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 2607040.0 20.80459976196289 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2607040.0 1705.5407309492336 0.0 - - - - - - - 1126.0 5214 1 557 71 B20140404_SF100_04 B20140404_SF100_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 1644930.0 20.80459976196289 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1644930.0 1973.2982734543439 0.0 - - - - - - - 1324.6666666666667 3289 3 559 71 B20140404_SF100_04 B20140404_SF100_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 1610600.0 20.80459976196289 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1610600.0 3011.173402289279 0.0 - - - - - - - 1347.0 3221 3 561 72 B20140404_SF100_04 B20140404_SF100_04 TB154390.[MT7]-QPAPLSQK[MT7].2y5_1.heavy 578.85 / 716.442 36652.0 22.405174732208252 32 11 10 3 8 1.2110440823324247 70.71141006263863 0.07470130920410156 4 0.8661376689817285 3.3347636297478767 36652.0 67.48210989597226 0.0 - - - - - - - 718.875 73 8 PLXNA4 plexin A4 563 72 B20140404_SF100_04 B20140404_SF100_04 TB154390.[MT7]-QPAPLSQK[MT7].2y3_1.heavy 578.85 / 506.306 7438.0 22.405174732208252 32 11 10 3 8 1.2110440823324247 70.71141006263863 0.07470130920410156 4 0.8661376689817285 3.3347636297478767 7438.0 6.090487419575849 2.0 - - - - - - - 1226.857142857143 22 7 PLXNA4 plexin A4 565 72 B20140404_SF100_04 B20140404_SF100_04 TB154390.[MT7]-QPAPLSQK[MT7].2y6_1.heavy 578.85 / 787.479 4524.0 22.405174732208252 32 11 10 3 8 1.2110440823324247 70.71141006263863 0.07470130920410156 4 0.8661376689817285 3.3347636297478767 4524.0 6.465706305632173 0.0 - - - - - - - 709.25 9 8 PLXNA4 plexin A4 567 72 B20140404_SF100_04 B20140404_SF100_04 TB154390.[MT7]-QPAPLSQK[MT7].2y7_1.heavy 578.85 / 884.532 81739.0 22.405174732208252 32 11 10 3 8 1.2110440823324247 70.71141006263863 0.07470130920410156 4 0.8661376689817285 3.3347636297478767 81739.0 51.68760062734201 0.0 - - - - - - - 747.5 163 8 PLXNA4 plexin A4 569 73 B20140404_SF100_04 B20140404_SF100_04 TB154391.[MT7]-APDGAALATAR.2y8_1.heavy 579.323 / 730.421 86915.0 24.2950496673584 43 18 10 5 10 6.625636874216174 15.092888713710288 0.042301177978515625 3 0.9873741230075984 10.971691449064528 86915.0 118.09103260869566 0.0 - - - - - - - 736.4285714285714 173 7 LRP11 low density lipoprotein receptor-related protein 11 571 73 B20140404_SF100_04 B20140404_SF100_04 TB154391.[MT7]-APDGAALATAR.2y9_1.heavy 579.323 / 845.448 18731.0 24.2950496673584 43 18 10 5 10 6.625636874216174 15.092888713710288 0.042301177978515625 3 0.9873741230075984 10.971691449064528 18731.0 65.10839548219951 0.0 - - - - - - - 259.15384615384613 37 13 LRP11 low density lipoprotein receptor-related protein 11 573 73 B20140404_SF100_04 B20140404_SF100_04 TB154391.[MT7]-APDGAALATAR.2b6_1.heavy 579.323 / 627.322 11298.0 24.2950496673584 43 18 10 5 10 6.625636874216174 15.092888713710288 0.042301177978515625 3 0.9873741230075984 10.971691449064528 11298.0 35.20226869177887 0.0 - - - - - - - 360.85714285714283 22 14 LRP11 low density lipoprotein receptor-related protein 11 575 73 B20140404_SF100_04 B20140404_SF100_04 TB154391.[MT7]-APDGAALATAR.2y10_1.heavy 579.323 / 942.5 203662.0 24.2950496673584 43 18 10 5 10 6.625636874216174 15.092888713710288 0.042301177978515625 3 0.9873741230075984 10.971691449064528 203662.0 147.96590682871047 0.0 - - - - - - - 264.3333333333333 407 3 LRP11 low density lipoprotein receptor-related protein 11 577 74 B20140404_SF100_04 B20140404_SF100_04 TB154115.[MT7]-FASVFR.2y4_1.heavy 435.751 / 508.288 27606.0 31.525299072265625 47 17 10 10 10 2.1487949890832 36.497315317993575 0.0 3 0.9742956166637359 7.68111181483478 27606.0 12.492963397013435 0.0 - - - - - - - 383.3333333333333 55 3 TSPAN18 tetraspanin 18 579 74 B20140404_SF100_04 B20140404_SF100_04 TB154115.[MT7]-FASVFR.2b3_1.heavy 435.751 / 450.247 18897.0 31.525299072265625 47 17 10 10 10 2.1487949890832 36.497315317993575 0.0 3 0.9742956166637359 7.68111181483478 18897.0 18.897 0.0 - - - - - - - 328.6666666666667 37 6 TSPAN18 tetraspanin 18 581 74 B20140404_SF100_04 B20140404_SF100_04 TB154115.[MT7]-FASVFR.2y5_1.heavy 435.751 / 579.325 90376.0 31.525299072265625 47 17 10 10 10 2.1487949890832 36.497315317993575 0.0 3 0.9742956166637359 7.68111181483478 90376.0 115.28190961321008 0.0 - - - - - - - 329.0 180 5 TSPAN18 tetraspanin 18 583 74 B20140404_SF100_04 B20140404_SF100_04 TB154115.[MT7]-FASVFR.2b4_1.heavy 435.751 / 549.315 31221.0 31.525299072265625 47 17 10 10 10 2.1487949890832 36.497315317993575 0.0 3 0.9742956166637359 7.68111181483478 31221.0 48.13524314313432 0.0 - - - - - - - 383.6666666666667 62 6 TSPAN18 tetraspanin 18 585 75 B20140404_SF100_04 B20140404_SF100_04 TB154393.[MT7]-RTGLVVVK[MT7].3y3_1.heavy 387.264 / 489.352 365667.0 24.93829917907715 45 15 10 10 10 1.8357158255156 36.95302554246138 0.0 3 0.9500823711830642 5.500625180546732 365667.0 283.6279596611669 0.0 - - - - - - - 806.5 731 2 CDADC1 cytidine and dCMP deaminase domain containing 1 587 75 B20140404_SF100_04 B20140404_SF100_04 TB154393.[MT7]-RTGLVVVK[MT7].3b6_1.heavy 387.264 / 770.5 3979.0 24.93829917907715 45 15 10 10 10 1.8357158255156 36.95302554246138 0.0 3 0.9500823711830642 5.500625180546732 3979.0 10.918822770466019 1.0 - - - - - - - 215.27272727272728 9 11 CDADC1 cytidine and dCMP deaminase domain containing 1 589 75 B20140404_SF100_04 B20140404_SF100_04 TB154393.[MT7]-RTGLVVVK[MT7].3b4_1.heavy 387.264 / 572.364 308881.0 24.93829917907715 45 15 10 10 10 1.8357158255156 36.95302554246138 0.0 3 0.9500823711830642 5.500625180546732 308881.0 98.02201157384083 0.0 - - - - - - - 1183.0 617 2 CDADC1 cytidine and dCMP deaminase domain containing 1 591 75 B20140404_SF100_04 B20140404_SF100_04 TB154393.[MT7]-RTGLVVVK[MT7].3b5_1.heavy 387.264 / 671.432 225208.0 24.93829917907715 45 15 10 10 10 1.8357158255156 36.95302554246138 0.0 3 0.9500823711830642 5.500625180546732 225208.0 372.11802164136077 0.0 - - - - - - - 301.2 450 5 CDADC1 cytidine and dCMP deaminase domain containing 1 593 76 B20140404_SF100_04 B20140404_SF100_04 TB154621.[MT7]-RTSMISFFSK[MT7].3y3_1.heavy 497.946 / 525.315 74159.0 32.87820053100586 46 16 10 10 10 3.321536645509497 30.106547261850487 0.0 3 0.9651211805628858 6.588871300141237 74159.0 40.12707553511864 0.0 - - - - - - - 290.0 148 1 MRO maestro 595 76 B20140404_SF100_04 B20140404_SF100_04 TB154621.[MT7]-RTSMISFFSK[MT7].3b4_1.heavy 497.946 / 620.331 30707.0 32.87820053100586 46 16 10 10 10 3.321536645509497 30.106547261850487 0.0 3 0.9651211805628858 6.588871300141237 30707.0 46.34057626924712 1.0 - - - - - - - 1260.3 61 10 MRO maestro 597 76 B20140404_SF100_04 B20140404_SF100_04 TB154621.[MT7]-RTSMISFFSK[MT7].3y4_1.heavy 497.946 / 672.384 18685.0 32.87820053100586 46 16 10 10 10 3.321536645509497 30.106547261850487 0.0 3 0.9651211805628858 6.588871300141237 18685.0 14.468278912335006 0.0 - - - - - - - 362.5 37 4 MRO maestro 599 76 B20140404_SF100_04 B20140404_SF100_04 TB154621.[MT7]-RTSMISFFSK[MT7].3y5_1.heavy 497.946 / 759.416 20278.0 32.87820053100586 46 16 10 10 10 3.321536645509497 30.106547261850487 0.0 3 0.9651211805628858 6.588871300141237 20278.0 75.535453419699 0.0 - - - - - - - 253.75 40 8 MRO maestro 601 77 B20140404_SF100_04 B20140404_SF100_04 TB501563.[MT7]-AGGGVLNR.2b6_1.heavy 444.263 / 599.363 23734.0 22.292999267578125 46 16 10 10 10 2.967555379009572 33.69777046363839 0.0 3 0.9619210119577773 6.304226713091387 23734.0 15.6528109585991 1.0 - - - - - - - 1167.857142857143 47 7 UNC119B unc-119 homolog B (C. elegans) 603 77 B20140404_SF100_04 B20140404_SF100_04 TB501563.[MT7]-AGGGVLNR.2y6_1.heavy 444.263 / 615.357 10541.0 22.292999267578125 46 16 10 10 10 2.967555379009572 33.69777046363839 0.0 3 0.9619210119577773 6.304226713091387 10541.0 9.060467651886889 3.0 - - - - - - - 430.0 95 1 UNC119B unc-119 homolog B (C. elegans) 605 77 B20140404_SF100_04 B20140404_SF100_04 TB501563.[MT7]-AGGGVLNR.2b5_1.heavy 444.263 / 486.279 39653.0 22.292999267578125 46 16 10 10 10 2.967555379009572 33.69777046363839 0.0 3 0.9619210119577773 6.304226713091387 39653.0 29.177106626955684 0.0 - - - - - - - 1700.7142857142858 79 7 UNC119B unc-119 homolog B (C. elegans) 607 77 B20140404_SF100_04 B20140404_SF100_04 TB501563.[MT7]-AGGGVLNR.2y7_1.heavy 444.263 / 672.379 109493.0 22.292999267578125 46 16 10 10 10 2.967555379009572 33.69777046363839 0.0 3 0.9619210119577773 6.304226713091387 109493.0 154.77679443930762 0.0 - - - - - - - 1764.1 218 10 UNC119B unc-119 homolog B (C. elegans) 609 78 B20140404_SF100_04 B20140404_SF100_04 TB154250.[MT7]-DAPPLSK[MT7].2y6_1.heavy 508.305 / 756.474 22716.0 23.153600692749023 37 20 6 10 1 16.98719694849537 5.886786401735187 0.0 18 0.9947264970423015 16.987197401176886 22716.0 26.108996246236323 1.0 - - - - - - - 830.0 47 8 LRP11 low density lipoprotein receptor-related protein 11 611 78 B20140404_SF100_04 B20140404_SF100_04 TB154250.[MT7]-DAPPLSK[MT7].2y4_1.heavy 508.305 / 588.384 N/A 23.153600692749023 37 20 6 10 1 16.98719694849537 5.886786401735187 0.0 18 0.9947264970423015 16.987197401176886 31802.0 11.315313976555226 1.0 - - - - - - - 1110.7142857142858 160 7 LRP11 low density lipoprotein receptor-related protein 11 613 78 B20140404_SF100_04 B20140404_SF100_04 TB154250.[MT7]-DAPPLSK[MT7].2y5_1.heavy 508.305 / 685.437 50849.0 23.153600692749023 37 20 6 10 1 16.98719694849537 5.886786401735187 0.0 18 0.9947264970423015 16.987197401176886 50849.0 61.76983951318988 0.0 - - - - - - - 1262.111111111111 101 9 LRP11 low density lipoprotein receptor-related protein 11 615 78 B20140404_SF100_04 B20140404_SF100_04 TB154250.[MT7]-DAPPLSK[MT7].2y3_1.heavy 508.305 / 491.331 N/A 23.153600692749023 37 20 6 10 1 16.98719694849537 5.886786401735187 0.0 18 0.9947264970423015 16.987197401176886 9348.0 1.3373390557939915 7.0 - - - - - - - 3058.0 106 1 LRP11 low density lipoprotein receptor-related protein 11 617 79 B20140404_SF100_04 B20140404_SF100_04 TB501767.[MT7]-NVFFILAER.2b3_1.heavy 626.862 / 505.289 102093.0 39.68009948730469 50 20 10 10 10 12.04114295045437 8.30485946487551 0.0 3 0.9979674908903791 27.369857293008575 102093.0 158.8477379630625 0.0 - - - - - - - 390.25 204 4 MRO maestro 619 79 B20140404_SF100_04 B20140404_SF100_04 TB501767.[MT7]-NVFFILAER.2y8_1.heavy 626.862 / 994.572 99750.0 39.68009948730469 50 20 10 10 10 12.04114295045437 8.30485946487551 0.0 3 0.9979674908903791 27.369857293008575 99750.0 854.0919117647059 0.0 - - - - - - - 260.3333333333333 199 3 MRO maestro 621 79 B20140404_SF100_04 B20140404_SF100_04 TB501767.[MT7]-NVFFILAER.2y6_1.heavy 626.862 / 748.435 104994.0 39.68009948730469 50 20 10 10 10 12.04114295045437 8.30485946487551 0.0 3 0.9979674908903791 27.369857293008575 104994.0 184.95065734699872 0.0 - - - - - - - 316.3333333333333 209 6 MRO maestro 623 79 B20140404_SF100_04 B20140404_SF100_04 TB501767.[MT7]-NVFFILAER.2y7_1.heavy 626.862 / 895.504 167589.0 39.68009948730469 50 20 10 10 10 12.04114295045437 8.30485946487551 0.0 3 0.9979674908903791 27.369857293008575 167589.0 362.99836314072115 0.0 - - - - - - - 223.2 335 5 MRO maestro 625 80 B20140404_SF100_04 B20140404_SF100_04 TB501676.[MT7]-ASNSSASQR.2y8_1.heavy 526.266 / 836.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF8 ring finger protein 8 627 80 B20140404_SF100_04 B20140404_SF100_04 TB501676.[MT7]-ASNSSASQR.2y5_1.heavy 526.266 / 548.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF8 ring finger protein 8 629 80 B20140404_SF100_04 B20140404_SF100_04 TB501676.[MT7]-ASNSSASQR.2b4_1.heavy 526.266 / 504.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF8 ring finger protein 8 631 80 B20140404_SF100_04 B20140404_SF100_04 TB501676.[MT7]-ASNSSASQR.2y6_1.heavy 526.266 / 635.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF8 ring finger protein 8 633 81 B20140404_SF100_04 B20140404_SF100_04 TB154791.[MT7]-EGPELSPDDPAGLLDLR.2b3_1.heavy 969.5 / 428.226 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 635 81 B20140404_SF100_04 B20140404_SF100_04 TB154791.[MT7]-EGPELSPDDPAGLLDLR.2y4_1.heavy 969.5 / 516.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 637 81 B20140404_SF100_04 B20140404_SF100_04 TB154791.[MT7]-EGPELSPDDPAGLLDLR.2b4_1.heavy 969.5 / 557.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 639 81 B20140404_SF100_04 B20140404_SF100_04 TB154791.[MT7]-EGPELSPDDPAGLLDLR.2b5_1.heavy 969.5 / 670.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 641 82 B20140404_SF100_04 B20140404_SF100_04 TB154790.[MT7]-EGPELSPDDPAGLLDLR.3y6_1.heavy 646.669 / 686.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 643 82 B20140404_SF100_04 B20140404_SF100_04 TB154790.[MT7]-EGPELSPDDPAGLLDLR.3b4_1.heavy 646.669 / 557.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 645 82 B20140404_SF100_04 B20140404_SF100_04 TB154790.[MT7]-EGPELSPDDPAGLLDLR.3b5_1.heavy 646.669 / 670.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 647 82 B20140404_SF100_04 B20140404_SF100_04 TB154790.[MT7]-EGPELSPDDPAGLLDLR.3y4_1.heavy 646.669 / 516.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 649 83 B20140404_SF100_04 B20140404_SF100_04 TB154326.[MT7]-LSQSNQK[MT7].2y4_1.heavy 546.816 / 620.348 13918.0 19.238100051879883 48 18 10 10 10 5.214328549246323 19.177924646588284 0.0 3 0.9811028439962156 8.963504748365265 13918.0 12.32621544378529 0.0 - - - - - - - 211.92857142857142 27 14 SPATA9 spermatogenesis associated 9 651 83 B20140404_SF100_04 B20140404_SF100_04 TB154326.[MT7]-LSQSNQK[MT7].2y5_1.heavy 546.816 / 748.407 6404.0 19.238100051879883 48 18 10 10 10 5.214328549246323 19.177924646588284 0.0 3 0.9811028439962156 8.963504748365265 6404.0 36.25539939583023 0.0 - - - - - - - 196.71428571428572 12 14 SPATA9 spermatogenesis associated 9 653 83 B20140404_SF100_04 B20140404_SF100_04 TB154326.[MT7]-LSQSNQK[MT7].2y3_1.heavy 546.816 / 533.316 7197.0 19.238100051879883 48 18 10 10 10 5.214328549246323 19.177924646588284 0.0 3 0.9811028439962156 8.963504748365265 7197.0 11.358497090037659 0.0 - - - - - - - 741.0 14 8 SPATA9 spermatogenesis associated 9 655 83 B20140404_SF100_04 B20140404_SF100_04 TB154326.[MT7]-LSQSNQK[MT7].2y6_1.heavy 546.816 / 835.439 47153.0 19.238100051879883 48 18 10 10 10 5.214328549246323 19.177924646588284 0.0 3 0.9811028439962156 8.963504748365265 47153.0 70.56373350258858 0.0 - - - - - - - 180.1 94 10 SPATA9 spermatogenesis associated 9 657 84 B20140404_SF100_04 B20140404_SF100_04 TB154792.[MT7]-VLVTHETGPDEDNPK[MT7].3y7_1.heavy 647.005 / 958.46 7664.0 23.7362003326416 44 14 10 10 10 1.8958584301543637 41.89196205225192 0.0 3 0.942368139451906 5.11590991381702 7664.0 23.012010443864227 0.0 - - - - - - - 324.5 15 18 PLXNA4 plexin A4 659 84 B20140404_SF100_04 B20140404_SF100_04 TB154792.[MT7]-VLVTHETGPDEDNPK[MT7].3y3_1.heavy 647.005 / 502.311 22321.0 23.7362003326416 44 14 10 10 10 1.8958584301543637 41.89196205225192 0.0 3 0.942368139451906 5.11590991381702 22321.0 14.546634274480684 0.0 - - - - - - - 1231.7142857142858 44 7 PLXNA4 plexin A4 661 84 B20140404_SF100_04 B20140404_SF100_04 TB154792.[MT7]-VLVTHETGPDEDNPK[MT7].3b4_1.heavy 647.005 / 557.378 15424.0 23.7362003326416 44 14 10 10 10 1.8958584301543637 41.89196205225192 0.0 3 0.942368139451906 5.11590991381702 15424.0 28.649971498593082 0.0 - - - - - - - 723.8888888888889 30 9 PLXNA4 plexin A4 663 84 B20140404_SF100_04 B20140404_SF100_04 TB154792.[MT7]-VLVTHETGPDEDNPK[MT7].3y8_1.heavy 647.005 / 1015.48 11496.0 23.7362003326416 44 14 10 10 10 1.8958584301543637 41.89196205225192 0.0 3 0.942368139451906 5.11590991381702 11496.0 29.414504503337007 0.0 - - - - - - - 307.92857142857144 22 14 PLXNA4 plexin A4 665 85 B20140404_SF100_04 B20140404_SF100_04 TB501672.[MT7]-EEEAGVK[MT7].2b3_1.heavy 525.289 / 532.237 N/A 19.61829948425293 37 17 2 10 8 3.106107288414931 32.19463808380899 0.0 4 0.9786175434789176 8.424743019531878 9405.0 13.052689693235717 1.0 - - - - - - - 763.3 49 10 ARHGAP24 Rho GTPase activating protein 24 667 85 B20140404_SF100_04 B20140404_SF100_04 TB501672.[MT7]-EEEAGVK[MT7].2y4_1.heavy 525.289 / 518.342 7192.0 19.61829948425293 37 17 2 10 8 3.106107288414931 32.19463808380899 0.0 4 0.9786175434789176 8.424743019531878 7192.0 26.42354374609046 0.0 - - - - - - - 254.55 14 20 ARHGAP24 Rho GTPase activating protein 24 669 85 B20140404_SF100_04 B20140404_SF100_04 TB501672.[MT7]-EEEAGVK[MT7].2y6_1.heavy 525.289 / 776.427 8298.0 19.61829948425293 37 17 2 10 8 3.106107288414931 32.19463808380899 0.0 4 0.9786175434789176 8.424743019531878 8298.0 14.59778313253012 1.0 - - - - - - - 713.7 21 10 ARHGAP24 Rho GTPase activating protein 24 671 85 B20140404_SF100_04 B20140404_SF100_04 TB501672.[MT7]-EEEAGVK[MT7].2b5_1.heavy 525.289 / 660.296 3485.0 19.61829948425293 37 17 2 10 8 3.106107288414931 32.19463808380899 0.0 4 0.9786175434789176 8.424743019531878 3485.0 8.958948270477933 0.0 - - - - - - - 268.4 6 20 ARHGAP24 Rho GTPase activating protein 24 673 86 B20140404_SF100_04 B20140404_SF100_04 TB154323.[MT7]-NC[CAM]PHFK[MT7].3y3_1.heavy 364.195 / 575.342 40286.0 19.026500701904297 26 10 2 10 4 1.630000760946766 61.34966461114792 0.0 8 0.8333018036792474 2.9796864880716134 40286.0 48.59275787951426 0.0 - - - - - - - 678.1111111111111 80 9 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 675 86 B20140404_SF100_04 B20140404_SF100_04 TB154323.[MT7]-NC[CAM]PHFK[MT7].3b3_1.heavy 364.195 / 516.236 3883.0 19.026500701904297 26 10 2 10 4 1.630000760946766 61.34966461114792 0.0 8 0.8333018036792474 2.9796864880716134 3883.0 2.546709487077611 9.0 - - - - - - - 733.1428571428571 40 7 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 677 86 B20140404_SF100_04 B20140404_SF100_04 TB154323.[MT7]-NC[CAM]PHFK[MT7].3y4_1.heavy 364.195 / 672.395 26557.0 19.026500701904297 26 10 2 10 4 1.630000760946766 61.34966461114792 0.0 8 0.8333018036792474 2.9796864880716134 26557.0 27.23794871794872 1.0 - - - - - - - 281.05555555555554 53 18 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 679 86 B20140404_SF100_04 B20140404_SF100_04 TB154323.[MT7]-NC[CAM]PHFK[MT7].3y3_2.heavy 364.195 / 288.175 1248.0 19.026500701904297 26 10 2 10 4 1.630000760946766 61.34966461114792 0.0 8 0.8333018036792474 2.9796864880716134 1248.0 -0.23768441759168185 40.0 - - - - - - - 2210.25 164 8 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 681 87 B20140404_SF100_04 B20140404_SF100_04 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 1944610.0 33.9822998046875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1944610.0 210.42285207880573 0.0 - - - - - - - 268.0 3889 4 683 87 B20140404_SF100_04 B20140404_SF100_04 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 897935.0 33.9822998046875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 897935.0 143.11986990997286 0.0 - - - - - - - 301.5 1795 4 685 87 B20140404_SF100_04 B20140404_SF100_04 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1332320.0 33.9822998046875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1332320.0 164.83835276339912 0.0 - - - - - - - 357.3333333333333 2664 3 687 88 B20140404_SF100_04 B20140404_SF100_04 TB154324.[MT7]-EEQGLVK[MT7].2y4_1.heavy 545.821 / 560.389 15706.0 23.092424869537354 32 16 0 6 10 7.620173595775556 13.123060615763087 0.03569984436035156 3 0.9683256813053043 6.9160110973072735 15706.0 24.14750504265418 0.0 - - - - - - - 1152.5714285714287 31 7 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 689 88 B20140404_SF100_04 B20140404_SF100_04 TB154324.[MT7]-EEQGLVK[MT7].2b4_1.heavy 545.821 / 588.275 10556.0 23.092424869537354 32 16 0 6 10 7.620173595775556 13.123060615763087 0.03569984436035156 3 0.9683256813053043 6.9160110973072735 10556.0 17.052570475103188 1.0 - - - - - - - 733.3636363636364 166 11 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 691 88 B20140404_SF100_04 B20140404_SF100_04 TB154324.[MT7]-EEQGLVK[MT7].2y6_1.heavy 545.821 / 817.49 15362.0 23.092424869537354 32 16 0 6 10 7.620173595775556 13.123060615763087 0.03569984436035156 3 0.9683256813053043 6.9160110973072735 15362.0 23.257698274772757 0.0 - - - - - - - 626.7 30 10 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 693 88 B20140404_SF100_04 B20140404_SF100_04 TB154324.[MT7]-EEQGLVK[MT7].2b5_1.heavy 545.821 / 701.359 15019.0 23.092424869537354 32 16 0 6 10 7.620173595775556 13.123060615763087 0.03569984436035156 3 0.9683256813053043 6.9160110973072735 15019.0 25.56410527304315 0.0 - - - - - - - 763.0 30 9 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 695 89 B20140404_SF100_04 B20140404_SF100_04 TB501671.[MT7]-SSILVNK[MT7].2y4_1.heavy 524.834 / 617.41 26660.0 25.66510009765625 46 20 10 6 10 12.83763415277674 7.78959727391595 0.0391998291015625 3 0.996608840955367 21.186805708819882 26660.0 19.414061132935366 0.0 - - - - - - - 1859.0 53 7 LNX1 ligand of numb-protein X 1 697 89 B20140404_SF100_04 B20140404_SF100_04 TB501671.[MT7]-SSILVNK[MT7].2b4_1.heavy 524.834 / 545.341 24561.0 25.66510009765625 46 20 10 6 10 12.83763415277674 7.78959727391595 0.0391998291015625 3 0.996608840955367 21.186805708819882 24561.0 16.82271885268276 0.0 - - - - - - - 315.0 49 2 LNX1 ligand of numb-protein X 1 699 89 B20140404_SF100_04 B20140404_SF100_04 TB501671.[MT7]-SSILVNK[MT7].2y3_1.heavy 524.834 / 504.326 29809.0 25.66510009765625 46 20 10 6 10 12.83763415277674 7.78959727391595 0.0391998291015625 3 0.996608840955367 21.186805708819882 29809.0 19.429479540915047 0.0 - - - - - - - 1469.0 59 3 LNX1 ligand of numb-protein X 1 701 89 B20140404_SF100_04 B20140404_SF100_04 TB501671.[MT7]-SSILVNK[MT7].2y6_1.heavy 524.834 / 817.526 14695.0 25.66510009765625 46 20 10 6 10 12.83763415277674 7.78959727391595 0.0391998291015625 3 0.996608840955367 21.186805708819882 14695.0 27.570619047619047 0.0 - - - - - - - 795.0 29 7 LNX1 ligand of numb-protein X 1 703 90 B20140404_SF100_04 B20140404_SF100_04 TB502005.[MT7]-LQPPGPETSSFSSQTK[MT7].3y6_1.heavy 660.349 / 841.454 30738.0 27.514699935913086 46 16 10 10 10 2.6104355624534636 31.287660555849314 0.0 3 0.9647818483168563 6.55686424702379 30738.0 11.054684208543783 0.0 - - - - - - - 413.3333333333333 61 3 MYOT myotilin 705 90 B20140404_SF100_04 B20140404_SF100_04 TB502005.[MT7]-LQPPGPETSSFSSQTK[MT7].3b5_1.heavy 660.349 / 637.379 80688.0 27.514699935913086 46 16 10 10 10 2.6104355624534636 31.287660555849314 0.0 3 0.9647818483168563 6.55686424702379 80688.0 30.89592748219971 0.0 - - - - - - - 1611.0 161 1 MYOT myotilin 707 90 B20140404_SF100_04 B20140404_SF100_04 TB502005.[MT7]-LQPPGPETSSFSSQTK[MT7].3y4_1.heavy 660.349 / 607.353 53048.0 27.514699935913086 46 16 10 10 10 2.6104355624534636 31.287660555849314 0.0 3 0.9647818483168563 6.55686424702379 53048.0 11.488516854826266 0.0 - - - - - - - 1363.0 106 2 MYOT myotilin 709 90 B20140404_SF100_04 B20140404_SF100_04 TB502005.[MT7]-LQPPGPETSSFSSQTK[MT7].3y5_1.heavy 660.349 / 694.385 82671.0 27.514699935913086 46 16 10 10 10 2.6104355624534636 31.287660555849314 0.0 3 0.9647818483168563 6.55686424702379 82671.0 44.633174407756115 0.0 - - - - - - - 806.0 165 2 MYOT myotilin 711 91 B20140404_SF100_04 B20140404_SF100_04 TB154510.[MT7]-DFEAIIQAK[MT7].3b4_1.heavy 441.59 / 607.284 391630.0 32.730098724365234 47 17 10 10 10 3.083794909780379 32.427578008785865 0.0 3 0.971157780277145 7.24934269894999 391630.0 162.07260158298163 0.0 - - - - - - - 292.5 783 2 RNF8 ring finger protein 8 713 91 B20140404_SF100_04 B20140404_SF100_04 TB154510.[MT7]-DFEAIIQAK[MT7].3b5_1.heavy 441.59 / 720.369 112542.0 32.730098724365234 47 17 10 10 10 3.083794909780379 32.427578008785865 0.0 3 0.971157780277145 7.24934269894999 112542.0 165.28603644978634 0.0 - - - - - - - 366.0 225 4 RNF8 ring finger protein 8 715 91 B20140404_SF100_04 B20140404_SF100_04 TB154510.[MT7]-DFEAIIQAK[MT7].3y4_1.heavy 441.59 / 603.395 54735.0 32.730098724365234 47 17 10 10 10 3.083794909780379 32.427578008785865 0.0 3 0.971157780277145 7.24934269894999 54735.0 42.02079262635145 0.0 - - - - - - - 829.3333333333334 109 3 RNF8 ring finger protein 8 717 91 B20140404_SF100_04 B20140404_SF100_04 TB154510.[MT7]-DFEAIIQAK[MT7].3b3_1.heavy 441.59 / 536.247 132592.0 32.730098724365234 47 17 10 10 10 3.083794909780379 32.427578008785865 0.0 3 0.971157780277145 7.24934269894999 132592.0 118.73730231030612 0.0 - - - - - - - 219.5 265 2 RNF8 ring finger protein 8 719 92 B20140404_SF100_04 B20140404_SF100_04 TB154322.[MT7]-INRVDPSESLSIR.3y7_1.heavy 543.973 / 791.426 16037.0 28.05660057067871 50 20 10 10 10 2.061455988119512 35.24524955184458 0.0 3 0.9918780055886042 13.684742917636774 16037.0 18.36639664804469 1.0 - - - - - - - 1247.5714285714287 47 7 LNX1 ligand of numb-protein X 1 721 92 B20140404_SF100_04 B20140404_SF100_04 TB154322.[MT7]-INRVDPSESLSIR.3b5_1.heavy 543.973 / 742.433 20189.0 28.05660057067871 50 20 10 10 10 2.061455988119512 35.24524955184458 0.0 3 0.9918780055886042 13.684742917636774 20189.0 4.947662842741664 0.0 - - - - - - - 322.0 40 4 LNX1 ligand of numb-protein X 1 723 92 B20140404_SF100_04 B20140404_SF100_04 TB154322.[MT7]-INRVDPSESLSIR.3y8_1.heavy 543.973 / 888.479 202033.0 28.05660057067871 50 20 10 10 10 2.061455988119512 35.24524955184458 0.0 3 0.9918780055886042 13.684742917636774 202033.0 176.1616338440905 0.0 - - - - - - - 1302.9 404 10 LNX1 ligand of numb-protein X 1 725 92 B20140404_SF100_04 B20140404_SF100_04 TB154322.[MT7]-INRVDPSESLSIR.3y5_1.heavy 543.973 / 575.351 40951.0 28.05660057067871 50 20 10 10 10 2.061455988119512 35.24524955184458 0.0 3 0.9918780055886042 13.684742917636774 40951.0 23.160726214904003 0.0 - - - - - - - 430.0 81 1 LNX1 ligand of numb-protein X 1 727 93 B20140404_SF100_04 B20140404_SF100_04 TB501670.[MT7]-ASPGSAASPR.2y8_1.heavy 522.781 / 742.384 78517.0 18.55389976501465 50 20 10 10 10 4.915183211886687 20.345121573121407 0.0 3 0.9907096914550418 12.794122340787055 78517.0 427.3672971962617 0.0 - - - - - - - 221.25 157 12 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 729 93 B20140404_SF100_04 B20140404_SF100_04 TB501670.[MT7]-ASPGSAASPR.2y9_1.heavy 522.781 / 829.416 64953.0 18.55389976501465 50 20 10 10 10 4.915183211886687 20.345121573121407 0.0 3 0.9907096914550418 12.794122340787055 64953.0 551.0618911439115 0.0 - - - - - - - 217.5 129 12 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 731 93 B20140404_SF100_04 B20140404_SF100_04 TB501670.[MT7]-ASPGSAASPR.2b6_1.heavy 522.781 / 615.322 5092.0 18.55389976501465 50 20 10 10 10 4.915183211886687 20.345121573121407 0.0 3 0.9907096914550418 12.794122340787055 5092.0 37.1192523364486 0.0 - - - - - - - 188.8235294117647 10 17 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 733 93 B20140404_SF100_04 B20140404_SF100_04 TB501670.[MT7]-ASPGSAASPR.2y7_1.heavy 522.781 / 645.331 9413.0 18.55389976501465 50 20 10 10 10 4.915183211886687 20.345121573121407 0.0 3 0.9907096914550418 12.794122340787055 9413.0 75.0431648423579 0.0 - - - - - - - 157.9375 18 16 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 735 94 B20140404_SF100_04 B20140404_SF100_04 TB154650.[MT7]-EVYEDPEVTGK[MT7].3b4_1.heavy 518.603 / 665.326 37631.0 25.694499969482422 45 17 10 10 8 2.3356512737308015 32.860019493448526 0.0 4 0.9776256675529803 8.235201501554625 37631.0 46.93329120283323 1.0 - - - - - - - 746.0 93 2 C3orf15 chromosome 3 open reading frame 15 737 94 B20140404_SF100_04 B20140404_SF100_04 TB154650.[MT7]-EVYEDPEVTGK[MT7].3b5_1.heavy 518.603 / 780.353 153392.0 25.694499969482422 45 17 10 10 8 2.3356512737308015 32.860019493448526 0.0 4 0.9776256675529803 8.235201501554625 153392.0 117.39389429841975 0.0 - - - - - - - 713.8888888888889 306 9 C3orf15 chromosome 3 open reading frame 15 739 94 B20140404_SF100_04 B20140404_SF100_04 TB154650.[MT7]-EVYEDPEVTGK[MT7].3b3_1.heavy 518.603 / 536.284 26273.0 25.694499969482422 45 17 10 10 8 2.3356512737308015 32.860019493448526 0.0 4 0.9776256675529803 8.235201501554625 26273.0 27.794107044299203 1.0 - - - - - - - 764.6666666666666 75 3 C3orf15 chromosome 3 open reading frame 15 741 94 B20140404_SF100_04 B20140404_SF100_04 TB154650.[MT7]-EVYEDPEVTGK[MT7].3y4_1.heavy 518.603 / 548.352 74574.0 25.694499969482422 45 17 10 10 8 2.3356512737308015 32.860019493448526 0.0 4 0.9776256675529803 8.235201501554625 74574.0 65.75025867641486 0.0 - - - - - - - 688.0 149 2 C3orf15 chromosome 3 open reading frame 15 743 95 B20140404_SF100_04 B20140404_SF100_04 TB154329.[MT7]-C[CAM]DFIQK[MT7].2y4_1.heavy 549.796 / 679.426 12203.0 26.083900451660156 46 17 9 10 10 5.266344607813317 12.659001951326516 0.0 2 0.975691605773501 7.8995169813778405 12203.0 11.909369743540086 0.0 - - - - - - - 1657.25 24 8 CDADC1 cytidine and dCMP deaminase domain containing 1 745 95 B20140404_SF100_04 B20140404_SF100_04 TB154329.[MT7]-C[CAM]DFIQK[MT7].2b3_1.heavy 549.796 / 567.235 N/A 26.083900451660156 46 17 9 10 10 5.266344607813317 12.659001951326516 0.0 2 0.975691605773501 7.8995169813778405 6571.0 11.196592119275826 3.0 - - - - - - - 736.0909090909091 39 11 CDADC1 cytidine and dCMP deaminase domain containing 1 747 95 B20140404_SF100_04 B20140404_SF100_04 TB154329.