Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140407_SF104_02 B20140407_SF104_02 TB390387.[MT7]-IMQDFESDTFFSEIDLEK[MT7].3b6_1.heavy 828.069 / 908.43 17223.0 40.04240036010742 41 11 10 10 10 0.8199818987462156 64.2049299126306 0.0 3 0.8702990770780239 3.389073745588811 17223.0 23.30182709209545 0.0 - - - - - - - 1174.0 34 7 DHFRL1 dihydrofolate reductase-like 1 3 1 B20140407_SF104_02 B20140407_SF104_02 TB390387.[MT7]-IMQDFESDTFFSEIDLEK[MT7].3b4_1.heavy 828.069 / 632.319 22964.0 40.04240036010742 41 11 10 10 10 0.8199818987462156 64.2049299126306 0.0 3 0.8702990770780239 3.389073745588811 22964.0 29.474783847971906 0.0 - - - - - - - 412.6666666666667 45 3 DHFRL1 dihydrofolate reductase-like 1 5 1 B20140407_SF104_02 B20140407_SF104_02 TB390387.[MT7]-IMQDFESDTFFSEIDLEK[MT7].3y4_1.heavy 828.069 / 648.369 37260.0 40.04240036010742 41 11 10 10 10 0.8199818987462156 64.2049299126306 0.0 3 0.8702990770780239 3.389073745588811 37260.0 28.567741935483866 0.0 - - - - - - - 394.0 74 2 DHFRL1 dihydrofolate reductase-like 1 7 1 B20140407_SF104_02 B20140407_SF104_02 TB390387.[MT7]-IMQDFESDTFFSEIDLEK[MT7].3b8_1.heavy 828.069 / 1110.49 8217.0 40.04240036010742 41 11 10 10 10 0.8199818987462156 64.2049299126306 0.0 3 0.8702990770780239 3.389073745588811 8217.0 30.591824511545294 0.0 - - - - - - - 225.27272727272728 16 11 DHFRL1 dihydrofolate reductase-like 1 9 2 B20140407_SF104_02 B20140407_SF104_02 TB151449.[MT7]-YFRVTEVDIPSVQILNLSSDAR.3y8_1.heavy 889.481 / 875.458 8591.0 37.50019836425781 37 7 10 10 10 0.6401882231493974 87.31908921451888 0.0 3 0.7412001580694592 2.3715650047679673 8591.0 5.533652533043415 1.0 - - - - - - - 716.0 27 10 PDILT protein disulfide isomerase-like, testis expressed 11 2 B20140407_SF104_02 B20140407_SF104_02 TB151449.[MT7]-YFRVTEVDIPSVQILNLSSDAR.3b8_1.heavy 889.481 / 1154.6 12627.0 37.50019836425781 37 7 10 10 10 0.6401882231493974 87.31908921451888 0.0 3 0.7412001580694592 2.3715650047679673 12627.0 40.709609098440914 0.0 - - - - - - - 613.8571428571429 25 7 PDILT protein disulfide isomerase-like, testis expressed 13 2 B20140407_SF104_02 B20140407_SF104_02 TB151449.[MT7]-YFRVTEVDIPSVQILNLSSDAR.3b8_2.heavy 889.481 / 577.802 22389.0 37.50019836425781 37 7 10 10 10 0.6401882231493974 87.31908921451888 0.0 3 0.7412001580694592 2.3715650047679673 22389.0 53.31903624218117 0.0 - - - - - - - 289.1111111111111 44 9 PDILT protein disulfide isomerase-like, testis expressed 15 2 B20140407_SF104_02 B20140407_SF104_02 TB151449.[MT7]-YFRVTEVDIPSVQILNLSSDAR.3y9_1.heavy 889.481 / 988.542 5337.0 37.50019836425781 37 7 10 10 10 0.6401882231493974 87.31908921451888 0.0 3 0.7412001580694592 2.3715650047679673 5337.0 12.84538834178089 0.0 - - - - - - - 667.25 10 8 PDILT protein disulfide isomerase-like, testis expressed 17 3 B20140407_SF104_02 B20140407_SF104_02 TB150883.[MT7]-GASPEDFK[MT7].2y5_1.heavy 569.803 / 779.406 8892.0 24.468324661254883 37 11 10 6 10 1.5175947337076139 51.09985378176981 0.038299560546875 3 0.8663493800206011 3.3374657612357295 8892.0 24.624 2.0 - - - - - - - 712.7142857142857 17 7 DNAJC5G DnaJ (Hsp40) homolog, subfamily C, member 5 gamma 19 3 B20140407_SF104_02 B20140407_SF104_02 TB150883.[MT7]-GASPEDFK[MT7].2y3_1.heavy 569.803 / 553.31 3579.0 24.468324661254883 37 11 10 6 10 1.5175947337076139 51.09985378176981 0.038299560546875 3 0.8663493800206011 3.3374657612357295 3579.0 4.4111623616236155 6.0 - - - - - - - 759.0 14 4 DNAJC5G DnaJ (Hsp40) homolog, subfamily C, member 5 gamma 21 3 B20140407_SF104_02 B20140407_SF104_02 TB150883.[MT7]-GASPEDFK[MT7].2b6_1.heavy 569.803 / 701.322 18543.0 24.468324661254883 37 11 10 6 10 1.5175947337076139 51.09985378176981 0.038299560546875 3 0.8663493800206011 3.3374657612357295 18543.0 25.180924072421266 0.0 - - - - - - - 271.0 37 2 DNAJC5G DnaJ (Hsp40) homolog, subfamily C, member 5 gamma 23 3 B20140407_SF104_02 B20140407_SF104_02 TB150883.[MT7]-GASPEDFK[MT7].2y6_1.heavy 569.803 / 866.438 4229.0 24.468324661254883 37 11 10 6 10 1.5175947337076139 51.09985378176981 0.038299560546875 3 0.8663493800206011 3.3374657612357295 4229.0 9.485124216657187 0.0 - - - - - - - 728.2857142857143 8 7 DNAJC5G DnaJ (Hsp40) homolog, subfamily C, member 5 gamma 25 4 B20140407_SF104_02 B20140407_SF104_02 TB390388.[MT7]-RIQEIIEQLDVTTSEYEK[MT7].3y7_1.heavy 828.114 / 1001.49 21322.0 36.88409996032715 38 13 10 5 10 2.4603646900187552 32.461635234731226 0.043201446533203125 3 0.9007248805948151 3.884025144498244 21322.0 37.348646153846154 0.0 - - - - - - - 761.4285714285714 42 7 HSPD1 heat shock 60kDa protein 1 (chaperonin) 27 4 B20140407_SF104_02 B20140407_SF104_02 TB390388.[MT7]-RIQEIIEQLDVTTSEYEK[MT7].3y3_1.heavy 828.114 / 583.321 22622.0 36.88409996032715 38 13 10 5 10 2.4603646900187552 32.461635234731226 0.043201446533203125 3 0.9007248805948151 3.884025144498244 22622.0 26.153488687782804 0.0 - - - - - - - 312.0 45 5 HSPD1 heat shock 60kDa protein 1 (chaperonin) 29 4 B20140407_SF104_02 B20140407_SF104_02 TB390388.[MT7]-RIQEIIEQLDVTTSEYEK[MT7].3b4_1.heavy 828.114 / 671.396 9491.0 36.88409996032715 38 13 10 5 10 2.4603646900187552 32.461635234731226 0.043201446533203125 3 0.9007248805948151 3.884025144498244 9491.0 15.696653846153845 0.0 - - - - - - - 676.0 18 10 HSPD1 heat shock 60kDa protein 1 (chaperonin) 31 4 B20140407_SF104_02 B20140407_SF104_02 TB390388.[MT7]-RIQEIIEQLDVTTSEYEK[MT7].3b5_1.heavy 828.114 / 784.48 12481.0 36.88409996032715 38 13 10 5 10 2.4603646900187552 32.461635234731226 0.043201446533203125 3 0.9007248805948151 3.884025144498244 12481.0 10.004162895927603 0.0 - - - - - - - 1235.0 24 10 HSPD1 heat shock 60kDa protein 1 (chaperonin) 33 5 B20140407_SF104_02 B20140407_SF104_02 TB151103.[MT7]-C[CAM]LEPDGLYK[MT7].3b6_1.heavy 461.579 / 816.368 42286.0 28.121700286865234 50 20 10 10 10 17.614981489311003 5.676985812371208 0.0 3 0.998965483599555 38.366857781282924 42286.0 50.45001343165303 0.0 - - - - - - - 298.61538461538464 84 13 ASTN2 astrotactin 2 35 5 B20140407_SF104_02 B20140407_SF104_02 TB151103.[MT7]-C[CAM]LEPDGLYK[MT7].3b5_1.heavy 461.579 / 759.346 12999.0 28.121700286865234 50 20 10 10 10 17.614981489311003 5.676985812371208 0.0 3 0.998965483599555 38.366857781282924 12999.0 12.275510292247013 1.0 - - - - - - - 336.0 43 4 ASTN2 astrotactin 2 37 5 B20140407_SF104_02 B20140407_SF104_02 TB151103.[MT7]-C[CAM]LEPDGLYK[MT7].3y4_1.heavy 461.579 / 624.384 23758.0 28.121700286865234 50 20 10 10 10 17.614981489311003 5.676985812371208 0.0 3 0.998965483599555 38.366857781282924 23758.0 28.171893108319708 0.0 - - - - - - - 1280.7142857142858 47 7 ASTN2 astrotactin 2 39 5 B20140407_SF104_02 B20140407_SF104_02 TB151103.[MT7]-C[CAM]LEPDGLYK[MT7].3b3_1.heavy 461.579 / 547.267 185280.0 28.121700286865234 50 20 10 10 10 17.614981489311003 5.676985812371208 0.0 3 0.998965483599555 38.366857781282924 185280.0 76.6266474812325 0.0 - - - - - - - 1494.0 370 1 ASTN2 astrotactin 2 41 6 B20140407_SF104_02 B20140407_SF104_02 TB151108.[MT7]-VSDYILQHK[MT7].3y3_1.heavy 464.269 / 556.332 34935.0 28.249300003051758 50 20 10 10 10 7.2806970435759775 13.73494864591758 0.0 3 0.9976954161708332 25.702932383246885 34935.0 23.50574816940619 0.0 - - - - - - - 1756.142857142857 69 7 ASTN2 astrotactin 2 43 6 B20140407_SF104_02 B20140407_SF104_02 TB151108.[MT7]-VSDYILQHK[MT7].3b4_1.heavy 464.269 / 609.3 198965.0 28.249300003051758 50 20 10 10 10 7.2806970435759775 13.73494864591758 0.0 3 0.9976954161708332 25.702932383246885 198965.0 77.50720634487541 0.0 - - - - - - - 825.0 397 2 ASTN2 astrotactin 2 45 6 B20140407_SF104_02 B20140407_SF104_02 TB151108.[MT7]-VSDYILQHK[MT7].3b5_1.heavy 464.269 / 722.384 82765.0 28.249300003051758 50 20 10 10 10 7.2806970435759775 13.73494864591758 0.0 3 0.9976954161708332 25.702932383246885 82765.0 119.56324436107637 0.0 - - - - - - - 765.0 165 10 ASTN2 astrotactin 2 47 6 B20140407_SF104_02 B20140407_SF104_02 TB151108.[MT7]-VSDYILQHK[MT7].3y4_1.heavy 464.269 / 669.416 33136.0 28.249300003051758 50 20 10 10 10 7.2806970435759775 13.73494864591758 0.0 3 0.9976954161708332 25.702932383246885 33136.0 38.165070080958664 0.0 - - - - - - - 685.7142857142857 66 7 ASTN2 astrotactin 2 49 7 B20140407_SF104_02 B20140407_SF104_02 TB151041.[MT7]-TWFSIPEK[MT7].3y3_1.heavy 432.579 / 517.31 563079.0 34.208099365234375 41 11 10 10 10 0.7623331373599571 66.05864149973678 0.0 3 0.8575863726401778 3.230668250049585 563079.0 617.1200761337533 0.0 - - - - - - - 629.0 1126 3 DHFR;DHFRL1 dihydrofolate reductase;dihydrofolate reductase-like 1 51 7 B20140407_SF104_02 B20140407_SF104_02 TB151041.[MT7]-TWFSIPEK[MT7].3b4_1.heavy 432.579 / 666.337 152919.0 34.208099365234375 41 11 10 10 10 0.7623331373599571 66.05864149973678 0.0 3 0.8575863726401778 3.230668250049585 152919.0 339.2528007138684 0.0 - - - - - - - 202.5 305 6 DHFR;DHFRL1 dihydrofolate reductase;dihydrofolate reductase-like 1 53 7 B20140407_SF104_02 B20140407_SF104_02 TB151041.[MT7]-TWFSIPEK[MT7].3b3_1.heavy 432.579 / 579.305 127567.0 34.208099365234375 41 11 10 10 10 0.7623331373599571 66.05864149973678 0.0 3 0.8575863726401778 3.230668250049585 127567.0 298.1617633258495 0.0 - - - - - - - 640.25 255 8 DHFR;DHFRL1 dihydrofolate reductase;dihydrofolate reductase-like 1 55 7 B20140407_SF104_02 B20140407_SF104_02 TB151041.[MT7]-TWFSIPEK[MT7].3y3_2.heavy 432.579 / 259.159 590424.0 34.208099365234375 41 11 10 10 10 0.7623331373599571 66.05864149973678 0.0 3 0.8575863726401778 3.230668250049585 590424.0 254.13855386901832 0.0 - - - - - - - 270.0 1180 1 DHFR;DHFRL1 dihydrofolate reductase;dihydrofolate reductase-like 1 57 8 B20140407_SF104_02 B20140407_SF104_02 TB151107.[MT7]-NTYYLTLSK[MT7].3y3_1.heavy 464.266 / 491.331 158589.0 30.21579933166504 47 17 10 10 10 3.4703688295496673 23.054804260146806 0.0 3 0.9791752887178155 8.53721678932092 158589.0 64.65144645692018 0.0 - - - - - - - 1417.0 317 1 ASTN2 astrotactin 2 59 8 B20140407_SF104_02 B20140407_SF104_02 TB151107.[MT7]-NTYYLTLSK[MT7].3b4_1.heavy 464.266 / 686.327 151345.0 30.21579933166504 47 17 10 10 10 3.4703688295496673 23.054804260146806 0.0 3 0.9791752887178155 8.53721678932092 151345.0 72.75766091874583 0.0 - - - - - - - 157.0 302 1 ASTN2 astrotactin 2 61 8 B20140407_SF104_02 B20140407_SF104_02 TB151107.[MT7]-NTYYLTLSK[MT7].3y4_1.heavy 464.266 / 592.379 137644.0 30.21579933166504 47 17 10 10 10 3.4703688295496673 23.054804260146806 0.0 3 0.9791752887178155 8.53721678932092 137644.0 86.43265306122449 0.0 - - - - - - - 283.0 275 5 ASTN2 astrotactin 2 63 8 B20140407_SF104_02 B20140407_SF104_02 TB151107.[MT7]-NTYYLTLSK[MT7].3b3_1.heavy 464.266 / 523.263 168826.0 30.21579933166504 47 17 10 10 10 3.4703688295496673 23.054804260146806 0.0 3 0.9791752887178155 8.53721678932092 168826.0 73.2328535167933 0.0 - - - - - - - 787.5 337 2 ASTN2 astrotactin 2 65 9 B20140407_SF104_02 B20140407_SF104_02 TB499720.[MT7]-DLSAFEVSWK[MT7].2y4_1.heavy 735.398 / 663.395 9792.0 35.0989990234375 42 18 8 10 6 3.352523588911754 23.85892840277317 0.0 5 0.980186419751625 8.75308597388632 9792.0 10.254039361142636 0.0 - - - - - - - 1191.111111111111 19 9 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 67 9 B20140407_SF104_02 B20140407_SF104_02 TB499720.[MT7]-DLSAFEVSWK[MT7].2b4_1.heavy 735.398 / 531.289 9527.0 35.0989990234375 42 18 8 10 6 3.352523588911754 23.85892840277317 0.0 5 0.980186419751625 8.75308597388632 9527.0 11.632998643829424 2.0 - - - - - - - 756.1428571428571 26 7 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 69 9 B20140407_SF104_02 B20140407_SF104_02 TB499720.[MT7]-DLSAFEVSWK[MT7].2y3_1.heavy 735.398 / 564.326 N/A 35.0989990234375 42 18 8 10 6 3.352523588911754 23.85892840277317 0.0 5 0.980186419751625 8.75308597388632 8733.0 8.905099803602614 0.0 - - - - - - - 297.75 17 4 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 71 9 B20140407_SF104_02 B20140407_SF104_02 TB499720.[MT7]-DLSAFEVSWK[MT7].2y6_1.heavy 735.398 / 939.506 9262.0 35.0989990234375 42 18 8 10 6 3.352523588911754 23.85892840277317 0.0 5 0.980186419751625 8.75308597388632 9262.0 16.642048698572626 0.0 - - - - - - - 733.6363636363636 18 11 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 73 10 B20140407_SF104_02 B20140407_SF104_02 TB150785.[MT7]-VLAPHLTR.3y3_1.heavy 350.89 / 389.251 452722.0 25.5226993560791 50 20 10 10 10 12.646336724863426 7.9074282280808035 0.0 3 0.998064798190094 28.04976175390514 452722.0 194.76983397322692 0.0 - - - - - - - 1296.0 905 1 HSPD1 heat shock 60kDa protein 1 (chaperonin) 75 10 B20140407_SF104_02 B20140407_SF104_02 TB150785.[MT7]-VLAPHLTR.3y4_1.heavy 350.89 / 526.31 195724.0 25.5226993560791 50 20 10 10 10 12.646336724863426 7.9074282280808035 0.0 3 0.998064798190094 28.04976175390514 195724.0 39.41087699274584 0.0 - - - - - - - 1061.0 391 1 HSPD1 heat shock 60kDa protein 1 (chaperonin) 77 10 B20140407_SF104_02 B20140407_SF104_02 TB150785.[MT7]-VLAPHLTR.3b3_1.heavy 350.89 / 428.299 440703.0 25.5226993560791 50 20 10 10 10 12.646336724863426 7.9074282280808035 0.0 3 0.998064798190094 28.04976175390514 440703.0 167.38365680954658 0.0 - - - - - - - 2475.0 881 1 HSPD1 heat shock 60kDa protein 1 (chaperonin) 79 10 B20140407_SF104_02 B20140407_SF104_02 TB150785.[MT7]-VLAPHLTR.3y5_1.heavy 350.89 / 623.362 61392.0 25.5226993560791 50 20 10 10 10 12.646336724863426 7.9074282280808035 0.0 3 0.998064798190094 28.04976175390514 61392.0 579.333372329969 0.0 - - - - - - - 235.875 122 8 HSPD1 heat shock 60kDa protein 1 (chaperonin) 81 11 B20140407_SF104_02 B20140407_SF104_02 TB499829.[MT7]-IILILLQGDRNNLK[MT7].3y8_1.heavy 637.738 / 1088.59 7546.0 38.124698638916016 38 8 10 10 10 0.9039331679458309 73.52663630257325 0.0 3 0.7798140383537012 2.58021581883016 7546.0 20.45056947890819 0.0 - - - - - - - 177.27272727272728 15 11 RWDD3 RWD domain containing 3 83 11 B20140407_SF104_02 B20140407_SF104_02 TB499829.[MT7]-IILILLQGDRNNLK[MT7].3y12_2.heavy 637.738 / 770.968 46318.0 38.124698638916016 38 8 10 10 10 0.9039331679458309 73.52663630257325 0.0 3 0.7798140383537012 2.58021581883016 46318.0 65.02120186513221 0.0 - - - - - - - 669.1428571428571 92 7 RWDD3 RWD domain containing 3 85 11 B20140407_SF104_02 B20140407_SF104_02 TB499829.