[MT7]-C[CAM]DFIQK[MT7].2b4_1.heavy 549.796 / 680.319 16544.0 26.083900451660156 46 17 9 10 10 5.266344607813317 12.659001951326516 0.0 2 0.975691605773501 7.8995169813778405 16544.0 19.93707720113607 0.0 - - - - - - - 1190.142857142857 33 7 CDADC1 cytidine and dCMP deaminase domain containing 1 749 95 B20140404_SF100_04 B20140404_SF100_04 TB154329.[MT7]-C[CAM]DFIQK[MT7].2y3_1.heavy 549.796 / 532.357 N/A 26.083900451660156 46 17 9 10 10 5.266344607813317 12.659001951326516 0.0 2 0.975691605773501 7.8995169813778405 11616.0 5.006013634115395 1.0 - - - - - - - 1936.0 23 2 CDADC1 cytidine and dCMP deaminase domain containing 1 751 96 B20140404_SF100_04 B20140404_SF100_04 TB501779.[MT7]-C[CAM]SVAVVELPR.2y9_1.heavy 637.356 / 969.573 12989.0 30.12809944152832 41 15 6 10 10 2.1772257418425904 33.901051587128634 0.0 3 0.9566341911403855 5.904818514437089 12989.0 39.423482428115015 0.0 - - - - - - - 312.75 25 8 LRP11 low density lipoprotein receptor-related protein 11 753 96 B20140404_SF100_04 B20140404_SF100_04 TB501779.[MT7]-C[CAM]SVAVVELPR.2b4_1.heavy 637.356 / 562.278 10641.0 30.12809944152832 41 15 6 10 10 2.1772257418425904 33.901051587128634 0.0 3 0.9566341911403855 5.904818514437089 10641.0 7.812618070425481 0.0 - - - - - - - 313.0 21 2 LRP11 low density lipoprotein receptor-related protein 11 755 96 B20140404_SF100_04 B20140404_SF100_04 TB501779.[MT7]-C[CAM]SVAVVELPR.2b5_1.heavy 637.356 / 661.346 5008.0 30.12809944152832 41 15 6 10 10 2.1772257418425904 33.901051587128634 0.0 3 0.9566341911403855 5.904818514437089 5008.0 -0.32453077831736443 5.0 - - - - - - - 390.75 41 4 LRP11 low density lipoprotein receptor-related protein 11 757 96 B20140404_SF100_04 B20140404_SF100_04 TB501779.[MT7]-C[CAM]SVAVVELPR.2y7_1.heavy 637.356 / 783.472 13145.0 30.12809944152832 41 15 6 10 10 2.1772257418425904 33.901051587128634 0.0 3 0.9566341911403855 5.904818514437089 13145.0 16.563579166156174 1.0 - - - - - - - 430.0 26 4 LRP11 low density lipoprotein receptor-related protein 11 759 97 B20140404_SF100_04 B20140404_SF100_04 TB154657.[MT7]-EEIFGPVQEILR.2b3_1.heavy 787.439 / 516.279 49462.0 38.433998107910156 41 11 10 10 10 1.0047508309815862 66.66728578289927 0.0 3 0.857354995280171 3.2279813357042673 49462.0 70.52762660788078 0.0 - - - - - - - 929.0 98 3 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 761 97 B20140404_SF100_04 B20140404_SF100_04 TB154657.[MT7]-EEIFGPVQEILR.2y8_1.heavy 787.439 / 911.531 28679.0 38.433998107910156 41 11 10 10 10 1.0047508309815862 66.66728578289927 0.0 3 0.857354995280171 3.2279813357042673 28679.0 12.424248803827751 1.0 - - - - - - - 116.0 57 2 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 763 97 B20140404_SF100_04 B20140404_SF100_04 TB154657.[MT7]-EEIFGPVQEILR.2y9_1.heavy 787.439 / 1058.6 27982.0 38.433998107910156 41 11 10 10 10 1.0047508309815862 66.66728578289927 0.0 3 0.857354995280171 3.2279813357042673 27982.0 154.39279459854944 0.0 - - - - - - - 215.42857142857142 55 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 765 97 B20140404_SF100_04 B20140404_SF100_04 TB154657.[MT7]-EEIFGPVQEILR.2y10_1.heavy 787.439 / 1171.68 9869.0 38.433998107910156 41 11 10 10 10 1.0047508309815862 66.66728578289927 0.0 3 0.857354995280171 3.2279813357042673 9869.0 41.951875752403566 0.0 - - - - - - - 322.22222222222223 19 9 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 767 98 B20140404_SF100_04 B20140404_SF100_04 TB501679.[MT7]-VLLSFGK[MT7].2y4_1.heavy 526.341 / 582.337 99225.0 33.54090118408203 50 20 10 10 10 8.772369433149096 11.399428713309682 0.0 3 0.9945650973724742 16.73283752071315 99225.0 114.51936218678813 0.0 - - - - - - - 329.5 198 4 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 769 98 B20140404_SF100_04 B20140404_SF100_04 TB501679.[MT7]-VLLSFGK[MT7].2y5_1.heavy 526.341 / 695.421 65711.0 33.54090118408203 50 20 10 10 10 8.772369433149096 11.399428713309682 0.0 3 0.9945650973724742 16.73283752071315 65711.0 96.20415385369719 0.0 - - - - - - - 1233.2857142857142 131 7 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 771 98 B20140404_SF100_04 B20140404_SF100_04 TB501679.[MT7]-VLLSFGK[MT7].2b4_1.heavy 526.341 / 557.378 18586.0 33.54090118408203 50 20 10 10 10 8.772369433149096 11.399428713309682 0.0 3 0.9945650973724742 16.73283752071315 18586.0 19.788405218949205 0.0 - - - - - - - 439.0 37 2 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 773 98 B20140404_SF100_04 B20140404_SF100_04 TB501679.[MT7]-VLLSFGK[MT7].2y6_1.heavy 526.341 / 808.505 74199.0 33.54090118408203 50 20 10 10 10 8.772369433149096 11.399428713309682 0.0 3 0.9945650973724742 16.73283752071315 74199.0 136.29980488442436 0.0 - - - - - - - 334.57142857142856 148 7 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 775 99 B20140404_SF100_04 B20140404_SF100_04 TB154795.[MT7]-HAWQLTQGATVLGLFR.3b4_1.heavy 648.031 / 667.343 57056.0 37.95009994506836 47 17 10 10 10 2.6904100935478485 29.712264624933326 0.0 3 0.9799742821339503 8.706445636089159 57056.0 41.53737252300688 0.0 - - - - - - - 469.0 114 1 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 777 99 B20140404_SF100_04 B20140404_SF100_04 TB154795.[MT7]-HAWQLTQGATVLGLFR.3b3_1.heavy 648.031 / 539.285 21206.0 37.95009994506836 47 17 10 10 10 2.6904100935478485 29.712264624933326 0.0 3 0.9799742821339503 8.706445636089159 21206.0 20.814132242824797 0.0 - - - - - - - 384.7142857142857 42 7 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 779 99 B20140404_SF100_04 B20140404_SF100_04 TB154795.[MT7]-HAWQLTQGATVLGLFR.3y5_1.heavy 648.031 / 605.377 55885.0 37.95009994506836 47 17 10 10 10 2.6904100935478485 29.712264624933326 0.0 3 0.9799742821339503 8.706445636089159 55885.0 47.19513423423423 0.0 - - - - - - - 1289.0 111 7 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 781 99 B20140404_SF100_04 B20140404_SF100_04 TB154795.[MT7]-HAWQLTQGATVLGLFR.3y9_1.heavy 648.031 / 933.552 38662.0 37.95009994506836 47 17 10 10 10 2.6904100935478485 29.712264624933326 0.0 3 0.9799742821339503 8.706445636089159 38662.0 76.2409808567295 0.0 - - - - - - - 299.3333333333333 77 9 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 783 100 B20140404_SF100_04 B20140404_SF100_04 TB154130.[MT7]-GLNSISR.2y5_1.heavy 445.762 / 576.31 24127.0 23.454999923706055 36 16 2 10 8 2.4584490574802076 28.43454617623751 0.0 4 0.9652488957270786 6.601038871655143 24127.0 15.956428500751544 1.0 - - - - - - - 867.1666666666666 112 6 SPATA9 spermatogenesis associated 9 785 100 B20140404_SF100_04 B20140404_SF100_04 TB154130.[MT7]-GLNSISR.2b4_1.heavy 445.762 / 516.29 23051.0 23.454999923706055 36 16 2 10 8 2.4584490574802076 28.43454617623751 0.0 4 0.9652488957270786 6.601038871655143 23051.0 12.191325391605291 0.0 - - - - - - - 1319.5714285714287 46 7 SPATA9 spermatogenesis associated 9 787 100 B20140404_SF100_04 B20140404_SF100_04 TB154130.[MT7]-GLNSISR.2y6_1.heavy 445.762 / 689.394 24755.0 23.454999923706055 36 16 2 10 8 2.4584490574802076 28.43454617623751 0.0 4 0.9652488957270786 6.601038871655143 24755.0 32.77879270667375 0.0 - - - - - - - 816.3 49 10 SPATA9 spermatogenesis associated 9 789 100 B20140404_SF100_04 B20140404_SF100_04 TB154130.[MT7]-GLNSISR.2b5_1.heavy 445.762 / 629.374 13813.0 23.454999923706055 36 16 2 10 8 2.4584490574802076 28.43454617623751 0.0 4 0.9652488957270786 6.601038871655143 13813.0 4.338555606865235 0.0 - - - - - - - 751.25 27 8 SPATA9 spermatogenesis associated 9 791 101 B20140404_SF100_04 B20140404_SF100_04 TB344933.[MT7]-FSLDELAGPGAEGPSNLK[MT7].2y5_1.heavy 1045.55 / 702.427 3361.0 34.249823570251465 44 18 10 6 10 3.839223713049539 20.701442141477546 0.035701751708984375 3 0.9810735856949584 8.956551747325381 3361.0 14.166974551504937 0.0 - - - - - - - 238.69230769230768 6 13 RNF8 ring finger protein 8 793 101 B20140404_SF100_04 B20140404_SF100_04 TB344933.[MT7]-FSLDELAGPGAEGPSNLK[MT7].2b4_1.heavy 1045.55 / 607.321 10859.0 34.249823570251465 44 18 10 6 10 3.839223713049539 20.701442141477546 0.035701751708984375 3 0.9810735856949584 8.956551747325381 10859.0 66.97672829677984 0.0 - - - - - - - 278.6923076923077 21 13 RNF8 ring finger protein 8 795 101 B20140404_SF100_04 B20140404_SF100_04 TB344933.[MT7]-FSLDELAGPGAEGPSNLK[MT7].2y10_1.heavy 1045.55 / 1113.6 5300.0 34.249823570251465 44 18 10 6 10 3.839223713049539 20.701442141477546 0.035701751708984375 3 0.9810735856949584 8.956551747325381 5300.0 21.855670103092784 0.0 - - - - - - - 210.0625 10 16 RNF8 ring finger protein 8 797 101 B20140404_SF100_04 B20140404_SF100_04 TB344933.[MT7]-FSLDELAGPGAEGPSNLK[MT7].2b5_1.heavy 1045.55 / 736.363 10471.0 34.249823570251465 44 18 10 6 10 3.839223713049539 20.701442141477546 0.035701751708984375 3 0.9810735856949584 8.956551747325381 10471.0 26.98711340206186 0.0 - - - - - - - 249.42857142857142 20 14 RNF8 ring finger protein 8 799 102 B20140404_SF100_04 B20140404_SF100_04 TB154781.[MT7]-RVIWGPFGGGIFGQK[MT7].4y4_1.heavy 477.528 / 623.363 42062.0 36.93050003051758 44 14 10 10 10 1.0728107655067816 60.570879763378514 0.0 3 0.9421879015269661 5.107850495452547 42062.0 123.5011914893617 0.0 - - - - - - - 286.8888888888889 84 9 ARHGAP24 Rho GTPase activating protein 24 801 102 B20140404_SF100_04 B20140404_SF100_04 TB154781.[MT7]-RVIWGPFGGGIFGQK[MT7].4b10_1.heavy 477.528 / 1171.65 N/A 36.93050003051758 44 14 10 10 10 1.0728107655067816 60.570879763378514 0.0 3 0.9421879015269661 5.107850495452547 235.0 0.0 0.0 - - - - - - - 0.0 0 0 ARHGAP24 Rho GTPase activating protein 24 803 102 B20140404_SF100_04 B20140404_SF100_04 TB154781.[MT7]-RVIWGPFGGGIFGQK[MT7].4b4_1.heavy 477.528 / 699.442 7872.0 36.93050003051758 44 14 10 10 10 1.0728107655067816 60.570879763378514 0.0 3 0.9421879015269661 5.107850495452547 7872.0 43.273636363636356 0.0 - - - - - - - 249.5 15 8 ARHGAP24 Rho GTPase activating protein 24 805 102 B20140404_SF100_04 B20140404_SF100_04 TB154781.[MT7]-RVIWGPFGGGIFGQK[MT7].4b9_2.heavy 477.528 / 557.818 32310.0 36.93050003051758 44 14 10 10 10 1.0728107655067816 60.570879763378514 0.0 3 0.9421879015269661 5.107850495452547 32310.0 111.62545735997749 0.0 - - - - - - - 234.625 64 8 ARHGAP24 Rho GTPase activating protein 24 807 103 B20140404_SF100_04 B20140404_SF100_04 TB344935.[MT7]-IHGMTIPVDGDYFTFTR.3b5_1.heavy 705.355 / 684.362 7245.0 35.726600646972656 38 12 10 10 6 0.8385348842570653 78.27519360401978 0.0 5 0.8835769519238945 3.581265033334232 7245.0 5.039599371745572 1.0 - - - - - - - 1326.4 14 10 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 809 103 B20140404_SF100_04 B20140404_SF100_04 TB344935.[MT7]-IHGMTIPVDGDYFTFTR.3y4_1.heavy 705.355 / 524.283 2702.0 35.726600646972656 38 12 10 10 6 0.8385348842570653 78.27519360401978 0.0 5 0.8835769519238945 3.581265033334232 2702.0 -0.5 4.0 - - - - - - - 765.3076923076923 6 13 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 811 103 B20140404_SF100_04 B20140404_SF100_04 TB344935.[MT7]-IHGMTIPVDGDYFTFTR.3y10_1.heavy 705.355 / 1220.56 2456.0 35.726600646972656 38 12 10 10 6 0.8385348842570653 78.27519360401978 0.0 5 0.8835769519238945 3.581265033334232 2456.0 12.786303710694948 0.0 - - - - - - - 290.27272727272725 4 11 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 813 103 B20140404_SF100_04 B20140404_SF100_04 TB344935.[MT7]-IHGMTIPVDGDYFTFTR.3y9_1.heavy 705.355 / 1121.49 7614.0 35.726600646972656 38 12 10 10 6 0.8385348842570653 78.27519360401978 0.0 5 0.8835769519238945 3.581265033334232 7614.0 41.80229363629142 0.0 - - - - - - - 228.14285714285714 15 14 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 815 104 B20140404_SF100_04 B20140404_SF100_04 TB344730.[MT7]-FTFELAASQR.2y8_1.heavy 657.352 / 921.479 62797.0 33.30820083618164 50 20 10 10 10 4.170785524928701 18.93471481894716 0.0 3 0.994461540037025 16.575521919412672 62797.0 72.69490762473208 0.0 - - - - - - - 296.25 125 4 MYOZ3 myozenin 3 817 104 B20140404_SF100_04 B20140404_SF100_04 TB344730.[MT7]-FTFELAASQR.2y9_1.heavy 657.352 / 1022.53 124673.0 33.30820083618164 50 20 10 10 10 4.170785524928701 18.93471481894716 0.0 3 0.994461540037025 16.575521919412672 124673.0 212.94390158285148 0.0 - - - - - - - 329.0 249 2 MYOZ3 myozenin 3 819 104 B20140404_SF100_04 B20140404_SF100_04 TB344730.[MT7]-FTFELAASQR.2y6_1.heavy 657.352 / 645.368 83598.0 33.30820083618164 50 20 10 10 10 4.170785524928701 18.93471481894716 0.0 3 0.994461540037025 16.575521919412672 83598.0 50.18903435804702 0.0 - - - - - - - 1448.0 167 1 MYOZ3 myozenin 3 821 104 B20140404_SF100_04 B20140404_SF100_04 TB344730.[MT7]-FTFELAASQR.2y7_1.heavy 657.352 / 774.41 62271.0 33.30820083618164 50 20 10 10 10 4.170785524928701 18.93471481894716 0.0 3 0.994461540037025 16.575521919412672 62271.0 43.7047871675521 0.0 - - - - - - - 263.0 124 1 MYOZ3 myozenin 3 823 105 B20140404_SF100_04 B20140404_SF100_04 TB154501.[MT7]-RLELIQELR.3b4_1.heavy 438.606 / 656.421 99507.0 31.57309913635254 43 13 10 10 10 1.0564277820381816 57.37775229946015 0.0 3 0.9047367958246554 3.9663427548515093 99507.0 116.06090481955493 0.0 - - - - - - - 359.2 199 5 C3orf15 chromosome 3 open reading frame 15 825 105 B20140404_SF100_04 B20140404_SF100_04 TB154501.[MT7]-RLELIQELR.3y4_1.heavy 438.606 / 545.304 217477.0 31.57309913635254 43 13 10 10 10 1.0564277820381816 57.37775229946015 0.0 3 0.9047367958246554 3.9663427548515093 217477.0 228.31783946711477 0.0 - - - - - - - 490.0 434 1 C3orf15 chromosome 3 open reading frame 15 827 105 B20140404_SF100_04 B20140404_SF100_04 TB154501.[MT7]-RLELIQELR.3b3_1.heavy 438.606 / 543.337 81533.0 31.57309913635254 43 13 10 10 10 1.0564277820381816 57.37775229946015 0.0 3 0.9047367958246554 3.9663427548515093 81533.0 100.02927761812147 0.0 - - - - - - - 490.0 163 1 C3orf15 chromosome 3 open reading frame 15 829 105 B20140404_SF100_04 B20140404_SF100_04 TB154501.[MT7]-RLELIQELR.3y5_1.heavy 438.606 / 658.388 44606.0 31.57309913635254 43 13 10 10 10 1.0564277820381816 57.37775229946015 0.0 3 0.9047367958246554 3.9663427548515093 44606.0 109.22061821057451 1.0 - - - - - - - 326.6666666666667 89 6 C3orf15 chromosome 3 open reading frame 15 831 106 B20140404_SF100_04 B20140404_SF100_04 TB501780.[MT7]-QPLYNIQVR.2y8_1.heavy 637.87 / 1002.57 252052.0 29.694900512695312 47 17 10 10 10 1.3099749256832967 44.70288051826913 0.0 3 0.9786935766064204 8.4398156064515 252052.0 128.8152834273579 0.0 - - - - - - - 375.0 504 2 SPATA9 spermatogenesis associated 9 833 106 B20140404_SF100_04 B20140404_SF100_04 TB501780.[MT7]-QPLYNIQVR.2y5_1.heavy 637.87 / 629.373 81568.0 29.694900512695312 47 17 10 10 10 1.3099749256832967 44.70288051826913 0.0 3 0.9786935766064204 8.4398156064515 81568.0 21.53436488850447 0.0 - - - - - - - 1949.0 163 1 SPATA9 spermatogenesis associated 9 835 106 B20140404_SF100_04 B20140404_SF100_04 TB501780.[MT7]-QPLYNIQVR.2y6_1.heavy 637.87 / 792.436 25940.0 29.694900512695312 47 17 10 10 10 1.3099749256832967 44.70288051826913 0.0 3 0.9786935766064204 8.4398156064515 25940.0 33.802026125625346 0.0 - - - - - - - 262.5 51 4 SPATA9 spermatogenesis associated 9 837 106 B20140404_SF100_04 B20140404_SF100_04 TB501780.[MT7]-QPLYNIQVR.2y7_1.heavy 637.87 / 905.52 10346.0 29.694900512695312 47 17 10 10 10 1.3099749256832967 44.70288051826913 0.0 3 0.9786935766064204 8.4398156064515 10346.0 25.867875486381323 0.0 - - - - - - - 300.0 20 8 SPATA9 spermatogenesis associated 9 839 107 B20140404_SF100_04 B20140404_SF100_04 TB501683.[MT7]-LFVFDK[MT7].2b3_1.heavy 528.82 / 504.33 28534.0 35.27320098876953 42 18 6 10 8 6.968344430172467 14.350610966789567 0.0 4 0.9825022726438014 9.316145054318905 28534.0 29.465654286451922 0.0 - - - - - - - 703.2222222222222 57 9 RANBP3 RAN binding protein 3 841 107 B20140404_SF100_04 B20140404_SF100_04 TB501683.[MT7]-LFVFDK[MT7].2y4_1.heavy 528.82 / 652.379 29826.0 35.27320098876953 42 18 6 10 8 6.968344430172467 14.350610966789567 0.0 4 0.9825022726438014 9.316145054318905 29826.0 39.2779014084507 0.0 - - - - - - - 1291.0 59 9 RANBP3 RAN binding protein 3 843 107 B20140404_SF100_04 B20140404_SF100_04 TB501683.[MT7]-LFVFDK[MT7].2y5_1.heavy 528.82 / 799.447 55261.0 35.27320098876953 42 18 6 10 8 6.968344430172467 14.350610966789567 0.0 4 0.9825022726438014 9.316145054318905 55261.0 71.94472873384888 1.0 - - - - - - - 1239.4 175 10 RANBP3 RAN binding protein 3 845 107 B20140404_SF100_04 B20140404_SF100_04 TB501683.[MT7]-LFVFDK[MT7].2y3_1.heavy 528.82 / 553.31 52421.0 35.27320098876953 42 18 6 10 8 6.968344430172467 14.350610966789567 0.0 4 0.9825022726438014 9.316145054318905 52421.0 38.809905096748196 0.0 - - - - - - - 738.0 104 7 RANBP3 RAN binding protein 3 847 108 B20140404_SF100_04 B20140404_SF100_04 TB154335.[MT7]-SMIFVTK[MT7].2y4_1.heavy 557.333 / 638.399 14545.0 30.958999633789062 45 15 10 10 10 3.0099997360713426 33.222594275214185 0.0 3 0.9542213958720923 5.745928674616135 14545.0 11.27371967973383 0.0 - - - - - - - 327.0 29 1 CDADC1 cytidine and dCMP deaminase domain containing 1 849 108 B20140404_SF100_04 B20140404_SF100_04 TB154335.[MT7]-SMIFVTK[MT7].2y5_1.heavy 557.333 / 751.483 5066.0 30.958999633789062 45 15 10 10 10 3.0099997360713426 33.222594275214185 0.0 3 0.9542213958720923 5.745928674616135 5066.0 4.006905594405594 1.0 - - - - - - - 392.0 10 5 CDADC1 cytidine and dCMP deaminase domain containing 1 851 108 B20140404_SF100_04 B20140404_SF100_04 TB154335.[MT7]-SMIFVTK[MT7].2b4_1.heavy 557.333 / 623.334 7027.0 30.958999633789062 45 15 10 10 10 3.0099997360713426 33.222594275214185 0.0 3 0.9542213958720923 5.745928674616135 7027.0 8.661426633342177 0.0 - - - - - - - 490.0 14 1 CDADC1 cytidine and dCMP deaminase domain containing 1 853 108 B20140404_SF100_04 B20140404_SF100_04 TB154335.[MT7]-SMIFVTK[MT7].2y6_1.heavy 557.333 / 882.524 3432.0 30.958999633789062 45 15 10 10 10 3.0099997360713426 33.222594275214185 0.0 3 0.9542213958720923 5.745928674616135 3432.0 5.194908200734394 4.0 - - - - - - - 367.5 13 4 CDADC1 cytidine and dCMP deaminase domain containing 1 855 109 B20140404_SF100_04 B20140404_SF100_04 TB344932.[MT7]-DLILLLATVASSVPNFK[MT7].4y4_1.heavy 523.068 / 649.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDADC1 cytidine and dCMP deaminase domain containing 1 857 109 B20140404_SF100_04 B20140404_SF100_04 TB344932.[MT7]-DLILLLATVASSVPNFK[MT7].4b5_1.heavy 523.068 / 712.472 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDADC1 cytidine and dCMP deaminase domain containing 1 859 109 B20140404_SF100_04 B20140404_SF100_04 TB344932.[MT7]-DLILLLATVASSVPNFK[MT7].4y3_1.heavy 523.068 / 552.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDADC1 cytidine and dCMP deaminase domain containing 1 861 109 B20140404_SF100_04 B20140404_SF100_04 TB344932.[MT7]-DLILLLATVASSVPNFK[MT7].4b6_1.heavy 523.068 / 825.557 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDADC1 cytidine and dCMP deaminase domain containing 1 863 110 B20140404_SF100_04 B20140404_SF100_04 TB501680.[MT7]-LEDLFK[MT7].2y4_1.heavy 526.815 / 666.394 32998.0 34.60999870300293 43 17 10 6 10 3.82209343512029 26.163672264294807 0.035800933837890625 3 0.9716006711643019 7.3059236940900165 32998.0 41.4260606060606 0.0 - - - - - - - 673.2 65 10 PLXNA4 plexin A4 865 110 B20140404_SF100_04 B20140404_SF100_04 TB501680.[MT7]-LEDLFK[MT7].2b3_1.heavy 526.815 / 502.263 91865.0 34.60999870300293 43 17 10 6 10 3.82209343512029 26.163672264294807 0.035800933837890625 3 0.9716006711643019 7.3059236940900165 91865.0 71.20072843822844 0.0 - - - - - - - 1861.2 183 10 PLXNA4 plexin A4 867 110 B20140404_SF100_04 B20140404_SF100_04 TB501680.[MT7]-LEDLFK[MT7].2y5_1.heavy 526.815 / 795.437 73519.0 34.60999870300293 43 17 10 6 10 3.82209343512029 26.163672264294807 0.035800933837890625 3 0.9716006711643019 7.3059236940900165 73519.0 178.8607902892562 0.0 - - - - - - - 1301.142857142857 147 7 PLXNA4 plexin A4 869 110 B20140404_SF100_04 B20140404_SF100_04 TB501680.[MT7]-LEDLFK[MT7].2y3_1.heavy 526.815 / 551.367 91601.0 34.60999870300293 43 17 10 6 10 3.82209343512029 26.163672264294807 0.035800933837890625 3 0.9716006711643019 7.3059236940900165 91601.0 136.70755303030302 0.0 - - - - - - - 1280.4 183 10 PLXNA4 plexin A4 871 111 B20140404_SF100_04 B20140404_SF100_04 TB501786.[MT7]-YQFTPAFLR.2y8_1.heavy 643.854 / 979.536 138156.0 35.389275550842285 44 18 10 6 10 4.646091672112207 21.523466831324484 0.035099029541015625 3 0.9858056387757813 10.346402989200003 138156.0 137.9503549964768 0.0 - - - - - - - 225.25 276 4 UNC119B;UNC119 unc-119 homolog B (C. elegans);unc-119 homolog (C. elegans) 873 111 B20140404_SF100_04 B20140404_SF100_04 TB501786.[MT7]-YQFTPAFLR.2y5_1.heavy 643.854 / 603.361 115773.0 35.389275550842285 44 18 10 6 10 4.646091672112207 21.523466831324484 0.035099029541015625 3 0.9858056387757813 10.346402989200003 115773.0 48.46082376338436 0.0 - - - - - - - 643.0 231 1 UNC119B;UNC119 unc-119 homolog B (C. elegans);unc-119 homolog (C. elegans) 875 111 B20140404_SF100_04 B20140404_SF100_04 TB501786.[MT7]-YQFTPAFLR.2y6_1.heavy 643.854 / 704.409 69592.0 35.389275550842285 44 18 10 6 10 4.646091672112207 21.523466831324484 0.035099029541015625 3 0.9858056387757813 10.346402989200003 69592.0 120.52251792338255 0.0 - - - - - - - 283.2 139 5 UNC119B;UNC119 unc-119 homolog B (C. elegans);unc-119 homolog (C. elegans) 877 111 B20140404_SF100_04 B20140404_SF100_04 TB501786.[MT7]-YQFTPAFLR.2y7_1.heavy 643.854 / 851.477 98021.0 35.389275550842285 44 18 10 6 10 4.646091672112207 21.523466831324484 0.035099029541015625 3 0.9858056387757813 10.346402989200003 98021.0 82.5346381553232 0.0 - - - - - - - 1139.4285714285713 196 7 UNC119B;UNC119 unc-119 homolog B (C. elegans);unc-119 homolog (C. elegans) 879 112 B20140404_SF100_04 B20140404_SF100_04 TB501901.[MT7]-FGTLYTENQDVATAVASLC[CAM]R.3y6_1.heavy 787.394 / 705.371 71584.0 37.17169952392578 48 18 10 10 10 4.17438028676736 19.15281913737457 0.0 3 0.9826050127871501 9.343697071777846 71584.0 71.73451116187958 0.0 - - - - - - - 313.6666666666667 143 3 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 881 112 B20140404_SF100_04 B20140404_SF100_04 TB501901.[MT7]-FGTLYTENQDVATAVASLC[CAM]R.3b4_1.heavy 787.394 / 563.331 64532.0 37.17169952392578 48 18 10 10 10 4.17438028676736 19.15281913737457 0.0 3 0.9826050127871501 9.343697071777846 64532.0 58.4974669515088 0.0 - - - - - - - 1248.875 129 8 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 883 112 B20140404_SF100_04 B20140404_SF100_04 TB501901.[MT7]-FGTLYTENQDVATAVASLC[CAM]R.3b5_1.heavy 787.394 / 726.394 76521.0 37.17169952392578 48 18 10 10 10 4.17438028676736 19.15281913737457 0.0 3 0.9826050127871501 9.343697071777846 76521.0 147.40056521739132 0.0 - - - - - - - 839.5714285714286 153 7 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 885 112 B20140404_SF100_04 B20140404_SF100_04 TB501901.[MT7]-FGTLYTENQDVATAVASLC[CAM]R.3y9_1.heavy 787.394 / 948.493 65237.0 37.17169952392578 48 18 10 10 10 4.17438028676736 19.15281913737457 0.0 3 0.9826050127871501 9.343697071777846 65237.0 109.68695901005412 0.0 - - - - - - - 352.8 130 5 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 887 113 B20140404_SF100_04 B20140404_SF100_04 TB154646.[MT7]-SLPVVNYNLLK[MT7].3b6_1.heavy 516.651 / 754.458 38061.0 34.6189489364624 46 20 10 6 10 11.027257405044233 9.068437992048384 0.035800933837890625 3 0.9963455492010096 20.408870147363242 38061.0 44.19376420388464 0.0 - - - - - - - 255.14285714285714 76 7 ARHGAP24 Rho GTPase activating protein 24 889 113 B20140404_SF100_04 B20140404_SF100_04 TB154646.[MT7]-SLPVVNYNLLK[MT7].3b4_1.heavy 516.651 / 541.347 96812.0 34.6189489364624 46 20 10 6 10 11.027257405044233 9.068437992048384 0.035800933837890625 3 0.9963455492010096 20.408870147363242 96812.0 84.70572176182161 0.0 - - - - - - - 191.5 193 2 ARHGAP24 Rho GTPase activating protein 24 891 113 B20140404_SF100_04 B20140404_SF100_04 TB154646.[MT7]-SLPVVNYNLLK[MT7].3b5_1.heavy 516.651 / 640.415 35123.0 34.6189489364624 46 20 10 6 10 11.027257405044233 9.068437992048384 0.035800933837890625 3 0.9963455492010096 20.408870147363242 35123.0 37.839904264577896 0.0 - - - - - - - 255.0 70 1 ARHGAP24 Rho GTPase activating protein 24 893 113 B20140404_SF100_04 B20140404_SF100_04 TB154646.[MT7]-SLPVVNYNLLK[MT7].3y5_1.heavy 516.651 / 794.489 9834.0 34.6189489364624 46 20 10 6 10 11.027257405044233 9.068437992048384 0.035800933837890625 3 0.9963455492010096 20.408870147363242 9834.0 14.072769953051644 0.0 - - - - - - - 695.5555555555555 19 9 ARHGAP24 Rho GTPase activating protein 24 895 114 B20140404_SF100_04 B20140404_SF100_04 TB501902.[MT7]-EEIFGPVQEILR.3b5_1.heavy 525.295 / 720.369 133636.0 38.433998107910156 50 20 10 10 10 11.823841876180103 8.457487933888604 0.0 3 0.9979928100806185 27.541999546310034 133636.0 198.0999394490471 0.0 - - - - - - - 586.0 267 2 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 897 114 B20140404_SF100_04 B20140404_SF100_04 TB501902.[MT7]-EEIFGPVQEILR.3y4_1.heavy 525.295 / 530.33 62309.0 38.433998107910156 50 20 10 10 10 11.823841876180103 8.457487933888604 0.0 3 0.9979928100806185 27.541999546310034 62309.0 39.499932034012176 1.0 - - - - - - - 312.0 134 3 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 899 114 B20140404_SF100_04 B20140404_SF100_04 TB501902.[MT7]-EEIFGPVQEILR.3b3_1.heavy 525.295 / 516.279 87139.0 38.433998107910156 50 20 10 10 10 11.823841876180103 8.457487933888604 0.0 3 0.9979928100806185 27.541999546310034 87139.0 113.36386867936145 0.0 - - - - - - - 820.0 174 2 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 901 114 B20140404_SF100_04 B20140404_SF100_04 TB501902.[MT7]-EEIFGPVQEILR.3y5_1.heavy 525.295 / 658.388 129654.0 38.433998107910156 50 20 10 10 10 11.823841876180103 8.457487933888604 0.0 3 0.9979928100806185 27.541999546310034 129654.0 158.79957332072982 0.0 - - - - - - - 761.5 259 2 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 903 115 B20140404_SF100_04 B20140404_SF100_04 TB154644.[MT7]-ELPEPVIPYAK[MT7].3b6_1.heavy 515.304 / 809.453 60624.0 32.386600494384766 48 18 10 10 10 3.8052965237535603 21.430992775180144 0.0 3 0.9835793828453473 9.617707231719638 60624.0 237.94847587195412 0.0 - - - - - - - 323.5 121 6 ARHGAP24 Rho GTPase activating protein 24 905 115 B20140404_SF100_04 B20140404_SF100_04 TB154644.[MT7]-ELPEPVIPYAK[MT7].3y3_1.heavy 515.304 / 525.315 75258.0 32.386600494384766 48 18 10 10 10 3.8052965237535603 21.430992775180144 0.0 3 0.9835793828453473 9.617707231719638 75258.0 41.925523302240535 0.0 - - - - - - - 647.0 150 3 ARHGAP24 Rho GTPase activating protein 24 907 115 B20140404_SF100_04 B20140404_SF100_04 TB154644.[MT7]-ELPEPVIPYAK[MT7].3b4_1.heavy 515.304 / 613.331 141706.0 32.386600494384766 48 18 10 10 10 3.8052965237535603 21.430992775180144 0.0 3 0.9835793828453473 9.617707231719638 141706.0 66.07323412698413 0.0 - - - - - - - 448.0 283 1 ARHGAP24 Rho GTPase activating protein 24 909 115 B20140404_SF100_04 B20140404_SF100_04 TB154644.[MT7]-ELPEPVIPYAK[MT7].3y4_1.heavy 515.304 / 622.368 182620.0 32.386600494384766 48 18 10 10 10 3.8052965237535603 21.430992775180144 0.0 3 0.9835793828453473 9.617707231719638 182620.0 177.71446477105695 0.0 - - - - - - - 149.0 365 2 ARHGAP24 Rho GTPase activating protein 24 911 116 B20140404_SF100_04 B20140404_SF100_04 TB154231.[MT7]-LIQEAAGR.2y5_1.heavy 501.297 / 503.257 69932.0 25.842724323272705 46 20 10 6 10 8.62182248980135 11.598475858009 0.03989982604980469 3 0.994105747865078 16.066987804402967 69932.0 46.963174130816405 0.0 - - - - - - - 693.5 139 2 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 913 116 B20140404_SF100_04 B20140404_SF100_04 TB154231.[MT7]-LIQEAAGR.2b4_1.heavy 501.297 / 628.379 52247.0 25.842724323272705 46 20 10 6 10 8.62182248980135 11.598475858009 0.03989982604980469 3 0.994105747865078 16.066987804402967 52247.0 40.1507528592221 0.0 - - - - - - - 2225.125 104 8 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 915 116 B20140404_SF100_04 B20140404_SF100_04 TB154231.[MT7]-LIQEAAGR.2y6_1.heavy 501.297 / 631.316 166681.0 25.842724323272705 46 20 10 6 10 8.62182248980135 11.598475858009 0.03989982604980469 3 0.994105747865078 16.066987804402967 166681.0 148.17919720235946 0.0 - - - - - - - 462.0 333 1 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 917 116 B20140404_SF100_04 B20140404_SF100_04 TB154231.[MT7]-LIQEAAGR.2y7_1.heavy 501.297 / 744.4 233839.0 25.842724323272705 46 20 10 6 10 8.62182248980135 11.598475858009 0.03989982604980469 3 0.994105747865078 16.066987804402967 233839.0 156.51836835545478 0.0 - - - - - - - 809.25 467 4 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 919 117 B20140404_SF100_04 B20140404_SF100_04 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1526980.0 31.95400047302246 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1526980.0 312.52313111980044 0.0 - - - - - - - 1641.0 3053 1 921 117 B20140404_SF100_04 B20140404_SF100_04 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 389135.0 31.95400047302246 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 389135.0 107.7213041986282 0.0 - - - - - - - 875.6666666666666 778 3 923 117 B20140404_SF100_04 B20140404_SF100_04 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 530631.0 31.95400047302246 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 530631.0 131.32920049436228 0.0 - - - - - - - 1149.0 1061 1 925 118 B20140404_SF100_04 B20140404_SF100_04 TB154787.