[MT7]-IILILLQGDRNNLK[MT7].3y13_2.heavy 637.738 / 827.51 44757.0 38.124698638916016 38 8 10 10 10 0.9039331679458309 73.52663630257325 0.0 3 0.7798140383537012 2.58021581883016 44757.0 77.314472052743 1.0 - - - - - - - 286.0 119 5 RWDD3 RWD domain containing 3 87 11 B20140407_SF104_02 B20140407_SF104_02 TB499829.[MT7]-IILILLQGDRNNLK[MT7].3y9_1.heavy 637.738 / 1201.68 7416.0 38.124698638916016 38 8 10 10 10 0.9039331679458309 73.52663630257325 0.0 3 0.7798140383537012 2.58021581883016 7416.0 73.58953846153847 0.0 - - - - - - - 173.33333333333334 14 9 RWDD3 RWD domain containing 3 89 12 B20140407_SF104_02 B20140407_SF104_02 TB499721.[MT7]-GRPNITHAVPK[MT7].3b6_1.heavy 493.3 / 783.459 16455.0 21.3517328898112 31 5 10 6 10 0.6793051282782727 100.00179243102016 0.03700065612792969 3 0.6388141534503661 1.9882079639628931 16455.0 41.319699892317054 0.0 - - - - - - - 583.8888888888889 32 9 INHBB inhibin, beta B 91 12 B20140407_SF104_02 B20140407_SF104_02 TB499721.[MT7]-GRPNITHAVPK[MT7].3b4_1.heavy 493.3 / 569.328 4566.0 21.3517328898112 31 5 10 6 10 0.6793051282782727 100.00179243102016 0.03700065612792969 3 0.6388141534503661 1.9882079639628931 4566.0 6.995542113394822 0.0 - - - - - - - 643.2 9 15 INHBB inhibin, beta B 93 12 B20140407_SF104_02 B20140407_SF104_02 TB499721.[MT7]-GRPNITHAVPK[MT7].3b8_2.heavy 493.3 / 496.281 74003.0 21.3517328898112 31 5 10 6 10 0.6793051282782727 100.00179243102016 0.03700065612792969 3 0.6388141534503661 1.9882079639628931 74003.0 168.76245734350857 0.0 - - - - - - - 701.4285714285714 148 7 INHBB inhibin, beta B 95 12 B20140407_SF104_02 B20140407_SF104_02 TB499721.[MT7]-GRPNITHAVPK[MT7].3b5_1.heavy 493.3 / 682.412 N/A 21.3517328898112 31 5 10 6 10 0.6793051282782727 100.00179243102016 0.03700065612792969 3 0.6388141534503661 1.9882079639628931 42214.0 88.74483865144524 0.0 - - - - - - - 654.7 84 10 INHBB inhibin, beta B 97 13 B20140407_SF104_02 B20140407_SF104_02 TB499928.[MT7]-TALLDAAGVASLLTTAEVVVTEIPK[MT7].4b8_1.heavy 693.407 / 857.485 3626.0 46.415199279785156 42 16 10 8 8 3.2575389855622428 30.698020942561413 0.01760101318359375 4 0.9645282876416805 6.5332472986533325 3626.0 24.553087757313108 1.0 - - - - - - - 127.69811320754717 7 53 HSPD1 heat shock 60kDa protein 1 (chaperonin) 99 13 B20140407_SF104_02 B20140407_SF104_02 TB499928.[MT7]-TALLDAAGVASLLTTAEVVVTEIPK[MT7].4b5_1.heavy 693.407 / 658.389 1771.0 46.415199279785156 42 16 10 8 8 3.2575389855622428 30.698020942561413 0.01760101318359375 4 0.9645282876416805 6.5332472986533325 1771.0 4.735230930895869 0.0 - - - - - - - 644.4285714285714 3 7 HSPD1 heat shock 60kDa protein 1 (chaperonin) 101 13 B20140407_SF104_02 B20140407_SF104_02 TB499928.[MT7]-TALLDAAGVASLLTTAEVVVTEIPK[MT7].4b7_1.heavy 693.407 / 800.463 1103.0 46.415199279785156 42 16 10 8 8 3.2575389855622428 30.698020942561413 0.01760101318359375 4 0.9645282876416805 6.5332472986533325 1103.0 2.0038975155279504 1.0 - - - - - - - 113.06896551724138 2 58 HSPD1 heat shock 60kDa protein 1 (chaperonin) 103 13 B20140407_SF104_02 B20140407_SF104_02 TB499928.[MT7]-TALLDAAGVASLLTTAEVVVTEIPK[MT7].4b6_1.heavy 693.407 / 729.426 1596.0 46.415199279785156 42 16 10 8 8 3.2575389855622428 30.698020942561413 0.01760101318359375 4 0.9645282876416805 6.5332472986533325 1596.0 7.659672195504957 1.0 - - - - - - - 131.89473684210526 5 57 HSPD1 heat shock 60kDa protein 1 (chaperonin) 105 14 B20140407_SF104_02 B20140407_SF104_02 TB499722.[MT7]-ELQQEFGITK[MT7].3b4_1.heavy 494.28 / 643.353 142243.0 30.21579933166504 45 15 10 10 10 2.2861458260518317 34.82067965119364 0.0 3 0.9579268786542301 5.9955004946439985 142243.0 171.84661567413553 0.0 - - - - - - - 352.75 284 4 PDILT protein disulfide isomerase-like, testis expressed 107 14 B20140407_SF104_02 B20140407_SF104_02 TB499722.[MT7]-ELQQEFGITK[MT7].3b5_1.heavy 494.28 / 772.396 201994.0 30.21579933166504 45 15 10 10 10 2.2861458260518317 34.82067965119364 0.0 3 0.9579268786542301 5.9955004946439985 201994.0 235.17466469755237 0.0 - - - - - - - 345.0 403 5 PDILT protein disulfide isomerase-like, testis expressed 109 14 B20140407_SF104_02 B20140407_SF104_02 TB499722.[MT7]-ELQQEFGITK[MT7].3y4_1.heavy 494.28 / 562.368 370270.0 30.21579933166504 45 15 10 10 10 2.2861458260518317 34.82067965119364 0.0 3 0.9579268786542301 5.9955004946439985 370270.0 266.05660842518085 0.0 - - - - - - - 470.0 740 1 PDILT protein disulfide isomerase-like, testis expressed 111 14 B20140407_SF104_02 B20140407_SF104_02 TB499722.[MT7]-ELQQEFGITK[MT7].3b3_1.heavy 494.28 / 515.295 231478.0 30.21579933166504 45 15 10 10 10 2.2861458260518317 34.82067965119364 0.0 3 0.9579268786542301 5.9955004946439985 231478.0 145.0213948328451 0.0 - - - - - - - 470.0 462 1 PDILT protein disulfide isomerase-like, testis expressed 113 15 B20140407_SF104_02 B20140407_SF104_02 TB150688.[MT7]-LGEVNK[MT7].2y4_1.heavy 474.292 / 633.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 115 15 B20140407_SF104_02 B20140407_SF104_02 TB150688.[MT7]-LGEVNK[MT7].2y5_1.heavy 474.292 / 690.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 117 15 B20140407_SF104_02 B20140407_SF104_02 TB150688.[MT7]-LGEVNK[MT7].2b4_1.heavy 474.292 / 543.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 119 15 B20140407_SF104_02 B20140407_SF104_02 TB150688.[MT7]-LGEVNK[MT7].2y3_1.heavy 474.292 / 504.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 121 16 B20140407_SF104_02 B20140407_SF104_02 TB389846.[MT7]-AEPTNPSK[MT7].2y4_1.heavy 566.316 / 589.343 5493.0 18.697999954223633 48 18 10 10 10 7.963928607796559 12.556616831308808 0.0 3 0.98442940500171 9.877445254478639 5493.0 36.19132445462898 0.0 - - - - - - - 198.5 10 16 PYCARD PYD and CARD domain containing 123 16 B20140407_SF104_02 B20140407_SF104_02 TB389846.[MT7]-AEPTNPSK[MT7].2y6_1.heavy 566.316 / 787.443 50295.0 18.697999954223633 48 18 10 10 10 7.963928607796559 12.556616831308808 0.0 3 0.98442940500171 9.877445254478639 50295.0 173.6917006306577 0.0 - - - - - - - 208.0 100 13 PYCARD PYD and CARD domain containing 125 16 B20140407_SF104_02 B20140407_SF104_02 TB389846.[MT7]-AEPTNPSK[MT7].2b5_1.heavy 566.316 / 657.332 15878.0 18.697999954223633 48 18 10 10 10 7.963928607796559 12.556616831308808 0.0 3 0.98442940500171 9.877445254478639 15878.0 85.11640922716354 0.0 - - - - - - - 232.41666666666666 31 12 PYCARD PYD and CARD domain containing 127 16 B20140407_SF104_02 B20140407_SF104_02 TB389846.[MT7]-AEPTNPSK[MT7].2y7_1.heavy 566.316 / 916.486 10342.0 18.697999954223633 48 18 10 10 10 7.963928607796559 12.556616831308808 0.0 3 0.98442940500171 9.877445254478639 10342.0 89.47032558139534 0.0 - - - - - - - 156.7058823529412 20 17 PYCARD PYD and CARD domain containing 129 17 B20140407_SF104_02 B20140407_SF104_02 TB499821.[MT7]-QQEALFQLLIEEK[MT7].3b4_1.heavy 626.359 / 601.306 267526.0 38.755401611328125 40 10 10 10 10 0.8952070677811976 74.27619036650948 0.0 3 0.8496511489524411 3.1420600777388343 267526.0 258.5480684600342 0.0 - - - - - - - 321.75 535 4 INPP1 inositol polyphosphate-1-phosphatase 131 17 B20140407_SF104_02 B20140407_SF104_02 TB499821.[MT7]-QQEALFQLLIEEK[MT7].3b5_1.heavy 626.359 / 714.39 524643.0 38.755401611328125 40 10 10 10 10 0.8952070677811976 74.27619036650948 0.0 3 0.8496511489524411 3.1420600777388343 524643.0 391.3529320027555 0.0 - - - - - - - 514.0 1049 2 INPP1 inositol polyphosphate-1-phosphatase 133 17 B20140407_SF104_02 B20140407_SF104_02 TB499821.[MT7]-QQEALFQLLIEEK[MT7].3y4_1.heavy 626.359 / 662.384 479001.0 38.755401611328125 40 10 10 10 10 0.8952070677811976 74.27619036650948 0.0 3 0.8496511489524411 3.1420600777388343 479001.0 398.50246443198085 0.0 - - - - - - - 668.4 958 5 INPP1 inositol polyphosphate-1-phosphatase 135 17 B20140407_SF104_02 B20140407_SF104_02 TB499821.[MT7]-QQEALFQLLIEEK[MT7].3b3_1.heavy 626.359 / 530.269 80091.0 38.755401611328125 40 10 10 10 10 0.8952070677811976 74.27619036650948 0.0 3 0.8496511489524411 3.1420600777388343 80091.0 93.25427769216807 0.0 - - - - - - - 257.0 160 1 INPP1 inositol polyphosphate-1-phosphatase 137 18 B20140407_SF104_02 B20140407_SF104_02 TB499826.[MT7]-VTNVEWLLDALYGK[MT7].3b6_1.heavy 637.027 / 873.459 266905.0 42.71049880981445 43 13 10 10 10 1.8024183174609616 43.714488682839146 0.0 3 0.9206732693160751 4.3525019247210075 266905.0 346.4813582155477 0.0 - - - - - - - 239.25 533 4 PYCARD PYD and CARD domain containing 139 18 B20140407_SF104_02 B20140407_SF104_02 TB499826.[MT7]-VTNVEWLLDALYGK[MT7].3y3_1.heavy 637.027 / 511.3 616607.0 42.71049880981445 43 13 10 10 10 1.8024183174609616 43.714488682839146 0.0 3 0.9206732693160751 4.3525019247210075 616607.0 480.62820375901674 0.0 - - - - - - - 697.0 1233 3 PYCARD PYD and CARD domain containing 141 18 B20140407_SF104_02 B20140407_SF104_02 TB499826.[MT7]-VTNVEWLLDALYGK[MT7].3b4_1.heavy 637.027 / 558.337 124875.0 42.71049880981445 43 13 10 10 10 1.8024183174609616 43.714488682839146 0.0 3 0.9206732693160751 4.3525019247210075 124875.0 252.53901913044803 0.0 - - - - - - - 791.9090909090909 249 11 PYCARD PYD and CARD domain containing 143 18 B20140407_SF104_02 B20140407_SF104_02 TB499826.[MT7]-VTNVEWLLDALYGK[MT7].3b5_1.heavy 637.027 / 687.379 423216.0 42.71049880981445 43 13 10 10 10 1.8024183174609616 43.714488682839146 0.0 3 0.9206732693160751 4.3525019247210075 423216.0 414.98168472474873 0.0 - - - - - - - 290.0 846 3 PYCARD PYD and CARD domain containing 145 19 B20140407_SF104_02 B20140407_SF104_02 TB390397.[MT7]-VLEGQPVSLPC[CAM]IVLAGRPLPER.3y17_2.heavy 848.82 / 937.538 103987.0 36.02840042114258 43 13 10 10 10 2.3892488187324217 34.8900679414553 0.0 3 0.9292516209895659 4.612217508294324 103987.0 220.34986879939063 0.0 - - - - - - - 697.0 207 8 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 147 19 B20140407_SF104_02 B20140407_SF104_02 TB390397.[MT7]-VLEGQPVSLPC[CAM]IVLAGRPLPER.3b4_1.heavy 848.82 / 543.326 22561.0 36.02840042114258 43 13 10 10 10 2.3892488187324217 34.8900679414553 0.0 3 0.9292516209895659 4.612217508294324 22561.0 24.40983145639121 0.0 - - - - - - - 1240.857142857143 45 7 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 149 19 B20140407_SF104_02 B20140407_SF104_02 TB390397.[MT7]-VLEGQPVSLPC[CAM]IVLAGRPLPER.3b5_1.heavy 848.82 / 671.385 67293.0 36.02840042114258 43 13 10 10 10 2.3892488187324217 34.8900679414553 0.0 3 0.9292516209895659 4.612217508294324 67293.0 112.66431627464524 0.0 - - - - - - - 741.0 134 7 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 151 19 B20140407_SF104_02 B20140407_SF104_02 TB390397.[MT7]-VLEGQPVSLPC[CAM]IVLAGRPLPER.3y5_1.heavy 848.82 / 611.351 10762.0 36.02840042114258 43 13 10 10 10 2.3892488187324217 34.8900679414553 0.0 3 0.9292516209895659 4.612217508294324 10762.0 13.187369323050557 0.0 - - - - - - - 1129.857142857143 21 7 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 153 20 B20140407_SF104_02 B20140407_SF104_02 TB390398.[MT7]-ARDAILDALENLTAEELK[MT7]K[MT7].4b8_1.heavy 637.12 / 970.544 9059.0 38.80149841308594 35 5 10 10 10 0.43967991935028466 109.68521766621751 0.0 3 0.6351065390057469 1.9773743571659623 9059.0 38.71991935483871 1.0 - - - - - - - 285.2 18 10 PYCARD PYD and CARD domain containing 155 20 B20140407_SF104_02 B20140407_SF104_02 TB390398.[MT7]-ARDAILDALENLTAEELK[MT7]K[MT7].4b7_1.heavy 637.12 / 899.507 10424.0 38.80149841308594 35 5 10 10 10 0.43967991935028466 109.68521766621751 0.0 3 0.6351065390057469 1.9773743571659623 10424.0 37.829032258064515 0.0 - - - - - - - 292.2857142857143 20 14 PYCARD PYD and CARD domain containing 157 20 B20140407_SF104_02 B20140407_SF104_02 TB390398.[MT7]-ARDAILDALENLTAEELK[MT7]K[MT7].4y11_2.heavy 637.12 / 788.463 5460.0 38.80149841308594 35 5 10 10 10 0.43967991935028466 109.68521766621751 0.0 3 0.6351065390057469 1.9773743571659623 5460.0 7.255636193496399 1.0 - - - - - - - 360.72727272727275 10 11 PYCARD PYD and CARD domain containing 159 20 B20140407_SF104_02 B20140407_SF104_02 TB390398.[MT7]-ARDAILDALENLTAEELK[MT7]K[MT7].4y7_2.heavy 637.12 / 553.837 29162.0 38.80149841308594 35 5 10 10 10 0.43967991935028466 109.68521766621751 0.0 3 0.6351065390057469 1.9773743571659623 29162.0 129.91480110775427 0.0 - - - - - - - 223.2 58 10 PYCARD PYD and CARD domain containing 161 21 B20140407_SF104_02 B20140407_SF104_02 TB151439.[MT7]-LLEAGALGPGITDALGAGLVHHATR.4y10_1.heavy 639.361 / 1018.55 36454.0 36.02840042114258 45 15 10 10 10 2.125726983698995 41.48521426492907 0.0 3 0.9554313528534496 5.82399920377591 36454.0 122.57803135741422 0.0 - - - - - - - 300.55555555555554 72 9 ESPNL espin-like 163 21 B20140407_SF104_02 B20140407_SF104_02 TB151439.[MT7]-LLEAGALGPGITDALGAGLVHHATR.4b5_1.heavy 639.361 / 628.379 82954.0 36.02840042114258 45 15 10 10 10 2.125726983698995 41.48521426492907 0.0 3 0.9554313528534496 5.82399920377591 82954.0 61.83872609377329 0.0 - - - - - - - 386.0 165 1 ESPNL espin-like 165 21 B20140407_SF104_02 B20140407_SF104_02 TB151439.[MT7]-LLEAGALGPGITDALGAGLVHHATR.4b3_1.heavy 639.361 / 500.32 29369.0 36.02840042114258 45 15 10 10 10 2.125726983698995 41.48521426492907 0.0 3 0.9554313528534496 5.82399920377591 29369.0 35.97770002169124 1.0 - - - - - - - 1195.857142857143 59 7 ESPNL espin-like 167 21 B20140407_SF104_02 B20140407_SF104_02 TB151439.[MT7]-LLEAGALGPGITDALGAGLVHHATR.4b6_1.heavy 639.361 / 699.416 118378.0 36.02840042114258 45 15 10 10 10 2.125726983698995 41.48521426492907 0.0 3 0.9554313528534496 5.82399920377591 118378.0 124.22420963129557 0.0 - - - - - - - 386.0 236 2 ESPNL espin-like 169 22 B20140407_SF104_02 B20140407_SF104_02 TB150894.[MT7]-IC[CAM]LDVLK[MT7].2y4_1.heavy 574.851 / 618.394 16012.0 33.259700775146484 35 15 2 10 8 2.3562695849405353 34.36393940495985 0.0 4 0.954793346592548 5.782443211014066 16012.0 8.669154281086431 1.0 - - - - - - - 690.0 76 1 UBE2T ubiquitin-conjugating enzyme E2T (putative) 171 22 B20140407_SF104_02 B20140407_SF104_02 TB150894.[MT7]-IC[CAM]LDVLK[MT7].2b4_1.heavy 574.851 / 646.335 23603.0 33.259700775146484 35 15 2 10 8 2.3562695849405353 34.36393940495985 0.0 4 0.954793346592548 5.782443211014066 23603.0 21.550565217391306 0.0 - - - - - - - 2277.625 47 8 UBE2T ubiquitin-conjugating enzyme E2T (putative) 173 22 B20140407_SF104_02 B20140407_SF104_02 TB150894.