[MT7]-RILGQPLSIPTSQPK[MT7].3y6_1.heavy 641.726 / 801.459 77003.0 29.792299270629883 41 11 10 10 10 1.7688945736720187 41.994376631552655 0.0 3 0.8753543815114426 3.458645159584681 77003.0 120.92625017425462 0.0 - - - - - - - 446.2 154 5 MRO maestro 927 118 B20140404_SF100_04 B20140404_SF100_04 TB154787.[MT7]-RILGQPLSIPTSQPK[MT7].3b4_1.heavy 641.726 / 584.4 6377.0 29.792299270629883 41 11 10 10 10 1.7688945736720187 41.994376631552655 0.0 3 0.8753543815114426 3.458645159584681 6377.0 3.7335842568719646 0.0 - - - - - - - 478.0 12 1 MRO maestro 929 118 B20140404_SF100_04 B20140404_SF100_04 TB154787.[MT7]-RILGQPLSIPTSQPK[MT7].3b5_1.heavy 641.726 / 712.459 43045.0 29.792299270629883 41 11 10 10 10 1.7688945736720187 41.994376631552655 0.0 3 0.8753543815114426 3.458645159584681 43045.0 102.006018018626 0.0 - - - - - - - 300.8888888888889 86 9 MRO maestro 931 118 B20140404_SF100_04 B20140404_SF100_04 TB154787.[MT7]-RILGQPLSIPTSQPK[MT7].3b8_1.heavy 641.726 / 1009.63 11638.0 29.792299270629883 41 11 10 10 10 1.7688945736720187 41.994376631552655 0.0 3 0.8753543815114426 3.458645159584681 11638.0 30.01454672634234 0.0 - - - - - - - 283.22222222222223 23 9 MRO maestro 933 119 B20140404_SF100_04 B20140404_SF100_04 TB154786.[MT7]-SLPEK[MT7]PDISDYPK[MT7].3y3_1.heavy 641.026 / 551.331 41728.0 27.42959976196289 41 11 10 10 10 1.5723526625098805 50.59362769438795 0.0 3 0.8721237677020879 3.4137127054202963 41728.0 56.57779849971149 0.0 - - - - - - - 333.5 83 2 SPATA9 spermatogenesis associated 9 935 119 B20140404_SF100_04 B20140404_SF100_04 TB154786.[MT7]-SLPEK[MT7]PDISDYPK[MT7].3y11_2.heavy 641.026 / 788.927 36929.0 27.42959976196289 41 11 10 10 10 1.5723526625098805 50.59362769438795 0.0 3 0.8721237677020879 3.4137127054202963 36929.0 68.50980536384095 0.0 - - - - - - - 699.875 73 8 SPATA9 spermatogenesis associated 9 937 119 B20140404_SF100_04 B20140404_SF100_04 TB154786.[MT7]-SLPEK[MT7]PDISDYPK[MT7].3y8_1.heavy 641.026 / 1078.55 7999.0 27.42959976196289 41 11 10 10 10 1.5723526625098805 50.59362769438795 0.0 3 0.8721237677020879 3.4137127054202963 7999.0 22.856735262593784 0.0 - - - - - - - 222.08333333333334 15 12 SPATA9 spermatogenesis associated 9 939 119 B20140404_SF100_04 B20140404_SF100_04 TB154786.[MT7]-SLPEK[MT7]PDISDYPK[MT7].3b7_2.heavy 641.026 / 528.302 63859.0 27.42959976196289 41 11 10 10 10 1.5723526625098805 50.59362769438795 0.0 3 0.8721237677020879 3.4137127054202963 63859.0 29.56819930386756 0.0 - - - - - - - 933.0 127 1 SPATA9 spermatogenesis associated 9 941 120 B20140404_SF100_04 B20140404_SF100_04 TB344731.[MT7]-RLELIQELR.2b3_1.heavy 657.405 / 543.337 9006.0 31.57309913635254 39 11 10 10 8 1.2385505871853273 55.511847609187306 0.0 4 0.8605712779994945 3.2659232175714434 9006.0 6.63868923089281 1.0 - - - - - - - 327.5 18 2 C3orf15 chromosome 3 open reading frame 15 943 120 B20140404_SF100_04 B20140404_SF100_04 TB344731.[MT7]-RLELIQELR.2y8_1.heavy 657.405 / 1013.6 7205.0 31.57309913635254 39 11 10 10 8 1.2385505871853273 55.511847609187306 0.0 4 0.8605712779994945 3.2659232175714434 7205.0 23.322551748629134 0.0 - - - - - - - 218.66666666666666 14 12 C3orf15 chromosome 3 open reading frame 15 945 120 B20140404_SF100_04 B20140404_SF100_04 TB344731.[MT7]-RLELIQELR.2b4_1.heavy 657.405 / 656.421 3766.0 31.57309913635254 39 11 10 10 8 1.2385505871853273 55.511847609187306 0.0 4 0.8605712779994945 3.2659232175714434 3766.0 0.12847797645006537 17.0 - - - - - - - 778.0 23 4 C3orf15 chromosome 3 open reading frame 15 947 120 B20140404_SF100_04 B20140404_SF100_04 TB344731.[MT7]-RLELIQELR.2b7_1.heavy 657.405 / 1026.61 14246.0 31.57309913635254 39 11 10 10 8 1.2385505871853273 55.511847609187306 0.0 4 0.8605712779994945 3.2659232175714434 14246.0 109.5075887934032 0.0 - - - - - - - 232.25 28 12 C3orf15 chromosome 3 open reading frame 15 949 121 B20140404_SF100_04 B20140404_SF100_04 TB154346.[MT7]-TLTVVLGK[MT7].2y5_1.heavy 559.873 / 659.457 28557.0 31.220199584960938 48 20 10 10 8 7.232882004267728 13.825747460140434 0.0 4 0.995763602052605 18.954422445787106 28557.0 15.549706060424997 0.0 - - - - - - - 985.0 57 1 MRO maestro 951 121 B20140404_SF100_04 B20140404_SF100_04 TB154346.[MT7]-TLTVVLGK[MT7].2b4_1.heavy 559.873 / 559.357 N/A 31.220199584960938 48 20 10 10 8 7.232882004267728 13.825747460140434 0.0 4 0.995763602052605 18.954422445787106 243722.0 6.250943028842149 1.0 - - - - - - - 38405.0 487 1 MRO maestro 953 121 B20140404_SF100_04 B20140404_SF100_04 TB154346.[MT7]-TLTVVLGK[MT7].2y6_1.heavy 559.873 / 760.505 31840.0 31.220199584960938 48 20 10 10 8 7.232882004267728 13.825747460140434 0.0 4 0.995763602052605 18.954422445787106 31840.0 31.204211525638883 0.0 - - - - - - - 820.5714285714286 63 7 MRO maestro 955 121 B20140404_SF100_04 B20140404_SF100_04 TB154346.[MT7]-TLTVVLGK[MT7].2y7_1.heavy 559.873 / 873.589 14279.0 31.220199584960938 48 20 10 10 8 7.232882004267728 13.825747460140434 0.0 4 0.995763602052605 18.954422445787106 14279.0 0.2762765542728115 2.0 - - - - - - - 328.0 60 1 MRO maestro 957 122 B20140404_SF100_04 B20140404_SF100_04 TB501791.[MT7]-LLQAAYLSK[MT7].2y4_1.heavy 647.902 / 654.394 31221.0 32.28860092163086 50 20 10 10 10 11.036701357775573 9.060678255061058 0.0 3 0.9973965987422532 24.1822969228174 31221.0 39.024674189912176 0.0 - - - - - - - 246.5 62 2 PLXNA4 plexin A4 959 122 B20140404_SF100_04 B20140404_SF100_04 TB501791.[MT7]-LLQAAYLSK[MT7].2y5_1.heavy 647.902 / 725.431 35329.0 32.28860092163086 50 20 10 10 10 11.036701357775573 9.060678255061058 0.0 3 0.9973965987422532 24.1822969228174 35329.0 30.12705857671112 0.0 - - - - - - - 383.3333333333333 70 3 PLXNA4 plexin A4 961 122 B20140404_SF100_04 B20140404_SF100_04 TB501791.[MT7]-LLQAAYLSK[MT7].2b4_1.heavy 647.902 / 570.373 31385.0 32.28860092163086 50 20 10 10 10 11.036701357775573 9.060678255061058 0.0 3 0.9973965987422532 24.1822969228174 31385.0 11.971929266750948 1.0 - - - - - - - 438.3333333333333 70 3 PLXNA4 plexin A4 963 122 B20140404_SF100_04 B20140404_SF100_04 TB501791.[MT7]-LLQAAYLSK[MT7].2y6_1.heavy 647.902 / 796.469 31221.0 32.28860092163086 50 20 10 10 10 11.036701357775573 9.060678255061058 0.0 3 0.9973965987422532 24.1822969228174 31221.0 42.10609023789992 0.0 - - - - - - - 164.0 62 3 PLXNA4 plexin A4 965 123 B20140404_SF100_04 B20140404_SF100_04 TB501655.[MT7]-REPAQK[MT7].2y4_1.heavy 508.808 / 587.363 2673.0 16.847999572753906 48 18 10 10 10 3.033293118009173 25.164573385268795 0.0 3 0.9886056643973219 11.550602209192368 2673.0 35.821836734693875 0.0 - - - - - - - 126.625 5 16 SPATA9 spermatogenesis associated 9 967 123 B20140404_SF100_04 B20140404_SF100_04 TB501655.[MT7]-REPAQK[MT7].2b5_1.heavy 508.808 / 726.401 1032.0 16.847999572753906 48 18 10 10 10 3.033293118009173 25.164573385268795 0.0 3 0.9886056643973219 11.550602209192368 1032.0 30.37173464373464 0.0 - - - - - - - 77.61111111111111 2 18 SPATA9 spermatogenesis associated 9 969 123 B20140404_SF100_04 B20140404_SF100_04 TB501655.[MT7]-REPAQK[MT7].2y5_1.heavy 508.808 / 716.406 1143.0 16.847999572753906 48 18 10 10 10 3.033293118009173 25.164573385268795 0.0 3 0.9886056643973219 11.550602209192368 1143.0 14.549245372567633 0.0 - - - - - - - 99.14285714285714 2 21 SPATA9 spermatogenesis associated 9 971 123 B20140404_SF100_04 B20140404_SF100_04 TB501655.[MT7]-REPAQK[MT7].2b4_1.heavy 508.808 / 598.343 313.0 16.847999572753906 48 18 10 10 10 3.033293118009173 25.164573385268795 0.0 3 0.9886056643973219 11.550602209192368 313.0 3.7331962397179788 1.0 - - - - - - - 0.0 1 0 SPATA9 spermatogenesis associated 9 973 124 B20140404_SF100_04 B20140404_SF100_04 TB344806.[MT7]-ALADMFDFLSK[MT7].2y4_1.heavy 773.415 / 638.399 4314.0 42.13814926147461 44 18 10 6 10 3.518975039217118 28.41736553557579 0.03189849853515625 3 0.9886046904890012 11.55010766705366 4314.0 9.820344722080572 0.0 - - - - - - - 650.7 8 10 C3orf15 chromosome 3 open reading frame 15 975 124 B20140404_SF100_04 B20140404_SF100_04 TB344806.[MT7]-ALADMFDFLSK[MT7].2b4_1.heavy 773.415 / 515.295 7341.0 42.13814926147461 44 18 10 6 10 3.518975039217118 28.41736553557579 0.03189849853515625 3 0.9886046904890012 11.55010766705366 7341.0 10.135465242700853 0.0 - - - - - - - 676.5 14 16 C3orf15 chromosome 3 open reading frame 15 977 124 B20140404_SF100_04 B20140404_SF100_04 TB344806.[MT7]-ALADMFDFLSK[MT7].2b6_1.heavy 773.415 / 793.404 1438.0 42.13814926147461 44 18 10 6 10 3.518975039217118 28.41736553557579 0.03189849853515625 3 0.9886046904890012 11.55010766705366 1438.0 2.406555205744912 8.0 - - - - - - - 282.8421052631579 2 19 C3orf15 chromosome 3 open reading frame 15 979 124 B20140404_SF100_04 B20140404_SF100_04 TB344806.[MT7]-ALADMFDFLSK[MT7].2b7_1.heavy 773.415 / 908.43 2119.0 42.13814926147461 44 18 10 6 10 3.518975039217118 28.41736553557579 0.03189849853515625 3 0.9886046904890012 11.55010766705366 2119.0 4.993419590058246 0.0 - - - - - - - 659.5714285714286 4 7 C3orf15 chromosome 3 open reading frame 15 981 125 B20140404_SF100_04 B20140404_SF100_04 TB154206.[MT7]-VTLLIK[MT7].2y4_1.heavy 487.846 / 630.467 25862.0 32.386600494384766 46 20 10 10 6 4.938113376123505 20.250648857823823 0.0 5 0.9930380399771598 14.782378674611508 25862.0 26.14801528929672 0.0 - - - - - - - 454.0 51 5 MYOT myotilin 983 125 B20140404_SF100_04 B20140404_SF100_04 TB154206.[MT7]-VTLLIK[MT7].2y5_1.heavy 487.846 / 731.515 72746.0 32.386600494384766 46 20 10 10 6 4.938113376123505 20.250648857823823 0.0 5 0.9930380399771598 14.782378674611508 72746.0 107.92542155439911 0.0 - - - - - - - 226.5 145 2 MYOT myotilin 985 125 B20140404_SF100_04 B20140404_SF100_04 TB154206.[MT7]-VTLLIK[MT7].2b4_1.heavy 487.846 / 571.394 35692.0 32.386600494384766 46 20 10 10 6 4.938113376123505 20.250648857823823 0.0 5 0.9930380399771598 14.782378674611508 35692.0 9.202261277634172 3.0 - - - - - - - 1210.0 143 2 MYOT myotilin 987 125 B20140404_SF100_04 B20140404_SF100_04 TB154206.[MT7]-VTLLIK[MT7].2y3_1.heavy 487.846 / 517.383 50060.0 32.386600494384766 46 20 10 10 6 4.938113376123505 20.250648857823823 0.0 5 0.9930380399771598 14.782378674611508 50060.0 25.03181828365581 0.0 - - - - - - - 680.5 100 2 MYOT myotilin 989 126 B20140404_SF100_04 B20140404_SF100_04 TB154670.[MT7]-WFWDSAEEGYR.2y4_1.heavy 795.361 / 524.246 17222.0 36.55569839477539 48 18 10 10 10 4.621899706296156 21.636125046974858 0.0 3 0.9859612571655118 10.403725110684396 17222.0 27.239249591155755 0.0 - - - - - - - 777.5 34 8 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 991 126 B20140404_SF100_04 B20140404_SF100_04 TB154670.[MT7]-WFWDSAEEGYR.2y8_1.heavy 795.361 / 926.385 24278.0 36.55569839477539 48 18 10 10 10 4.621899706296156 21.636125046974858 0.0 3 0.9859612571655118 10.403725110684396 24278.0 39.1914159739324 0.0 - - - - - - - 346.8 48 10 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 993 126 B20140404_SF100_04 B20140404_SF100_04 TB154670.[MT7]-WFWDSAEEGYR.2y9_1.heavy 795.361 / 1112.46 26312.0 36.55569839477539 48 18 10 10 10 4.621899706296156 21.636125046974858 0.0 3 0.9859612571655118 10.403725110684396 26312.0 24.963209675627976 1.0 - - - - - - - 315.1818181818182 56 11 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 995 126 B20140404_SF100_04 B20140404_SF100_04 TB154670.[MT7]-WFWDSAEEGYR.2y7_1.heavy 795.361 / 811.358 47959.0 36.55569839477539 48 18 10 10 10 4.621899706296156 21.636125046974858 0.0 3 0.9859612571655118 10.403725110684396 47959.0 134.41217615202697 0.0 - - - - - - - 807.375 95 8 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 997 127 B20140404_SF100_04 B20140404_SF100_04 TB344804.[MT7]-ELPEPVIPYAK[MT7].2y4_1.heavy 772.452 / 622.368 34901.0 32.37435054779053 38 13 10 5 10 1.6656449797565342 49.45437400395172 0.048999786376953125 3 0.9284731313877201 4.586743868288754 34901.0 76.42483637982579 0.0 - - - - - - - 715.1428571428571 69 7 ARHGAP24 Rho GTPase activating protein 24 999 127 B20140404_SF100_04 B20140404_SF100_04 TB344804.[MT7]-ELPEPVIPYAK[MT7].2b4_1.heavy 772.452 / 613.331 21647.0 32.37435054779053 38 13 10 5 10 1.6656449797565342 49.45437400395172 0.048999786376953125 3 0.9284731313877201 4.586743868288754 21647.0 21.914609856423496 0.0 - - - - - - - 331.75 43 4 ARHGAP24 Rho GTPase activating protein 24 1001 127 B20140404_SF100_04 B20140404_SF100_04 TB344804.[MT7]-ELPEPVIPYAK[MT7].2y3_1.heavy 772.452 / 525.315 2209.0 32.37435054779053 38 13 10 5 10 1.6656449797565342 49.45437400395172 0.048999786376953125 3 0.9284731313877201 4.586743868288754 2209.0 3.196319618734775 4.0 - - - - - - - 276.375 5 8 ARHGAP24 Rho GTPase activating protein 24 1003 127 B20140404_SF100_04 B20140404_SF100_04 TB344804.[MT7]-ELPEPVIPYAK[MT7].2y7_1.heavy 772.452 / 931.573 13990.0 32.37435054779053 38 13 10 5 10 1.6656449797565342 49.45437400395172 0.048999786376953125 3 0.9284731313877201 4.586743868288754 13990.0 37.06589673913044 0.0 - - - - - - - 278.3333333333333 27 9 ARHGAP24 Rho GTPase activating protein 24 1005 128 B20140404_SF100_04 B20140404_SF100_04 TB154207.[MT7]-IEGIQK[MT7].2y4_1.heavy 488.307 / 589.379 52160.0 24.98390007019043 39 17 4 10 8 4.413169922374333 22.65944927545389 0.0 4 0.9743059921733986 7.682669220929632 52160.0 37.94925974234182 0.0 - - - - - - - 2187.1428571428573 104 7 SPATA9 spermatogenesis associated 9 1007 128 B20140404_SF100_04 B20140404_SF100_04 TB154207.[MT7]-IEGIQK[MT7].2y5_1.heavy 488.307 / 718.422 112873.0 24.98390007019043 39 17 4 10 8 4.413169922374333 22.65944927545389 0.0 4 0.9743059921733986 7.682669220929632 112873.0 19.498201661683517 1.0 - - - - - - - 1478.0 419 1 SPATA9 spermatogenesis associated 9 1009 128 B20140404_SF100_04 B20140404_SF100_04 TB154207.[MT7]-IEGIQK[MT7].2b4_1.heavy 488.307 / 557.341 26291.0 24.98390007019043 39 17 4 10 8 4.413169922374333 22.65944927545389 0.0 4 0.9743059921733986 7.682669220929632 26291.0 26.187811794766432 0.0 - - - - - - - 774.3333333333334 52 6 SPATA9 spermatogenesis associated 9 1011 128 B20140404_SF100_04 B20140404_SF100_04 TB154207.[MT7]-IEGIQK[MT7].2y3_1.heavy 488.307 / 532.357 10981.0 24.98390007019043 39 17 4 10 8 4.413169922374333 22.65944927545389 0.0 4 0.9743059921733986 7.682669220929632 10981.0 7.92424869084228 1.0 - - - - - - - 1306.625 29 8 SPATA9 spermatogenesis associated 9 1013 129 B20140404_SF100_04 B20140404_SF100_04 TB501912.[MT7]-GSLFEIISFPAK[MT7].2y5_1.heavy 798.966 / 693.405 20447.0 39.82569885253906 43 13 10 10 10 2.184121623960711 45.78499608399045 0.0 3 0.9058847192828637 3.990853714578746 20447.0 43.91436680595328 0.0 - - - - - - - 289.4 40 5 SPATA9 spermatogenesis associated 9 1015 129 B20140404_SF100_04 B20140404_SF100_04 TB501912.[MT7]-GSLFEIISFPAK[MT7].2b4_1.heavy 798.966 / 549.315 13528.0 39.82569885253906 43 13 10 10 10 2.184121623960711 45.78499608399045 0.0 3 0.9058847192828637 3.990853714578746 13528.0 41.26615677790305 0.0 - - - - - - - 332.77777777777777 27 9 SPATA9 spermatogenesis associated 9 1017 129 B20140404_SF100_04 B20140404_SF100_04 TB501912.[MT7]-GSLFEIISFPAK[MT7].2y6_1.heavy 798.966 / 806.489 16007.0 39.82569885253906 43 13 10 10 10 2.184121623960711 45.78499608399045 0.0 3 0.9058847192828637 3.990853714578746 16007.0 41.709718581582436 0.0 - - - - - - - 681.6 32 10 SPATA9 spermatogenesis associated 9 1019 129 B20140404_SF100_04 B20140404_SF100_04 TB501912.[MT7]-GSLFEIISFPAK[MT7].2b5_1.heavy 798.966 / 678.358 24372.0 39.82569885253906 43 13 10 10 10 2.184121623960711 45.78499608399045 0.0 3 0.9058847192828637 3.990853714578746 24372.0 32.872926567068205 0.0 - - - - - - - 825.875 48 8 SPATA9 spermatogenesis associated 9 1021 130 B20140404_SF100_04 B20140404_SF100_04 TB501913.[MT7]-GSLFEIISFPAK[MT7].3b6_1.heavy 532.979 / 791.442 163386.0 39.82569885253906 47 17 10 10 10 5.543603605686863 18.038807806787585 0.0 3 0.9771169080816642 8.14279223956135 163386.0 397.67733461538455 0.0 - - - - - - - 242.66666666666666 326 3 SPATA9 spermatogenesis associated 9 1023 130 B20140404_SF100_04 B20140404_SF100_04 TB501913.[MT7]-GSLFEIISFPAK[MT7].3b4_1.heavy 532.979 / 549.315 79873.0 39.82569885253906 47 17 10 10 10 5.543603605686863 18.038807806787585 0.0 3 0.9771169080816642 8.14279223956135 79873.0 291.84365384615387 0.0 - - - - - - - 260.0 159 4 SPATA9 spermatogenesis associated 9 1025 130 B20140404_SF100_04 B20140404_SF100_04 TB501913.[MT7]-GSLFEIISFPAK[MT7].3b5_1.heavy 532.979 / 678.358 401653.0 39.82569885253906 47 17 10 10 10 5.543603605686863 18.038807806787585 0.0 3 0.9771169080816642 8.14279223956135 401653.0 143.6051346153846 0.0 - - - - - - - 260.0 803 2 SPATA9 spermatogenesis associated 9 1027 130 B20140404_SF100_04 B20140404_SF100_04 TB501913.[MT7]-GSLFEIISFPAK[MT7].3y5_1.heavy 532.979 / 693.405 105977.0 39.82569885253906 47 17 10 10 10 5.543603605686863 18.038807806787585 0.0 3 0.9771169080816642 8.14279223956135 105977.0 399.21200226244343 0.0 - - - - - - - 228.8 211 5 SPATA9 spermatogenesis associated 9 1029 131 B20140404_SF100_04 B20140404_SF100_04 TB154675.[MT7]-TTFQAC[CAM]SPYLK[MT7].3y3_1.heavy 535.285 / 567.362 56875.0 29.260299682617188 50 20 10 10 10 6.378182887825979 15.678446629504736 0.0 3 0.9911551289810214 13.11281671202686 56875.0 32.19798597374573 0.0 - - - - - - - 922.0 113 1 MRO maestro 1031 131 B20140404_SF100_04 B20140404_SF100_04 TB154675.[MT7]-TTFQAC[CAM]SPYLK[MT7].3b4_1.heavy 535.285 / 622.332 61794.0 29.260299682617188 50 20 10 10 10 6.378182887825979 15.678446629504736 0.0 3 0.9911551289810214 13.11281671202686 61794.0 36.26669916516161 0.0 - - - - - - - 820.0 123 3 MRO maestro 1033 131 B20140404_SF100_04 B20140404_SF100_04 TB154675.[MT7]-TTFQAC[CAM]SPYLK[MT7].3b5_1.heavy 535.285 / 693.369 45192.0 29.260299682617188 50 20 10 10 10 6.378182887825979 15.678446629504736 0.0 3 0.9911551289810214 13.11281671202686 45192.0 61.63435190045158 0.0 - - - - - - - 768.7142857142857 90 7 MRO maestro 1035 131 B20140404_SF100_04 B20140404_SF100_04 TB154675.[MT7]-TTFQAC[CAM]SPYLK[MT7].3y4_1.heavy 535.285 / 664.415 81777.0 29.260299682617188 50 20 10 10 10 6.378182887825979 15.678446629504736 0.0 3 0.9911551289810214 13.11281671202686 81777.0 61.59759296707247 0.0 - - - - - - - 1230.0 163 3 MRO maestro 1037 132 B20140404_SF100_04 B20140404_SF100_04 TB501918.[MT7]-AAAAASAAGPGGLVAGK[MT7].3b9_1.heavy 543.317 / 786.423 108441.0 26.488100051879883 40 15 10 5 10 2.913975345502373 34.31738026004467 0.04000091552734375 3 0.9570761717743168 5.935363327622834 108441.0 73.09284942809036 0.0 - - - - - - - 343.5 216 2 UNC119B unc-119 homolog B (C. elegans) 1039 132 B20140404_SF100_04 B20140404_SF100_04 TB501918.[MT7]-AAAAASAAGPGGLVAGK[MT7].3b6_1.heavy 543.317 / 587.327 94700.0 26.488100051879883 40 15 10 5 10 2.913975345502373 34.31738026004467 0.04000091552734375 3 0.9570761717743168 5.935363327622834 94700.0 69.86600781429556 0.0 - - - - - - - 1750.4285714285713 189 7 UNC119B unc-119 homolog B (C. elegans) 1041 132 B20140404_SF100_04 B20140404_SF100_04 TB501918.[MT7]-AAAAASAAGPGGLVAGK[MT7].3b5_1.heavy 543.317 / 500.295 116343.0 26.488100051879883 40 15 10 5 10 2.913975345502373 34.31738026004467 0.04000091552734375 3 0.9570761717743168 5.935363327622834 116343.0 61.6260979544444 0.0 - - - - - - - 1489.0 232 1 UNC119B unc-119 homolog B (C. elegans) 1043 132 B20140404_SF100_04 B20140404_SF100_04 TB501918.[MT7]-AAAAASAAGPGGLVAGK[MT7].3y4_1.heavy 543.317 / 518.342 253068.0 26.488100051879883 40 15 10 5 10 2.913975345502373 34.31738026004467 0.04000091552734375 3 0.9570761717743168 5.935363327622834 253068.0 87.8554537842605 0.0 - - - - - - - 1431.5 506 2 UNC119B unc-119 homolog B (C. elegans) 1045 133 B20140404_SF100_04 B20140404_SF100_04 TB154146.[MT7]-TNLGPK[MT7].2b3_1.heavy 459.287 / 473.284 4541.0 22.10462522506714 24 3 10 3 8 0.45007084911357037 109.10944860922163 0.07530021667480469 4 0.5925819046837449 1.86360091905787 4541.0 3.949173934108527 2.0 - - - - - - - 1804.2222222222222 61 9 CCT6B;CCT6A chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin containing TCP1, subunit 6A (zeta 1) 1047 133 B20140404_SF100_04 B20140404_SF100_04 TB154146.[MT7]-TNLGPK[MT7].2y4_1.heavy 459.287 / 558.373 25731.0 22.10462522506714 24 3 10 3 8 0.45007084911357037 109.10944860922163 0.07530021667480469 4 0.5925819046837449 1.86360091905787 25731.0 9.766297456805818 1.0 - - - - - - - 688.0 51 1 CCT6B;CCT6A chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin containing TCP1, subunit 6A (zeta 1) 1049 133 B20140404_SF100_04 B20140404_SF100_04 TB154146.[MT7]-TNLGPK[MT7].2y5_1.heavy 459.287 / 672.416 3096.0 22.10462522506714 24 3 10 3 8 0.45007084911357037 109.10944860922163 0.07530021667480469 4 0.5925819046837449 1.86360091905787 3096.0 4.715187480947058 2.0 - - - - - - - 1179.4285714285713 66 7 CCT6B;CCT6A chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin containing TCP1, subunit 6A (zeta 1) 1051 133 B20140404_SF100_04 B20140404_SF100_04 TB154146.[MT7]-TNLGPK[MT7].2b4_1.heavy 459.287 / 530.305 50430.0 22.10462522506714 24 3 10 3 8 0.45007084911357037 109.10944860922163 0.07530021667480469 4 0.5925819046837449 1.86360091905787 50430.0 46.32209874669841 0.0 - - - - - - - 1247.0 100 8 CCT6B;CCT6A chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin containing TCP1, subunit 6A (zeta 1) 1053 134 B20140404_SF100_04 B20140404_SF100_04 TB154145.[MT7]-VLLEHR.2b3_1.heavy 455.783 / 470.346 13442.0 24.072200775146484 39 11 10 10 8 0.9021822822213253 66.06346588232866 0.0 4 0.858416734981523 3.2403646861990465 13442.0 20.20841638317253 0.0 - - - - - - - 787.4285714285714 26 7 DEF8;TRPA1 differentially expressed in FDCP 8 homolog (mouse);transient receptor potential cation channel, subfamily A, member 1 1055 134 B20140404_SF100_04 B20140404_SF100_04 TB154145.[MT7]-VLLEHR.2y4_1.heavy 455.783 / 554.305 18760.0 24.072200775146484 39 11 10 10 8 0.9021822822213253 66.06346588232866 0.0 4 0.858416734981523 3.2403646861990465 18760.0 15.203587358463079 1.0 - - - - - - - 759.8571428571429 39 7 DEF8;TRPA1 differentially expressed in FDCP 8 homolog (mouse);transient receptor potential cation channel, subfamily A, member 1 1057 134 B20140404_SF100_04 B20140404_SF100_04 TB154145.[MT7]-VLLEHR.2y5_1.heavy 455.783 / 667.389 N/A 24.072200775146484 39 11 10 10 8 0.9021822822213253 66.06346588232866 0.0 4 0.858416734981523 3.2403646861990465 58699.0 28.112441592032912 0.0 - - - - - - - 725.25 117 8 DEF8;TRPA1 differentially expressed in FDCP 8 homolog (mouse);transient receptor potential cation channel, subfamily A, member 1 1059 134 B20140404_SF100_04 B20140404_SF100_04 TB154145.[MT7]-VLLEHR.2b4_1.heavy 455.783 / 599.388 41582.0 24.072200775146484 39 11 10 10 8 0.9021822822213253 66.06346588232866 0.0 4 0.858416734981523 3.2403646861990465 41582.0 61.970663073644374 0.0 - - - - - - - 744.5 83 10 DEF8;TRPA1 differentially expressed in FDCP 8 homolog (mouse);transient receptor potential cation channel, subfamily A, member 1 1061 135 B20140404_SF100_04 B20140404_SF100_04 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 955026.0 23.773099899291992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 955026.0 496.0038210198238 0.0 - - - - - - - 1259.2727272727273 1910 11 1063 135 B20140404_SF100_04 B20140404_SF100_04 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 1594550.0 23.773099899291992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1594550.0 951.5675847545322 0.0 - - - - - - - 263.0 3189 16 1065 135 B20140404_SF100_04 B20140404_SF100_04 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 4919950.0 23.773099899291992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 4919950.0 983.3697663139257 0.0 - - - - - - - 713.7142857142857 9839 7 1067 136 B20140404_SF100_04 B20140404_SF100_04 TB154340.[MT7]-MIVNAGVNR.2y8_1.heavy 559.317 / 842.484 18126.0 26.122400283813477 38 18 0 10 10 4.802663486464525 20.821779473376115 0.0 3 0.9898201721060814 12.221458634541001 18126.0 46.00480878107307 0.0 - - - - - - - 381.7 36 10 CDADC1 cytidine and dCMP deaminase domain containing 1 1069 136 B20140404_SF100_04 B20140404_SF100_04 TB154340.[MT7]-MIVNAGVNR.2y5_1.heavy 559.317 / 516.289 12522.0 26.122400283813477 38 18 0 10 10 4.802663486464525 20.821779473376115 0.0 3 0.9898201721060814 12.221458634541001 12522.0 2.5297953240774076 1.0 - - - - - - - 1312.0 25 1 CDADC1 cytidine and dCMP deaminase domain containing 1 1071 136 B20140404_SF100_04 B20140404_SF100_04 TB154340.[MT7]-MIVNAGVNR.2y6_1.heavy 559.317 / 630.332 N/A 26.122400283813477 38 18 0 10 10 4.802663486464525 20.821779473376115 0.0 3 0.9898201721060814 12.221458634541001 15264.0 7.906671704433424 2.0 - - - - - - - 954.0 179 1 CDADC1 cytidine and dCMP deaminase domain containing 1 1073 136 B20140404_SF100_04 B20140404_SF100_04 TB154340.[MT7]-MIVNAGVNR.2y7_1.heavy 559.317 / 729.4 22419.0 26.122400283813477 38 18 0 10 10 4.802663486464525 20.821779473376115 0.0 3 0.9898201721060814 12.221458634541001 22419.0 11.554545117257444 0.0 - - - - - - - 477.0 44 3 CDADC1 cytidine and dCMP deaminase domain containing 1 1075 137 B20140404_SF100_04 B20140404_SF100_04 TB501663.[MT7]-ARDPSAK[MT7].2y4_1.heavy 516.806 / 546.337 5227.0 17.067899703979492 47 17 10 10 10 5.562252320923131 17.97832860329566 0.0 3 0.9724334707261325 7.415980478566851 5227.0 21.487074929855467 0.0 - - - - - - - 156.85 10 20 MRO maestro 1077 137 B20140404_SF100_04 B20140404_SF100_04 TB501663.[MT7]-ARDPSAK[MT7].2b3_1.heavy 516.806 / 487.275 4579.0 17.067899703979492 47 17 10 10 10 5.562252320923131 17.97832860329566 0.0 3 0.9724334707261325 7.415980478566851 4579.0 9.622516203763585 0.0 - - - - - - - 312.29411764705884 9 17 MRO maestro 1079 137 B20140404_SF100_04 B20140404_SF100_04 TB501663.[MT7]-ARDPSAK[MT7].2y5_1.heavy 516.806 / 661.364 397.0 17.067899703979492 47 17 10 10 10 5.562252320923131 17.97832860329566 0.0 3 0.9724334707261325 7.415980478566851 397.0 5.211827773025378 1.0 - - - - - - - 0.0 0 0 MRO maestro 1081 137 B20140404_SF100_04 B20140404_SF100_04 TB501663.[MT7]-ARDPSAK[MT7].2b6_1.heavy 516.806 / 742.396 565.0 17.067899703979492 47 17 10 10 10 5.562252320923131 17.97832860329566 0.0 3 0.9724334707261325 7.415980478566851 565.0 3.8698630136986303 1.0 - - - - - - - 0.0 1 0 MRO maestro 1083 138 B20140404_SF100_04 B20140404_SF100_04 TB345007.[MT7]-NYYLNTYEGLVELESC[CAM]LPDFVTQPQIR.4y4_1.heavy 852.175 / 513.314 16985.0 43.73887348175049 36 10 10 6 10 0.7441642032574127 77.16886009848605 0.038700103759765625 3 0.8312806118642585 2.9612531928011374 16985.0 -1.116384976525822 0.0 - - - - - - - 384.5 33 2 C3orf15 chromosome 3 open reading frame 15 1085 138 B20140404_SF100_04 B20140404_SF100_04 TB345007.[MT7]-NYYLNTYEGLVELESC[CAM]LPDFVTQPQIR.4y10_1.heavy 852.175 / 1200.64 9055.0 43.73887348175049 36 10 10 6 10 0.7441642032574127 77.16886009848605 0.038700103759765625 3 0.8312806118642585 2.9612531928011374 9055.0 -3.836864406779668 0.0 - - - - - - - 141.9 18 10 C3orf15 chromosome 3 open reading frame 15 1087 138 B20140404_SF100_04 B20140404_SF100_04 TB345007.[MT7]-NYYLNTYEGLVELESC[CAM]LPDFVTQPQIR.4b4_1.heavy 852.175 / 698.363 5208.0 43.73887348175049 36 10 10 6 10 0.7441642032574127 77.16886009848605 0.038700103759765625 3 0.8312806118642585 2.9612531928011374 5208.0 -0.5600000000000005 1.0 - - - - - - - 369.75 15 8 C3orf15 chromosome 3 open reading frame 15 1089 138 B20140404_SF100_04 B20140404_SF100_04 TB345007.[MT7]-NYYLNTYEGLVELESC[CAM]LPDFVTQPQIR.4b3_1.heavy 852.175 / 585.279 6155.0 43.73887348175049 36 10 10 6 10 0.7441642032574127 77.16886009848605 0.038700103759765625 3 0.8312806118642585 2.9612531928011374 6155.0 -0.6367241379310344 1.0 - - - - - - - 177.66666666666666 12 3 C3orf15 chromosome 3 open reading frame 15 1091 139 B20140404_SF100_04 B20140404_SF100_04 TB154151.[MT7]-AMLAGSAR.2b4_1.heavy 460.759 / 531.308 17880.0 23.213900089263916 46 20 10 6 10 11.098301735581316 9.010387569424118 0.03439903259277344 3 0.997168476812984 23.187278541759785 17880.0 10.954588283028649 0.0 - - - - - - - 676.0 35 4 MYOZ3 myozenin 3 1093 139 B20140404_SF100_04 B20140404_SF100_04 TB154151.[MT7]-AMLAGSAR.2y6_1.heavy 460.759 / 574.331 37330.0 23.213900089263916 46 20 10 6 10 11.098301735581316 9.010387569424118 0.03439903259277344 3 0.997168476812984 23.187278541759785 37330.0 9.683439755328168 0.0 - - - - - - - 349.0 74 1 MYOZ3 myozenin 3 1095 139 B20140404_SF100_04 B20140404_SF100_04 TB154151.[MT7]-AMLAGSAR.2b5_1.heavy 460.759 / 588.33 9681.0 23.213900089263916 46 20 10 6 10 11.098301735581316 9.010387569424118 0.03439903259277344 3 0.997168476812984 23.187278541759785 9681.0 2.691035441278666 1.0 - - - - - - - 1234.6923076923076 19 13 MYOZ3 myozenin 3 1097 139 B20140404_SF100_04 B20140404_SF100_04 TB154151.