[MT7]-IC[CAM]LDVLK[MT7].2y3_1.heavy 574.851 / 503.367 26088.0 33.259700775146484 35 15 2 10 8 2.3562695849405353 34.36393940495985 0.0 4 0.954793346592548 5.782443211014066 26088.0 20.604455456117474 0.0 - - - - - - - 2268.0 52 7 UBE2T ubiquitin-conjugating enzyme E2T (putative) 175 22 B20140407_SF104_02 B20140407_SF104_02 TB150894.[MT7]-IC[CAM]LDVLK[MT7].2y6_1.heavy 574.851 / 891.509 N/A 33.259700775146484 35 15 2 10 8 2.3562695849405353 34.36393940495985 0.0 4 0.954793346592548 5.782443211014066 32852.0 12.675997005604522 3.0 - - - - - - - 2070.0 198 1 UBE2T ubiquitin-conjugating enzyme E2T (putative) 177 23 B20140407_SF104_02 B20140407_SF104_02 TB150799.[MT7]-ITC[CAM]EEK[MT7].2y4_1.heavy 534.286 / 709.331 27371.0 21.005699157714844 50 20 10 10 10 14.193087560461187 7.045683299987379 0.0 3 0.9975069415475765 24.711884822725093 27371.0 91.10861401558466 0.0 - - - - - - - 269.1666666666667 54 12 ASTN2;ZNF571 astrotactin 2;zinc finger protein 571 179 23 B20140407_SF104_02 B20140407_SF104_02 TB150799.[MT7]-ITC[CAM]EEK[MT7].2y5_1.heavy 534.286 / 810.378 80792.0 21.005699157714844 50 20 10 10 10 14.193087560461187 7.045683299987379 0.0 3 0.9975069415475765 24.711884822725093 80792.0 38.5629358614143 0.0 - - - - - - - 744.4285714285714 161 7 ASTN2;ZNF571 astrotactin 2;zinc finger protein 571 181 23 B20140407_SF104_02 B20140407_SF104_02 TB150799.[MT7]-ITC[CAM]EEK[MT7].2y3_1.heavy 534.286 / 549.3 8952.0 21.005699157714844 50 20 10 10 10 14.193087560461187 7.045683299987379 0.0 3 0.9975069415475765 24.711884822725093 8952.0 17.2149536054416 0.0 - - - - - - - 660.4444444444445 17 9 ASTN2;ZNF571 astrotactin 2;zinc finger protein 571 183 23 B20140407_SF104_02 B20140407_SF104_02 TB150799.[MT7]-ITC[CAM]EEK[MT7].2b5_1.heavy 534.286 / 777.357 11888.0 21.005699157714844 50 20 10 10 10 14.193087560461187 7.045683299987379 0.0 3 0.9975069415475765 24.711884822725093 11888.0 20.54226201932005 0.0 - - - - - - - 635.8888888888889 23 9 ASTN2;ZNF571 astrotactin 2;zinc finger protein 571 185 24 B20140407_SF104_02 B20140407_SF104_02 TB499730.[MT7]-ITTFDFSGVTK[MT7].2y5_1.heavy 752.419 / 635.385 15992.0 33.3036994934082 50 20 10 10 10 12.163535938546248 8.221293586439776 0.0 3 0.9977822368123553 26.201399463187958 15992.0 16.70964858958478 0.0 - - - - - - - 772.2222222222222 31 9 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 187 24 B20140407_SF104_02 B20140407_SF104_02 TB499730.[MT7]-ITTFDFSGVTK[MT7].2y6_1.heavy 752.419 / 782.453 27117.0 33.3036994934082 50 20 10 10 10 12.163535938546248 8.221293586439776 0.0 3 0.9977822368123553 26.201399463187958 27117.0 31.111493646121264 0.0 - - - - - - - 814.1428571428571 54 7 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 189 24 B20140407_SF104_02 B20140407_SF104_02 TB499730.[MT7]-ITTFDFSGVTK[MT7].2y10_1.heavy 752.419 / 1246.64 N/A 33.3036994934082 50 20 10 10 10 12.163535938546248 8.221293586439776 0.0 3 0.9977822368123553 26.201399463187958 13767.0 23.852524735267963 1.0 - - - - - - - 301.1666666666667 27 6 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 191 24 B20140407_SF104_02 B20140407_SF104_02 TB499730.[MT7]-ITTFDFSGVTK[MT7].2b5_1.heavy 752.419 / 722.384 20303.0 33.3036994934082 50 20 10 10 10 12.163535938546248 8.221293586439776 0.0 3 0.9977822368123553 26.201399463187958 20303.0 12.862785369884906 0.0 - - - - - - - 278.0 40 2 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 193 25 B20140407_SF104_02 B20140407_SF104_02 TB151237.[MT7]-TVLPFVNTHPDK[MT7].3b6_1.heavy 552.65 / 801.499 31986.0 30.5039005279541 47 17 10 10 10 0.9524980260992941 61.33638099274161 0.0 3 0.9762504322909542 7.992289792925723 31986.0 58.610415564978794 0.0 - - - - - - - 290.1666666666667 63 6 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 195 25 B20140407_SF104_02 B20140407_SF104_02 TB151237.[MT7]-TVLPFVNTHPDK[MT7].3y3_1.heavy 552.65 / 503.295 425632.0 30.5039005279541 47 17 10 10 10 0.9524980260992941 61.33638099274161 0.0 3 0.9762504322909542 7.992289792925723 425632.0 137.46290468648317 0.0 - - - - - - - 1425.0 851 1 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 197 25 B20140407_SF104_02 B20140407_SF104_02 TB151237.[MT7]-TVLPFVNTHPDK[MT7].3b5_1.heavy 552.65 / 702.431 64763.0 30.5039005279541 47 17 10 10 10 0.9524980260992941 61.33638099274161 0.0 3 0.9762504322909542 7.992289792925723 64763.0 56.98896040733306 0.0 - - - - - - - 422.3333333333333 129 3 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 199 25 B20140407_SF104_02 B20140407_SF104_02 TB151237.[MT7]-TVLPFVNTHPDK[MT7].3y9_2.heavy 552.65 / 599.82 103716.0 30.5039005279541 47 17 10 10 10 0.9524980260992941 61.33638099274161 0.0 3 0.9762504322909542 7.992289792925723 103716.0 87.72463870936392 0.0 - - - - - - - 264.0 207 6 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 201 26 B20140407_SF104_02 B20140407_SF104_02 TB151030.[MT7]-GDVIDDWC[CAM]R.2y4_1.heavy 640.297 / 636.256 33358.0 30.21579933166504 50 20 10 10 10 6.907193120490126 14.477660933404469 0.0 3 0.991625753122751 13.476774117987631 33358.0 8.444027816659345 0.0 - - - - - - - 1174.5 66 2 ASTN2 astrotactin 2 203 26 B20140407_SF104_02 B20140407_SF104_02 TB151030.[MT7]-GDVIDDWC[CAM]R.2b6_1.heavy 640.297 / 759.364 34924.0 30.21579933166504 50 20 10 10 10 6.907193120490126 14.477660933404469 0.0 3 0.991625753122751 13.476774117987631 34924.0 25.868838519134663 0.0 - - - - - - - 470.0 69 1 ASTN2 astrotactin 2 205 26 B20140407_SF104_02 B20140407_SF104_02 TB151030.[MT7]-GDVIDDWC[CAM]R.2y3_1.heavy 640.297 / 521.229 54500.0 30.21579933166504 50 20 10 10 10 6.907193120490126 14.477660933404469 0.0 3 0.991625753122751 13.476774117987631 54500.0 42.417502107304884 0.0 - - - - - - - 470.0 109 1 ASTN2 astrotactin 2 207 26 B20140407_SF104_02 B20140407_SF104_02 TB151030.[MT7]-GDVIDDWC[CAM]R.2b5_1.heavy 640.297 / 644.337 31165.0 30.21579933166504 50 20 10 10 10 6.907193120490126 14.477660933404469 0.0 3 0.991625753122751 13.476774117987631 31165.0 25.71498411670537 0.0 - - - - - - - 470.0 62 1 ASTN2 astrotactin 2 209 27 B20140407_SF104_02 B20140407_SF104_02 TB150795.[MT7]-AEEIADK[MT7].2y4_1.heavy 532.297 / 590.363 29039.0 21.834400177001953 45 15 10 10 10 2.9312303906231563 34.11536681657452 0.0 3 0.956134356860936 5.8708318932412675 29039.0 76.85793218132758 0.0 - - - - - - - 671.3636363636364 58 11 ASTN2 astrotactin 2 211 27 B20140407_SF104_02 B20140407_SF104_02 TB150795.[MT7]-AEEIADK[MT7].2b4_1.heavy 532.297 / 587.316 28781.0 21.834400177001953 45 15 10 10 10 2.9312303906231563 34.11536681657452 0.0 3 0.956134356860936 5.8708318932412675 28781.0 56.221916435772584 0.0 - - - - - - - 665.5 57 8 ASTN2 astrotactin 2 213 27 B20140407_SF104_02 B20140407_SF104_02 TB150795.[MT7]-AEEIADK[MT7].2b6_1.heavy 532.297 / 773.38 57563.0 21.834400177001953 45 15 10 10 10 2.9312303906231563 34.11536681657452 0.0 3 0.956134356860936 5.8708318932412675 57563.0 95.47947469968582 0.0 - - - - - - - 797.5714285714286 115 7 ASTN2 astrotactin 2 215 27 B20140407_SF104_02 B20140407_SF104_02 TB150795.[MT7]-AEEIADK[MT7].2y6_1.heavy 532.297 / 848.448 26891.0 21.834400177001953 45 15 10 10 10 2.9312303906231563 34.11536681657452 0.0 3 0.956134356860936 5.8708318932412675 26891.0 50.286986222031956 0.0 - - - - - - - 163.4 53 10 ASTN2 astrotactin 2 217 28 B20140407_SF104_02 B20140407_SF104_02 TB151232.[MT7]-AQILGGANTPYEK[MT7].3b6_1.heavy 550.642 / 684.416 131999.0 27.482500076293945 50 20 10 10 10 6.411873349604963 15.596066008721309 0.0 3 0.9900431287294476 12.357764447105541 131999.0 100.01844511706119 0.0 - - - - - - - 429.0 263 1 UBE2T ubiquitin-conjugating enzyme E2T (putative) 219 28 B20140407_SF104_02 B20140407_SF104_02 TB151232.[MT7]-AQILGGANTPYEK[MT7].3y3_1.heavy 550.642 / 583.321 176237.0 27.482500076293945 50 20 10 10 10 6.411873349604963 15.596066008721309 0.0 3 0.9900431287294476 12.357764447105541 176237.0 118.47555935714209 0.0 - - - - - - - 429.0 352 1 UBE2T ubiquitin-conjugating enzyme E2T (putative) 221 28 B20140407_SF104_02 B20140407_SF104_02 TB151232.[MT7]-AQILGGANTPYEK[MT7].3b4_1.heavy 550.642 / 570.373 124268.0 27.482500076293945 50 20 10 10 10 6.411873349604963 15.596066008721309 0.0 3 0.9900431287294476 12.357764447105541 124268.0 94.19859414562866 0.0 - - - - - - - 716.0 248 3 UBE2T ubiquitin-conjugating enzyme E2T (putative) 223 28 B20140407_SF104_02 B20140407_SF104_02 TB151232.[MT7]-AQILGGANTPYEK[MT7].3b7_1.heavy 550.642 / 755.453 86472.0 27.482500076293945 50 20 10 10 10 6.411873349604963 15.596066008721309 0.0 3 0.9900431287294476 12.357764447105541 86472.0 31.1160739650599 0.0 - - - - - - - 680.25 172 4 UBE2T ubiquitin-conjugating enzyme E2T (putative) 225 29 B20140407_SF104_02 B20140407_SF104_02 TB151036.[MT7]-K[MT7]FAVDFK[MT7].3y3_1.heavy 429.599 / 553.31 90711.0 28.163799285888672 44 14 10 10 10 2.141257511482872 37.83728408258046 0.0 3 0.9376847051700318 4.91794378310607 90711.0 66.12016038254046 0.0 - - - - - - - 300.0 181 1 INPP1 inositol polyphosphate-1-phosphatase 227 29 B20140407_SF104_02 B20140407_SF104_02 TB151036.[MT7]-K[MT7]FAVDFK[MT7].3b3_2.heavy 429.599 / 318.21 152485.0 28.163799285888672 44 14 10 10 10 2.141257511482872 37.83728408258046 0.0 3 0.9376847051700318 4.91794378310607 152485.0 123.06130559712457 0.0 - - - - - - - 150.0 304 1 INPP1 inositol polyphosphate-1-phosphatase 229 29 B20140407_SF104_02 B20140407_SF104_02 TB151036.[MT7]-K[MT7]FAVDFK[MT7].3b3_1.heavy 429.599 / 635.412 16943.0 28.163799285888672 44 14 10 10 10 2.141257511482872 37.83728408258046 0.0 3 0.9376847051700318 4.91794378310607 16943.0 20.33612114743162 0.0 - - - - - - - 337.5 33 8 INPP1 inositol polyphosphate-1-phosphatase 231 29 B20140407_SF104_02 B20140407_SF104_02 TB151036.[MT7]-K[MT7]FAVDFK[MT7].3y4_1.heavy 429.599 / 652.379 28038.0 28.163799285888672 44 14 10 10 10 2.141257511482872 37.83728408258046 0.0 3 0.9376847051700318 4.91794378310607 28038.0 64.30048000000001 0.0 - - - - - - - 750.0 56 7 INPP1 inositol polyphosphate-1-phosphatase 233 30 B20140407_SF104_02 B20140407_SF104_02 TB390119.[MT7]-NEAVLNEEINPR.2y8_1.heavy 771.406 / 984.511 19739.0 27.25979995727539 42 12 10 10 10 1.5568500740416935 51.10325609499473 0.0 3 0.8810759976328133 3.5426363007239248 19739.0 87.37318915499043 0.0 - - - - - - - 317.3333333333333 39 9 KIF6 kinesin family member 6 235 30 B20140407_SF104_02 B20140407_SF104_02 TB390119.[MT7]-NEAVLNEEINPR.2b4_1.heavy 771.406 / 558.3 31718.0 27.25979995727539 42 12 10 10 10 1.5568500740416935 51.10325609499473 0.0 3 0.8810759976328133 3.5426363007239248 31718.0 62.890781158796386 0.0 - - - - - - - 340.0 63 6 KIF6 kinesin family member 6 237 30 B20140407_SF104_02 B20140407_SF104_02 TB390119.[MT7]-NEAVLNEEINPR.2y10_1.heavy 771.406 / 1154.62 7351.0 27.25979995727539 42 12 10 10 10 1.5568500740416935 51.10325609499473 0.0 3 0.8810759976328133 3.5426363007239248 7351.0 44.47535171568627 0.0 - - - - - - - 246.5 14 16 KIF6 kinesin family member 6 239 30 B20140407_SF104_02 B20140407_SF104_02 TB390119.[MT7]-NEAVLNEEINPR.2y7_1.heavy 771.406 / 871.427 16608.0 27.25979995727539 42 12 10 10 10 1.5568500740416935 51.10325609499473 0.0 3 0.8810759976328133 3.5426363007239248 16608.0 71.45400814764521 0.0 - - - - - - - 204.0 33 10 KIF6 kinesin family member 6 241 31 B20140407_SF104_02 B20140407_SF104_02 TB499738.[MT7]-ILFILVDADEPR.2y8_1.heavy 772.944 / 914.458 22644.0 41.15489959716797 46 16 10 10 10 2.2156121859050866 35.973211143764686 0.0 3 0.961039531335386 6.2320377609019975 22644.0 38.938423023362986 0.0 - - - - - - - 688.7142857142857 45 7 PDILT protein disulfide isomerase-like, testis expressed 243 31 B20140407_SF104_02 B20140407_SF104_02 TB499738.[MT7]-ILFILVDADEPR.2y5_1.heavy 772.944 / 587.278 15694.0 41.15489959716797 46 16 10 10 10 2.2156121859050866 35.973211143764686 0.0 3 0.961039531335386 6.2320377609019975 15694.0 28.35631318136769 0.0 - - - - - - - 354.6666666666667 31 6 PDILT protein disulfide isomerase-like, testis expressed 245 31 B20140407_SF104_02 B20140407_SF104_02 TB499738.[MT7]-ILFILVDADEPR.2y9_1.heavy 772.944 / 1027.54 13900.0 41.15489959716797 46 16 10 10 10 2.2156121859050866 35.973211143764686 0.0 3 0.961039531335386 6.2320377609019975 13900.0 21.29430043416513 0.0 - - - - - - - 257.6 27 10 PDILT protein disulfide isomerase-like, testis expressed 247 31 B20140407_SF104_02 B20140407_SF104_02 TB499738.[MT7]-ILFILVDADEPR.2y10_1.heavy 772.944 / 1174.61 11770.0 41.15489959716797 46 16 10 10 10 2.2156121859050866 35.973211143764686 0.0 3 0.961039531335386 6.2320377609019975 11770.0 110.34374999999999 0.0 - - - - - - - 235.2 23 10 PDILT protein disulfide isomerase-like, testis expressed 249 32 B20140407_SF104_02 B20140407_SF104_02 TB499737.[MT7]-LVSFYLETYGAELTANVLR.3y6_1.heavy 768.418 / 673.399 211256.0 44.77389907836914 44 14 10 10 10 1.4440319391390473 55.260951130197796 0.0 3 0.9321937520254222 4.712403111457683 211256.0 -51.96949569495695 0.0 - - - - - - - 226.36363636363637 422 11 PYCARD PYD and CARD domain containing 251 32 B20140407_SF104_02 B20140407_SF104_02 TB499737.[MT7]-LVSFYLETYGAELTANVLR.3b4_1.heavy 768.418 / 591.362 108321.0 44.77389907836914 44 14 10 10 10 1.4440319391390473 55.260951130197796 0.0 3 0.9321937520254222 4.712403111457683 108321.0 303.1607496698338 0.0 - - - - - - - 262.4166666666667 216 12 PYCARD PYD and CARD domain containing 253 32 B20140407_SF104_02 B20140407_SF104_02 TB499737.[MT7]-LVSFYLETYGAELTANVLR.3b5_1.heavy 768.418 / 754.426 224720.0 44.77389907836914 44 14 10 10 10 1.4440319391390473 55.260951130197796 0.0 3 0.9321937520254222 4.712403111457683 224720.0 -31.60618846694797 0.0 - - - - - - - 283.75 449 12 PYCARD PYD and CARD domain containing 255 32 B20140407_SF104_02 B20140407_SF104_02 TB499737.[MT7]-LVSFYLETYGAELTANVLR.3y10_1.heavy 768.418 / 1043.58 127018.0 44.77389907836914 44 14 10 10 10 1.4440319391390473 55.260951130197796 0.0 3 0.9321937520254222 4.712403111457683 127018.0 785.0964532804347 0.0 - - - - - - - 160.66666666666666 254 6 PYCARD PYD and CARD domain containing 257 33 B20140407_SF104_02 B20140407_SF104_02 TB389739.