[MT7]-AMLAGSAR.2y7_1.heavy 460.759 / 705.371 65763.0 23.213900089263916 46 20 10 6 10 11.098301735581316 9.010387569424118 0.03439903259277344 3 0.997168476812984 23.187278541759785 65763.0 24.388617704634015 0.0 - - - - - - - 262.0 131 1 MYOZ3 myozenin 3 1099 140 B20140404_SF100_04 B20140404_SF100_04 TB154357.[MT7]-VQQVLAGK[MT7].2b3_1.heavy 565.86 / 500.295 30500.0 26.350500106811523 45 15 10 10 10 1.668750959104532 47.65545892261058 0.0 3 0.9580138426361787 6.001750560643341 30500.0 24.88235294117647 0.0 - - - - - - - 2196.0 61 9 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1101 140 B20140404_SF100_04 B20140404_SF100_04 TB154357.[MT7]-VQQVLAGK[MT7].2y4_1.heavy 565.86 / 532.357 58681.0 26.350500106811523 45 15 10 10 10 1.668750959104532 47.65545892261058 0.0 3 0.9580138426361787 6.001750560643341 58681.0 62.345699453551916 0.0 - - - - - - - 1753.75 117 8 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1103 140 B20140404_SF100_04 B20140404_SF100_04 TB154357.[MT7]-VQQVLAGK[MT7].2y5_1.heavy 565.86 / 631.426 24888.0 26.350500106811523 45 15 10 10 10 1.668750959104532 47.65545892261058 0.0 3 0.9580138426361787 6.001750560643341 24888.0 33.75 0.0 - - - - - - - 840.4444444444445 49 9 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1105 140 B20140404_SF100_04 B20140404_SF100_04 TB154357.[MT7]-VQQVLAGK[MT7].2b4_1.heavy 565.86 / 599.363 42334.0 26.350500106811523 45 15 10 10 10 1.668750959104532 47.65545892261058 0.0 3 0.9580138426361787 6.001750560643341 42334.0 59.337 0.0 - - - - - - - 1274.2222222222222 84 9 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1107 141 B20140404_SF100_04 B20140404_SF100_04 TB154219.[MT7]-LILNTK[MT7].2y4_1.heavy 495.333 / 619.39 39224.0 28.550100326538086 38 20 0 10 8 5.110756194726022 19.566576097524216 0.0 4 0.9922360407816122 13.997141697855783 39224.0 22.89435584883739 0.0 - - - - - - - 1083.4 78 5 RANBP3 RAN binding protein 3 1109 141 B20140404_SF100_04 B20140404_SF100_04 TB154219.[MT7]-LILNTK[MT7].2y5_1.heavy 495.333 / 732.474 N/A 28.550100326538086 38 20 0 10 8 5.110756194726022 19.566576097524216 0.0 4 0.9922360407816122 13.997141697855783 40395.0 3.873331417462099 1.0 - - - - - - - 829.3333333333334 427 3 RANBP3 RAN binding protein 3 1111 141 B20140404_SF100_04 B20140404_SF100_04 TB154219.[MT7]-LILNTK[MT7].2b4_1.heavy 495.333 / 598.404 10831.0 28.550100326538086 38 20 0 10 8 5.110756194726022 19.566576097524216 0.0 4 0.9922360407816122 13.997141697855783 10831.0 3.819995839496074 2.0 - - - - - - - 390.3333333333333 36 3 RANBP3 RAN binding protein 3 1113 141 B20140404_SF100_04 B20140404_SF100_04 TB154219.[MT7]-LILNTK[MT7].2y3_1.heavy 495.333 / 506.306 32199.0 28.550100326538086 38 20 0 10 8 5.110756194726022 19.566576097524216 0.0 4 0.9922360407816122 13.997141697855783 32199.0 36.3773505194733 0.0 - - - - - - - 1207.75 64 8 RANBP3 RAN binding protein 3 1115 142 B20140404_SF100_04 B20140404_SF100_04 TB154154.[MT7]-QGGFVK[MT7].2y5_1.heavy 462.281 / 651.395 19878.0 23.083499908447266 36 20 0 10 6 6.257402509484368 15.98107199407895 0.0 6 0.9949853058656226 17.420414742590843 19878.0 33.685152232506525 0.0 - - - - - - - 1131.0 39 7 ARHGAP24 Rho GTPase activating protein 24 1117 142 B20140404_SF100_04 B20140404_SF100_04 TB154154.[MT7]-QGGFVK[MT7].2b4_1.heavy 462.281 / 534.279 5222.0 23.083499908447266 36 20 0 10 6 6.257402509484368 15.98107199407895 0.0 6 0.9949853058656226 17.420414742590843 5222.0 2.793249287749288 2.0 - - - - - - - 1215.2857142857142 18 7 ARHGAP24 Rho GTPase activating protein 24 1119 142 B20140404_SF100_04 B20140404_SF100_04 TB154154.[MT7]-QGGFVK[MT7].2y3_1.heavy 462.281 / 537.352 2190.0 23.083499908447266 36 20 0 10 6 6.257402509484368 15.98107199407895 0.0 6 0.9949853058656226 17.420414742590843 2190.0 0.9642469341186787 28.0 - - - - - - - 842.0 180 1 ARHGAP24 Rho GTPase activating protein 24 1121 142 B20140404_SF100_04 B20140404_SF100_04 TB154154.[MT7]-QGGFVK[MT7].2b5_1.heavy 462.281 / 633.348 4296.0 23.083499908447266 36 20 0 10 6 6.257402509484368 15.98107199407895 0.0 6 0.9949853058656226 17.420414742590843 4296.0 5.424376725517599 5.0 - - - - - - - 337.0 30 3 ARHGAP24 Rho GTPase activating protein 24 1123 143 B20140404_SF100_04 B20140404_SF100_04 TB501664.[MT7]-RAEQLK[MT7].2b3_1.heavy 516.824 / 501.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - B3GALTL;FAM160A2 beta 1,3-galactosyltransferase-like;family with sequence similarity 160, member A2 1125 143 B20140404_SF100_04 B20140404_SF100_04 TB501664.[MT7]-RAEQLK[MT7].2y5_1.heavy 516.824 / 732.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - B3GALTL;FAM160A2 beta 1,3-galactosyltransferase-like;family with sequence similarity 160, member A2 1127 143 B20140404_SF100_04 B20140404_SF100_04 TB501664.[MT7]-RAEQLK[MT7].2b4_1.heavy 516.824 / 629.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - B3GALTL;FAM160A2 beta 1,3-galactosyltransferase-like;family with sequence similarity 160, member A2 1129 143 B20140404_SF100_04 B20140404_SF100_04 TB501664.[MT7]-RAEQLK[MT7].2b5_1.heavy 516.824 / 742.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - B3GALTL;FAM160A2 beta 1,3-galactosyltransferase-like;family with sequence similarity 160, member A2 1131 144 B20140404_SF100_04 B20140404_SF100_04 TB154218.[MT7]-VVNIQK[MT7].2y4_1.heavy 494.823 / 646.4 27415.0 24.98390007019043 50 20 10 10 10 29.261076329081213 3.4175092835055656 0.0 3 0.9954528050415062 18.29472461424281 27415.0 33.769932352178394 0.0 - - - - - - - 703.8571428571429 54 7 LNX1 ligand of numb-protein X 1 1133 144 B20140404_SF100_04 B20140404_SF100_04 TB154218.[MT7]-VVNIQK[MT7].2y5_1.heavy 494.823 / 745.469 33091.0 24.98390007019043 50 20 10 10 10 29.261076329081213 3.4175092835055656 0.0 3 0.9954528050415062 18.29472461424281 33091.0 33.75668413680552 0.0 - - - - - - - 1271.625 66 8 LNX1 ligand of numb-protein X 1 1135 144 B20140404_SF100_04 B20140404_SF100_04 TB154218.[MT7]-VVNIQK[MT7].2b4_1.heavy 494.823 / 570.373 12744.0 24.98390007019043 50 20 10 10 10 29.261076329081213 3.4175092835055656 0.0 3 0.9954528050415062 18.29472461424281 12744.0 14.37510168778087 0.0 - - - - - - - 1306.4 25 10 LNX1 ligand of numb-protein X 1 1137 144 B20140404_SF100_04 B20140404_SF100_04 TB154218.[MT7]-VVNIQK[MT7].2y3_1.heavy 494.823 / 532.357 11352.0 24.98390007019043 50 20 10 10 10 29.261076329081213 3.4175092835055656 0.0 3 0.9954528050415062 18.29472461424281 11352.0 9.044262437072698 2.0 - - - - - - - 1298.375 25 8 LNX1 ligand of numb-protein X 1 1139 145 B20140404_SF100_04 B20140404_SF100_04 TB501523.[MT7]-TQGSLR.2y4_1.heavy 403.236 / 432.257 6474.0 18.938199996948242 42 16 10 10 6 3.5784671958040866 27.944925726091462 0.0 5 0.96770641278522 6.849021022268509 6474.0 7.992853906764501 1.0 - - - - - - - 729.5384615384615 12 13 RANBP3 RAN binding protein 3 1141 145 B20140404_SF100_04 B20140404_SF100_04 TB501523.[MT7]-TQGSLR.2b3_2.heavy 403.236 / 216.122 N/A 18.938199996948242 42 16 10 10 6 3.5784671958040866 27.944925726091462 0.0 5 0.96770641278522 6.849021022268509 2911.0 1.317177267190523 17.0 - - - - - - - 1294.8 31 5 RANBP3 RAN binding protein 3 1143 145 B20140404_SF100_04 B20140404_SF100_04 TB501523.[MT7]-TQGSLR.2y5_1.heavy 403.236 / 560.315 19873.0 18.938199996948242 42 16 10 10 6 3.5784671958040866 27.944925726091462 0.0 5 0.96770641278522 6.849021022268509 19873.0 22.093885997252947 0.0 - - - - - - - 803.0 39 7 RANBP3 RAN binding protein 3 1145 145 B20140404_SF100_04 B20140404_SF100_04 TB501523.[MT7]-TQGSLR.2b4_1.heavy 403.236 / 518.269 7829.0 18.938199996948242 42 16 10 10 6 3.5784671958040866 27.944925726091462 0.0 5 0.96770641278522 6.849021022268509 7829.0 5.532509823482071 2.0 - - - - - - - 351.6666666666667 32 3 RANBP3 RAN binding protein 3 1147 146 B20140404_SF100_04 B20140404_SF100_04 TB501921.[MT7]-SVLSLERLPDPQR.3y6_1.heavy 551.985 / 725.394 13993.0 30.958999633789062 41 13 10 10 8 2.4352464340204403 41.06360596734607 0.0 4 0.9198824539979631 4.330673524100214 13993.0 23.289199761509018 0.0 - - - - - - - 483.0 27 2 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1149 146 B20140404_SF100_04 B20140404_SF100_04 TB501921.[MT7]-SVLSLERLPDPQR.3b4_1.heavy 551.985 / 531.326 17532.0 30.958999633789062 41 13 10 10 8 2.4352464340204403 41.06360596734607 0.0 4 0.9198824539979631 4.330673524100214 17532.0 7.045833479049136 1.0 - - - - - - - 1448.0 76 1 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1151 146 B20140404_SF100_04 B20140404_SF100_04 TB501921.[MT7]-SVLSLERLPDPQR.3b10_2.heavy 551.985 / 627.862 336806.0 30.958999633789062 41 13 10 10 8 2.4352464340204403 41.06360596734607 0.0 4 0.9198824539979631 4.330673524100214 336806.0 393.88479302623034 0.0 - - - - - - - 322.0 673 1 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1153 146 B20140404_SF100_04 B20140404_SF100_04 TB501921.[MT7]-SVLSLERLPDPQR.3y5_1.heavy 551.985 / 612.31 27183.0 30.958999633789062 41 13 10 10 8 2.4352464340204403 41.06360596734607 0.0 4 0.9198824539979631 4.330673524100214 27183.0 23.51581773521686 0.0 - - - - - - - 723.5 54 2 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1155 147 B20140404_SF100_04 B20140404_SF100_04 TB154904.[MT7]-ISYWPADPEISLLTEASSSEDAK[MT7].3y7_1.heavy 933.139 / 867.418 7971.0 39.047401428222656 47 17 10 10 10 3.0717985132117422 32.554218504209196 0.0 3 0.9729349578148636 7.484686289265217 7971.0 8.963802359472119 0.0 - - - - - - - 1186.857142857143 15 7 CDADC1 cytidine and dCMP deaminase domain containing 1 1157 147 B20140404_SF100_04 B20140404_SF100_04 TB154904.[MT7]-ISYWPADPEISLLTEASSSEDAK[MT7].3b4_1.heavy 933.139 / 694.368 12125.0 39.047401428222656 47 17 10 10 10 3.0717985132117422 32.554218504209196 0.0 3 0.9729349578148636 7.484686289265217 12125.0 14.085240741935978 0.0 - - - - - - - 1138.857142857143 24 7 CDADC1 cytidine and dCMP deaminase domain containing 1 1159 147 B20140404_SF100_04 B20140404_SF100_04 TB154904.[MT7]-ISYWPADPEISLLTEASSSEDAK[MT7].3b3_1.heavy 933.139 / 508.289 7073.0 39.047401428222656 47 17 10 10 10 3.0717985132117422 32.554218504209196 0.0 3 0.9729349578148636 7.484686289265217 7073.0 8.432513251497404 0.0 - - - - - - - 1251.142857142857 14 7 CDADC1 cytidine and dCMP deaminase domain containing 1 1161 147 B20140404_SF100_04 B20140404_SF100_04 TB154904.[MT7]-ISYWPADPEISLLTEASSSEDAK[MT7].3b7_1.heavy 933.139 / 977.485 10104.0 39.047401428222656 47 17 10 10 10 3.0717985132117422 32.554218504209196 0.0 3 0.9729349578148636 7.484686289265217 10104.0 12.978093211794107 0.0 - - - - - - - 1222.5555555555557 20 9 CDADC1 cytidine and dCMP deaminase domain containing 1 1163 148 B20140404_SF100_04 B20140404_SF100_04 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 902218.0 30.12809944152832 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 902218.0 502.23590537708424 0.0 - - - - - - - 1283.3333333333333 1804 3 1165 148 B20140404_SF100_04 B20140404_SF100_04 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 905586.0 30.12809944152832 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 905586.0 1130.7302033493877 0.0 - - - - - - - 1693.0 1811 1 1167 148 B20140404_SF100_04 B20140404_SF100_04 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1556160.0 30.12809944152832 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1556160.0 562.1503269892697 0.0 - - - - - - - 2309.0 3112 1 1169 149 B20140404_SF100_04 B20140404_SF100_04 TB154761.[MT7]-NFDFDFGFC[CAM]IPSSR.3y6_1.heavy 618.286 / 719.351 122782.0 39.2244987487793 47 17 10 10 10 2.275456649385713 35.03332086992393 0.0 3 0.976133114665185 7.97254392166117 122782.0 90.29187439009543 0.0 - - - - - - - 444.0 245 1 UNC119B unc-119 homolog B (C. elegans) 1171 149 B20140404_SF100_04 B20140404_SF100_04 TB154761.[MT7]-NFDFDFGFC[CAM]IPSSR.3b5_1.heavy 618.286 / 783.343 138005.0 39.2244987487793 47 17 10 10 10 2.275456649385713 35.03332086992393 0.0 3 0.976133114665185 7.97254392166117 138005.0 121.9246957251294 0.0 - - - - - - - 277.5 276 2 UNC119B unc-119 homolog B (C. elegans) 1173 149 B20140404_SF100_04 B20140404_SF100_04 TB154761.[MT7]-NFDFDFGFC[CAM]IPSSR.3b3_1.heavy 618.286 / 521.248 88447.0 39.2244987487793 47 17 10 10 10 2.275456649385713 35.03332086992393 0.0 3 0.976133114665185 7.97254392166117 88447.0 63.02459720447734 0.0 - - - - - - - 333.0 176 4 UNC119B unc-119 homolog B (C. elegans) 1175 149 B20140404_SF100_04 B20140404_SF100_04 TB154761.[MT7]-NFDFDFGFC[CAM]IPSSR.3b7_1.heavy 618.286 / 987.433 62002.0 39.2244987487793 47 17 10 10 10 2.275456649385713 35.03332086992393 0.0 3 0.976133114665185 7.97254392166117 62002.0 134.50715739130436 0.0 - - - - - - - 333.0 124 5 UNC119B unc-119 homolog B (C. elegans) 1177 150 B20140404_SF100_04 B20140404_SF100_04 TB344712.[MT7]-HGPLGDNEER.2y6_1.heavy 634.311 / 719.295 685.0 20.413224697113037 36 17 10 3 6 1.1284069189290953 51.82589476598064 0.06309890747070312 5 0.9780365043455662 8.31215308189398 685.0 0.14668094218415414 5.0 - - - - - - - 0.0 1 0 CDADC1 cytidine and dCMP deaminase domain containing 1 1179 150 B20140404_SF100_04 B20140404_SF100_04 TB344712.[MT7]-HGPLGDNEER.2b9_1.heavy 634.311 / 1093.5 436.0 20.413224697113037 36 17 10 3 6 1.1284069189290953 51.82589476598064 0.06309890747070312 5 0.9780365043455662 8.31215308189398 436.0 -0.5 7.0 - - - - - - - 0.0 1 0 CDADC1 cytidine and dCMP deaminase domain containing 1 1181 150 B20140404_SF100_04 B20140404_SF100_04 TB344712.[MT7]-HGPLGDNEER.2y9_1.heavy 634.311 / 986.454 7600.0 20.413224697113037 36 17 10 3 6 1.1284069189290953 51.82589476598064 0.06309890747070312 5 0.9780365043455662 8.31215308189398 7600.0 71.82610932475885 0.0 - - - - - - - 141.77777777777777 15 18 CDADC1 cytidine and dCMP deaminase domain containing 1 1183 150 B20140404_SF100_04 B20140404_SF100_04 TB344712.[MT7]-HGPLGDNEER.2b6_1.heavy 634.311 / 721.375 2118.0 20.413224697113037 36 17 10 3 6 1.1284069189290953 51.82589476598064 0.06309890747070312 5 0.9780365043455662 8.31215308189398 2118.0 18.443971393595774 0.0 - - - - - - - 232.78947368421052 4 19 CDADC1 cytidine and dCMP deaminase domain containing 1 1185 151 B20140404_SF100_04 B20140404_SF100_04 TB345000.[MT7]-IVLDLLVYGLYDPVNLEVIHESMK[MT7].4y5_1.heavy 765.929 / 775.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRO maestro 1187 151 B20140404_SF100_04 B20140404_SF100_04 TB345000.[MT7]-IVLDLLVYGLYDPVNLEVIHESMK[MT7].4b4_1.heavy 765.929 / 585.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRO maestro 1189 151 B20140404_SF100_04 B20140404_SF100_04 TB345000.[MT7]-IVLDLLVYGLYDPVNLEVIHESMK[MT7].4b5_1.heavy 765.929 / 698.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRO maestro 1191 151 B20140404_SF100_04 B20140404_SF100_04 TB345000.[MT7]-IVLDLLVYGLYDPVNLEVIHESMK[MT7].4b6_1.heavy 765.929 / 811.541 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRO maestro 1193 152 B20140404_SF100_04 B20140404_SF100_04 TB154883.[MT7]-NTC[CAM]EHIYEFPQLSEDVIR.3y7_1.heavy 798.722 / 831.457 27845.0 34.06949996948242 46 16 10 10 10 2.5310545348728204 31.49560301232122 0.0 3 0.964983094396134 6.575790489468773 27845.0 27.267770489356 0.0 - - - - - - - 296.2857142857143 55 7 UNC119B unc-119 homolog B (C. elegans) 1195 152 B20140404_SF100_04 B20140404_SF100_04 TB154883.[MT7]-NTC[CAM]EHIYEFPQLSEDVIR.3b4_1.heavy 798.722 / 649.273 31212.0 34.06949996948242 46 16 10 10 10 2.5310545348728204 31.49560301232122 0.0 3 0.964983094396134 6.575790489468773 31212.0 33.266402647545505 0.0 - - - - - - - 730.1818181818181 62 11 UNC119B unc-119 homolog B (C. elegans) 1197 152 B20140404_SF100_04 B20140404_SF100_04 TB154883.[MT7]-NTC[CAM]EHIYEFPQLSEDVIR.3b5_1.heavy 798.722 / 786.332 44422.0 34.06949996948242 46 16 10 10 10 2.5310545348728204 31.49560301232122 0.0 3 0.964983094396134 6.575790489468773 44422.0 77.68929650920217 0.0 - - - - - - - 791.6666666666666 88 9 UNC119B unc-119 homolog B (C. elegans) 1199 152 B20140404_SF100_04 B20140404_SF100_04 TB154883.[MT7]-NTC[CAM]EHIYEFPQLSEDVIR.3y9_1.heavy 798.722 / 1056.57 53359.0 34.06949996948242 46 16 10 10 10 2.5310545348728204 31.49560301232122 0.0 3 0.964983094396134 6.575790489468773 53359.0 175.26265753849088 0.0 - - - - - - - 604.4444444444445 106 9 UNC119B unc-119 homolog B (C. elegans) 1201 153 B20140404_SF100_04 B20140404_SF100_04 TB154882.[MT7]-TPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLR.3y6_1.heavy 1187.33 / 700.435 1055.0 42.86869812011719 35 5 10 10 10 0.3825077575832308 110.18068214944381 0.0 3 0.6154337138085654 1.9224647462939821 1055.0 0.4884259259259258 0.0 - - - - - - - 150.85714285714286 2 21 MYOZ3 myozenin 3 1203 153 B20140404_SF100_04 B20140404_SF100_04 TB154882.[MT7]-TPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLR.3y23_2.heavy 1187.33 / 1226.17 5038.0 42.86869812011719 35 5 10 10 10 0.3825077575832308 110.18068214944381 0.0 3 0.6154337138085654 1.9224647462939821 5038.0 146.94166666666666 0.0 - - - - - - - 88.61538461538461 10 13 MYOZ3 myozenin 3 1205 153 B20140404_SF100_04 B20140404_SF100_04 TB154882.[MT7]-TPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLR.3b3_1.heavy 1187.33 / 442.278 53877.0 42.86869812011719 35 5 10 10 10 0.3825077575832308 110.18068214944381 0.0 3 0.6154337138085654 1.9224647462939821 53877.0 166.12075 0.0 - - - - - - - 252.0 107 12 MYOZ3 myozenin 3 1207 153 B20140404_SF100_04 B20140404_SF100_04 TB154882.[MT7]-TPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLR.3y9_1.heavy 1187.33 / 997.604 3023.0 42.86869812011719 35 5 10 10 10 0.3825077575832308 110.18068214944381 0.0 3 0.6154337138085654 1.9224647462939821 3023.0 59.33020833333333 1.0 - - - - - - - 129.0 6 16 MYOZ3 myozenin 3 1209 154 B20140404_SF100_04 B20140404_SF100_04 TB154698.[MT7]-K[MT7]APDTQSSASEK[MT7].3y6_1.heavy 560.976 / 752.391 13153.0 18.20949935913086 50 20 10 10 10 16.36121125710606 6.11201691785305 0.0 3 0.9960057284158998 19.520858388281372 13153.0 74.61354780496269 0.0 - - - - - - - 160.27777777777777 26 18 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 1211 154 B20140404_SF100_04 B20140404_SF100_04 TB154698.[MT7]-K[MT7]APDTQSSASEK[MT7].3y3_1.heavy 560.976 / 507.289 15996.0 18.20949935913086 50 20 10 10 10 16.36121125710606 6.11201691785305 0.0 3 0.9960057284158998 19.520858388281372 15996.0 35.29806966618287 0.0 - - - - - - - 660.5714285714286 31 14 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 1213 154 B20140404_SF100_04 B20140404_SF100_04 TB154698.[MT7]-K[MT7]APDTQSSASEK[MT7].3y4_1.heavy 560.976 / 578.327 10141.0 18.20949935913086 50 20 10 10 10 16.36121125710606 6.11201691785305 0.0 3 0.9960057284158998 19.520858388281372 10141.0 64.31022454312934 0.0 - - - - - - - 187.1764705882353 20 17 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 1215 154 B20140404_SF100_04 B20140404_SF100_04 TB154698.[MT7]-K[MT7]APDTQSSASEK[MT7].3y5_1.heavy 560.976 / 665.359 9250.0 18.20949935913086 50 20 10 10 10 16.36121125710606 6.11201691785305 0.0 3 0.9960057284158998 19.520858388281372 9250.0 26.174959224524592 0.0 - - - - - - - 189.30769230769232 18 13 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 1217 155 B20140404_SF100_04 B20140404_SF100_04 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 938189.0 26.38920021057129 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 938189.0 831.9992052403355 0.0 - - - - - - - 9202.0 1876 1 1219 155 B20140404_SF100_04 B20140404_SF100_04 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 1200150.0 26.38920021057129 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1200150.0 1008.3297020336206 0.0 - - - - - - - 11503.0 2400 1 1221 155 B20140404_SF100_04 B20140404_SF100_04 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 1545150.0 26.38920021057129 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1545150.0 1667.1719505134367 0.0 - - - - - - - 10353.0 3090 1 1223 156 B20140404_SF100_04 B20140404_SF100_04 TB154496.[MT7]-ISLYQDNTGR.2y8_1.heavy 655.845 / 966.464 13050.0 27.816200256347656 48 18 10 10 10 5.158283045961745 19.386295615997035 0.0 3 0.9848829836854958 10.024915097179933 13050.0 50.80505165388591 0.0 - - - - - - - 244.8 26 10 MYOT myotilin 1225 156 B20140404_SF100_04 B20140404_SF100_04 TB154496.[MT7]-ISLYQDNTGR.2y9_1.heavy 655.845 / 1053.5 73273.0 27.816200256347656 48 18 10 10 10 5.158283045961745 19.386295615997035 0.0 3 0.9848829836854958 10.024915097179933 73273.0 135.0894621369519 0.0 - - - - - - - 226.66666666666666 146 3 MYOT myotilin 1227 156 B20140404_SF100_04 B20140404_SF100_04 TB154496.[MT7]-ISLYQDNTGR.2y6_1.heavy 655.845 / 690.317 19984.0 27.816200256347656 48 18 10 10 10 5.158283045961745 19.386295615997035 0.0 3 0.9848829836854958 10.024915097179933 19984.0 8.842569620801681 0.0 - - - - - - - 340.0 39 4 MYOT myotilin 1229 156 B20140404_SF100_04 B20140404_SF100_04 TB154496.[MT7]-ISLYQDNTGR.2y7_1.heavy 655.845 / 853.38 37792.0 27.816200256347656 48 18 10 10 10 5.158283045961745 19.386295615997035 0.0 3 0.9848829836854958 10.024915097179933 37792.0 91.54238655462186 0.0 - - - - - - - 725.3333333333334 75 9 MYOT myotilin 1231 157 B20140404_SF100_04 B20140404_SF100_04 TB154172.[MT7]-GLQDVLR.2y5_1.heavy 472.786 / 630.357 25826.0 29.88800048828125 50 20 10 10 10 8.644791801376925 11.567658573809977 0.0 3 0.993601217553143 15.419910236017502 25826.0 30.745238095238093 0.0 - - - - - - - 813.6666666666666 51 6 CCT6B;CCT6A chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin containing TCP1, subunit 6A (zeta 1) 1233 157 B20140404_SF100_04 B20140404_SF100_04 TB154172.[MT7]-GLQDVLR.2b4_1.heavy 472.786 / 558.3 174165.0 29.88800048828125 50 20 10 10 10 8.644791801376925 11.567658573809977 0.0 3 0.993601217553143 15.419910236017502 174165.0 91.48033119975808 0.0 - - - - - - - 1890.0 348 1 CCT6B;CCT6A chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin containing TCP1, subunit 6A (zeta 1) 1235 157 B20140404_SF100_04 B20140404_SF100_04 TB154172.[MT7]-GLQDVLR.2y6_1.heavy 472.786 / 743.441 37006.0 29.88800048828125 50 20 10 10 10 8.644791801376925 11.567658573809977 0.0 3 0.993601217553143 15.419910236017502 37006.0 124.96087429891126 0.0 - - - - - - - 235.875 74 8 CCT6B;CCT6A chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin containing TCP1, subunit 6A (zeta 1) 1237 157 B20140404_SF100_04 B20140404_SF100_04 TB154172.[MT7]-GLQDVLR.2b5_1.heavy 472.786 / 657.369 63147.0 29.88800048828125 50 20 10 10 10 8.644791801376925 11.567658573809977 0.0 3 0.993601217553143 15.419910236017502 63147.0 35.710444082577936 0.0 - - - - - - - 787.5 126 2 CCT6B;CCT6A chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin containing TCP1, subunit 6A (zeta 1) 1239 158 B20140404_SF100_04 B20140404_SF100_04 TB344774.[MT7]-GLHSLIFEVVR.2b8_2.heavy 707.42 / 521.296 N/A 35.65639877319336 48 20 10 10 8 5.2179251877603985 19.16470558730285 0.0 4 0.9947429313560656 17.013752176242395 26378.0 16.982078408017074 0.0 - - - - - - - 371.5 52 2 MYOT myotilin 1241 158 B20140404_SF100_04 B20140404_SF100_04 TB344774.[MT7]-GLHSLIFEVVR.2y8_1.heavy 707.42 / 962.567 23034.0 35.65639877319336 48 20 10 10 8 5.2179251877603985 19.16470558730285 0.0 4 0.9947429313560656 17.013752176242395 23034.0 41.90963150935901 0.0 - - - - - - - 743.0 46 7 MYOT myotilin 1243 158 B20140404_SF100_04 B20140404_SF100_04 TB344774.[MT7]-GLHSLIFEVVR.2y9_1.heavy 707.42 / 1099.63 10526.0 35.65639877319336 48 20 10 10 8 5.2179251877603985 19.16470558730285 0.0 4 0.9947429313560656 17.013752176242395 10526.0 41.48320951449983 0.0 - - - - - - - 268.5 21 18 MYOT myotilin 1245 158 B20140404_SF100_04 B20140404_SF100_04 TB344774.[MT7]-GLHSLIFEVVR.2y6_1.heavy 707.42 / 762.451 10155.0 35.65639877319336 48 20 10 10 8 5.2179251877603985 19.16470558730285 0.0 4 0.9947429313560656 17.013752176242395 10155.0 10.050410112855385 1.0 - - - - - - - 849.2857142857143 28 7 MYOT myotilin 1247 159 B20140404_SF100_04 B20140404_SF100_04 TB154177.[MT7]-LEC[CAM]GGK[MT7].2b3_1.heavy 476.262 / 547.267 5746.0 20.778500080108643 41 15 10 6 10 2.8090611199314073 27.249624418129702 0.03479957580566406 3 0.956733887650158 5.911667636323326 5746.0 12.377267461021246 0.0 - - - - - - - 716.2307692307693 11 13 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1249 159 B20140404_SF100_04 B20140404_SF100_04 TB154177.[MT7]-LEC[CAM]GGK[MT7].2y4_1.heavy 476.262 / 565.288 21860.0 20.778500080108643 41 15 10 6 10 2.8090611199314073 27.249624418129702 0.03479957580566406 3 0.956733887650158 5.911667636323326 21860.0 41.24093505421012 0.0 - - - - - - - 682.1666666666666 43 12 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1251 159 B20140404_SF100_04 B20140404_SF100_04 TB154177.[MT7]-LEC[CAM]GGK[MT7].2y5_1.heavy 476.262 / 694.331 31832.0 20.778500080108643 41 15 10 6 10 2.8090611199314073 27.249624418129702 0.03479957580566406 3 0.956733887650158 5.911667636323326 31832.0 39.53459927490245 0.0 - - - - - - - 713.1 63 10 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1253 159 B20140404_SF100_04 B20140404_SF100_04 TB154177.[MT7]-LEC[CAM]GGK[MT7].2b5_1.heavy 476.262 / 661.31 1783.0 20.778500080108643 41 15 10 6 10 2.8090611199314073 27.249624418129702 0.03479957580566406 3 0.956733887650158 5.911667636323326 1783.0 2.4313636363636366 11.0 - - - - - - - 695.1764705882352 16 17 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1255 160 B20140404_SF100_04 B20140404_SF100_04 TB344773.[MT7]-LMIENPYETR.2y5_1.heavy 705.364 / 665.325 22421.0 31.95400047302246 44 14 10 10 10 2.094711080566488 38.284976533045004 0.0 3 0.9365739670125901 4.8742293689256755 22421.0 19.623292194512665 0.0 - - - - - - - 389.0 44 2 UNC119B unc-119 homolog B (C. elegans) 1257 160 B20140404_SF100_04 B20140404_SF100_04 TB344773.[MT7]-LMIENPYETR.2y9_1.heavy 705.364 / 1152.54 21643.0 31.95400047302246 44 14 10 10 10 2.094711080566488 38.284976533045004 0.0 3 0.9365739670125901 4.8742293689256755 21643.0 52.164133447214574 0.0 - - - - - - - 333.2857142857143 43 7 UNC119B unc-119 homolog B (C. elegans) 1259 160 B20140404_SF100_04 B20140404_SF100_04 TB344773.[MT7]-LMIENPYETR.2y6_1.heavy 705.364 / 779.368 19619.0 31.95400047302246 44 14 10 10 10 2.094711080566488 38.284976533045004 0.0 3 0.9365739670125901 4.8742293689256755 19619.0 52.51095493309898 0.0 - - - - - - - 778.5714285714286 39 7 UNC119B unc-119 homolog B (C. elegans) 1261 160 B20140404_SF100_04 B20140404_SF100_04 TB344773.[MT7]-LMIENPYETR.2y7_1.heavy 705.364 / 908.411 21332.0 31.95400047302246 44 14 10 10 10 2.094711080566488 38.284976533045004 0.0 3 0.9365739670125901 4.8742293689256755 21332.0 46.0224180234364 0.0 - - - - - - - 739.875 42 8 UNC119B unc-119 homolog B (C. elegans) 1263 161 B20140404_SF100_04 B20140404_SF100_04 TB154175.[MT7]-LSSDLK[MT7].2y4_1.heavy 475.792 / 606.358 23774.0 25.120899200439453 45 17 10 10 8 4.059668784468606 18.175937298197752 0.0 4 0.9740551064458479 7.645272113866817 23774.0 28.07262721432387 1.0 - - - - - - - 321.0 209 1 PRKACG;PLXNA4 protein kinase, cAMP-dependent, catalytic, gamma;plexin A4 1265 161 B20140404_SF100_04 B20140404_SF100_04 TB154175.[MT7]-LSSDLK[MT7].2y5_1.heavy 475.792 / 693.39 116835.0 25.120899200439453 45 17 10 10 8 4.059668784468606 18.175937298197752 0.0 4 0.9740551064458479 7.645272113866817 116835.0 42.41069273045336 0.0 - - - - - - - 321.0 233 1 PRKACG;PLXNA4 protein kinase, cAMP-dependent, catalytic, gamma;plexin A4 1267 161 B20140404_SF100_04 B20140404_SF100_04 TB154175.[MT7]-LSSDLK[MT7].2b4_1.heavy 475.792 / 547.284 136754.0 25.120899200439453 45 17 10 10 8 4.059668784468606 18.175937298197752 0.0 4 0.9740551064458479 7.645272113866817 136754.0 64.42703633222003 0.0 - - - - - - - 814.2 273 5 PRKACG;PLXNA4 protein kinase, cAMP-dependent, catalytic, gamma;plexin A4 1269 161 B20140404_SF100_04 B20140404_SF100_04 TB154175.[MT7]-LSSDLK[MT7].2y3_1.heavy 475.792 / 519.326 12101.0 25.120899200439453 45 17 10 10 8 4.059668784468606 18.175937298197752 0.0 4 0.9740551064458479 7.645272113866817 12101.0 10.13758219770479 1.0 - - - - - - - 750.0 72 2 PRKACG;PLXNA4 protein kinase, cAMP-dependent, catalytic, gamma;plexin A4 1271 162 B20140404_SF100_04 B20140404_SF100_04 TB502058.[MT7]-LVGGSETPLVHIIIQHIYR.4y8_1.heavy 573.085 / 1055.64 7291.0 38.17020034790039 39 9 10 10 10 0.7932779052719963 65.39172941794747 0.0 3 0.8112476409029543 2.794701951073374 7291.0 -0.36597654880662345 2.0 - - - - - - - 208.23076923076923 16 13 LNX1 ligand of numb-protein X 1 1273 162 B20140404_SF100_04 B20140404_SF100_04 TB502058.[MT7]-LVGGSETPLVHIIIQHIYR.4y7_1.heavy 573.085 / 942.552 19991.0 38.17020034790039 39 9 10 10 10 0.7932779052719963 65.39172941794747 0.0 3 0.8112476409029543 2.794701951073374 19991.0 75.08705246779563 0.0 - - - - - - - 326.6666666666667 39 9 LNX1 ligand of numb-protein X 1 1275 162 B20140404_SF100_04 B20140404_SF100_04 TB502058.[MT7]-LVGGSETPLVHIIIQHIYR.4y6_1.heavy 573.085 / 829.468 12230.0 38.17020034790039 39 9 10 10 10 0.7932779052719963 65.39172941794747 0.0 3 0.8112476409029543 2.794701951073374 12230.0 43.48619245148484 0.0 - - - - - - - 310.09090909090907 24 11 LNX1 ligand of numb-protein X 1 1277 162 B20140404_SF100_04 B20140404_SF100_04 TB502058.