[MT7]-AQLPGNQR.2y5_1.heavy 514.292 / 571.295 344481.0 21.118499755859375 48 18 10 10 10 18.594319974749883 5.377986403148638 0.0 3 0.9821994333630677 9.236323156126712 344481.0 83.17491911253576 0.0 - - - - - - - 268.5 688 4 ESPNL espin-like 259 33 B20140407_SF104_02 B20140407_SF104_02 TB389739.[MT7]-AQLPGNQR.2b4_1.heavy 514.292 / 554.342 30310.0 21.118499755859375 48 18 10 10 10 18.594319974749883 5.377986403148638 0.0 3 0.9821994333630677 9.236323156126712 30310.0 53.409691629955944 0.0 - - - - - - - 836.125 60 8 ESPNL espin-like 261 33 B20140407_SF104_02 B20140407_SF104_02 TB389739.[MT7]-AQLPGNQR.2y6_1.heavy 514.292 / 684.379 85150.0 21.118499755859375 48 18 10 10 10 18.594319974749883 5.377986403148638 0.0 3 0.9821994333630677 9.236323156126712 85150.0 225.6893542540918 0.0 - - - - - - - 277.90909090909093 170 11 ESPNL espin-like 263 33 B20140407_SF104_02 B20140407_SF104_02 TB389739.[MT7]-AQLPGNQR.2y7_1.heavy 514.292 / 812.437 107284.0 21.118499755859375 48 18 10 10 10 18.594319974749883 5.377986403148638 0.0 3 0.9821994333630677 9.236323156126712 107284.0 76.48031967121021 0.0 - - - - - - - 192.91666666666666 214 12 ESPNL espin-like 265 34 B20140407_SF104_02 B20140407_SF104_02 TB150599.[MT7]-VTFPVR.2y4_1.heavy 431.767 / 518.308 29405.0 28.845399856567383 42 18 10 10 4 5.820024361242444 17.182058663866528 0.0 7 0.9842960433544816 9.83530511626452 29405.0 13.38088996397043 3.0 - - - - - - - 909.0 94 1 FAM151A;PNP family with sequence similarity 151, member A;purine nucleoside phosphorylase 267 34 B20140407_SF104_02 B20140407_SF104_02 TB150599.[MT7]-VTFPVR.2b3_1.heavy 431.767 / 492.294 46381.0 28.845399856567383 42 18 10 10 4 5.820024361242444 17.182058663866528 0.0 7 0.9842960433544816 9.83530511626452 46381.0 31.778911501866016 1.0 - - - - - - - 227.5 156 2 FAM151A;PNP family with sequence similarity 151, member A;purine nucleoside phosphorylase 269 34 B20140407_SF104_02 B20140407_SF104_02 TB150599.[MT7]-VTFPVR.2y5_1.heavy 431.767 / 619.356 177489.0 28.845399856567383 42 18 10 10 4 5.820024361242444 17.182058663866528 0.0 7 0.9842960433544816 9.83530511626452 177489.0 89.79974335822402 0.0 - - - - - - - 404.3333333333333 354 3 FAM151A;PNP family with sequence similarity 151, member A;purine nucleoside phosphorylase 271 34 B20140407_SF104_02 B20140407_SF104_02 TB150599.[MT7]-VTFPVR.2b5_1.heavy 431.767 / 688.415 21523.0 28.845399856567383 42 18 10 10 4 5.820024361242444 17.182058663866528 0.0 7 0.9842960433544816 9.83530511626452 21523.0 20.389544904065204 0.0 - - - - - - - 364.0 43 5 FAM151A;PNP family with sequence similarity 151, member A;purine nucleoside phosphorylase 273 35 B20140407_SF104_02 B20140407_SF104_02 TB151032.[MT7]-QYVLC[CAM]TLSR.2b3_1.heavy 642.349 / 535.3 45261.0 30.118499755859375 46 18 10 10 8 5.736552708044453 17.432072028165717 0.0 4 0.9871240194128039 10.86438411585025 45261.0 65.26831827111984 0.0 - - - - - - - 783.0 90 10 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 275 35 B20140407_SF104_02 B20140407_SF104_02 TB151032.[MT7]-QYVLC[CAM]TLSR.2y8_1.heavy 642.349 / 1011.53 81438.0 30.118499755859375 46 18 10 10 8 5.736552708044453 17.432072028165717 0.0 4 0.9871240194128039 10.86438411585025 81438.0 196.57448275862066 0.0 - - - - - - - 348.1111111111111 162 9 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 277 35 B20140407_SF104_02 B20140407_SF104_02 TB151032.[MT7]-QYVLC[CAM]TLSR.2y6_1.heavy 642.349 / 749.397 46201.0 30.118499755859375 46 18 10 10 8 5.736552708044453 17.432072028165717 0.0 4 0.9871240194128039 10.86438411585025 46201.0 56.89951608635307 1.0 - - - - - - - 1230.5714285714287 130 7 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 279 35 B20140407_SF104_02 B20140407_SF104_02 TB151032.[MT7]-QYVLC[CAM]TLSR.2y7_1.heavy 642.349 / 848.466 39466.0 30.118499755859375 46 18 10 10 8 5.736552708044453 17.432072028165717 0.0 4 0.9871240194128039 10.86438411585025 39466.0 39.68929628916143 0.0 - - - - - - - 335.57142857142856 78 7 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 281 36 B20140407_SF104_02 B20140407_SF104_02 TB390115.[MT7]-YK[MT7]FEVC[CAM]EK[MT7].3b4_1.heavy 512.281 / 856.481 7607.0 26.401599884033203 42 12 10 10 10 2.362983556690935 42.319380393843105 0.0 3 0.8946202975811031 3.7678548943218084 7607.0 24.477828145911257 0.0 - - - - - - - 277.4 15 10 DHFRL1 dihydrofolate reductase-like 1 283 36 B20140407_SF104_02 B20140407_SF104_02 TB390115.[MT7]-YK[MT7]FEVC[CAM]EK[MT7].3y7_2.heavy 512.281 / 614.336 14127.0 26.401599884033203 42 12 10 10 10 2.362983556690935 42.319380393843105 0.0 3 0.8946202975811031 3.7678548943218084 14127.0 5.385527851203514 1.0 - - - - - - - 804.6666666666666 28 3 DHFRL1 dihydrofolate reductase-like 1 285 36 B20140407_SF104_02 B20140407_SF104_02 TB390115.[MT7]-YK[MT7]FEVC[CAM]EK[MT7].3y4_1.heavy 512.281 / 679.357 24149.0 26.401599884033203 42 12 10 10 10 2.362983556690935 42.319380393843105 0.0 3 0.8946202975811031 3.7678548943218084 24149.0 23.715050589319343 0.0 - - - - - - - 830.0 48 8 DHFRL1 dihydrofolate reductase-like 1 287 36 B20140407_SF104_02 B20140407_SF104_02 TB390115.[MT7]-YK[MT7]FEVC[CAM]EK[MT7].3b4_2.heavy 512.281 / 428.744 77155.0 26.401599884033203 42 12 10 10 10 2.362983556690935 42.319380393843105 0.0 3 0.8946202975811031 3.7678548943218084 77155.0 90.68870745887139 0.0 - - - - - - - 810.5714285714286 154 7 DHFRL1 dihydrofolate reductase-like 1 289 37 B20140407_SF104_02 B20140407_SF104_02 TB499735.[MT7]-LNFTGPGDPDSIR.2b3_1.heavy 766.895 / 519.305 40607.0 30.5039005279541 48 18 10 10 10 6.347177385417658 15.755034707198401 0.0 3 0.9897714597928411 12.19227253896444 40607.0 53.60417721518988 0.0 - - - - - - - 368.6666666666667 81 3 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 291 37 B20140407_SF104_02 B20140407_SF104_02 TB499735.[MT7]-LNFTGPGDPDSIR.2y5_1.heavy 766.895 / 587.315 187866.0 30.5039005279541 48 18 10 10 10 6.347177385417658 15.755034707198401 0.0 3 0.9897714597928411 12.19227253896444 187866.0 106.92901340282948 0.0 - - - - - - - 632.0 375 1 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 293 37 B20140407_SF104_02 B20140407_SF104_02 TB499735.[MT7]-LNFTGPGDPDSIR.2y9_1.heavy 766.895 / 913.437 43293.0 30.5039005279541 48 18 10 10 10 6.347177385417658 15.755034707198401 0.0 3 0.9897714597928411 12.19227253896444 43293.0 57.54132911392405 0.0 - - - - - - - 263.3333333333333 86 3 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 295 37 B20140407_SF104_02 B20140407_SF104_02 TB499735.[MT7]-LNFTGPGDPDSIR.2y10_1.heavy 766.895 / 1014.49 26228.0 30.5039005279541 48 18 10 10 10 6.347177385417658 15.755034707198401 0.0 3 0.9897714597928411 12.19227253896444 26228.0 74.22571428571429 0.0 - - - - - - - 316.0 52 7 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 297 38 B20140407_SF104_02 B20140407_SF104_02 TB499938.[MT7]-EVAQPVPLLMTPPPPPFPPPPLLATRR.4y10_1.heavy 768.944 / 1117.68 2148.0 38.89720153808594 49 20 9 10 10 2.9521655378826837 33.873439248844015 0.0 3 0.9901321136857388 12.413450662795489 2148.0 4.252343060163536 0.0 - - - - - - - 577.4285714285714 4 7 ESPNL espin-like 299 38 B20140407_SF104_02 B20140407_SF104_02 TB499938.