[MT7]-LVGGSETPLVHIIIQHIYR.4b6_1.heavy 573.085 / 687.379 31281.0 38.17020034790039 39 9 10 10 10 0.7932779052719963 65.39172941794747 0.0 3 0.8112476409029543 2.794701951073374 31281.0 91.49205785931393 0.0 - - - - - - - 323.5 62 8 LNX1 ligand of numb-protein X 1 1279 163 B20140404_SF100_04 B20140404_SF100_04 TB154174.[MT7]-ELVVAK[MT7].2y4_1.heavy 473.812 / 560.389 27510.0 25.732900619506836 46 18 10 10 8 2.9878561801420496 23.282858962993096 0.0 4 0.9840947209315125 9.772696371331861 27510.0 11.768276856524874 4.0 - - - - - - - 1700.7142857142858 65 7 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 1281 163 B20140404_SF100_04 B20140404_SF100_04 TB154174.[MT7]-ELVVAK[MT7].2b3_1.heavy 473.812 / 486.304 29822.0 25.732900619506836 46 18 10 10 8 2.9878561801420496 23.282858962993096 0.0 4 0.9840947209315125 9.772696371331861 29822.0 17.855832599349903 0.0 - - - - - - - 1188.7142857142858 59 7 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 1283 163 B20140404_SF100_04 B20140404_SF100_04 TB154174.[MT7]-ELVVAK[MT7].2y5_1.heavy 473.812 / 673.473 35255.0 25.732900619506836 46 18 10 10 8 2.9878561801420496 23.282858962993096 0.0 4 0.9840947209315125 9.772696371331861 35255.0 24.968996014220057 0.0 - - - - - - - 1223.1666666666667 70 12 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 1285 163 B20140404_SF100_04 B20140404_SF100_04 TB154174.[MT7]-ELVVAK[MT7].2b4_1.heavy 473.812 / 585.373 13408.0 25.732900619506836 46 18 10 10 8 2.9878561801420496 23.282858962993096 0.0 4 0.9840947209315125 9.772696371331861 13408.0 14.378773795141441 2.0 - - - - - - - 710.2857142857143 37 7 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 1287 164 B20140404_SF100_04 B20140404_SF100_04 TB154685.[MT7]-GLPAGQAEVEMIER.2y4_1.heavy 822.431 / 548.286 6408.0 31.2716007232666 35 13 4 10 8 2.0392738754993758 38.89953309716222 0.0 4 0.9031872367235522 3.93394595041502 6408.0 16.831236520411235 1.0 - - - - - - - 328.6666666666667 23 12 C3orf15 chromosome 3 open reading frame 15 1289 164 B20140404_SF100_04 B20140404_SF100_04 TB154685.[MT7]-GLPAGQAEVEMIER.2y6_1.heavy 822.431 / 776.397 2793.0 31.2716007232666 35 13 4 10 8 2.0392738754993758 38.89953309716222 0.0 4 0.9031872367235522 3.93394595041502 2793.0 0.417920353982301 4.0 - - - - - - - 892.1428571428571 5 7 C3orf15 chromosome 3 open reading frame 15 1291 164 B20140404_SF100_04 B20140404_SF100_04 TB154685.[MT7]-GLPAGQAEVEMIER.2y10_1.heavy 822.431 / 1161.56 4437.0 31.2716007232666 35 13 4 10 8 2.0392738754993758 38.89953309716222 0.0 4 0.9031872367235522 3.93394595041502 4437.0 8.575051825615917 0.0 - - - - - - - 274.0 8 6 C3orf15 chromosome 3 open reading frame 15 1293 164 B20140404_SF100_04 B20140404_SF100_04 TB154685.[MT7]-GLPAGQAEVEMIER.2y11_1.heavy 822.431 / 1232.59 2300.0 31.2716007232666 35 13 4 10 8 2.0392738754993758 38.89953309716222 0.0 4 0.9031872367235522 3.93394595041502 2300.0 5.2468853080919535 0.0 - - - - - - - 253.9090909090909 4 11 C3orf15 chromosome 3 open reading frame 15 1295 165 B20140404_SF100_04 B20140404_SF100_04 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 472200.0 33.4025993347168 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 472200.0 122.57628864527841 0.0 - - - - - - - 1164.75 944 8 1297 165 B20140404_SF100_04 B20140404_SF100_04 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 1083400.0 33.4025993347168 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1083400.0 131.21892558253808 0.0 - - - - - - - 344.0 2166 5 1299 165 B20140404_SF100_04 B20140404_SF100_04 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 1051240.0 33.4025993347168 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1051240.0 101.06239903094148 0.0 - - - - - - - 382.3333333333333 2102 3 1301 166 B20140404_SF100_04 B20140404_SF100_04 TB501893.[MT7]-ALADMFDFLSK[MT7].3b4_1.heavy 515.946 / 515.295 48682.0 42.12220001220703 46 16 10 10 10 3.188201591139483 31.365645220777704 0.0 3 0.9658829690342714 6.662453975860747 48682.0 80.82991530262271 0.0 - - - - - - - 782.5714285714286 97 7 C3orf15 chromosome 3 open reading frame 15 1303 166 B20140404_SF100_04 B20140404_SF100_04 TB501893.[MT7]-ALADMFDFLSK[MT7].3b5_1.heavy 515.946 / 646.335 26768.0 42.12220001220703 46 16 10 10 10 3.188201591139483 31.365645220777704 0.0 3 0.9658829690342714 6.662453975860747 26768.0 135.6882604481738 0.0 - - - - - - - 310.05263157894734 53 19 C3orf15 chromosome 3 open reading frame 15 1305 166 B20140404_SF100_04 B20140404_SF100_04 TB501893.[MT7]-ALADMFDFLSK[MT7].3y4_1.heavy 515.946 / 638.399 11096.0 42.12220001220703 46 16 10 10 10 3.188201591139483 31.365645220777704 0.0 3 0.9658829690342714 6.662453975860747 11096.0 91.75538461538463 0.0 - - - - - - - 164.5625 22 16 C3orf15 chromosome 3 open reading frame 15 1307 166 B20140404_SF100_04 B20140404_SF100_04 TB501893.[MT7]-ALADMFDFLSK[MT7].3b7_1.heavy 515.946 / 908.43 22469.0 42.12220001220703 46 16 10 10 10 3.188201591139483 31.365645220777704 0.0 3 0.9658829690342714 6.662453975860747 22469.0 215.99637016354208 0.0 - - - - - - - 221.0 44 16 C3orf15 chromosome 3 open reading frame 15 1309 167 B20140404_SF100_04 B20140404_SF100_04 TB502041.[MT7]-TLGVHPDDDLLFTVFSK[MT7].3b9_2.heavy 731.4 / 547.765 123147.0 38.64970016479492 44 14 10 10 10 7.726964795493121 12.941692196957677 0.0 3 0.9415558729379121 5.079883266307063 123147.0 113.54455761791272 0.0 - - - - - - - 233.5 246 4 PLXNA4 plexin A4 1311 167 B20140404_SF100_04 B20140404_SF100_04 TB502041.[MT7]-TLGVHPDDDLLFTVFSK[MT7].3y6_1.heavy 731.4 / 872.5 46413.0 38.64970016479492 44 14 10 10 10 7.726964795493121 12.941692196957677 0.0 3 0.9415558729379121 5.079883266307063 46413.0 46.71229002408927 0.0 - - - - - - - 783.0 92 7 PLXNA4 plexin A4 1313 167 B20140404_SF100_04 B20140404_SF100_04 TB502041.[MT7]-TLGVHPDDDLLFTVFSK[MT7].3y3_1.heavy 731.4 / 525.315 99124.0 38.64970016479492 44 14 10 10 10 7.726964795493121 12.941692196957677 0.0 3 0.9415558729379121 5.079883266307063 99124.0 106.97562922065754 0.0 - - - - - - - 408.0 198 2 PLXNA4 plexin A4 1315 167 B20140404_SF100_04 B20140404_SF100_04 TB502041.[MT7]-TLGVHPDDDLLFTVFSK[MT7].3b4_1.heavy 731.4 / 515.331 39066.0 38.64970016479492 44 14 10 10 10 7.726964795493121 12.941692196957677 0.0 3 0.9415558729379121 5.079883266307063 39066.0 41.47765839215921 0.0 - - - - - - - 1282.5714285714287 78 7 PLXNA4 plexin A4 1317 168 B20140404_SF100_04 B20140404_SF100_04 TB154681.[MT7]-DHTQANIQATLIR.3b6_1.heavy 542.301 / 811.381 51789.0 27.471900939941406 48 18 10 10 10 6.356620159789062 15.731630565655568 0.0 3 0.9883733497658407 11.434400075873935 51789.0 35.732757417752026 0.0 - - - - - - - 1148.125 103 8 C3orf15 chromosome 3 open reading frame 15 1319 168 B20140404_SF100_04 B20140404_SF100_04 TB154681.[MT7]-DHTQANIQATLIR.3y6_1.heavy 542.301 / 701.43 137928.0 27.471900939941406 48 18 10 10 10 6.356620159789062 15.731630565655568 0.0 3 0.9883733497658407 11.434400075873935 137928.0 65.42486904819503 0.0 - - - - - - - 1236.0 275 7 C3orf15 chromosome 3 open reading frame 15 1321 168 B20140404_SF100_04 B20140404_SF100_04 TB154681.[MT7]-DHTQANIQATLIR.3y4_1.heavy 542.301 / 502.335 70029.0 27.471900939941406 48 18 10 10 10 6.356620159789062 15.731630565655568 0.0 3 0.9883733497658407 11.434400075873935 70029.0 43.262787305136996 0.0 - - - - - - - 1264.5 140 2 C3orf15 chromosome 3 open reading frame 15 1323 168 B20140404_SF100_04 B20140404_SF100_04 TB154681.[MT7]-DHTQANIQATLIR.3y5_1.heavy 542.301 / 573.372 155901.0 27.471900939941406 48 18 10 10 10 6.356620159789062 15.731630565655568 0.0 3 0.9883733497658407 11.434400075873935 155901.0 61.307986356027946 0.0 - - - - - - - 533.0 311 1 C3orf15 chromosome 3 open reading frame 15 1325 169 B20140404_SF100_04 B20140404_SF100_04 TB502046.[MT7]-LREGPELSPDDPAGLLDLR.3y7_1.heavy 736.398 / 757.457 14489.0 35.41559982299805 48 18 10 10 10 3.5361485316768344 28.27935509614473 0.0 3 0.9820208945528485 9.190211136243375 14489.0 9.79430288823338 0.0 - - - - - - - 1138.0 28 8 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 1327 169 B20140404_SF100_04 B20140404_SF100_04 TB502046.[MT7]-LREGPELSPDDPAGLLDLR.3y6_1.heavy 736.398 / 686.42 18720.0 35.41559982299805 48 18 10 10 10 3.5361485316768344 28.27935509614473 0.0 3 0.9820208945528485 9.190211136243375 18720.0 9.91533042104285 0.0 - - - - - - - 726.6666666666666 37 3 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 1329 169 B20140404_SF100_04 B20140404_SF100_04 TB502046.[MT7]-LREGPELSPDDPAGLLDLR.3b6_1.heavy 736.398 / 826.454 21156.0 35.41559982299805 48 18 10 10 10 3.5361485316768344 28.27935509614473 0.0 3 0.9820208945528485 9.190211136243375 21156.0 19.29199782508397 0.0 - - - - - - - 256.0 42 1 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 1331 169 B20140404_SF100_04 B20140404_SF100_04 TB502046.[MT7]-LREGPELSPDDPAGLLDLR.3y8_1.heavy 736.398 / 854.509 62698.0 35.41559982299805 48 18 10 10 10 3.5361485316768344 28.27935509614473 0.0 3 0.9820208945528485 9.190211136243375 62698.0 39.00864526314706 0.0 - - - - - - - 385.0 125 1 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 1333 170 B20140404_SF100_04 B20140404_SF100_04 TB501808.[MT7]-DFEAIIQAK[MT7].2y4_1.heavy 661.882 / 603.395 31801.0 32.730098724365234 43 13 10 10 10 2.1414934901680827 46.69638290245335 0.0 3 0.9148322055210919 4.198489333772238 31801.0 30.48467286467137 0.0 - - - - - - - 316.0 63 1 RNF8 ring finger protein 8 1335 170 B20140404_SF100_04 B20140404_SF100_04 TB501808.[MT7]-DFEAIIQAK[MT7].2b3_1.heavy 661.882 / 536.247 22308.0 32.730098724365234 43 13 10 10 10 2.1414934901680827 46.69638290245335 0.0 3 0.9148322055210919 4.198489333772238 22308.0 26.777234792716 0.0 - - - - - - - 751.5 44 8 RNF8 ring finger protein 8 1337 170 B20140404_SF100_04 B20140404_SF100_04 TB501808.[MT7]-DFEAIIQAK[MT7].2b4_1.heavy 661.882 / 607.284 34016.0 32.730098724365234 43 13 10 10 10 2.1414934901680827 46.69638290245335 0.0 3 0.9148322055210919 4.198489333772238 34016.0 30.471850582752534 0.0 - - - - - - - 1305.375 68 8 RNF8 ring finger protein 8 1339 170 B20140404_SF100_04 B20140404_SF100_04 TB501808.[MT7]-DFEAIIQAK[MT7].2b5_1.heavy 661.882 / 720.369 27371.0 32.730098724365234 43 13 10 10 10 2.1414934901680827 46.69638290245335 0.0 3 0.9148322055210919 4.198489333772238 27371.0 37.8242108887587 0.0 - - - - - - - 237.0 54 2 RNF8 ring finger protein 8 1341 171 B20140404_SF100_04 B20140404_SF100_04 TB154057.[MT7]-AGAVLGR.2b3_1.heavy 394.249 / 344.205 44569.0 23.255699157714844 43 13 10 10 10 1.1592768861982765 53.00287338200488 0.0 3 0.9209562715102981 4.360392566598966 44569.0 7.087815026773287 0.0 - - - - - - - 2311.1666666666665 89 6 PLXNA4 plexin A4 1343 171 B20140404_SF100_04 B20140404_SF100_04 TB154057.[MT7]-AGAVLGR.2b4_1.heavy 394.249 / 443.273 62711.0 23.255699157714844 43 13 10 10 10 1.1592768861982765 53.00287338200488 0.0 3 0.9209562715102981 4.360392566598966 62711.0 57.800652496642556 0.0 - - - - - - - 1090.5 125 8 PLXNA4 plexin A4 1345 171 B20140404_SF100_04 B20140404_SF100_04 TB154057.[MT7]-AGAVLGR.2y6_1.heavy 394.249 / 572.352 122020.0 23.255699157714844 43 13 10 10 10 1.1592768861982765 53.00287338200488 0.0 3 0.9209562715102981 4.360392566598966 122020.0 129.76078855615847 0.0 - - - - - - - 305.5 244 2 PLXNA4 plexin A4 1347 171 B20140404_SF100_04 B20140404_SF100_04 TB154057.[MT7]-AGAVLGR.2b5_1.heavy 394.249 / 556.357 25817.0 23.255699157714844 43 13 10 10 10 1.1592768861982765 53.00287338200488 0.0 3 0.9209562715102981 4.360392566598966 25817.0 31.002283311262076 1.0 - - - - - - - 1308.4285714285713 134 7 PLXNA4 plexin A4 1349 172 B20140404_SF100_04 B20140404_SF100_04 TB501807.[MT7]-GDQLYYFK[MT7].2y4_1.heavy 661.355 / 764.41 11671.0 31.413350582122803 39 18 8 3 10 2.6029196367579526 30.70483060003302 0.05140113830566406 3 0.9801465027195939 8.744252859051354 11671.0 9.269188884137787 0.0 - - - - - - - 405.0 23 2 ARHGAP24 Rho GTPase activating protein 24 1351 172 B20140404_SF100_04 B20140404_SF100_04 TB501807.[MT7]-GDQLYYFK[MT7].2b5_1.heavy 661.355 / 721.364 8753.0 31.413350582122803 39 18 8 3 10 2.6029196367579526 30.70483060003302 0.05140113830566406 3 0.9801465027195939 8.744252859051354 8753.0 2.849966936718913 2.0 - - - - - - - 396.0 32 9 ARHGAP24 Rho GTPase activating protein 24 1353 172 B20140404_SF100_04 B20140404_SF100_04 TB501807.[MT7]-GDQLYYFK[MT7].2b4_1.heavy 661.355 / 558.3 11671.0 31.413350582122803 39 18 8 3 10 2.6029196367579526 30.70483060003302 0.05140113830566406 3 0.9801465027195939 8.744252859051354 11671.0 11.662536010623036 1.0 - - - - - - - 1204.4285714285713 23 7 ARHGAP24 Rho GTPase activating protein 24 1355 172 B20140404_SF100_04 B20140404_SF100_04 TB501807.[MT7]-GDQLYYFK[MT7].2y3_1.heavy 661.355 / 601.347 9888.0 31.413350582122803 39 18 8 3 10 2.6029196367579526 30.70483060003302 0.05140113830566406 3 0.9801465027195939 8.744252859051354 9888.0 11.299992565164576 0.0 - - - - - - - 162.0 19 1 ARHGAP24 Rho GTPase activating protein 24 1357 173 B20140404_SF100_04 B20140404_SF100_04 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 639955.0 35.38050079345703 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 639955.0 148.7198419740567 0.0 - - - - - - - 382.0 1279 3 1359 173 B20140404_SF100_04 B20140404_SF100_04 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 1186500.0 35.38050079345703 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1186500.0 214.93835714901596 0.0 - - - - - - - 763.0 2373 1 1361 173 B20140404_SF100_04 B20140404_SF100_04 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 1413280.0 35.38050079345703 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1413280.0 205.97895681965048 0.0 - - - - - - - 254.0 2826 1 1363 174 B20140404_SF100_04 B20140404_SF100_04 TB501806.[MT7]-SSDNVSVTVLR.2y8_1.heavy 660.866 / 887.531 34845.0 27.898500442504883 46 16 10 10 10 8.124154831442537 12.308972696208926 0.0 3 0.9650356317167009 6.580758199611927 34845.0 49.67985880645881 0.0 - - - - - - - 238.25 69 8 LRP11 low density lipoprotein receptor-related protein 11 1365 174 B20140404_SF100_04 B20140404_SF100_04 TB501806.[MT7]-SSDNVSVTVLR.2b4_1.heavy 660.866 / 548.243 12717.0 27.898500442504883 46 16 10 10 10 8.124154831442537 12.308972696208926 0.0 3 0.9650356317167009 6.580758199611927 12717.0 5.166392585842128 0.0 - - - - - - - 2177.875 25 8 LRP11 low density lipoprotein receptor-related protein 11 1367 174 B20140404_SF100_04 B20140404_SF100_04 TB501806.[MT7]-SSDNVSVTVLR.2y6_1.heavy 660.866 / 674.42 16532.0 27.898500442504883 46 16 10 10 10 8.124154831442537 12.308972696208926 0.0 3 0.9650356317167009 6.580758199611927 16532.0 15.95495803583619 0.0 - - - - - - - 744.8571428571429 33 7 LRP11 low density lipoprotein receptor-related protein 11 1369 174 B20140404_SF100_04 B20140404_SF100_04 TB501806.[MT7]-SSDNVSVTVLR.2y10_1.heavy 660.866 / 1089.59 19584.0 27.898500442504883 46 16 10 10 10 8.124154831442537 12.308972696208926 0.0 3 0.9650356317167009 6.580758199611927 19584.0 30.808455801929007 0.0 - - - - - - - 211.83333333333334 39 6 LRP11 low density lipoprotein receptor-related protein 11 1371 175 B20140404_SF100_04 B20140404_SF100_04 TB154308.[MT7]-QVTLALQR.2y5_1.heavy 536.833 / 600.383 8388.0 28.05660057067871 48 18 10 10 10 5.018817420712445 19.92501253129956 0.0 3 0.981513912140028 9.062928431905219 8388.0 9.165578994717833 1.0 - - - - - - - 829.3333333333334 22 6 C3orf15 chromosome 3 open reading frame 15 1373 175 B20140404_SF100_04 B20140404_SF100_04 TB154308.[MT7]-QVTLALQR.2y6_1.heavy 536.833 / 701.43 23743.0 28.05660057067871 48 18 10 10 10 5.018817420712445 19.92501253129956 0.0 3 0.981513912140028 9.062928431905219 23743.0 16.244350214890616 0.0 - - - - - - - 771.8571428571429 47 7 C3orf15 chromosome 3 open reading frame 15 1375 175 B20140404_SF100_04 B20140404_SF100_04 TB154308.[MT7]-QVTLALQR.2b5_1.heavy 536.833 / 657.405 13791.0 28.05660057067871 48 18 10 10 10 5.018817420712445 19.92501253129956 0.0 3 0.981513912140028 9.062928431905219 13791.0 16.418607159172485 0.0 - - - - - - - 771.8571428571429 27 7 C3orf15 chromosome 3 open reading frame 15 1377 175 B20140404_SF100_04 B20140404_SF100_04 TB154308.[MT7]-QVTLALQR.2y7_1.heavy 536.833 / 800.499 27724.0 28.05660057067871 48 18 10 10 10 5.018817420712445 19.92501253129956 0.0 3 0.981513912140028 9.062928431905219 27724.0 10.392804872844065 0.0 - - - - - - - 284.3333333333333 55 3 C3orf15 chromosome 3 open reading frame 15 1379 176 B20140404_SF100_04 B20140404_SF100_04 TB501604.[MT7]-VAQGWVR.2y4_1.heavy 480.281 / 517.288 52204.0 27.42959976196289 48 20 10 10 8 14.292437625515113 6.996707113241357 0.0 4 0.991349831870039 13.259786691875842 52204.0 27.239038623875132 0.0 - - - - - - - 725.0 104 2 MYOZ3 myozenin 3 1381 176 B20140404_SF100_04 B20140404_SF100_04 TB501604.[MT7]-VAQGWVR.2y5_1.heavy 480.281 / 645.347 54862.0 27.42959976196289 48 20 10 10 8 14.292437625515113 6.996707113241357 0.0 4 0.991349831870039 13.259786691875842 54862.0 0.6432066040924718 2.0 - - - - - - - 362.6666666666667 130 3 MYOZ3 myozenin 3 1383 176 B20140404_SF100_04 B20140404_SF100_04 TB501604.[MT7]-VAQGWVR.2b4_1.heavy 480.281 / 500.295 41328.0 27.42959976196289 48 20 10 10 8 14.292437625515113 6.996707113241357 0.0 4 0.991349831870039 13.259786691875842 41328.0 14.359882309672674 2.0 - - - - - - - 121.0 302 1 MYOZ3 myozenin 3 1385 176 B20140404_SF100_04 B20140404_SF100_04 TB501604.[MT7]-VAQGWVR.2y6_1.heavy 480.281 / 716.384 285912.0 27.42959976196289 48 20 10 10 8 14.292437625515113 6.996707113241357 0.0 4 0.991349831870039 13.259786691875842 285912.0 58.64152065862752 0.0 - - - - - - - 2175.0 571 1 MYOZ3 myozenin 3 1387 177 B20140404_SF100_04 B20140404_SF100_04 TB502032.[MT7]-AAAAASAAGPGGLVAGK[MT7]EEK[MT7].4b5_1.heavy 540.31 / 500.295 83339.0 25.260299682617188 42 12 10 10 10 2.3051711346423485 29.098799226081525 0.0 3 0.8960052467801769 3.793316437305347 83339.0 37.26407609319155 0.0 - - - - - - - 791.0 166 1 UNC119B unc-119 homolog B (C. elegans) 1389 177 B20140404_SF100_04 B20140404_SF100_04 TB502032.[MT7]-AAAAASAAGPGGLVAGK[MT7]EEK[MT7].4y7_2.heavy 540.31 / 524.816 86404.0 25.260299682617188 42 12 10 10 10 2.3051711346423485 29.098799226081525 0.0 3 0.8960052467801769 3.793316437305347 86404.0 41.10618894147625 0.0 - - - - - - - 890.0 172 1 UNC119B unc-119 homolog B (C. elegans) 1391 177 B20140404_SF100_04 B20140404_SF100_04 TB502032.[MT7]-AAAAASAAGPGGLVAGK[MT7]EEK[MT7].4y6_1.heavy 540.31 / 949.556 22540.0 25.260299682617188 42 12 10 10 10 2.3051711346423485 29.098799226081525 0.0 3 0.8960052467801769 3.793316437305347 22540.0 49.680927048708924 0.0 - - - - - - - 214.33333333333334 45 12 UNC119B unc-119 homolog B (C. elegans) 1393 177 B20140404_SF100_04 B20140404_SF100_04 TB502032.[MT7]-AAAAASAAGPGGLVAGK[MT7]EEK[MT7].4b6_1.heavy 540.31 / 587.327 76518.0 25.260299682617188 42 12 10 10 10 2.3051711346423485 29.098799226081525 0.0 3 0.8960052467801769 3.793316437305347 76518.0 45.49793923669233 0.0 - - - - - - - 725.0 153 3 UNC119B unc-119 homolog B (C. elegans) 1395 178 B20140404_SF100_04 B20140404_SF100_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 825170.0 31.906200408935547 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 825170.0 418.58356317586674 0.0 - - - - - - - 328.5 1650 2 1397 178 B20140404_SF100_04 B20140404_SF100_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 142465.0 31.906200408935547 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 142465.0 114.62416622728945 1.0 - - - - - - - 460.2 284 5 1399 178 B20140404_SF100_04 B20140404_SF100_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 111737.0 31.906200408935547 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 111737.0 51.720525791556526 0.0 - - - - - - - 986.0 223 1 1401 179 B20140404_SF100_04 B20140404_SF100_04 TB502038.[MT7]-QLQQERPQEELELELR.3y15_2.heavy 728.058 / 955.503 61356.0 30.853300094604492 42 12 10 10 10 0.8930344607685846 64.23854929443155 0.0 3 0.8801807973638361 3.529102108011492 61356.0 64.3056070893592 0.0 - - - - - - - 277.5 122 4 LRP11 low density lipoprotein receptor-related protein 11 1403 179 B20140404_SF100_04 B20140404_SF100_04 TB502038.[MT7]-QLQQERPQEELELELR.3b10_2.heavy 728.058 / 705.858 24732.0 30.853300094604492 42 12 10 10 10 0.8930344607685846 64.23854929443155 0.0 3 0.8801807973638361 3.529102108011492 24732.0 17.52953278930739 0.0 - - - - - - - 476.0 49 2 LRP11 low density lipoprotein receptor-related protein 11 1405 179 B20140404_SF100_04 B20140404_SF100_04 TB502038.[MT7]-QLQQERPQEELELELR.3y4_1.heavy 728.058 / 530.33 26159.0 30.853300094604492 42 12 10 10 10 0.8930344607685846 64.23854929443155 0.0 3 0.8801807973638361 3.529102108011492 26159.0 24.81821196411653 0.0 - - - - - - - 792.6666666666666 52 3 LRP11 low density lipoprotein receptor-related protein 11 1407 179 B20140404_SF100_04 B20140404_SF100_04 TB502038.[MT7]-QLQQERPQEELELELR.3b12_2.heavy 728.058 / 826.922 45501.0 30.853300094604492 42 12 10 10 10 0.8930344607685846 64.23854929443155 0.0 3 0.8801807973638361 3.529102108011492 45501.0 37.617917402251614 0.0 - - - - - - - 317.3333333333333 91 3 LRP11 low density lipoprotein receptor-related protein 11 1409 180 B20140404_SF100_04 B20140404_SF100_04 TB501698.[MT7]-VEPSLLQYADWR.3y6_1.heavy 540.955 / 838.384 32219.0 36.7864990234375 44 14 10 10 10 1.412792520206271 48.28946654892765 0.0 3 0.9353571715274741 4.827635384213951 32219.0 103.33263734166886 0.0 - - - - - - - 298.25 64 8 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1411 180 B20140404_SF100_04 B20140404_SF100_04 TB501698.[MT7]-VEPSLLQYADWR.3b4_1.heavy 540.955 / 557.305 48686.0 36.7864990234375 44 14 10 10 10 1.412792520206271 48.28946654892765 0.0 3 0.9353571715274741 4.827635384213951 48686.0 72.1570048734102 0.0 - - - - - - - 298.5 97 2 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1413 180 B20140404_SF100_04 B20140404_SF100_04 TB501698.[MT7]-VEPSLLQYADWR.3b5_1.heavy 540.955 / 670.389 89735.0 36.7864990234375 44 14 10 10 10 1.412792520206271 48.28946654892765 0.0 3 0.9353571715274741 4.827635384213951 89735.0 109.80274880596244 0.0 - - - - - - - 119.0 179 1 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1415 180 B20140404_SF100_04 B20140404_SF100_04 TB501698.[MT7]-VEPSLLQYADWR.3y5_1.heavy 540.955 / 710.326 72671.0 36.7864990234375 44 14 10 10 10 1.412792520206271 48.28946654892765 0.0 3 0.9353571715274741 4.827635384213951 72671.0 109.74300886249964 0.0 - - - - - - - 306.7142857142857 145 7 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1417 181 B20140404_SF100_04 B20140404_SF100_04 TB154040.[MT7]-VRPTFSK[MT7].3y3_1.heavy 374.901 / 525.315 97925.0 23.322200775146484 47 17 10 10 10 3.2093431918157203 26.05458595113921 0.0 3 0.9792474760247895 8.552104023646498 97925.0 71.94489795918368 0.0 - - - - - - - 747.8571428571429 195 7 MYOT myotilin 1419 181 B20140404_SF100_04 B20140404_SF100_04 TB154040.[MT7]-VRPTFSK[MT7].3b4_1.heavy 374.901 / 598.379 10289.0 23.322200775146484 47 17 10 10 10 3.2093431918157203 26.05458595113921 0.0 3 0.9792474760247895 8.552104023646498 10289.0 16.15078485687904 0.0 - - - - - - - 747.8571428571429 20 7 MYOT myotilin 1421 181 B20140404_SF100_04 B20140404_SF100_04 TB154040.[MT7]-VRPTFSK[MT7].3y4_1.heavy 374.901 / 626.363 29784.0 23.322200775146484 47 17 10 10 10 3.2093431918157203 26.05458595113921 0.0 3 0.9792474760247895 8.552104023646498 29784.0 55.775037163931145 0.0 - - - - - - - 695.1 59 10 MYOT myotilin 1423 181 B20140404_SF100_04 B20140404_SF100_04 TB154040.[MT7]-VRPTFSK[MT7].3y5_1.heavy 374.901 / 723.416 26896.0 23.322200775146484 47 17 10 10 10 3.2093431918157203 26.05458595113921 0.0 3 0.9792474760247895 8.552104023646498 26896.0 203.68712401378158 0.0 - - - - - - - 196.52941176470588 53 17 MYOT myotilin 1425 182 B20140404_SF100_04 B20140404_SF100_04 TB502022.[MT7]-AGQDVVLHLPTDGVVLDGR.3b6_1.heavy 702.387 / 714.39 67869.0 33.76150131225586 44 14 10 10 10 2.1498096977416736 39.26907500239662 0.0 3 0.9381057106698386 4.93481856086098 67869.0 37.270600256610365 0.0 - - - - - - - 773.6666666666666 135 3 LRP11 low density lipoprotein receptor-related protein 11 1427 182 B20140404_SF100_04 B20140404_SF100_04 TB502022.[MT7]-AGQDVVLHLPTDGVVLDGR.3b4_1.heavy 702.387 / 516.253 32774.0 33.76150131225586 44 14 10 10 10 2.1498096977416736 39.26907500239662 0.0 3 0.9381057106698386 4.93481856086098 32774.0 21.788233370460645 0.0 - - - - - - - 1366.0 65 1 LRP11 low density lipoprotein receptor-related protein 11 1429 182 B20140404_SF100_04 B20140404_SF100_04 TB502022.[MT7]-AGQDVVLHLPTDGVVLDGR.3b5_1.heavy 702.387 / 615.322 36188.0 33.76150131225586 44 14 10 10 10 2.1498096977416736 39.26907500239662 0.0 3 0.9381057106698386 4.93481856086098 36188.0 30.093577405857737 0.0 - - - - - - - 1297.5 72 4 LRP11 low density lipoprotein receptor-related protein 11 1431 182 B20140404_SF100_04 B20140404_SF100_04 TB502022.[MT7]-AGQDVVLHLPTDGVVLDGR.3y10_1.heavy 702.387 / 1028.54 76062.0 33.76150131225586 44 14 10 10 10 2.1498096977416736 39.26907500239662 0.0 3 0.9381057106698386 4.93481856086098 76062.0 67.45423611288777 0.0 - - - - - - - 410.0 152 1 LRP11 low density lipoprotein receptor-related protein 11 1433 183 B20140404_SF100_04 B20140404_SF100_04 TB502020.[MT7]-DLILLLATVASSVPNFK[MT7].3y3_1.heavy 697.089 / 552.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDADC1 cytidine and dCMP deaminase domain containing 1 1435 183 B20140404_SF100_04 B20140404_SF100_04 TB502020.[MT7]-DLILLLATVASSVPNFK[MT7].3b6_1.heavy 697.089 / 825.557 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDADC1 cytidine and dCMP deaminase domain containing 1 1437 183 B20140404_SF100_04 B20140404_SF100_04 TB502020.[MT7]-DLILLLATVASSVPNFK[MT7].3b5_1.heavy 697.089 / 712.472 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDADC1 cytidine and dCMP deaminase domain containing 1 1439 183 B20140404_SF100_04 B20140404_SF100_04 TB502020.[MT7]-DLILLLATVASSVPNFK[MT7].3y4_1.heavy 697.089 / 649.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDADC1 cytidine and dCMP deaminase domain containing 1 1441 184 B20140404_SF100_04 B20140404_SF100_04 TB154044.[MT7]-AVQAAR.2b3_1.heavy 380.233 / 443.273 30482.0 18.01919937133789 46 16 10 10 10 2.0834671884224134 37.55417994069034 0.0 3 0.9620263486951168 6.313020640858575 30482.0 58.251190241787086 0.0 - - - - - - - 768.0833333333334 60 12 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1443 184 B20140404_SF100_04 B20140404_SF100_04 TB154044.[MT7]-AVQAAR.2y5_1.heavy 380.233 / 544.32 87851.0 18.01919937133789 46 16 10 10 10 2.0834671884224134 37.55417994069034 0.0 3 0.9620263486951168 6.313020640858575 87851.0 92.3743512356917 0.0 - - - - - - - 234.85714285714286 175 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1445 184 B20140404_SF100_04 B20140404_SF100_04 TB154044.[MT7]-AVQAAR.2b4_1.heavy 380.233 / 514.311 46393.0 18.01919937133789 46 16 10 10 10 2.0834671884224134 37.55417994069034 0.0 3 0.9620263486951168 6.313020640858575 46393.0 44.490167619337186 0.0 - - - - - - - 1289.4285714285713 92 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1447 184 B20140404_SF100_04 B20140404_SF100_04 TB154044.[MT7]-AVQAAR.2b5_1.heavy 380.233 / 585.348 24210.0 18.01919937133789 46 16 10 10 10 2.0834671884224134 37.55417994069034 0.0 3 0.9620263486951168 6.313020640858575 24210.0 27.62828348019513 0.0 - - - - - - - 338.57142857142856 48 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1449 185 B20140404_SF100_04 B20140404_SF100_04 TB154311.[MT7]-ELETLGK[MT7].2b3_1.heavy 539.323 / 516.279 35198.0 26.590900421142578 50 20 10 10 10 7.604204319861867 13.150619814199906 0.0 3 0.9939568215458281 15.867580401547228 35198.0 9.193263960511551 0.0 - - - - - - - 2795.5714285714284 70 7 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 1451 185 B20140404_SF100_04 B20140404_SF100_04 TB154311.[MT7]-ELETLGK[MT7].2y4_1.heavy 539.323 / 562.368 40490.0 26.590900421142578 50 20 10 10 10 7.604204319861867 13.150619814199906 0.0 3 0.9939568215458281 15.867580401547228 40490.0 34.91892465475223 0.0 - - - - - - - 1231.0 80 11 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 1453 185 B20140404_SF100_04 B20140404_SF100_04 TB154311.[MT7]-ELETLGK[MT7].2y5_1.heavy 539.323 / 691.411 31383.0 26.590900421142578 50 20 10 10 10 7.604204319861867 13.150619814199906 0.0 3 0.9939568215458281 15.867580401547228 31383.0 46.439784343703764 0.0 - - - - - - - 799.625 62 8 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 1455 185 B20140404_SF100_04 B20140404_SF100_04 TB154311.[MT7]-ELETLGK[MT7].2y6_1.heavy 539.323 / 804.495 42459.0 26.590900421142578 50 20 10 10 10 7.604204319861867 13.150619814199906 0.0 3 0.9939568215458281 15.867580401547228 42459.0 60.81763543070214 0.0 - - - - - - - 738.2222222222222 84 9 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 1457 186 B20140404_SF100_04 B20140404_SF100_04 TB344740.[MT7]-TVQSDDLHK[MT7].3b6_1.heavy 444.245 / 790.37 74339.0 21.201799392700195 39 9 10 10 10 0.6122567203124653 77.3451160703492 0.0 3 0.8037897065319749 2.739240614105108 74339.0 293.1565750887483 0.0 - - - - - - - 246.0 148 17 MYOT myotilin 1459 186 B20140404_SF100_04 B20140404_SF100_04 TB344740.[MT7]-TVQSDDLHK[MT7].3b5_1.heavy 444.245 / 675.343 22713.0 21.201799392700195 39 9 10 10 10 0.6122567203124653 77.3451160703492 0.0 3 0.8037897065319749 2.739240614105108 22713.0 22.804768903567165 0.0 - - - - - - - 750.3846153846154 45 13 MYOT myotilin 1461 186 B20140404_SF100_04 B20140404_SF100_04 TB344740.[MT7]-TVQSDDLHK[MT7].3b3_1.heavy 444.245 / 473.284 31979.0 21.201799392700195 39 9 10 10 10 0.6122567203124653 77.3451160703492 0.0 3 0.8037897065319749 2.739240614105108 31979.0 2.8392358075397346 0.0 - - - - - - - 906.0 63 1 MYOT myotilin 1463 186 B20140404_SF100_04 B20140404_SF100_04 TB344740.[MT7]-TVQSDDLHK[MT7].3y3_2.heavy 444.245 / 271.183 87368.0 21.201799392700195 39 9 10 10 10 0.6122567203124653 77.3451160703492 0.0 3 0.8037897065319749 2.739240614105108 87368.0 108.02556660626132 0.0 - - - - - - - 488.0 174 1 MYOT myotilin 1465 187 B20140404_SF100_04 B20140404_SF100_04 TB154317.[MT7]-EMGEFGLR.2b4_1.heavy 541.775 / 591.256 12657.0 30.638099670410156 43 17 8 10 8 4.033459922393974 24.792610295888878 0.0 4 0.9787053252072413 8.442151804108352 12657.0 10.890667634264974 0.0 - - - - - - - 325.0 25 2 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1467 187 B20140404_SF100_04 B20140404_SF100_04 TB154317.[MT7]-EMGEFGLR.2b6_1.heavy 541.775 / 795.346 6166.0 30.638099670410156 43 17 8 10 8 4.033459922393974 24.792610295888878 0.0 4 0.9787053252072413 8.442151804108352 6166.0 5.6721636191458575 1.0 - - - - - - - 324.7142857142857 16 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1469 187 B20140404_SF100_04 B20140404_SF100_04 TB154317.[MT7]-EMGEFGLR.2y6_1.heavy 541.775 / 678.357 6004.0 30.638099670410156 43 17 8 10 8 4.033459922393974 24.792610295888878 0.0 4 0.9787053252072413 8.442151804108352 6004.0 4.9325024720857185 3.0 - - - - - - - 162.0 16 2 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1471 187 B20140404_SF100_04 B20140404_SF100_04 TB154317.[MT7]-EMGEFGLR.2y7_1.heavy 541.775 / 809.397 13469.0 30.638099670410156 43 17 8 10 8 4.033459922393974 24.792610295888878 0.0 4 0.9787053252072413 8.442151804108352 13469.0 16.003866696240436 1.0 - - - - - - - 406.0 36 6 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1473 188 B20140404_SF100_04 B20140404_SF100_04 TB154316.[MT7]-GSLLFQK[MT7].2y4_1.heavy 540.836 / 679.426 45146.0 30.424400329589844 48 18 10 10 10 3.5202292365303345 22.622046248403024 0.0 3 0.9882501010157149 11.374154973859914 45146.0 39.06169831584691 0.0 - - - - - - - 431.3333333333333 90 3 MYOZ3 myozenin 3 1475 188 B20140404_SF100_04 B20140404_SF100_04 TB154316.[MT7]-GSLLFQK[MT7].2b4_1.heavy 540.836 / 515.331 61812.0 30.424400329589844 48 18 10 10 10 3.5202292365303345 22.622046248403024 0.0 3 0.9882501010157149 11.374154973859914 61812.0 40.51609611830859 0.0 - - - - - - - 485.0 123 1 MYOZ3 myozenin 3 1477 188 B20140404_SF100_04 B20140404_SF100_04 TB154316.[MT7]-GSLLFQK[MT7].2y3_1.heavy 540.836 / 566.342 75890.0 30.424400329589844 48 18 10 10 10 3.5202292365303345 22.622046248403024 0.0 3 0.9882501010157149 11.374154973859914 75890.0 72.85690152451586 0.0 - - - - - - - 364.0 151 4 MYOZ3 myozenin 3 1479 188 B20140404_SF100_04 B20140404_SF100_04 TB154316.[MT7]-GSLLFQK[MT7].2y6_1.heavy 540.836 / 879.542 16667.0 30.424400329589844 48 18 10 10 10 3.5202292365303345 22.622046248403024 0.0 3 0.9882501010157149 11.374154973859914 16667.0 62.54420618556702 0.0 - - - - - - - 338.27272727272725 33 11 MYOZ3 myozenin 3 1481 189 B20140404_SF100_04 B20140404_SF100_04 TB502027.[MT7]-DSLLIHLQDRNPQVAK[MT7].4y9_2.heavy 534.56 / 600.334 96567.0 29.358600616455078 41 11 10 10 10 1.8892699427897859 52.930498567258866 0.0 3 0.8562548989740478 3.2152943425541216 96567.0 83.17770829559072 0.0 - - - - - - - 721.0 193 2 MRO maestro 1483 189 B20140404_SF100_04 B20140404_SF100_04 TB502027.[MT7]-DSLLIHLQDRNPQVAK[MT7].4y10_2.heavy 534.56 / 656.876 100891.0 29.358600616455078 41 11 10 10 10 1.8892699427897859 52.930498567258866 0.0 3 0.8562548989740478 3.2152943425541216 100891.0 117.87405468898702 0.0 - - - - - - - 360.0 201 2 MRO maestro 1485 189 B20140404_SF100_04 B20140404_SF100_04 TB502027.[MT7]-DSLLIHLQDRNPQVAK[MT7].4b4_1.heavy 534.56 / 573.336 118187.0 29.358600616455078 41 11 10 10 10 1.8892699427897859 52.930498567258866 0.0 3 0.8562548989740478 3.2152943425541216 118187.0 64.2249897866752 0.0 - - - - - - - 1345.0 236 3 MRO maestro 1487 189 B20140404_SF100_04 B20140404_SF100_04 TB502027.[MT7]-DSLLIHLQDRNPQVAK[MT7].4b6_1.heavy 534.56 / 823.479 3315.0 29.358600616455078 41 11 10 10 10 1.8892699427897859 52.930498567258866 0.0 3 0.8562548989740478 3.2152943425541216 3315.0 3.8299898839738393 7.0 - - - - - - - 288.0 10 5 MRO maestro 1489 190 B20140404_SF100_04 B20140404_SF100_04 TB501866.[MT7]-ASDAGAYAC[CAM]VAK[MT7].3b6_1.heavy 491.253 / 617.301 166753.0 24.23240089416504 44 14 10 10 10 1.2127312326189623 53.96549990656406 0.0 3 0.9330508279223991 4.742818360240805 166753.0 32.520033651704345 0.0 - - - - - - - 402.5 333 2 MYOT myotilin 1491 190 B20140404_SF100_04 B20140404_SF100_04 TB501866.[MT7]-ASDAGAYAC[CAM]VAK[MT7].3b5_1.heavy 491.253 / 546.264 58238.0 24.23240089416504 44 14 10 10 10 1.2127312326189623 53.96549990656406 0.0 3 0.9330508279223991 4.742818360240805 58238.0 35.99397342191098 0.0 - - - - - - - 1290.7142857142858 116 7 MYOT myotilin 1493 190 B20140404_SF100_04 B20140404_SF100_04 TB501866.[MT7]-ASDAGAYAC[CAM]VAK[MT7].3y4_1.heavy 491.253 / 621.351 65484.0 24.23240089416504 44 14 10 10 10 1.2127312326189623 53.96549990656406 0.0 3 0.9330508279223991 4.742818360240805 65484.0 10.0297112847511 0.0 - - - - - - - 313.0 130 2 MYOT myotilin 1495 190 B20140404_SF100_04 B20140404_SF100_04 TB501866.[MT7]-ASDAGAYAC[CAM]VAK[MT7].3b7_1.heavy 491.253 / 780.364 36857.0 24.23240089416504 44 14 10 10 10 1.2127312326189623 53.96549990656406 0.0 3 0.9330508279223991 4.742818360240805 36857.0 30.290105193951348 0.0 - - - - - - - 1188.5714285714287 73 7 MYOT myotilin 1497 191 B20140404_SF100_04 B20140404_SF100_04 TB154849.[MT7]-TLGVHPDDDLLFTVFSK[MT7].4b4_1.heavy 548.802 / 515.331 52084.0 38.64970016479492 43 13 10 10 10 2.035219147883349 41.63581136685971 0.0 3 0.9001830714416937 3.873287956928827 52084.0 26.245747733416167 0.0 - - - - - - - 344.0 104 1 PLXNA4 plexin A4 1499 191 B20140404_SF100_04 B20140404_SF100_04 TB154849.[MT7]-TLGVHPDDDLLFTVFSK[MT7].4b5_1.heavy 548.802 / 652.39 85240.0 38.64970016479492 43 13 10 10 10 2.035219147883349 41.63581136685971 0.0 3 0.9001830714416937 3.873287956928827 85240.0 169.74591359125162 0.0 - - - - - - - 324.8333333333333 170 6 PLXNA4 plexin A4 1501 191 B20140404_SF100_04 B20140404_SF100_04 TB154849.[MT7]-TLGVHPDDDLLFTVFSK[MT7].4y3_1.heavy 548.802 / 525.315 436179.0 38.64970016479492 43 13 10 10 10 2.035219147883349 41.63581136685971 0.0 3 0.9001830714416937 3.873287956928827 436179.0 183.467697359058 0.0 - - - - - - - 459.0 872 1 PLXNA4 plexin A4 1503 191 B20140404_SF100_04 B20140404_SF100_04 TB154849.[MT7]-TLGVHPDDDLLFTVFSK[MT7].4b9_2.heavy 548.802 / 547.765 283826.0 38.64970016479492 43 13 10 10 10 2.035219147883349 41.63581136685971 0.0 3 0.9001830714416937 3.873287956928827 283826.0 215.15695523599126 0.0 - - - - - - - 229.0 567 1 PLXNA4 plexin A4 1505 192 B20140404_SF100_04 B20140404_SF100_04 TB501869.[MT7]-ISGPNPLSC[CAM]LK[MT7].3y3_1.heavy 491.949 / 564.33 26588.0 32.23970031738281 47 17 10 10 10 5.557792106491813 17.992756491052337 0.0 3 0.9774571203389013 8.204241324472346 26588.0 29.938523978929325 0.0 - - - - - - - 164.0 53 1 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 1507 192 B20140404_SF100_04 B20140404_SF100_04 TB501869.[MT7]-ISGPNPLSC[CAM]LK[MT7].3b5_1.heavy 491.949 / 613.343 138356.0 32.23970031738281 47 17 10 10 10 5.557792106491813 17.992756491052337 0.0 3 0.9774571203389013 8.204241324472346 138356.0 56.45896377142777 0.0 - - - - - - - 164.0 276 1 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 1509 192 B20140404_SF100_04 B20140404_SF100_04 TB501869.[MT7]-ISGPNPLSC[CAM]LK[MT7].3y4_1.heavy 491.949 / 651.362 104218.0 32.23970031738281 47 17 10 10 10 5.557792106491813 17.992756491052337 0.0 3 0.9774571203389013 8.204241324472346 104218.0 106.0969205961095 0.0 - - - - - - - 459.2 208 5 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 1511 192 B20140404_SF100_04 B20140404_SF100_04 TB501869.[MT7]-ISGPNPLSC[CAM]LK[MT7].3y5_1.heavy 491.949 / 764.446 5416.0 32.23970031738281 47 17 10 10 10 5.557792106491813 17.992756491052337 0.0 3 0.9774571203389013 8.204241324472346 5416.0 0.7843456275846213 2.0 - - - - - - - 255.11111111111111 12 9 UTP23 UTP23, small subunit (SSU) processome component, homolog (yeast) 1513 193 B20140404_SF100_04 B20140404_SF100_04 TB501573.[MT7]-DGVLLSR.2b3_1.heavy 452.273 / 416.226 16934.0 26.81315040588379 30 18 0 6 6 8.62442458530447 11.594976454474926 0.03910064697265625 6 0.9886147001484588 11.555193507763295 16934.0 3.5711156462585034 3.0 - - - - - - - 2195.0 76 3 TSPAN18 tetraspanin 18 1515 193 B20140404_SF100_04 B20140404_SF100_04 TB501573.[MT7]-DGVLLSR.2y4_1.heavy 452.273 / 488.319 11525.0 26.81315040588379 30 18 0 6 6 8.62442458530447 11.594976454474926 0.03910064697265625 6 0.9886147001484588 11.555193507763295 11525.0 3.843260779357954 4.0 - - - - - - - 823.0 1291 1 TSPAN18 tetraspanin 18 1517 193 B20140404_SF100_04 B20140404_SF100_04 TB501573.[MT7]-DGVLLSR.2b4_1.heavy 452.273 / 529.31 13994.0 26.81315040588379 30 18 0 6 6 8.62442458530447 11.594976454474926 0.03910064697265625 6 0.9886147001484588 11.555193507763295 13994.0 11.973260918472361 1.0 - - - - - - - 823.5 56 2 TSPAN18 tetraspanin 18 1519 193 B20140404_SF100_04 B20140404_SF100_04 TB501573.[MT7]-DGVLLSR.2y6_1.heavy 452.273 / 644.409 25049.0 26.81315040588379 30 18 0 6 6 8.62442458530447 11.594976454474926 0.03910064697265625 6 0.9886147001484588 11.555193507763295 25049.0 16.547519822781783 1.0 - - - - - - - 1749.25 51 8 TSPAN18 tetraspanin 18 1521 194 B20140404_SF100_04 B20140404_SF100_04 TB501578.[MT7]-SSPEEQLGIK[MT7].3b6_1.heavy 459.261 / 802.37 36351.0 27.42959976196289 46 16 10 10 10 2.554801780897213 29.803575894504306 0.0 3 0.9672794080419416 6.803939253925254 36351.0 134.82989826408186 0.0 - - - - - - - 314.2 72 10 LNX1 ligand of numb-protein X 1 1523 194 B20140404_SF100_04 B20140404_SF100_04 TB501578.[MT7]-SSPEEQLGIK[MT7].3y3_1.heavy 459.261 / 461.32 203976.0 27.42959976196289 46 16 10 10 10 2.554801780897213 29.803575894504306 0.0 3 0.9672794080419416 6.803939253925254 203976.0 56.626741330727604 0.0 - - - - - - - 966.0 407 1 LNX1 ligand of numb-protein X 1 1525 194 B20140404_SF100_04 B20140404_SF100_04 TB501578.[MT7]-SSPEEQLGIK[MT7].3b5_1.heavy 459.261 / 674.311 46495.0 27.42959976196289 46 16 10 10 10 2.554801780897213 29.803575894504306 0.0 3 0.9672794080419416 6.803939253925254 46495.0 22.671666000663933 0.0 - - - - - - - 362.0 92 1 LNX1 ligand of numb-protein X 1 1527 194 B20140404_SF100_04 B20140404_SF100_04 TB501578.[MT7]-SSPEEQLGIK[MT7].3y4_1.heavy 459.261 / 574.404 52534.0 27.42959976196289 46 16 10 10 10 2.554801780897213 29.803575894504306 0.0 3 0.9672794080419416 6.803939253925254 52534.0 48.33535047169542 0.0 - - - - - - - 483.0 105 1 LNX1 ligand of numb-protein X 1 1529 195 B20140404_SF100_04 B20140404_SF100_04 TB501823.[MT7]-LC[CAM]FDLLSWR.2y8_1.heavy 677.359 / 1096.52 39349.0 40.82609939575195 50 20 10 10 10 13.293297617739542 7.5225879142698755 0.0 3 0.99830252677067 29.950180916863776 39349.0 101.29164938058197 0.0 - - - - - - - 302.6 78 10 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1531 195 B20140404_SF100_04 B20140404_SF100_04 TB501823.[MT7]-LC[CAM]FDLLSWR.2y5_1.heavy 677.359 / 674.398 44334.0 40.82609939575195 50 20 10 10 10 13.293297617739542 7.5225879142698755 0.0 3 0.99830252677067 29.950180916863776 44334.0 39.31949714343282 0.0 - - - - - - - 1246.0 88 7 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1533 195 B20140404_SF100_04 B20140404_SF100_04 TB501823.[MT7]-LC[CAM]FDLLSWR.2b4_1.heavy 677.359 / 680.319 42020.0 40.82609939575195 50 20 10 10 10 13.293297617739542 7.5225879142698755 0.0 3 0.99830252677067 29.950180916863776 42020.0 90.17775280898877 0.0 - - - - - - - 703.1 84 10 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1535 195 B20140404_SF100_04 B20140404_SF100_04 TB501823.[MT7]-LC[CAM]FDLLSWR.2y7_1.heavy 677.359 / 936.494 16737.0 40.82609939575195 50 20 10 10 10 13.293297617739542 7.5225879142698755 0.0 3 0.99830252677067 29.950180916863776 16737.0 51.597914325842694 0.0 - - - - - - - 584.8571428571429 33 7 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1537 196 B20140404_SF100_04 B20140404_SF100_04 TB154594.[MT7]-MTSVIAYVYK[MT7].3y3_1.heavy 488.279 / 553.347 30479.0 34.592098236083984 50 20 10 10 10 5.558206045125466 17.991416508875155 0.0 3 0.9905291128984337 12.671373152642408 30479.0 52.08271276910338 0.0 - - - - - - - 768.0 60 8 PLXNA4 plexin A4 1539 196 B20140404_SF100_04 B20140404_SF100_04 TB154594.[MT7]-MTSVIAYVYK[MT7].3b6_1.heavy 488.279 / 747.419 26253.0 34.592098236083984 50 20 10 10 10 5.558206045125466 17.991416508875155 0.0 3 0.9905291128984337 12.671373152642408 26253.0 71.37534375 0.0 - - - - - - - 264.0 52 16 PLXNA4 plexin A4 1541 196 B20140404_SF100_04 B20140404_SF100_04 TB154594.[MT7]-MTSVIAYVYK[MT7].3b4_1.heavy 488.279 / 563.298 40980.0 34.592098236083984 50 20 10 10 10 5.558206045125466 17.991416508875155 0.0 3 0.9905291128984337 12.671373152642408 40980.0 95.43705357142858 0.0 - - - - - - - 665.6 81 10 PLXNA4 plexin A4 1543 196 B20140404_SF100_04 B20140404_SF100_04 TB154594.[MT7]-MTSVIAYVYK[MT7].3b5_1.heavy 488.279 / 676.382 23307.0 34.592098236083984 50 20 10 10 10 5.558206045125466 17.991416508875155 0.0 3 0.9905291128984337 12.671373152642408 23307.0 56.13388403749187 0.0 - - - - - - - 329.14285714285717 46 7 PLXNA4 plexin A4 1545 197 B20140404_SF100_04 B20140404_SF100_04 TB501725.[MT7]-IC[CAM]PLMISR.2y4_1.heavy 567.318 / 506.276 10516.0 32.001800537109375 36 20 0 10 6 10.552633645457576 9.476307371197844 0.0 5 0.9959501657336344 19.386395436709524 10516.0 5.498310397688673 1.0 - - - - - - - 1396.875 31 8 RNF8 ring finger protein 8 1547 197 B20140404_SF100_04 B20140404_SF100_04 TB501725.[MT7]-IC[CAM]PLMISR.2b4_1.heavy 567.318 / 628.361 9859.0 32.001800537109375 36 20 0 10 6 10.552633645457576 9.476307371197844 0.0 5 0.9959501657336344 19.386395436709524 9859.0 14.196734927772077 0.0 - - - - - - - 821.5714285714286 19 7 RNF8 ring finger protein 8 1549 197 B20140404_SF100_04 B20140404_SF100_04 TB501725.[MT7]-IC[CAM]PLMISR.2y6_1.heavy 567.318 / 716.412 39930.0 32.001800537109375 36 20 0 10 6 10.552633645457576 9.476307371197844 0.0 5 0.9959501657336344 19.386395436709524 39930.0 35.60888364063177 0.0 - - - - - - - 493.0 79 2 RNF8 ring finger protein 8 1551 197 B20140404_SF100_04 B20140404_SF100_04 TB501725.[MT7]-IC[CAM]PLMISR.2y7_1.heavy 567.318 / 876.443 45352.0 32.001800537109375 36 20 0 10 6 10.552633645457576 9.476307371197844 0.0 5 0.9959501657336344 19.386395436709524 45352.0 56.71033503120741 3.0 - - - - - - - 1291.142857142857 603 7 RNF8 ring finger protein 8 1553 198 B20140404_SF100_04 B20140404_SF100_04 TB501726.[MT7]-DEFPTILR.2b3_1.heavy 567.817 / 536.247 100493.0 33.4025993347168 47 17 10 10 10 3.2292051269551183 30.967373105310283 0.0 3 0.9740564986891476 7.6454781462731844 100493.0 91.66047785426514 0.0 - - - - - - - 846.3333333333334 200 3 SPATA9 spermatogenesis associated 9 1555 198 B20140404_SF100_04 B20140404_SF100_04 TB501726.[MT7]-DEFPTILR.2y5_1.heavy 567.817 / 599.388 141557.0 33.4025993347168 47 17 10 10 10 3.2292051269551183 30.967373105310283 0.0 3 0.9740564986891476 7.6454781462731844 141557.0 93.91044313953898 0.0 - - - - - - - 299.0 283 1 SPATA9 spermatogenesis associated 9 1557 198 B20140404_SF100_04 B20140404_SF100_04 TB501726.[MT7]-DEFPTILR.2y6_1.heavy 567.817 / 746.456 63163.0 33.4025993347168 47 17 10 10 10 3.2292051269551183 30.967373105310283 0.0 3 0.9740564986891476 7.6454781462731844 63163.0 47.16544118684815 0.0 - - - - - - - 1237.142857142857 126 7 SPATA9 spermatogenesis associated 9 1559 198 B20140404_SF100_04 B20140404_SF100_04 TB501726.[MT7]-DEFPTILR.2y7_1.heavy 567.817 / 875.498 67792.0 33.4025993347168 47 17 10 10 10 3.2292051269551183 30.967373105310283 0.0 3 0.9740564986891476 7.6454781462731844 67792.0 98.15505618649132 0.0 - - - - - - - 796.5555555555555 135 9 SPATA9 spermatogenesis associated 9 1561 199 B20140404_SF100_04 B20140404_SF100_04 TB154845.[MT7]-DRDWINQVYLPENHAR.4b7_2.heavy 543.278 / 536.768 158815.0 30.4768009185791 42 12 10 10 10 1.5269490079792392 55.14720366707931 0.0 3 0.8807432396170448 3.537587796208398 158815.0 29.2332007134718 0.0 - - - - - - - 1463.0 317 2 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1563 199 B20140404_SF100_04 B20140404_SF100_04 TB154845.[MT7]-DRDWINQVYLPENHAR.4y6_1.heavy 543.278 / 723.353 105660.0 30.4768009185791 42 12 10 10 10 1.5269490079792392 55.14720366707931 0.0 3 0.8807432396170448 3.537587796208398 105660.0 71.84573555464587 0.0 - - - - - - - 406.5 211 2 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1565 199 B20140404_SF100_04 B20140404_SF100_04 TB154845.[MT7]-DRDWINQVYLPENHAR.4b3_1.heavy 543.278 / 531.264 16255.0 30.4768009185791 42 12 10 10 10 1.5269490079792392 55.14720366707931 0.0 3 0.8807432396170448 3.537587796208398 16255.0 7.893250648344467 0.0 - - - - - - - 488.0 32 1 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1567 199 B20140404_SF100_04 B20140404_SF100_04 TB154845.[MT7]-DRDWINQVYLPENHAR.4b6_1.heavy 543.278 / 944.471 9591.0 30.4768009185791 42 12 10 10 10 1.5269490079792392 55.14720366707931 0.0 3 0.8807432396170448 3.537587796208398 9591.0 29.681662785070472 0.0 - - - - - - - 310.54545454545456 19 11 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1569 200 B20140404_SF100_04 B20140404_SF100_04 TB501728.[MT7]-EQVYTSK[MT7].2b3_1.heavy 571.818 / 501.279 21295.0 21.33639907836914 48 20 10 10 8 11.01617024520051 9.077564868205236 0.0 4 0.9975531054855119 24.944003011115345 21295.0 9.528355796074258 1.0 - - - - - - - 1184.2857142857142 48 7 PLXNA4 plexin A4 1571 200 B20140404_SF100_04 B20140404_SF100_04 TB501728.[MT7]-EQVYTSK[MT7].2y4_1.heavy 571.818 / 642.358 27899.0 21.33639907836914 48 20 10 10 8 11.01617024520051 9.077564868205236 0.0 4 0.9975531054855119 24.944003011115345 27899.0 46.19219630934718 0.0 - - - - - - - 280.0769230769231 55 13 PLXNA4 plexin A4 1573 200 B20140404_SF100_04 B20140404_SF100_04 TB501728.[MT7]-EQVYTSK[MT7].2y5_1.heavy 571.818 / 741.426 13410.0 21.33639907836914 48 20 10 10 8 11.01617024520051 9.077564868205236 0.0 4 0.9975531054855119 24.944003011115345 13410.0 28.984295629432175 0.0 - - - - - - - 251.78947368421052 26 19 PLXNA4 plexin A4 1575 200 B20140404_SF100_04 B20140404_SF100_04 TB501728.[MT7]-EQVYTSK[MT7].2y6_1.heavy 571.818 / 869.485 16241.0 21.33639907836914 48 20 10 10 8 11.01617024520051 9.077564868205236 0.0 4 0.9975531054855119 24.944003011115345 16241.0 49.67827527336287 0.0 - - - - - - - 180.6818181818182 32 22 PLXNA4 plexin A4 1577 201 B20140404_SF100_04 B20140404_SF100_04 TB154597.[MT7]-QAFNPEGEFQR.2y5_1.heavy 733.861 / 636.31 7059.0 28.96769905090332 39 11 10 10 8 0.8419236490148012 72.0097388734466 0.0 4 0.8652755913331195 3.323825982212478 7059.0 23.731884615384615 0.0 - - - - - - - 343.2857142857143 14 7 MYOT myotilin 1579 201 B20140404_SF100_04 B20140404_SF100_04 TB154597.[MT7]-QAFNPEGEFQR.2b4_1.heavy 733.861 / 605.316 23578.0 28.96769905090332 39 11 10 10 8 0.8419236490148012 72.0097388734466 0.0 4 0.8652755913331195 3.323825982212478 23578.0 58.413921928406666 0.0 - - - - - - - 686.7142857142857 47 7 MYOT myotilin 1581 201 B20140404_SF100_04 B20140404_SF100_04 TB154597.[MT7]-QAFNPEGEFQR.2y10_1.heavy 733.861 / 1194.55 8560.0 28.96769905090332 39 11 10 10 8 0.8419236490148012 72.0097388734466 0.0 4 0.8652755913331195 3.323825982212478 8560.0 68.82670214338506 1.0 - - - - - - - 250.22222222222223 47 9 MYOT myotilin 1583 201 B20140404_SF100_04 B20140404_SF100_04 TB154597.[MT7]-QAFNPEGEFQR.2y7_1.heavy 733.861 / 862.405 16069.0 28.96769905090332 39 11 10 10 8 0.8419236490148012 72.0097388734466 0.0 4 0.8652755913331195 3.323825982212478 16069.0 30.169494007989346 0.0 - - - - - - - 210.1 32 10 MYOT myotilin 1585 202 B20140404_SF100_04 B20140404_SF100_04 TB154453.[MT7]-FGELEGVSK[MT7].2y4_1.heavy 627.353 / 534.337 11338.0 29.260299682617188 50 20 10 10 10 7.338535780881915 13.626696521738893 0.0 3 0.9928717863666009 14.608771619628868 11338.0 15.849953401677539 0.0 - - - - - - - 1685.2857142857142 22 7 CDADC1 cytidine and dCMP deaminase domain containing 1 1587 202 B20140404_SF100_04 B20140404_SF100_04 TB154453.[MT7]-FGELEGVSK[MT7].2y8_1.heavy 627.353 / 962.528 6895.0 29.260299682617188 50 20 10 10 10 7.338535780881915 13.626696521738893 0.0 3 0.9928717863666009 14.608771619628868 6895.0 11.341644908616189 0.0 - - - - - - - 722.2857142857143 13 7 CDADC1 cytidine and dCMP deaminase domain containing 1 1589 202 B20140404_SF100_04 B20140404_SF100_04 TB154453.[MT7]-FGELEGVSK[MT7].2y5_1.heavy 627.353 / 663.379 6741.0 29.260299682617188 50 20 10 10 10 7.338535780881915 13.626696521738893 0.0 3 0.9928717863666009 14.608771619628868 6741.0 7.137337212230455 0.0 - - - - - - - 744.1428571428571 13 7 CDADC1 cytidine and dCMP deaminase domain containing 1 1591 202 B20140404_SF100_04 B20140404_SF100_04 TB154453.[MT7]-FGELEGVSK[MT7].2y6_1.heavy 627.353 / 776.463 6282.0 29.260299682617188 50 20 10 10 10 7.338535780881915 13.626696521738893 0.0 3 0.9928717863666009 14.608771619628868 6282.0 8.474016059618636 3.0 - - - - - - - 408.6666666666667 16 6 CDADC1 cytidine and dCMP deaminase domain containing 1 1593 203 B20140404_SF100_04 B20140404_SF100_04 TB501865.[MT7]-AIMDLVDEFK[MT7].2y4_1.heavy 734.902 / 682.353 13176.0 39.68009948730469 48 18 10 10 10 5.205779235517339 19.209420045654745 0.0 3 0.9827291942680878 9.37732634394927 13176.0 24.65772675086108 0.0 - - - - - - - 749.8888888888889 26 9 SPATA9 spermatogenesis associated 9 1595 203 B20140404_SF100_04 B20140404_SF100_04 TB501865.[MT7]-AIMDLVDEFK[MT7].2y8_1.heavy 734.902 / 1140.57 8276.0 39.68009948730469 48 18 10 10 10 5.205779235517339 19.209420045654745 0.0 3 0.9827291942680878 9.37732634394927 8276.0 32.37069414463033 0.0 - - - - - - - 225.78571428571428 16 14 SPATA9 spermatogenesis associated 9 1597 203 B20140404_SF100_04 B20140404_SF100_04 TB501865.[MT7]-AIMDLVDEFK[MT7].2b4_1.heavy 734.902 / 575.298 23085.0 39.68009948730469 48 18 10 10 10 5.205779235517339 19.209420045654745 0.0 3 0.9827291942680878 9.37732634394927 23085.0 17.795960861004325 0.0 - - - - - - - 327.0 46 1 SPATA9 spermatogenesis associated 9 1599 203 B20140404_SF100_04 B20140404_SF100_04 TB501865.[MT7]-AIMDLVDEFK[MT7].2y3_1.heavy 734.902 / 567.326 14265.0 39.68009948730469 48 18 10 10 10 5.205779235517339 19.209420045654745 0.0 3 0.9827291942680878 9.37732634394927 14265.0 13.513198605344986 0.0 - - - - - - - 436.0 28 1 SPATA9 spermatogenesis associated 9 1601 204 B20140404_SF100_04 B20140404_SF100_04 TB154457.[MT7]-SDPVPPFISR.2y8_1.heavy 629.849 / 912.53 160931.0 31.14204978942871 39 18 10 3 8 3.484189754364749 28.70107745272111 0.05210113525390625 4 0.9876094656251327 11.075616274525753 160931.0 192.54916879833723 0.0 - - - - - - - 246.0 321 2 C3orf15 chromosome 3 open reading frame 15 1603 204 B20140404_SF100_04 B20140404_SF100_04 TB154457.[MT7]-SDPVPPFISR.2y5_1.heavy 629.849 / 619.356 7390.0 31.14204978942871 39 18 10 3 8 3.484189754364749 28.70107745272111 0.05210113525390625 4 0.9876094656251327 11.075616274525753 7390.0 6.988642244631465 1.0 - - - - - - - 493.0 14 3 C3orf15 chromosome 3 open reading frame 15 1605 204 B20140404_SF100_04 B20140404_SF100_04 TB154457.[MT7]-SDPVPPFISR.2b4_1.heavy 629.849 / 543.289 60103.0 31.14204978942871 39 18 10 3 8 3.484189754364749 28.70107745272111 0.05210113525390625 4 0.9876094656251327 11.075616274525753 60103.0 22.182207040963213 1.0 - - - - - - - 657.0 140 1 C3orf15 chromosome 3 open reading frame 15 1607 204 B20140404_SF100_04 B20140404_SF100_04 TB154457.[MT7]-SDPVPPFISR.2y6_1.heavy 629.849 / 716.409 74390.0 31.14204978942871 39 18 10 3 8 3.484189754364749 28.70107745272111 0.05210113525390625 4 0.9876094656251327 11.075616274525753 74390.0 54.52176356832234 0.0 - - - - - - - 328.0 148 1 C3orf15 chromosome 3 open reading frame 15 1609 205 B20140404_SF100_04 B20140404_SF100_04 TB502090.[MT7]-ADPAALMASLHLLPSPTPNLEIK[MT7].4b7_1.heavy 672.632 / 814.425 2874.0 40.252601623535156 35 5 10 10 10 0.45159734442182986 99.45708012406305 0.0 3 0.6907176053645598 2.1592181755638435 2874.0 7.017646415672639 0.0 - - - - - - - 327.7692307692308 5 13 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1611 205 B20140404_SF100_04 B20140404_SF100_04 TB502090.[MT7]-ADPAALMASLHLLPSPTPNLEIK[MT7].4b5_1.heavy 672.632 / 570.3 14368.0 40.252601623535156 35 5 10 10 10 0.45159734442182986 99.45708012406305 0.0 3 0.6907176053645598 2.1592181755638435 14368.0 22.5322734478057 0.0 - - - - - - - 357.2857142857143 28 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1613 205 B20140404_SF100_04 B20140404_SF100_04 TB502090.[MT7]-ADPAALMASLHLLPSPTPNLEIK[MT7].4y3_1.heavy 672.632 / 533.341 35226.0 40.252601623535156 35 5 10 10 10 0.45159734442182986 99.45708012406305 0.0 3 0.6907176053645598 2.1592181755638435 35226.0 49.034419642857145 0.0 - - - - - - - 264.85714285714283 70 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1615 205 B20140404_SF100_04 B20140404_SF100_04 TB502090.[MT7]-ADPAALMASLHLLPSPTPNLEIK[MT7].4b6_1.heavy 672.632 / 683.385 15481.0 40.252601623535156 35 5 10 10 10 0.45159734442182986 99.45708012406305 0.0 3 0.6907176053645598 2.1592181755638435 15481.0 36.39543186292042 0.0 - - - - - - - 710.6666666666666 30 9 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1617 206 B20140404_SF100_04 B20140404_SF100_04 TB154837.[MT7]-GFFIEPTVFSNVTDDMR.3b4_1.heavy 707.014 / 609.352 26527.0 40.06290054321289 50 20 10 10 10 6.520228617676543 15.3368855393961 0.0 3 0.9946317905940261 16.83655261814194 26527.0 31.903242961351012 0.0 - - - - - - - 670.0 53 8 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1619 206 B20140404_SF100_04 B20140404_SF100_04 TB154837.[MT7]-GFFIEPTVFSNVTDDMR.3b5_1.heavy 707.014 / 738.394 56347.0 40.06290054321289 50 20 10 10 10 6.520228617676543 15.3368855393961 0.0 3 0.9946317905940261 16.83655261814194 56347.0 48.720985957584446 0.0 - - - - - - - 416.2857142857143 112 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1621 206 B20140404_SF100_04 B20140404_SF100_04 TB154837.[MT7]-GFFIEPTVFSNVTDDMR.3y8_1.heavy 707.014 / 937.404 25963.0 40.06290054321289 50 20 10 10 10 6.520228617676543 15.3368855393961 0.0 3 0.9946317905940261 16.83655261814194 25963.0 46.89985939310336 0.0 - - - - - - - 272.6 51 10 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1623 206 B20140404_SF100_04 B20140404_SF100_04 TB154837.[MT7]-GFFIEPTVFSNVTDDMR.3y9_1.heavy 707.014 / 1084.47 20225.0 40.06290054321289 50 20 10 10 10 6.520228617676543 15.3368855393961 0.0 3 0.9946317905940261 16.83655261814194 20225.0 48.09233085348713 0.0 - - - - - - - 352.5 40 8 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1625 207 B20140404_SF100_04 B20140404_SF100_04 TB501858.[MT7]-GIPVFTEDRDR.3y8_2.heavy 483.592 / 519.254 N/A 28.940500259399414 42 17 10 5 10 2.94315754098749 33.97711424120638 0.040798187255859375 3 0.9714430006887125 7.285630104063483 61572.0 54.275116543280205 1.0 - - - - - - - 1239.5 123 2 PLXNA4 plexin A4 1627 207 B20140404_SF100_04 B20140404_SF100_04 TB501858.[MT7]-GIPVFTEDRDR.3y9_2.heavy 483.592 / 567.781 169288.0 28.940500259399414 42 17 10 5 10 2.94315754098749 33.97711424120638 0.040798187255859375 3 0.9714430006887125 7.285630104063483 169288.0 180.58603260466742 0.0 - - - - - - - 275.5 338 2 PLXNA4 plexin A4 1629 207 B20140404_SF100_04 B20140404_SF100_04 TB501858.[MT7]-GIPVFTEDRDR.3b4_1.heavy 483.592 / 511.336 92564.0 28.940500259399414 42 17 10 5 10 2.94315754098749 33.97711424120638 0.040798187255859375 3 0.9714430006887125 7.285630104063483 92564.0 95.05856884871929 0.0 - - - - - - - 860.75 185 4 PLXNA4 plexin A4 1631 207 B20140404_SF100_04 B20140404_SF100_04 TB501858.[MT7]-GIPVFTEDRDR.3b3_1.heavy 483.592 / 412.268 22177.0 28.940500259399414 42 17 10 5 10 2.94315754098749 33.97711424120638 0.040798187255859375 3 0.9714430006887125 7.285630104063483 22177.0 13.138496503312226 0.0 - - - - - - - 826.5 44 2 PLXNA4 plexin A4 1633 208 B20140404_SF100_04 B20140404_SF100_04 TB501586.[MT7]-EPGWFR.2y4_1.heavy 468.246 / 565.288 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1635 208 B20140404_SF100_04 B20140404_SF100_04 TB501586.[MT7]-EPGWFR.2y5_1.heavy 468.246 / 662.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1637 208 B20140404_SF100_04 B20140404_SF100_04 TB501586.[MT7]-EPGWFR.2b4_1.heavy 468.246 / 614.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1639 208 B20140404_SF100_04 B20140404_SF100_04 TB501586.[MT7]-EPGWFR.2y3_1.heavy 468.246 / 508.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1641 209 B20140404_SF100_04 B20140404_SF100_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 1242780.0 37.64189910888672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1242780.0 466.0388725907676 0.0 - - - - - - - 471.0 2485 1 1643 209 B20140404_SF100_04 B20140404_SF100_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 2217690.0 37.64189910888672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2217690.0 388.8398868304656 0.0 - - - - - - - 353.0 4435 1 1645 209 B20140404_SF100_04 B20140404_SF100_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 1855680.0 37.64189910888672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1855680.0 347.33756614028937 0.0 - - - - - - - 236.0 3711 2 1647 210 B20140404_SF100_04 B20140404_SF100_04 TB501588.[MT7]-QETLFR.2b3_1.heavy 469.265 / 503.258 25366.0 27.898500442504883 47 17 10 10 10 3.1389430675343237 26.78779697237966 0.0 3 0.978041099829824 8.313026015417186 25366.0 9.951504916656017 1.0 - - - - - - - 746.0 50 1 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1649 210 B20140404_SF100_04 B20140404_SF100_04 TB501588.[MT7]-QETLFR.2y4_1.heavy 469.265 / 536.319 30340.0 27.898500442504883 47 17 10 10 10 3.1389430675343237 26.78779697237966 0.0 3 0.978041099829824 8.313026015417186 30340.0 18.846077393081377 0.0 - - - - - - - 1758.4285714285713 60 7 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1651 210 B20140404_SF100_04 B20140404_SF100_04 TB501588.[MT7]-QETLFR.2y5_1.heavy 469.265 / 665.362 52349.0 27.898500442504883 47 17 10 10 10 3.1389430675343237 26.78779697237966 0.0 3 0.978041099829824 8.313026015417186 52349.0 70.48582060885303 0.0 - - - - - - - 1296.5714285714287 104 7 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1653 210 B20140404_SF100_04 B20140404_SF100_04 TB501588.[MT7]-QETLFR.2b4_1.heavy 469.265 / 616.342 32205.0 27.898500442504883 47 17 10 10 10 3.1389430675343237 26.78779697237966 0.0 3 0.978041099829824 8.313026015417186 32205.0 21.03244481874386 0.0 - - - - - - - 622.0 64 1 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1655 211 B20140404_SF100_04 B20140404_SF100_04 TB154839.[MT7]-YSAFVLFGQLAAFAGRK[MT7].3b6_1.heavy 712.073 / 825.463 2821.0 42.15409851074219 44 16 10 10 8 6.035632663044508 16.56827139469382 0.0 4 0.9610949112126284 6.236500913888042 2821.0 8.904671717171716 1.0 - - - - - - - 254.28571428571428 6 21 MRO maestro 1657 211 B20140404_SF100_04 B20140404_SF100_04 TB154839.[MT7]-YSAFVLFGQLAAFAGRK[MT7].3y6_1.heavy 712.073 / 793.48 3301.0 42.15409851074219 44 16 10 10 8 6.035632663044508 16.56827139469382 0.0 4 0.9610949112126284 6.236500913888042 3301.0 9.627916666666666 0.0 - - - - - - - 237.6 6 25 MRO maestro 1659 211 B20140404_SF100_04 B20140404_SF100_04 TB154839.[MT7]-YSAFVLFGQLAAFAGRK[MT7].3b4_1.heavy 712.073 / 613.31 10384.0 42.15409851074219 44 16 10 10 8 6.035632663044508 16.56827139469382 0.0 4 0.9610949112126284 6.236500913888042 10384.0 13.100070175438596 0.0 - - - - - - - 784.6153846153846 20 13 MRO maestro 1661 211 B20140404_SF100_04 B20140404_SF100_04 TB154839.[MT7]-YSAFVLFGQLAAFAGRK[MT7].3y10_1.heavy 712.073 / 1162.68 2281.0 42.15409851074219 44 16 10 10 8 6.035632663044508 16.56827139469382 0.0 4 0.9610949112126284 6.236500913888042 2281.0 23.44361111111111 0.0 - - - - - - - 146.66666666666666 4 18 MRO maestro 1663 212 B20140404_SF100_04 B20140404_SF100_04 TB501714.[MT7]-VPQSGTLK[MT7].2y4_1.heavy 559.345 / 562.368 5422.0 23.396899700164795 44 18 10 6 10 7.21228429156801 13.86523269984123 0.03320121765136719 3 0.9877999286702354 11.16191365468903 5422.0 1.322322223825565 1.0 - - - - - - - 1227.2857142857142 10 7 LRP11 low density lipoprotein receptor-related protein 11 1665 212 B20140404_SF100_04 B20140404_SF100_04 TB501714.[MT7]-VPQSGTLK[MT7].2y5_1.heavy 559.345 / 649.4 15265.0 23.396899700164795 44 18 10 6 10 7.21228429156801 13.86523269984123 0.03320121765136719 3 0.9877999286702354 11.16191365468903 15265.0 44.29961081157493 0.0 - - - - - - - 741.4444444444445 30 9 LRP11 low density lipoprotein receptor-related protein 11 1667 212 B20140404_SF100_04 B20140404_SF100_04 TB501714.[MT7]-VPQSGTLK[MT7].2y6_1.heavy 559.345 / 777.459 4338.0 23.396899700164795 44 18 10 6 10 7.21228429156801 13.86523269984123 0.03320121765136719 3 0.9877999286702354 11.16191365468903 4338.0 16.591996702884977 1.0 - - - - - - - 619.4285714285714 30 7 LRP11 low density lipoprotein receptor-related protein 11 1669 212 B20140404_SF100_04 B20140404_SF100_04 TB501714.[MT7]-VPQSGTLK[MT7].2y7_1.heavy 559.345 / 874.511 86251.0 23.396899700164795 44 18 10 6 10 7.21228429156801 13.86523269984123 0.03320121765136719 3 0.9877999286702354 11.16191365468903 86251.0 287.16323981464865 0.0 - - - - - - - 292.0 172 6 LRP11 low density lipoprotein receptor-related protein 11 1671 213 B20140404_SF100_04 B20140404_SF100_04 TB154830.[MT7]-FSLDELAGPGAEGPSNLK[MT7].3b6_1.heavy 697.372 / 849.447 61516.0 34.24089813232422 45 15 10 10 10 1.4535429480833644 47.734143913330286 0.0 3 0.9516816442396331 5.591674678187541 61516.0 57.66099662848288 0.0 - - - - - - - 323.0 123 2 RNF8 ring finger protein 8 1673 213 B20140404_SF100_04 B20140404_SF100_04 TB154830.[MT7]-FSLDELAGPGAEGPSNLK[MT7].3y6_1.heavy 697.372 / 759.448 115925.0 34.24089813232422 45 15 10 10 10 1.4535429480833644 47.734143913330286 0.0 3 0.9516816442396331 5.591674678187541 115925.0 89.23202283265115 0.0 - - - - - - - 710.625 231 8 RNF8 ring finger protein 8 1675 213 B20140404_SF100_04 B20140404_SF100_04 TB154830.[MT7]-FSLDELAGPGAEGPSNLK[MT7].3b4_1.heavy 697.372 / 607.321 81031.0 34.24089813232422 45 15 10 10 10 1.4535429480833644 47.734143913330286 0.0 3 0.9516816442396331 5.591674678187541 81031.0 70.45788914086378 0.0 - - - - - - - 388.0 162 1 RNF8 ring finger protein 8 1677 213 B20140404_SF100_04 B20140404_SF100_04 TB154830.[MT7]-FSLDELAGPGAEGPSNLK[MT7].3b5_1.heavy 697.372 / 736.363 113857.0 34.24089813232422 45 15 10 10 10 1.4535429480833644 47.734143913330286 0.0 3 0.9516816442396331 5.591674678187541 113857.0 58.41935614814095 0.0 - - - - - - - 905.0 227 1 RNF8 ring finger protein 8 1679 214 B20140404_SF100_04 B20140404_SF100_04 TB154851.[MT7]-AYDFLYDPLFIVSSEK[MT7].3b4_1.heavy 732.389 / 641.305 65570.0 42.66460037231445 41 11 10 10 10 0.9850283897563198 58.98937835628486 0.0 3 0.8644792397397507 3.3138143411259184 65570.0 143.65159010600706 0.0 - - - - - - - 694.2727272727273 131 11 C3orf15 chromosome 3 open reading frame 15 1681 214 B20140404_SF100_04 B20140404_SF100_04 TB154851.[MT7]-AYDFLYDPLFIVSSEK[MT7].3b5_1.heavy 732.389 / 754.389 88878.0 42.66460037231445 41 11 10 10 10 0.9850283897563198 58.98937835628486 0.0 3 0.8644792397397507 3.3138143411259184 88878.0 133.04540841170075 0.0 - - - - - - - 1155.5714285714287 177 7 C3orf15 chromosome 3 open reading frame 15 1683 214 B20140404_SF100_04 B20140404_SF100_04 TB154851.[MT7]-AYDFLYDPLFIVSSEK[MT7].3y4_1.heavy 732.389 / 594.321 210004.0 42.66460037231445 41 11 10 10 10 0.9850283897563198 58.98937835628486 0.0 3 0.8644792397397507 3.3138143411259184 210004.0 358.58481260371315 0.0 - - - - - - - 358.3333333333333 420 3 C3orf15 chromosome 3 open reading frame 15 1685 214 B20140404_SF100_04 B20140404_SF100_04 TB154851.[MT7]-AYDFLYDPLFIVSSEK[MT7].3b7_1.heavy 732.389 / 1032.48 122314.0 42.66460037231445 41 11 10 10 10 0.9850283897563198 58.98937835628486 0.0 3 0.8644792397397507 3.3138143411259184 122314.0 330.04546268279256 0.0 - - - - - - - 759.8571428571429 244 7 C3orf15 chromosome 3 open reading frame 15 1687 215 B20140404_SF100_04 B20140404_SF100_04 TB501713.[MT7]-ALGIPFLSR.2b3_1.heavy 559.346 / 386.252 53594.0 37.461700439453125 47 17 10 10 10 3.6019793842273815 27.76251314426938 0.0 3 0.9731963937178872 7.521265119741793 53594.0 70.77398362992307 0.0 - - - - - - - 235.5 107 2 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1689 215 B20140404_SF100_04 B20140404_SF100_04 TB501713.[MT7]-ALGIPFLSR.2y8_1.heavy 559.346 / 902.546 38635.0 37.461700439453125 47 17 10 10 10 3.6019793842273815 27.76251314426938 0.0 3 0.9731963937178872 7.521265119741793 38635.0 20.60912909710816 1.0 - - - - - - - 282.6 95 5 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1691 215 B20140404_SF100_04 B20140404_SF100_04 TB501713.[MT7]-ALGIPFLSR.2y5_1.heavy 559.346 / 619.356 109308.0 37.461700439453125 47 17 10 10 10 3.6019793842273815 27.76251314426938 0.0 3 0.9731963937178872 7.521265119741793 109308.0 195.80872773592176 0.0 - - - - - - - 294.5 218 2 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1693 215 B20140404_SF100_04 B20140404_SF100_04 TB501713.[MT7]-ALGIPFLSR.2y7_1.heavy 559.346 / 789.462 42993.0 37.461700439453125 47 17 10 10 10 3.6019793842273815 27.76251314426938 0.0 3 0.9731963937178872 7.521265119741793 42993.0 144.29875125651103 0.0 - - - - - - - 265.125 85 8 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1695 216 B20140404_SF100_04 B20140404_SF100_04 TB154834.[MT7]-K[MT7]DPATQQAFVFGQNLR.3y7_1.heavy 703.388 / 833.463 21009.0 31.063199996948242 48 18 10 10 10 9.549189161918425 10.472093316445527 0.0 3 0.9826798569399191 9.363922173043559 21009.0 30.241439451637476 0.0 - - - - - - - 821.0 42 8 RANBP3 RAN binding protein 3 1697 216 B20140404_SF100_04 B20140404_SF100_04 TB154834.[MT7]-K[MT7]DPATQQAFVFGQNLR.3y6_1.heavy 703.388 / 734.394 40048.0 31.063199996948242 48 18 10 10 10 9.549189161918425 10.472093316445527 0.0 3 0.9826798569399191 9.363922173043559 40048.0 52.23258626304931 0.0 - - - - - - - 328.0 80 5 RANBP3 RAN binding protein 3 1699 216 B20140404_SF100_04 B20140404_SF100_04 TB154834.[MT7]-K[MT7]DPATQQAFVFGQNLR.3y8_1.heavy 703.388 / 980.531 18383.0 31.063199996948242 48 18 10 10 10 9.549189161918425 10.472093316445527 0.0 3 0.9826798569399191 9.363922173043559 18383.0 74.0927418131732 0.0 - - - - - - - 309.77777777777777 36 9 RANBP3 RAN binding protein 3 1701 216 B20140404_SF100_04 B20140404_SF100_04 TB154834.[MT7]-K[MT7]DPATQQAFVFGQNLR.3y5_1.heavy 703.388 / 587.326 21993.0 31.063199996948242 48 18 10 10 10 9.549189161918425 10.472093316445527 0.0 3 0.9826798569399191 9.363922173043559 21993.0 17.082127530339328 0.0 - - - - - - - 328.0 43 1 RANBP3 RAN binding protein 3 1703 217 B20140404_SF100_04 B20140404_SF100_04 TB501998.[MT7]-IFVEESIYEEFVRR.3b4_1.heavy 654.015 / 633.373 23218.0 37.86140060424805 39 11 10 10 8 2.303928478494557 43.404125142522844 0.0 4 0.875601060507414 3.462147246441964 23218.0 25.781059528952778 1.0 - - - - - - - 759.4444444444445 46 9 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1705 217 B20140404_SF100_04 B20140404_SF100_04 TB501998.[MT7]-IFVEESIYEEFVRR.3b5_1.heavy 654.015 / 762.415 21686.0 37.86140060424805 39 11 10 10 8 2.303928478494557 43.404125142522844 0.0 4 0.875601060507414 3.462147246441964 21686.0 34.409965639354425 0.0 - - - - - - - 756.1666666666666 43 12 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1707 217 B20140404_SF100_04 B20140404_SF100_04 TB501998.[MT7]-IFVEESIYEEFVRR.3b3_1.heavy 654.015 / 504.33 22040.0 37.86140060424805 39 11 10 10 8 2.303928478494557 43.404125142522844 0.0 4 0.875601060507414 3.462147246441964 22040.0 22.06473625140292 1.0 - - - - - - - 1165.6666666666667 130 9 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1709 217 B20140404_SF100_04 B20140404_SF100_04 TB501998.[MT7]-IFVEESIYEEFVRR.3y13_2.heavy 654.015 / 851.925 152628.0 37.86140060424805 39 11 10 10 8 2.303928478494557 43.404125142522844 0.0 4 0.875601060507414 3.462147246441964 152628.0 464.48743143503833 0.0 - - - - - - - 196.66666666666666 305 6 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1711 218 B20140404_SF100_04 B20140404_SF100_04 TB154443.[MT7]-YSLYWSK[MT7].2b3_1.heavy 617.839 / 508.289 18044.0 31.859100341796875 46 16 10 10 10 14.403854121292062 6.94258627988866 0.0 3 0.9608106455090019 6.213691723782187 18044.0 18.087824726233997 0.0 - - - - - - - 163.0 36 1 C3orf15 chromosome 3 open reading frame 15 1713 218 B20140404_SF100_04 B20140404_SF100_04 TB154443.[MT7]-YSLYWSK[MT7].2y4_1.heavy 617.839 / 727.39 21946.0 31.859100341796875 46 16 10 10 10 14.403854121292062 6.94258627988866 0.0 3 0.9608106455090019 6.213691723782187 21946.0 31.96592621060723 0.0 - - - - - - - 163.0 43 3 C3orf15 chromosome 3 open reading frame 15 1715 218 B20140404_SF100_04 B20140404_SF100_04 TB154443.[MT7]-YSLYWSK[MT7].2y3_1.heavy 617.839 / 564.326 18044.0 31.859100341796875 46 16 10 10 10 14.403854121292062 6.94258627988866 0.0 3 0.9608106455090019 6.213691723782187 18044.0 4.727190422186588 1.0 - - - - - - - 325.0 38 3 C3orf15 chromosome 3 open reading frame 15 1717 218 B20140404_SF100_04 B20140404_SF100_04 TB154443.[MT7]-YSLYWSK[MT7].2y6_1.heavy 617.839 / 927.506 18695.0 31.859100341796875 46 16 10 10 10 14.403854121292062 6.94258627988866 0.0 3 0.9608106455090019 6.213691723782187 18695.0 51.15290912101429 0.0 - - - - - - - 789.5714285714286 37 7 C3orf15 chromosome 3 open reading frame 15 1719 219 B20140404_SF100_04 B20140404_SF100_04 TB344869.[MT7]-IFVEESIYEEFVR.2b3_1.heavy 902.468 / 504.33 40981.0 39.920101165771484 38 8 10 10 10 0.7905217729981282 84.21529605542699 0.0 3 0.7729527157738576 2.5393462605036223 40981.0 114.33214615348393 0.0 - - - - - - - 686.0 81 9 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1721 219 B20140404_SF100_04 B20140404_SF100_04 TB344869.[MT7]-IFVEESIYEEFVR.2y9_1.heavy 902.468 / 1171.56 14476.0 39.920101165771484 38 8 10 10 10 0.7905217729981282 84.21529605542699 0.0 3 0.7729527157738576 2.5393462605036223 14476.0 46.223582569240946 0.0 - - - - - - - 257.0833333333333 28 12 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1723 219 B20140404_SF100_04 B20140404_SF100_04 TB344869.[MT7]-IFVEESIYEEFVR.2y3_1.heavy 902.468 / 421.256 14264.0 39.920101165771484 38 8 10 10 10 0.7905217729981282 84.21529605542699 0.0 3 0.7729527157738576 2.5393462605036223 14264.0 45.56031063574429 0.0 - - - - - - - 308.5 28 10 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1725 219 B20140404_SF100_04 B20140404_SF100_04 TB344869.[MT7]-IFVEESIYEEFVR.2b6_1.heavy 902.468 / 849.447 8196.0 39.920101165771484 38 8 10 10 10 0.7905217729981282 84.21529605542699 0.0 3 0.7729527157738576 2.5393462605036223 8196.0 18.487218045112783 0.0 - - - - - - - 729.8571428571429 16 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1727 220 B20140404_SF100_04 B20140404_SF100_04 TB154444.[MT7]-VFLISASSK[MT7].2b3_1.heavy 620.381 / 504.33 35250.0 31.95400047302246 50 20 10 10 10 16.102621972217015 6.210168764598524 0.0 3 0.9924020187684993 14.149395876563478 35250.0 24.90930243848309 0.0 - - - - - - - 479.0 70 1 RANBP3 RAN binding protein 3 1729 220 B20140404_SF100_04 B20140404_SF100_04 TB154444.[MT7]-VFLISASSK[MT7].2y8_1.heavy 620.381 / 996.585 16907.0 31.95400047302246 50 20 10 10 10 16.102621972217015 6.210168764598524 0.0 3 0.9924020187684993 14.149395876563478 16907.0 23.272019498607243 0.0 - - - - - - - 351.2 33 5 RANBP3 RAN binding protein 3 1731 220 B20140404_SF100_04 B20140404_SF100_04 TB154444.[MT7]-VFLISASSK[MT7].2y5_1.heavy 620.381 / 623.348 48967.0 31.95400047302246 50 20 10 10 10 16.102621972217015 6.210168764598524 0.0 3 0.9924020187684993 14.149395876563478 48967.0 47.58548589341693 0.0 - - - - - - - 160.0 97 1 RANBP3 RAN binding protein 3 1733 220 B20140404_SF100_04 B20140404_SF100_04 TB154444.[MT7]-VFLISASSK[MT7].2y6_1.heavy 620.381 / 736.432 24244.0 31.95400047302246 50 20 10 10 10 16.102621972217015 6.210168764598524 0.0 3 0.9924020187684993 14.149395876563478 24244.0 40.012 0.0 - - - - - - - 372.6666666666667 48 3 RANBP3 RAN binding protein 3 1735 221 B20140404_SF100_04 B20140404_SF100_04 TB501853.[MT7]-LLRLEDLFK[MT7].3y3_1.heavy 478.969 / 551.367 31081.0 37.597900390625 40 10 10 10 10 2.5761814210373744 38.817141985183675 0.0 3 0.8468423799514092 3.1123436803302797 31081.0 61.89265347326467 0.0 - - - - - - - 248.55555555555554 62 9 PLXNA4 plexin A4 1737 221 B20140404_SF100_04 B20140404_SF100_04 TB501853.[MT7]-LLRLEDLFK[MT7].3b6_1.heavy 478.969 / 884.532 8241.0 37.597900390625 40 10 10 10 10 2.5761814210373744 38.817141985183675 0.0 3 0.8468423799514092 3.1123436803302797 8241.0 109.64720338983051 0.0 - - - - - - - 134.71428571428572 16 7 PLXNA4 plexin A4 1739 221 B20140404_SF100_04 B20140404_SF100_04 TB501853.[MT7]-LLRLEDLFK[MT7].3y4_1.heavy 478.969 / 666.394 8948.0 37.597900390625 40 10 10 10 10 2.5761814210373744 38.817141985183675 0.0 3 0.8468423799514092 3.1123436803302797 8948.0 67.77634042553191 0.0 - - - - - - - 168.21428571428572 17 14 PLXNA4 plexin A4 1741 221 B20140404_SF100_04 B20140404_SF100_04 TB501853.[MT7]-LLRLEDLFK[MT7].3y8_2.heavy 478.969 / 589.357 21427.0 37.597900390625 40 10 10 10 10 2.5761814210373744 38.817141985183675 0.0 3 0.8468423799514092 3.1123436803302797 21427.0 217.53929648422036 0.0 - - - - - - - 235.36363636363637 42 11 PLXNA4 plexin A4 1743 222 B20140404_SF100_04 B20140404_SF100_04 TB154473.[MT7]-FVFSDQVHR.3b5_1.heavy 426.895 / 740.374 42473.0 29.04840087890625 43 13 10 10 10 1.1633191337580713 60.56015340684081 0.0 3 0.9006978520793366 3.883487443414954 42473.0 156.3928049325517 0.0 - - - - - - - 349.1666666666667 84 6 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1745 222 B20140404_SF100_04 B20140404_SF100_04 TB154473.[MT7]-FVFSDQVHR.3b3_1.heavy 426.895 / 538.315 65803.0 29.04840087890625 43 13 10 10 10 1.1633191337580713 60.56015340684081 0.0 3 0.9006978520793366 3.883487443414954 65803.0 79.5773381617945 0.0 - - - - - - - 299.0 131 1 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1747 222 B20140404_SF100_04 B20140404_SF100_04 TB154473.[MT7]-FVFSDQVHR.3y4_1.heavy 426.895 / 539.305 52643.0 29.04840087890625 43 13 10 10 10 1.1633191337580713 60.56015340684081 0.0 3 0.9006978520793366 3.883487443414954 52643.0 102.59779385599244 0.0 - - - - - - - 747.5714285714286 105 7 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1749 222 B20140404_SF100_04 B20140404_SF100_04 TB154473.[MT7]-FVFSDQVHR.3y5_1.heavy 426.895 / 654.332 24527.0 29.04840087890625 43 13 10 10 10 1.1633191337580713 60.56015340684081 0.0 3 0.9006978520793366 3.883487443414954 24527.0 34.66794344932555 0.0 - - - - - - - 359.2 49 5 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1751 223 B20140404_SF100_04 B20140404_SF100_04 TB154474.[MT7]-LAFSLGSVWR.2y8_1.heavy 640.368 / 951.505 59114.0 38.64970016479492 46 16 10 10 10 2.8860256480842317 28.359534456165193 0.0 3 0.9647419115374252 6.553127624904158 59114.0 139.01182691007438 0.0 - - - - - - - 369.09090909090907 118 11 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1753 223 B20140404_SF100_04 B20140404_SF100_04 TB154474.[MT7]-LAFSLGSVWR.2y5_1.heavy 640.368 / 604.32 54593.0 38.64970016479492 46 16 10 10 10 2.8860256480842317 28.359534456165193 0.0 3 0.9647419115374252 6.553127624904158 54593.0 55.2084367437964 0.0 - - - - - - - 695.25 109 4 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1755 223 B20140404_SF100_04 B20140404_SF100_04 TB154474.[MT7]-LAFSLGSVWR.2y9_1.heavy 640.368 / 1022.54 114402.0 38.64970016479492 46 16 10 10 10 2.8860256480842317 28.359534456165193 0.0 3 0.9647419115374252 6.553127624904158 114402.0 197.7273353238854 0.0 - - - - - - - 708.1111111111111 228 9 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1757 223 B20140404_SF100_04 B20140404_SF100_04 TB154474.[MT7]-LAFSLGSVWR.2y7_1.heavy 640.368 / 804.436 77891.0 38.64970016479492 46 16 10 10 10 2.8860256480842317 28.359534456165193 0.0 3 0.9647419115374252 6.553127624904158 77891.0 110.44217203273793 0.0 - - - - - - - 708.3333333333334 155 9 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1759 224 B20140404_SF100_04 B20140404_SF100_04 TB154298.[MT7]-IQMQEK[MT7].2b3_1.heavy 532.804 / 517.292 N/A 23.62529945373535 50 20 10 10 10 7.725245391723746 12.944572622525698 0.0 3 0.9918986396403148 13.702182890709576 6627.0 1.5738706417382515 5.0 - - - - - - - 2222.1428571428573 25 7 RNF8 ring finger protein 8 1761 224 B20140404_SF100_04 B20140404_SF100_04 TB154298.[MT7]-IQMQEK[MT7].2y4_1.heavy 532.804 / 679.357 7732.0 23.62529945373535 50 20 10 10 10 7.725245391723746 12.944572622525698 0.0 3 0.9918986396403148 13.702182890709576 7732.0 14.707608695652173 0.0 - - - - - - - 719.2727272727273 15 11 RNF8 ring finger protein 8 1763 224 B20140404_SF100_04 B20140404_SF100_04 TB154298.[MT7]-IQMQEK[MT7].2y5_1.heavy 532.804 / 807.415 11782.0 23.62529945373535 50 20 10 10 10 7.725245391723746 12.944572622525698 0.0 3 0.9918986396403148 13.702182890709576 11782.0 9.091688592504132 0.0 - - - - - - - 1223.142857142857 23 7 RNF8 ring finger protein 8 1765 224 B20140404_SF100_04 B20140404_SF100_04 TB154298.[MT7]-IQMQEK[MT7].2y3_1.heavy 532.804 / 548.316 3866.0 23.62529945373535 50 20 10 10 10 7.725245391723746 12.944572622525698 0.0 3 0.9918986396403148 13.702182890709576 3866.0 5.881142042101121 0.0 - - - - - - - 690.0 7 14 RNF8 ring finger protein 8 1767 225 B20140404_SF100_04 B20140404_SF100_04 TB154297.[MT7]-EQEIEK[MT7].2b3_1.heavy 532.297 / 531.253 8638.0 21.11995029449463 41 20 9 6 6 6.638718587207365 15.063147908196825 0.03190040588378906 5 0.9900392009553383 12.35532367137952 8638.0 12.014533073929961 1.0 - - - - - - - 1142.7777777777778 23 9 C3orf15 chromosome 3 open reading frame 15 1769 225 B20140404_SF100_04 B20140404_SF100_04 TB154297.[MT7]-EQEIEK[MT7].2y5_1.heavy 532.297 / 790.443 9530.0 21.11995029449463 41 20 9 6 6 6.638718587207365 15.063147908196825 0.03190040588378906 5 0.9900392009553383 12.35532367137952 9530.0 24.11694614991047 0.0 - - - - - - - 691.9090909090909 19 11 C3orf15 chromosome 3 open reading frame 15 1771 225 B20140404_SF100_04 B20140404_SF100_04 TB154297.[MT7]-EQEIEK[MT7].2b4_1.heavy 532.297 / 644.337 4731.0 21.11995029449463 41 20 9 6 6 6.638718587207365 15.063147908196825 0.03190040588378906 5 0.9900392009553383 12.35532367137952 4731.0 11.044470217701264 0.0 - - - - - - - 673.0909090909091 9 11 C3orf15 chromosome 3 open reading frame 15 1773 225 B20140404_SF100_04 B20140404_SF100_04 TB154297.[MT7]-EQEIEK[MT7].2b5_1.heavy 532.297 / 773.38 8159.0 21.11995029449463 41 20 9 6 6 6.638718587207365 15.063147908196825 0.03190040588378906 5 0.9900392009553383 12.35532367137952 8159.0 21.75050935218978 1.0 - - - - - - - 705.1428571428571 18 14 C3orf15 chromosome 3 open reading frame 15 1775 226 B20140404_SF100_04 B20140404_SF100_04 TB501849.[MT7]-GLHSLIFEVVR.3y6_1.heavy 471.949 / 762.451 124012.0 35.65639877319336 50 20 10 10 10 15.849128030667563 6.3094953745406785 0.0 3 0.9968065771158034 21.83325623293212 124012.0 430.2918323547277 0.0 - - - - - - - 694.6666666666666 248 12 MYOT myotilin 1777 226 B20140404_SF100_04 B20140404_SF100_04 TB501849.[MT7]-GLHSLIFEVVR.3y4_1.heavy 471.949 / 502.298 120549.0 35.65639877319336 50 20 10 10 10 15.849128030667563 6.3094953745406785 0.0 3 0.9968065771158034 21.83325623293212 120549.0 114.00261414224016 0.0 - - - - - - - 1245.7142857142858 241 7 MYOT myotilin 1779 226 B20140404_SF100_04 B20140404_SF100_04 TB501849.[MT7]-GLHSLIFEVVR.3y5_1.heavy 471.949 / 649.367 269440.0 35.65639877319336 50 20 10 10 10 15.849128030667563 6.3094953745406785 0.0 3 0.9968065771158034 21.83325623293212 269440.0 392.76040039736324 0.0 - - - - - - - 696.0 538 7 MYOT myotilin 1781 226 B20140404_SF100_04 B20140404_SF100_04 TB501849.[MT7]-GLHSLIFEVVR.3b8_2.heavy 471.949 / 521.296 96824.0 35.65639877319336 50 20 10 10 10 15.849128030667563 6.3094953745406785 0.0 3 0.9968065771158034 21.83325623293212 96824.0 121.12580833136468 0.0 - - - - - - - 673.125 193 8 MYOT myotilin 1783 227 B20140404_SF100_04 B20140404_SF100_04 TB501594.[MT7]-SVLSLER.2y4_1.heavy 474.286 / 504.278 30516.0 28.96769905090332 45 15 10 10 10 1.7147829685670728 40.34669080791059 0.0 3 0.9564512778877508 5.892313489159041 30516.0 27.743455794754233 0.0 - - - - - - - 696.6666666666666 61 3 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1785 227 B20140404_SF100_04 B20140404_SF100_04 TB501594.[MT7]-SVLSLER.2y5_1.heavy 474.286 / 617.362 42221.0 28.96769905090332 45 15 10 10 10 1.7147829685670728 40.34669080791059 0.0 3 0.9564512778877508 5.892313489159041 42221.0 43.03799413654828 0.0 - - - - - - - 1313.5714285714287 84 7 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1787 227 B20140404_SF100_04 B20140404_SF100_04 TB501594.[MT7]-SVLSLER.2b4_1.heavy 474.286 / 531.326 17836.0 28.96769905090332 45 15 10 10 10 1.7147829685670728 40.34669080791059 0.0 3 0.9564512778877508 5.892313489159041 17836.0 14.081052631578949 0.0 - - - - - - - 975.0 35 1 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1789 227 B20140404_SF100_04 B20140404_SF100_04 TB501594.[MT7]-SVLSLER.2y6_1.heavy 474.286 / 716.43 51139.0 28.96769905090332 45 15 10 10 10 1.7147829685670728 40.34669080791059 0.0 3 0.9564512778877508 5.892313489159041 51139.0 80.01173684210526 0.0 - - - - - - - 818.5 102 8 ACCS 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) 1791 228 B20140404_SF100_04 B20140404_SF100_04 TB154869.[MT7]-ANNSDFGLVAAVFTNDINK[MT7].3b6_1.heavy 766.737 / 793.36 6706.0 39.44169998168945 48 18 10 10 10 3.3272527533397813 30.054825230702253 0.0 3 0.9821498114840098 9.223437766378265 6706.0 12.682591486654555 0.0 - - - - - - - 775.5714285714286 13 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1793 228 B20140404_SF100_04 B20140404_SF100_04 TB154869.[MT7]-ANNSDFGLVAAVFTNDINK[MT7].3b5_1.heavy 766.737 / 646.291 15967.0 39.44169998168945 48 18 10 10 10 3.3272527533397813 30.054825230702253 0.0 3 0.9821498114840098 9.223437766378265 15967.0 27.35672722802084 0.0 - - - - - - - 623.4285714285714 31 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1795 228 B20140404_SF100_04 B20140404_SF100_04 TB154869.[MT7]-ANNSDFGLVAAVFTNDINK[MT7].3b8_1.heavy 766.737 / 963.465 40130.0 39.44169998168945 48 18 10 10 10 3.3272527533397813 30.054825230702253 0.0 3 0.9821498114840098 9.223437766378265 40130.0 49.92466592142146 0.0 - - - - - - - 372.5 80 4 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1797 228 B20140404_SF100_04 B20140404_SF100_04 TB154869.[MT7]-ANNSDFGLVAAVFTNDINK[MT7].3b7_1.heavy 766.737 / 850.381 48645.0 39.44169998168945 48 18 10 10 10 3.3272527533397813 30.054825230702253 0.0 3 0.9821498114840098 9.223437766378265 48645.0 40.98878676836676 0.0 - - - - - - - 319.5 97 2 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1799 229 B20140404_SF100_04 B20140404_SF100_04 TB501595.[MT7]-AVLTQK[MT7].2y4_1.heavy 474.31 / 633.405 102379.0 22.655099868774414 50 20 10 10 10 7.25454406417053 13.784463794753144 0.0 3 0.9941965329899527 16.19229291204191 102379.0 123.93514778456547 0.0 - - - - - - - 708.0 204 7 TNFSF12-TNFSF13;TNFSF13;CD5L TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13;CD5 molecule-like 1801 229 B20140404_SF100_04 B20140404_SF100_04 TB501595.[MT7]-AVLTQK[MT7].2y5_1.heavy 474.31 / 732.474 92622.0 22.655099868774414 50 20 10 10 10 7.25454406417053 13.784463794753144 0.0 3 0.9941965329899527 16.19229291204191 92622.0 48.129380069310145 0.0 - - - - - - - 709.6363636363636 185 11 TNFSF12-TNFSF13;TNFSF13;CD5L TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13;CD5 molecule-like 1803 229 B20140404_SF100_04 B20140404_SF100_04 TB501595.[MT7]-AVLTQK[MT7].2b4_1.heavy 474.31 / 529.347 14786.0 22.655099868774414 50 20 10 10 10 7.25454406417053 13.784463794753144 0.0 3 0.9941965329899527 16.19229291204191 14786.0 12.598159882500465 0.0 - - - - - - - 791.8181818181819 29 11 TNFSF12-TNFSF13;TNFSF13;CD5L TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13;CD5 molecule-like 1805 229 B20140404_SF100_04 B20140404_SF100_04 TB501595.[MT7]-AVLTQK[MT7].2y3_1.heavy 474.31 / 520.321 121594.0 22.655099868774414 50 20 10 10 10 7.25454406417053 13.784463794753144 0.0 3 0.9941965329899527 16.19229291204191 121594.0 223.17150136612022 0.0 - - - - - - - 1658.6 243 10 TNFSF12-TNFSF13;TNFSF13;CD5L TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13;CD5 molecule-like 1807 230 B20140404_SF100_04 B20140404_SF100_04 TB501705.[MT7]-LIEAFSQR.2b3_1.heavy 554.318 / 500.32 18546.0 32.0968017578125 48 20 10 10 8 15.286674606573625 6.541645097685123 0.0 4 0.9931658716406832 14.920148929176657 18546.0 4.009824904329944 2.0 - - - - - - - 821.0 50 1 IQSEC2;IQSEC3;IQSEC1 IQ motif and Sec7 domain 2;IQ motif and Sec7 domain 3;IQ motif and Sec7 domain 1 1809 230 B20140404_SF100_04 B20140404_SF100_04 TB501705.[MT7]-LIEAFSQR.2y5_1.heavy 554.318 / 608.315 28065.0 32.0968017578125 48 20 10 10 8 15.286674606573625 6.541645097685123 0.0 4 0.9931658716406832 14.920148929176657 28065.0 15.483949426646753 0.0 - - - - - - - 369.0 56 4 IQSEC2;IQSEC3;IQSEC1 IQ motif and Sec7 domain 2;IQ motif and Sec7 domain 3;IQ motif and Sec7 domain 1 1811 230 B20140404_SF100_04 B20140404_SF100_04 TB501705.[MT7]-LIEAFSQR.2y6_1.heavy 554.318 / 737.358 30363.0 32.0968017578125 48 20 10 10 8 15.286674606573625 6.541645097685123 0.0 4 0.9931658716406832 14.920148929176657 30363.0 34.025308682605555 1.0 - - - - - - - 328.0 62 3 IQSEC2;IQSEC3;IQSEC1 IQ motif and Sec7 domain 2;IQ motif and Sec7 domain 3;IQ motif and Sec7 domain 1 1813 230 B20140404_SF100_04 B20140404_SF100_04 TB501705.[MT7]-LIEAFSQR.2y7_1.heavy 554.318 / 850.442 43328.0 32.0968017578125 48 20 10 10 8 15.286674606573625 6.541645097685123 0.0 4 0.9931658716406832 14.920148929176657 43328.0 53.68330399458361 0.0 - - - - - - - 773.5714285714286 86 7 IQSEC2;IQSEC3;IQSEC1 IQ motif and Sec7 domain 2;IQ motif and Sec7 domain 3;IQ motif and Sec7 domain 1 1815 231 B20140404_SF100_04 B20140404_SF100_04 TB154864.[MT7]-AFSEPVLSEPMFAEGEIK[MT7].3b6_1.heavy 757.06 / 775.411 27977.0 36.51250076293945 50 20 10 10 10 5.914378885569808 16.907946199386195 0.0 3 0.9901919375555754 12.451313072429802 27977.0 29.618723532970357 0.0 - - - - - - - 393.3333333333333 55 3 SPATA9 spermatogenesis associated 9 1817 231 B20140404_SF100_04 B20140404_SF100_04 TB154864.[MT7]-AFSEPVLSEPMFAEGEIK[MT7].3b4_1.heavy 757.06 / 579.289 51940.0 36.51250076293945 50 20 10 10 10 5.914378885569808 16.907946199386195 0.0 3 0.9901919375555754 12.451313072429802 51940.0 52.930213029101694 0.0 - - - - - - - 314.6666666666667 103 3 SPATA9 spermatogenesis associated 9 1819 231 B20140404_SF100_04 B20140404_SF100_04 TB154864.[MT7]-AFSEPVLSEPMFAEGEIK[MT7].3b5_1.heavy 757.06 / 676.342 10034.0 36.51250076293945 50 20 10 10 10 5.914378885569808 16.907946199386195 0.0 3 0.9901919375555754 12.451313072429802 10034.0 20.73882297551789 0.0 - - - - - - - 309.75 20 8 SPATA9 spermatogenesis associated 9 1821 231 B20140404_SF100_04 B20140404_SF100_04 TB154864.[MT7]-AFSEPVLSEPMFAEGEIK[MT7].3y4_1.heavy 757.06 / 590.363 22311.0 36.51250076293945 50 20 10 10 10 5.914378885569808 16.907946199386195 0.0 3 0.9901919375555754 12.451313072429802 22311.0 36.566133755706346 1.0 - - - - - - - 354.0 44 5 SPATA9 spermatogenesis associated 9 1823 232 B20140404_SF100_04 B20140404_SF100_04 TB154865.[MT7]-MSVQNLATVFGPNILRPK[MT7].3b4_1.heavy 758.44 / 590.309 4819.0 37.575599670410156 40 17 10 5 8 12.221198419895153 8.182503594509017 0.0446014404296875 4 0.9796040943611224 8.626804268370071 4819.0 3.6327490698186953 5.0 - - - - - - - 353.0 10 1 ARHGAP24 Rho GTPase activating protein 24 1825 232 B20140404_SF100_04 B20140404_SF100_04 TB154865.[MT7]-MSVQNLATVFGPNILRPK[MT7].3b5_1.heavy 758.44 / 704.352 11284.0 37.575599670410156 40 17 10 5 8 12.221198419895153 8.182503594509017 0.0446014404296875 4 0.9796040943611224 8.626804268370071 11284.0 15.040795934677384 0.0 - - - - - - - 789.1428571428571 22 7 ARHGAP24 Rho GTPase activating protein 24 1827 232 B20140404_SF100_04 B20140404_SF100_04 TB154865.[MT7]-MSVQNLATVFGPNILRPK[MT7].3y8_1.heavy 758.44 / 1038.65 7288.0 37.575599670410156 40 17 10 5 8 12.221198419895153 8.182503594509017 0.0446014404296875 4 0.9796040943611224 8.626804268370071 7288.0 28.6633805476865 0.0 - - - - - - - 267.3636363636364 14 11 ARHGAP24 Rho GTPase activating protein 24 1829 232 B20140404_SF100_04 B20140404_SF100_04 TB154865.[MT7]-MSVQNLATVFGPNILRPK[MT7].3y9_1.heavy 758.44 / 1185.72 3291.0 37.575599670410156 40 17 10 5 8 12.221198419895153 8.182503594509017 0.0446014404296875 4 0.9796040943611224 8.626804268370071 3291.0 25.458644067796612 1.0 - - - - - - - 196.16666666666666 6 12 ARHGAP24 Rho GTPase activating protein 24 1831 233 B20140404_SF100_04 B20140404_SF100_04 TB502079.[MT7]-NTC[CAM]EHIY[MT7]EFPQLSEDVIR.4b4_1.heavy 635.319 / 649.273 15627.0 31.42620086669922 38 8 10 10 10 0.6612848062367994 84.32354528502853 0.0 3 0.7654075516718891 2.4964589759186486 15627.0 12.846880546075086 0.0 - - - - - - - 434.0 31 3 UNC119B unc-119 homolog B (C. elegans) 1833 233 B20140404_SF100_04 B20140404_SF100_04 TB502079.[MT7]-NTC[CAM]EHIY[MT7]EFPQLSEDVIR.4b5_1.heavy 635.319 / 786.332 6837.0 31.42620086669922 38 8 10 10 10 0.6612848062367994 84.32354528502853 0.0 3 0.7654075516718891 2.4964589759186486 6837.0 9.987235023041475 1.0 - - - - - - - 325.6 13 5 UNC119B unc-119 homolog B (C. elegans) 1835 233 B20140404_SF100_04 B20140404_SF100_04 TB502079.[MT7]-NTC[CAM]EHIY[MT7]EFPQLSEDVIR.4y7_1.heavy 635.319 / 831.457 18883.0 31.42620086669922 38 8 10 10 10 0.6612848062367994 84.32354528502853 0.0 3 0.7654075516718891 2.4964589759186486 18883.0 47.71515296816427 0.0 - - - - - - - 349.0 37 7 UNC119B unc-119 homolog B (C. elegans) 1837 233 B20140404_SF100_04 B20140404_SF100_04 TB502079.[MT7]-NTC[CAM]EHIY[MT7]EFPQLSEDVIR.4y6_1.heavy 635.319 / 718.373 46882.0 31.42620086669922 38 8 10 10 10 0.6612848062367994 84.32354528502853 0.0 3 0.7654075516718891 2.4964589759186486 46882.0 57.01276392201664 0.0 - - - - - - - 1729.75 93 8 UNC119B unc-119 homolog B (C. elegans) 1839 234 B20140404_SF100_04 B20140404_SF100_04 TB502078.[MT7]-TFQEEEQHLQGLEIAQGEK[MT7].4b8_2.heavy 626.323 / 587.268 34128.0 30.958999633789062 34 7 9 10 8 0.5732306502815807 97.40646278058873 0.0 4 0.7132874188573245 2.2473436370259563 34128.0 5.39504109941852 0.0 - - - - - - - 400.5 68 4 RNF8 ring finger protein 8 1841 234 B20140404_SF100_04 B20140404_SF100_04 TB502078.[MT7]-TFQEEEQHLQGLEIAQGEK[MT7].4b7_1.heavy 626.323 / 1036.47 9453.0 30.958999633789062 34 7 9 10 8 0.5732306502815807 97.40646278058873 0.0 4 0.7132874188573245 2.2473436370259563 9453.0 81.53212500000001 1.0 - - - - - - - 266.8888888888889 82 9 RNF8 ring finger protein 8 1843 234 B20140404_SF100_04 B20140404_SF100_04 TB502078.[MT7]-TFQEEEQHLQGLEIAQGEK[MT7].4b5_1.heavy 626.323 / 779.369 14100.0 30.958999633789062 34 7 9 10 8 0.5732306502815807 97.40646278058873 0.0 4 0.7132874188573245 2.2473436370259563 14100.0 14.964245175936433 0.0 - - - - - - - 400.5 28 4 RNF8 ring finger protein 8 1845 234 B20140404_SF100_04 B20140404_SF100_04 TB502078.[MT7]-TFQEEEQHLQGLEIAQGEK[MT7].4b6_1.heavy 626.323 / 908.412 4807.0 30.958999633789062 34 7 9 10 8 0.5732306502815807 97.40646278058873 0.0 4 0.7132874188573245 2.2473436370259563 4807.0 12.696820113112247 0.0 - - - - - - - 288.2 9 10 RNF8 ring finger protein 8 1847 235 B20140404_SF100_04 B20140404_SF100_04 TB154576.[MT7]-VQGEAQK[MT7]VER.3y8_1.heavy 477.943 / 1060.59 N/A 20.700199127197266 41 11 10 10 10 1.3740440891998444 64.30666817542357 0.0 3 0.8761747165040886 3.4703315254611273 134.0 1.94 4.0 - - - - - - - 0.0 0 0 IQSEC2;IQSEC3;IQSEC1 IQ motif and Sec7 domain 2;IQ motif and Sec7 domain 3;IQ motif and Sec7 domain 1 1849 235 B20140404_SF100_04 B20140404_SF100_04 TB154576.[MT7]-VQGEAQK[MT7]VER.3y8_2.heavy 477.943 / 530.797 8230.0 20.700199127197266 41 11 10 10 10 1.3740440891998444 64.30666817542357 0.0 3 0.8761747165040886 3.4703315254611273 8230.0 10.450183764412092 0.0 - - - - - - - 752.75 16 8 IQSEC2;IQSEC3;IQSEC1 IQ motif and Sec7 domain 2;IQ motif and Sec7 domain 3;IQ motif and Sec7 domain 1 1851 235 B20140404_SF100_04 B20140404_SF100_04 TB154576.[MT7]-VQGEAQK[MT7]VER.3y9_2.heavy 477.943 / 594.826 23219.0 20.700199127197266 41 11 10 10 10 1.3740440891998444 64.30666817542357 0.0 3 0.8761747165040886 3.4703315254611273 23219.0 46.53111325141148 0.0 - - - - - - - 638.5454545454545 46 11 IQSEC2;IQSEC3;IQSEC1 IQ motif and Sec7 domain 2;IQ motif and Sec7 domain 3;IQ motif and Sec7 domain 1 1853 235 B20140404_SF100_04 B20140404_SF100_04 TB154576.[MT7]-VQGEAQK[MT7]VER.3b4_1.heavy 477.943 / 558.3 5621.0 20.700199127197266 41 11 10 10 10 1.3740440891998444 64.30666817542357 0.0 3 0.8761747165040886 3.4703315254611273 5621.0 11.30401109702996 0.0 - - - - - - - 330.25 11 16 IQSEC2;IQSEC3;IQSEC1 IQ motif and Sec7 domain 2;IQ motif and Sec7 domain 3;IQ motif and Sec7 domain 1 1855 236 B20140404_SF100_04 B20140404_SF100_04 TB501986.[MT7]-RVIWGPFGGGIFGQK[MT7].3b10_1.heavy 636.368 / 1171.65 10535.0 36.93050003051758 44 14 10 10 10 1.5612183811543565 52.02904593763115 0.0 3 0.9339349691718218 4.774809808457673 10535.0 43.41652506963788 0.0 - - - - - - - 221.0 21 13 ARHGAP24 Rho GTPase activating protein 24 1857 236 B20140404_SF100_04 B20140404_SF100_04 TB501986.[MT7]-RVIWGPFGGGIFGQK[MT7].3b3_1.heavy 636.368 / 513.363 7303.0 36.93050003051758 44 14 10 10 10 1.5612183811543565 52.02904593763115 0.0 3 0.9339349691718218 4.774809808457673 7303.0 4.242394890820058 2.0 - - - - - - - 329.0 21 4 ARHGAP24 Rho GTPase activating protein 24 1859 236 B20140404_SF100_04 B20140404_SF100_04 TB501986.[MT7]-RVIWGPFGGGIFGQK[MT7].3y4_1.heavy 636.368 / 623.363 75302.0 36.93050003051758 44 14 10 10 10 1.5612183811543565 52.02904593763115 0.0 3 0.9339349691718218 4.774809808457673 75302.0 69.80920964664118 0.0 - - - - - - - 479.0 150 1 ARHGAP24 Rho GTPase activating protein 24 1861 236 B20140404_SF100_04 B20140404_SF100_04 TB501986.[MT7]-RVIWGPFGGGIFGQK[MT7].3y8_1.heavy 636.368 / 907.512 17718.0 36.93050003051758 44 14 10 10 10 1.5612183811543565 52.02904593763115 0.0 3 0.9339349691718218 4.774809808457673 17718.0 66.40848830947806 0.0 - - - - - - - 311.2 35 10 ARHGAP24 Rho GTPase activating protein 24 1863 237 B20140404_SF100_04 B20140404_SF100_04 TB154578.[MT7]-LAFSLGSVWRR.3y10_2.heavy 479.281 / 589.825 42013.0 35.70905113220215 42 16 10 6 10 5.359877708679678 18.657142090772336 0.035099029541015625 3 0.9601361489578348 6.160548229096949 42013.0 109.1328573082578 0.0 - - - - - - - 322.64285714285717 84 14 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1865 237 B20140404_SF100_04 B20140404_SF100_04 TB154578.[MT7]-LAFSLGSVWRR.3y6_1.heavy 479.281 / 760.421 3664.0 35.70905113220215 42 16 10 6 10 5.359877708679678 18.657142090772336 0.035099029541015625 3 0.9601361489578348 6.160548229096949 3664.0 21.523497267759566 1.0 - - - - - - - 262.84615384615387 7 13 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1867 237 B20140404_SF100_04 B20140404_SF100_04 TB154578.[MT7]-LAFSLGSVWRR.3b4_1.heavy 479.281 / 563.331 16244.0 35.70905113220215 42 16 10 6 10 5.359877708679678 18.657142090772336 0.035099029541015625 3 0.9601361489578348 6.160548229096949 16244.0 47.62571832707003 0.0 - - - - - - - 733.0 32 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1869 237 B20140404_SF100_04 B20140404_SF100_04 TB154578.[MT7]-LAFSLGSVWRR.3y9_2.heavy 479.281 / 554.307 12091.0 35.70905113220215 42 16 10 6 10 5.359877708679678 18.657142090772336 0.035099029541015625 3 0.9601361489578348 6.160548229096949 12091.0 36.70999616527658 0.0 - - - - - - - 279.0 24 14 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1871 238 B20140404_SF100_04 B20140404_SF100_04 TB501884.[MT7]-C[CAM]PWQEFVSYR.2y8_1.heavy 758.362 / 1114.53 2346.0 34.99250030517578 38 17 9 6 6 2.612334094227334 31.118877655077736 0.0355987548828125 5 0.9759598100727722 7.943639356465744 2346.0 0.9694214876033057 3.0 - - - - - - - 282.4166666666667 4 12 MYOZ3 myozenin 3 1873 238 B20140404_SF100_04 B20140404_SF100_04 TB501884.[MT7]-C[CAM]PWQEFVSYR.2y9_1.heavy 758.362 / 1211.58 22937.0 34.99250030517578 38 17 9 6 6 2.612334094227334 31.118877655077736 0.0355987548828125 5 0.9759598100727722 7.943639356465744 22937.0 0.3434068196279523 2.0 - - - - - - - 304.3333333333333 53 3 MYOZ3 myozenin 3 1875 238 B20140404_SF100_04 B20140404_SF100_04 TB501884.[MT7]-C[CAM]PWQEFVSYR.2y6_1.heavy 758.362 / 800.394 8211.0 34.99250030517578 38 17 9 6 6 2.612334094227334 31.118877655077736 0.0355987548828125 5 0.9759598100727722 7.943639356465744 8211.0 6.79 0.0 - - - - - - - 651.5555555555555 16 9 MYOZ3 myozenin 3 1877 238 B20140404_SF100_04 B20140404_SF100_04 TB501884.[MT7]-C[CAM]PWQEFVSYR.2y7_1.heavy 758.362 / 928.452 5213.0 34.99250030517578 38 17 9 6 6 2.612334094227334 31.118877655077736 0.0355987548828125 5 0.9759598100727722 7.943639356465744 5213.0 1.036970730321114 1.0 - - - - - - - 595.5714285714286 11 7 MYOZ3 myozenin 3 1879 239 B20140404_SF100_04 B20140404_SF100_04 TB502077.[MT7]-LFIATAVDGK[MT7]PEYFPTISSR.3y6_1.heavy 834.128 / 660.367 12209.0 35.54382610321045 38 12 10 6 10 1.338890488077573 62.69661000158529 0.034702301025390625 3 0.883059782126315 3.5731762384461767 12209.0 11.17602338815314 0.0 - - - - - - - 696.8461538461538 24 13 PLXNA4 plexin A4 1881 239 B20140404_SF100_04 B20140404_SF100_04 TB502077.[MT7]-LFIATAVDGK[MT7]PEYFPTISSR.3b3_1.heavy 834.128 / 518.346 23537.0 35.54382610321045 38 12 10 6 10 1.338890488077573 62.69661000158529 0.034702301025390625 3 0.883059782126315 3.5731762384461767 23537.0 15.839491567330844 0.0 - - - - - - - 1133.0 47 7 PLXNA4 plexin A4 1883 239 B20140404_SF100_04 B20140404_SF100_04 TB502077.[MT7]-LFIATAVDGK[MT7]PEYFPTISSR.3y8_1.heavy 834.128 / 970.499 5286.0 35.54382610321045 38 12 10 6 10 1.338890488077573 62.69661000158529 0.034702301025390625 3 0.883059782126315 3.5731762384461767 5286.0 9.629314796425026 0.0 - - - - - - - 692.0 10 12 PLXNA4 plexin A4 1885 239 B20140404_SF100_04 B20140404_SF100_04 TB502077.[MT7]-LFIATAVDGK[MT7]PEYFPTISSR.3y10_1.heavy 834.128 / 1196.59 28572.0 35.54382610321045 38 12 10 6 10 1.338890488077573 62.69661000158529 0.034702301025390625 3 0.883059782126315 3.5731762384461767 28572.0 127.24791903140371 0.0 - - - - - - - 229.0909090909091 57 11 PLXNA4 plexin A4 1887 240 B20140404_SF100_04 B20140404_SF100_04 TB154712.[MT7]-GEVASTPSDNLDPK[MT7].3y3_1.heavy 573.3 / 503.295 25214.0 24.534700393676758 44 14 10 10 10 1.9538129861978748 43.58457606796637 0.0 3 0.9484603528485087 5.412631836111497 25214.0 12.452277926502799 1.0 - - - - - - - 408.0 50 1 RNF8 ring finger protein 8 1889 240 B20140404_SF100_04 B20140404_SF100_04 TB154712.[MT7]-GEVASTPSDNLDPK[MT7].3b6_1.heavy 573.3 / 689.359 23785.0 24.534700393676758 44 14 10 10 10 1.9538129861978748 43.58457606796637 0.0 3 0.9484603528485087 5.412631836111497 23785.0 29.412657178145032 0.0 - - - - - - - 272.0 47 3 RNF8 ring finger protein 8 1891 240 B20140404_SF100_04 B20140404_SF100_04 TB154712.[MT7]-GEVASTPSDNLDPK[MT7].3b4_1.heavy 573.3 / 501.279 53185.0 24.534700393676758 44 14 10 10 10 1.9538129861978748 43.58457606796637 0.0 3 0.9484603528485087 5.412631836111497 53185.0 6.061312464697195 1.0 - - - - - - - 1940.0 111 1 RNF8 ring finger protein 8 1893 240 B20140404_SF100_04 B20140404_SF100_04 TB154712.[MT7]-GEVASTPSDNLDPK[MT7].3b5_1.heavy 573.3 / 588.311 21744.0 24.534700393676758 44 14 10 10 10 1.9538129861978748 43.58457606796637 0.0 3 0.9484603528485087 5.412631836111497 21744.0 26.33253103938242 0.0 - - - - - - - 357.0 43 2 RNF8 ring finger protein 8 1895 241 B20140404_SF100_04 B20140404_SF100_04 TB154710.[MT7]-ILELIQSGVAEGAK[MT7].2y4_1.heavy 858.511 / 548.316 7776.0 37.41469955444336 41 11 10 10 10 0.8392779966546937 63.03336430307844 0.0 3 0.8686986095610855 3.3678833176328276 7776.0 13.934030526514045 0.0 - - - - - - - 639.5714285714286 15 7 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1897 241 B20140404_SF100_04 B20140404_SF100_04 TB154710.[MT7]-ILELIQSGVAEGAK[MT7].2b3_1.heavy 858.511 / 500.32 30631.0 37.41469955444336 41 11 10 10 10 0.8392779966546937 63.03336430307844 0.0 3 0.8686986095610855 3.3678833176328276 30631.0 46.80360558832164 0.0 - - - - - - - 353.25 61 8 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1899 241 B20140404_SF100_04 B20140404_SF100_04 TB154710.[MT7]-ILELIQSGVAEGAK[MT7].2y8_1.heavy 858.511 / 862.475 19321.0 37.41469955444336 41 11 10 10 10 0.8392779966546937 63.03336430307844 0.0 3 0.8686986095610855 3.3678833176328276 19321.0 31.303783277326822 0.0 - - - - - - - 331.90909090909093 38 11 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1901 241 B20140404_SF100_04 B20140404_SF100_04 TB154710.[MT7]-ILELIQSGVAEGAK[MT7].2b4_1.heavy 858.511 / 613.404 43591.0 37.41469955444336 41 11 10 10 10 0.8392779966546937 63.03336430307844 0.0 3 0.8686986095610855 3.3678833176328276 43591.0 29.604442752190103 0.0 - - - - - - - 275.0 87 3 ALDH1A2 aldehyde dehydrogenase 1 family, member A2 1903 242 B20140404_SF100_04 B20140404_SF100_04 TB501877.[MT7]-SRVEQEQEAK[MT7].3b6_1.heavy 497.938 / 873.455 7755.0 18.428600311279297 35 5 10 10 10 0.49368724831379673 104.19980214866138 0.0 3 0.6613718058187738 2.0578070344615855 7755.0 75.61125000000001 0.0 - - - - - - - 111.42857142857143 15 14 RANBP3 RAN binding protein 3 1905 242 B20140404_SF100_04 B20140404_SF100_04 TB501877.[MT7]-SRVEQEQEAK[MT7].3b4_1.heavy 497.938 / 616.354 6476.0 18.428600311279297 35 5 10 10 10 0.49368724831379673 104.19980214866138 0.0 3 0.6613718058187738 2.0578070344615855 6476.0 37.01122765196663 0.0 - - - - - - - 723.7777777777778 12 9 RANBP3 RAN binding protein 3 1907 242 B20140404_SF100_04 B20140404_SF100_04 TB501877.[MT7]-SRVEQEQEAK[MT7].3b5_1.heavy 497.938 / 744.412 6356.0 18.428600311279297 35 5 10 10 10 0.49368724831379673 104.19980214866138 0.0 3 0.6613718058187738 2.0578070344615855 6356.0 24.717777777777776 0.0 - - - - - - - 245.0 12 16 RANBP3 RAN binding protein 3 1909 242 B20140404_SF100_04 B20140404_SF100_04 TB501877.[MT7]-SRVEQEQEAK[MT7].3b7_2.heavy 497.938 / 501.26 26942.0 18.428600311279297 35 5 10 10 10 0.49368724831379673 104.19980214866138 0.0 3 0.6613718058187738 2.0578070344615855 26942.0 103.05661563064942 0.0 - - - - - - - 350.0 53 12 RANBP3 RAN binding protein 3 1911 243 B20140404_SF100_04 B20140404_SF100_04 TB154716.[MT7]-TYSLVLDNC[CAM]INK[MT7].3y3_1.heavy 576.646 / 518.342 42041.0 31.693299293518066 38 14 9 5 10 1.3001781274749662 47.734805556796644 0.04780006408691406 3 0.9451730313629271 5.246392113277751 42041.0 23.007890600121613 0.0 - - - - - - - 808.5 84 2 RNF8 ring finger protein 8 1913 243 B20140404_SF100_04 B20140404_SF100_04 TB154716.[MT7]-TYSLVLDNC[CAM]INK[MT7].3b4_1.heavy 576.646 / 609.336 39616.0 31.693299293518066 38 14 9 5 10 1.3001781274749662 47.734805556796644 0.04780006408691406 3 0.9451730313629271 5.246392113277751 39616.0 33.87861393192034 0.0 - - - - - - - 485.0 79 2 RNF8 ring finger protein 8 1915 243 B20140404_SF100_04 B20140404_SF100_04 TB154716.[MT7]-TYSLVLDNC[CAM]INK[MT7].3b5_1.heavy 576.646 / 708.405 42850.0 31.693299293518066 38 14 9 5 10 1.3001781274749662 47.734805556796644 0.04780006408691406 3 0.9451730313629271 5.246392113277751 42850.0 41.46991542624626 0.0 - - - - - - - 377.0 85 3 RNF8 ring finger protein 8 1917 243 B20140404_SF100_04 B20140404_SF100_04 TB154716.[MT7]-TYSLVLDNC[CAM]INK[MT7].3y4_1.heavy 576.646 / 678.372 12451.0 31.693299293518066 38 14 9 5 10 1.3001781274749662 47.734805556796644 0.04780006408691406 3 0.9451730313629271 5.246392113277751 12451.0 11.134693045095329 2.0 - - - - - - - 485.0 107 1 RNF8 ring finger protein 8 1919 244 B20140404_SF100_04 B20140404_SF100_04 TB154874.[MT7]-TVGATVEFTVGDK[MT7]PVSNFR.3y7_1.heavy 771.421 / 991.581 18745.0 31.4768009185791 44 14 10 10 10 1.967478010638458 40.56013950458546 0.0 3 0.9318997783075174 4.702102759826435 18745.0 19.294444444444444 0.0 - - - - - - - 326.0 37 10 UNC119B unc-119 homolog B (C. elegans) 1921 244 B20140404_SF100_04 B20140404_SF100_04 TB154874.[MT7]-TVGATVEFTVGDK[MT7]PVSNFR.3y6_1.heavy 771.421 / 719.383 26569.0 31.4768009185791 44 14 10 10 10 1.967478010638458 40.56013950458546 0.0 3 0.9318997783075174 4.702102759826435 26569.0 30.89238095238095 0.0 - - - - - - - 791.7142857142857 53 7 UNC119B unc-119 homolog B (C. elegans) 1923 244 B20140404_SF100_04 B20140404_SF100_04 TB154874.[MT7]-TVGATVEFTVGDK[MT7]PVSNFR.3b7_1.heavy 771.421 / 802.443 22983.0 31.4768009185791 44 14 10 10 10 1.967478010638458 40.56013950458546 0.0 3 0.9318997783075174 4.702102759826435 22983.0 7.187083333333333 1.0 - - - - - - - 407.5 52 4 UNC119B unc-119 homolog B (C. elegans) 1925 244 B20140404_SF100_04 B20140404_SF100_04 TB154874.[MT7]-TVGATVEFTVGDK[MT7]PVSNFR.3y9_1.heavy 771.421 / 1163.63 19397.0 31.4768009185791 44 14 10 10 10 1.967478010638458 40.56013950458546 0.0 3 0.9318997783075174 4.702102759826435 19397.0 50.24444444444444 0.0 - - - - - - - 362.22222222222223 38 9 UNC119B unc-119 homolog B (C. elegans) 1927 245 B20140404_SF100_04 B20140404_SF100_04 TB501970.[MT7]-TTGPSEDAGGDSLVEK[MT7].3b6_1.heavy 617.646 / 717.354 20354.0 24.98390007019043 43 13 10 10 10 2.7173603776667457 36.80041882625253 0.0 3 0.9270759267280355 4.542047680289885 20354.0 18.070521722235714 0.0 - - - - - - - 341.0 40 2 LRP11 low density lipoprotein receptor-related protein 11 1929 245 B20140404_SF100_04 B20140404_SF100_04 TB501970.[MT7]-TTGPSEDAGGDSLVEK[MT7].3y3_1.heavy 617.646 / 519.326 121247.0 24.98390007019043 43 13 10 10 10 2.7173603776667457 36.80041882625253 0.0 3 0.9270759267280355 4.542047680289885 121247.0 44.051118021337764 0.0 - - - - - - - 2337.0 242 1 LRP11 low density lipoprotein receptor-related protein 11 1931 245 B20140404_SF100_04 B20140404_SF100_04 TB501970.[MT7]-TTGPSEDAGGDSLVEK[MT7].3b5_1.heavy 617.646 / 588.311 21620.0 24.98390007019043 43 13 10 10 10 2.7173603776667457 36.80041882625253 0.0 3 0.9270759267280355 4.542047680289885 21620.0 19.117826203278756 0.0 - - - - - - - 844.0 43 3 LRP11 low density lipoprotein receptor-related protein 11 1933 245 B20140404_SF100_04 B20140404_SF100_04 TB501970.[MT7]-TTGPSEDAGGDSLVEK[MT7].3b7_1.heavy 617.646 / 832.38 44603.0 24.98390007019043 43 13 10 10 10 2.7173603776667457 36.80041882625253 0.0 3 0.9270759267280355 4.542047680289885 44603.0 39.24481292592923 0.0 - - - - - - - 876.3333333333334 89 3 LRP11 low density lipoprotein receptor-related protein 11 1935 246 B20140404_SF100_04 B20140404_SF100_04 TB154566.[MT7]-NIFQEEESIR.2y8_1.heavy 704.863 / 1037.49 40352.0 31.4768009185791 50 20 10 10 10 11.826873087984008 8.455320291007355 0.0 3 0.9944267363732714 16.523637811748706 40352.0 100.88 0.0 - - - - - - - 387.6363636363636 80 11 SPATA9 spermatogenesis associated 9 1937 246 B20140404_SF100_04 B20140404_SF100_04 TB154566.[MT7]-NIFQEEESIR.2y5_1.heavy 704.863 / 633.32 16895.0 31.4768009185791 50 20 10 10 10 11.826873087984008 8.455320291007355 0.0 3 0.9944267363732714 16.523637811748706 16895.0 34.74005758807588 0.0 - - - - - - - 360.8 33 5 SPATA9 spermatogenesis associated 9 1939 246 B20140404_SF100_04 B20140404_SF100_04 TB154566.[MT7]-NIFQEEESIR.2y9_1.heavy 704.863 / 1150.57 20668.0 31.4768009185791 50 20 10 10 10 11.826873087984008 8.455320291007355 0.0 3 0.9944267363732714 16.523637811748706 20668.0 83.68019512195121 0.0 - - - - - - - 266.5 41 8 SPATA9 spermatogenesis associated 9 1941 246 B20140404_SF100_04 B20140404_SF100_04 TB154566.[MT7]-NIFQEEESIR.2y7_1.heavy 704.863 / 890.421 21652.0 31.4768009185791 50 20 10 10 10 11.826873087984008 8.455320291007355 0.0 3 0.9944267363732714 16.523637811748706 21652.0 48.7547212543554 0.0 - - - - - - - 351.42857142857144 43 7 SPATA9 spermatogenesis associated 9 1943 247 B20140404_SF100_04 B20140404_SF100_04 TB501972.[MT7]-NFDFDFGFC[CAM]IPSSR.2b3_1.heavy 926.926 / 521.248 32568.0 39.2244987487793 44 14 10 10 10 1.68346878633672 40.26918364851134 0.0 3 0.9495745058287999 5.472619066705549 32568.0 38.09170166986133 0.0 - - - - - - - 735.4285714285714 65 7 UNC119B unc-119 homolog B (C. elegans) 1945 247 B20140404_SF100_04 B20140404_SF100_04 TB501972.[MT7]-NFDFDFGFC[CAM]IPSSR.2y8_1.heavy 926.926 / 923.44 9065.0 39.2244987487793 44 14 10 10 10 1.68346878633672 40.26918364851134 0.0 3 0.9495745058287999 5.472619066705549 9065.0 38.040625 0.0 - - - - - - - 360.8888888888889 18 9 UNC119B unc-119 homolog B (C. elegans) 1947 247 B20140404_SF100_04 B20140404_SF100_04 TB501972.[MT7]-NFDFDFGFC[CAM]IPSSR.2y9_1.heavy 926.926 / 1070.51 17907.0 39.2244987487793 44 14 10 10 10 1.68346878633672 40.26918364851134 0.0 3 0.9495745058287999 5.472619066705549 17907.0 68.35037946428571 0.0 - - - - - - - 258.46153846153845 35 13 UNC119B unc-119 homolog B (C. elegans) 1949 247 B20140404_SF100_04 B20140404_SF100_04 TB501972.[MT7]-NFDFDFGFC[CAM]IPSSR.2b5_1.heavy 926.926 / 783.343 20033.0 39.2244987487793 44 14 10 10 10 1.68346878633672 40.26918364851134 0.0 3 0.9495745058287999 5.472619066705549 20033.0 16.453784974054944 1.0 - - - - - - - 364.0 40 8 UNC119B unc-119 homolog B (C. elegans) 1951 248 B20140404_SF100_04 B20140404_SF100_04 TB154469.[MT7]-STVGTQTDYR.2b8_1.heavy 636.321 / 934.46 38871.0 21.168899536132812 38 10 10 10 8 0.7706522165190177 77.13003900391357 0.0 4 0.8279587593243135 2.931658983647276 38871.0 94.21750389190777 0.0 - - - - - - - 301.0 77 16 C3orf15 chromosome 3 open reading frame 15 1953 248 B20140404_SF100_04 B20140404_SF100_04 TB154469.[MT7]-STVGTQTDYR.2y8_1.heavy 636.321 / 939.453 5573.0 21.168899536132812 38 10 10 10 8 0.7706522165190177 77.13003900391357 0.0 4 0.8279587593243135 2.931658983647276 5573.0 86.82572463768116 0.0 - - - - - - - 120.58333333333333 11 12 C3orf15 chromosome 3 open reading frame 15 1955 248 B20140404_SF100_04 B20140404_SF100_04 TB154469.[MT7]-STVGTQTDYR.2y9_1.heavy 636.321 / 1040.5 11489.0 21.168899536132812 38 10 10 10 8 0.7706522165190177 77.13003900391357 0.0 4 0.8279587593243135 2.931658983647276 11489.0 88.80588300395257 1.0 - - - - - - - 165.94117647058823 48 17 C3orf15 chromosome 3 open reading frame 15 1957 248 B20140404_SF100_04 B20140404_SF100_04 TB154469.[MT7]-STVGTQTDYR.2y7_1.heavy 636.321 / 840.385 23529.0 21.168899536132812 38 10 10 10 8 0.7706522165190177 77.13003900391357 0.0 4 0.8279587593243135 2.931658983647276 23529.0 79.12030218730519 0.0 - - - - - - - 240.875 47 16 C3orf15 chromosome 3 open reading frame 15 1959 249 B20140404_SF100_04 B20140404_SF100_04 TB502062.[MT7]-DEDETK[MT7]PLGTIFLPGNK[MT7].4y4_1.heavy 577.321 / 559.332 N/A 32.82929992675781 40 10 10 10 10 0.6060907929884026 87.22220982386227 0.0 3 0.8358729237106174 3.003620204491949 90088.0 11.557378114018247 0.0 - - - - - - - 4865.0 180 2 ARHGAP24 Rho GTPase activating protein 24 1961 249 B20140404_SF100_04 B20140404_SF100_04 TB502062.[MT7]-DEDETK[MT7]PLGTIFLPGNK[MT7].4b11_2.heavy 577.321 / 744.395 34686.0 32.82929992675781 40 10 10 10 10 0.6060907929884026 87.22220982386227 0.0 3 0.8358729237106174 3.003620204491949 34686.0 66.90086388334495 0.0 - - - - - - - 392.5 69 4 ARHGAP24 Rho GTPase activating protein 24 1963 249 B20140404_SF100_04 B20140404_SF100_04 TB502062.[MT7]-DEDETK[MT7]PLGTIFLPGNK[MT7].4b10_2.heavy 577.321 / 687.853 42533.0 32.82929992675781 40 10 10 10 10 0.6060907929884026 87.22220982386227 0.0 3 0.8358729237106174 3.003620204491949 42533.0 35.48716073445176 0.0 - - - - - - - 314.0 85 8 ARHGAP24 Rho GTPase activating protein 24 1965 249 B20140404_SF100_04 B20140404_SF100_04 TB502062.[MT7]-DEDETK[MT7]PLGTIFLPGNK[MT7].4b3_1.heavy 577.321 / 504.206 11300.0 32.82929992675781 40 10 10 10 10 0.6060907929884026 87.22220982386227 0.0 3 0.8358729237106174 3.003620204491949 11300.0 7.027237564706483 0.0 - - - - - - - 2197.0 22 8 ARHGAP24 Rho GTPase activating protein 24 1967 250 B20140404_SF100_04 B20140404_SF100_04 TB154468.[MT7]-HGPLGDNEER.3y7_1.heavy 423.21 / 832.38 2903.0 20.428999423980713 44 18 10 6 10 3.81198364443708 19.97290520289679 0.03159904479980469 3 0.984568174436385 9.921872314597502 2903.0 13.945497987927565 1.0 - - - - - - - 196.58823529411765 7 17 CDADC1 cytidine and dCMP deaminase domain containing 1 1969 250 B20140404_SF100_04 B20140404_SF100_04 TB154468.[MT7]-HGPLGDNEER.3y3_1.heavy 423.21 / 433.204 16595.0 20.428999423980713 44 18 10 6 10 3.81198364443708 19.97290520289679 0.03159904479980469 3 0.984568174436385 9.921872314597502 16595.0 13.426729503201766 0.0 - - - - - - - 1716.3 33 10 CDADC1 cytidine and dCMP deaminase domain containing 1 1971 250 B20140404_SF100_04 B20140404_SF100_04 TB154468.[MT7]-HGPLGDNEER.3y6_1.heavy 423.21 / 719.295 42467.0 20.428999423980713 44 18 10 6 10 3.81198364443708 19.97290520289679 0.03159904479980469 3 0.984568174436385 9.921872314597502 42467.0 187.25416022761306 0.0 - - - - - - - 668.8 84 10 CDADC1 cytidine and dCMP deaminase domain containing 1 1973 250 B20140404_SF100_04 B20140404_SF100_04 TB154468.[MT7]-HGPLGDNEER.3y5_1.heavy 423.21 / 662.274 11295.0 20.428999423980713 44 18 10 6 10 3.81198364443708 19.97290520289679 0.03159904479980469 3 0.984568174436385 9.921872314597502 11295.0 27.439137677171793 0.0 - - - - - - - 750.3333333333334 22 9 CDADC1 cytidine and dCMP deaminase domain containing 1 1975 251 B20140404_SF100_04 B20140404_SF100_04 TB501870.[MT7]-VTPEIPAGLPSPR.3y7_1.heavy 493.288 / 697.399 52762.0 31.037150382995605 38 15 10 3 10 2.200725564700694 36.312305034327025 0.05209922790527344 3 0.959358853042448 6.1009498640243685 52762.0 66.0501883367425 0.0 - - - - - - - 381.3333333333333 105 3 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 1977 251 B20140404_SF100_04 B20140404_SF100_04 TB501870.[MT7]-VTPEIPAGLPSPR.3y6_1.heavy 493.288 / 626.362 81675.0 31.037150382995605 38 15 10 3 10 2.200725564700694 36.312305034327025 0.05209922790527344 3 0.959358853042448 6.1009498640243685 81675.0 63.926014218931655 0.0 - - - - - - - 408.5 163 2 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 1979 251 B20140404_SF100_04 B20140404_SF100_04 TB501870.[MT7]-VTPEIPAGLPSPR.3b5_1.heavy 493.288 / 684.405 78245.0 31.037150382995605 38 15 10 3 10 2.200725564700694 36.312305034327025 0.05209922790527344 3 0.959358853042448 6.1009498640243685 78245.0 155.83072406788136 0.0 - - - - - - - 490.0 156 2 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 1981 251 B20140404_SF100_04 B20140404_SF100_04 TB501870.[MT7]-VTPEIPAGLPSPR.3y8_1.heavy 493.288 / 794.452 51292.0 31.037150382995605 38 15 10 3 10 2.200725564700694 36.312305034327025 0.05209922790527344 3 0.959358853042448 6.1009498640243685 51292.0 117.39980848558416 0.0 - - - - - - - 367.5 102 4 TNFSF9 tumor necrosis factor (ligand) superfamily, member 9