[MT7]-EVAQPVPLLMTPPPPPFPPPPLLATRR.4b4_1.heavy 768.944 / 572.316 18702.0 38.89720153808594 49 20 9 10 10 2.9521655378826837 33.873439248844015 0.0 3 0.9901321136857388 12.413450662795489 18702.0 11.88118936592009 0.0 - - - - - - - 695.0 37 2 ESPNL espin-like 301 38 B20140407_SF104_02 B20140407_SF104_02 TB499938.[MT7]-EVAQPVPLLMTPPPPPFPPPPLLATRR.4y13_2.heavy 768.944 / 729.933 5813.0 38.89720153808594 49 20 9 10 10 2.9521655378826837 33.873439248844015 0.0 3 0.9901321136857388 12.413450662795489 5813.0 1.4359846188269598 2.0 - - - - - - - 126.0 12 3 ESPNL espin-like 303 38 B20140407_SF104_02 B20140407_SF104_02 TB499938.[MT7]-EVAQPVPLLMTPPPPPFPPPPLLATRR.4b6_1.heavy 768.944 / 768.437 N/A 38.89720153808594 49 20 9 10 10 2.9521655378826837 33.873439248844015 0.0 3 0.9901321136857388 12.413450662795489 20598.0 2.1100768763459254 9.0 - - - - - - - 5939.0 50 1 ESPNL espin-like 305 39 B20140407_SF104_02 B20140407_SF104_02 TB151035.[MT7]-HSELSTVTLR.3y6_1.heavy 429.578 / 676.399 36919.0 25.64699935913086 50 20 10 10 10 18.730053909496654 5.339012929871881 0.0 3 0.9970350697360287 22.659366580412936 36919.0 101.78315513741506 0.0 - - - - - - - 736.3 73 10 ASTN2 astrotactin 2 307 39 B20140407_SF104_02 B20140407_SF104_02 TB151035.[MT7]-HSELSTVTLR.3y4_1.heavy 429.578 / 488.319 61254.0 25.64699935913086 50 20 10 10 10 18.730053909496654 5.339012929871881 0.0 3 0.9970350697360287 22.659366580412936 61254.0 21.635449676677112 0.0 - - - - - - - 712.0 122 1 ASTN2 astrotactin 2 309 39 B20140407_SF104_02 B20140407_SF104_02 TB151035.[MT7]-HSELSTVTLR.3b3_1.heavy 429.578 / 498.243 83809.0 25.64699935913086 50 20 10 10 10 18.730053909496654 5.339012929871881 0.0 3 0.9970350697360287 22.659366580412936 83809.0 53.45281336502942 0.0 - - - - - - - 950.0 167 2 ASTN2 astrotactin 2 311 39 B20140407_SF104_02 B20140407_SF104_02 TB151035.[MT7]-HSELSTVTLR.3y5_1.heavy 429.578 / 589.367 49858.0 25.64699935913086 50 20 10 10 10 18.730053909496654 5.339012929871881 0.0 3 0.9970350697360287 22.659366580412936 49858.0 33.74534862233114 0.0 - - - - - - - 882.0 99 7 ASTN2 astrotactin 2 313 40 B20140407_SF104_02 B20140407_SF104_02 TB499939.[MT7]-SRQPDSGVLFFESVAPEDQAPYVC[CAM]EAR.4b8_1.heavy 800.388 / 971.503 6776.0 35.031025886535645 39 13 10 6 10 0.9537958422505921 67.04016618099902 0.038898468017578125 3 0.9036791211976707 3.944145585380039 6776.0 16.169306217782882 0.0 - - - - - - - 299.25 13 8 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 315 40 B20140407_SF104_02 B20140407_SF104_02 TB499939.[MT7]-SRQPDSGVLFFESVAPEDQAPYVC[CAM]EAR.4y7_1.heavy 800.388 / 894.414 58060.0 35.031025886535645 39 13 10 6 10 0.9537958422505921 67.04016618099902 0.038898468017578125 3 0.9036791211976707 3.944145585380039 58060.0 61.12880246793167 0.0 - - - - - - - 345.8 116 5 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 317 40 B20140407_SF104_02 B20140407_SF104_02 TB499939.[MT7]-SRQPDSGVLFFESVAPEDQAPYVC[CAM]EAR.4b9_1.heavy 800.388 / 1084.59 5713.0 35.031025886535645 39 13 10 6 10 0.9537958422505921 67.04016618099902 0.038898468017578125 3 0.9036791211976707 3.944145585380039 5713.0 13.445139276432228 0.0 - - - - - - - 664.0 11 7 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 319 40 B20140407_SF104_02 B20140407_SF104_02 TB499939.[MT7]-SRQPDSGVLFFESVAPEDQAPYVC[CAM]EAR.4b9_2.heavy 800.388 / 542.797 38795.0 35.031025886535645 39 13 10 6 10 0.9537958422505921 67.04016618099902 0.038898468017578125 3 0.9036791211976707 3.944145585380039 38795.0 46.17106914898997 0.0 - - - - - - - 763.75 77 8 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 321 41 B20140407_SF104_02 B20140407_SF104_02 TB150697.[MT7]-VASEALAR.2b4_1.heavy 480.783 / 531.289 83771.0 23.569499969482422 50 20 10 10 10 4.770544426246129 17.072549774345905 0.0 3 0.990957650591448 12.968624927794602 83771.0 59.77845063534108 0.0 - - - - - - - 1687.0 167 7 INPP1 inositol polyphosphate-1-phosphatase 323 41 B20140407_SF104_02 B20140407_SF104_02 TB150697.[MT7]-VASEALAR.2y6_1.heavy 480.783 / 646.352 126407.0 23.569499969482422 50 20 10 10 10 4.770544426246129 17.072549774345905 0.0 3 0.990957650591448 12.968624927794602 126407.0 92.06760466039809 0.0 - - - - - - - 200.0 252 2 INPP1 inositol polyphosphate-1-phosphatase 325 41 B20140407_SF104_02 B20140407_SF104_02 TB150697.[MT7]-VASEALAR.2b5_1.heavy 480.783 / 602.327 124105.0 23.569499969482422 50 20 10 10 10 4.770544426246129 17.072549774345905 0.0 3 0.990957650591448 12.968624927794602 124105.0 155.09770152983276 0.0 - - - - - - - 100.0 248 1 INPP1 inositol polyphosphate-1-phosphatase 327 41 B20140407_SF104_02 B20140407_SF104_02 TB150697.[MT7]-VASEALAR.2y7_1.heavy 480.783 / 717.389 549349.0 23.569499969482422 50 20 10 10 10 4.770544426246129 17.072549774345905 0.0 3 0.990957650591448 12.968624927794602 549349.0 144.80798900659457 0.0 - - - - - - - 1001.0 1098 1 INPP1 inositol polyphosphate-1-phosphatase 329 42 B20140407_SF104_02 B20140407_SF104_02 TB499834.[MT7]-LSSAPSQAQDFSILGK[MT7].3y11_2.heavy 646.358 / 669.363 9305.0 32.46839904785156 48 18 10 10 10 3.1808743046035683 31.437897390435545 0.0 3 0.9824284416788631 9.29649491523714 9305.0 7.108715434537245 0.0 - - - - - - - 801.4285714285714 18 7 KIF6 kinesin family member 6 331 42 B20140407_SF104_02 B20140407_SF104_02 TB499834.[MT7]-LSSAPSQAQDFSILGK[MT7].3b4_1.heavy 646.358 / 503.295 71485.0 32.46839904785156 48 18 10 10 10 3.1808743046035683 31.437897390435545 0.0 3 0.9824284416788631 9.29649491523714 71485.0 41.742890799499236 0.0 - - - - - - - 1181.5 142 2 KIF6 kinesin family member 6 333 42 B20140407_SF104_02 B20140407_SF104_02 TB499834.[MT7]-LSSAPSQAQDFSILGK[MT7].3b7_1.heavy 646.358 / 815.438 11668.0 32.46839904785156 48 18 10 10 10 3.1808743046035683 31.437897390435545 0.0 3 0.9824284416788631 9.29649491523714 11668.0 12.582756751164535 0.0 - - - - - - - 696.1428571428571 23 7 KIF6 kinesin family member 6 335 42 B20140407_SF104_02 B20140407_SF104_02 TB499834.[MT7]-LSSAPSQAQDFSILGK[MT7].3y5_1.heavy 646.358 / 661.437 30868.0 32.46839904785156 48 18 10 10 10 3.1808743046035683 31.437897390435545 0.0 3 0.9824284416788631 9.29649491523714 30868.0 35.089653767079675 0.0 - - - - - - - 443.0 61 2 KIF6 kinesin family member 6 337 43 B20140407_SF104_02 B20140407_SF104_02 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 2652980.0 28.501100540161133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2652980.0 437.510256545885 0.0 - - - - - - - 880.0 5305 1 339 43 B20140407_SF104_02 B20140407_SF104_02 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 843323.0 28.501100540161133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 843323.0 192.10630739653078 0.0 - - - - - - - 440.0 1686 1 341 43 B20140407_SF104_02 B20140407_SF104_02 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 623209.0 28.501100540161133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 623209.0 217.94470417069837 0.0 - - - - - - - 880.0 1246 1 343 44 B20140407_SF104_02 B20140407_SF104_02 TB499932.[MT7]-NLTLHQATTEEEALNLLFLGDTNR.3y7_1.heavy 953.165 / 822.41 40263.0 38.66239929199219 44 14 10 10 10 3.214609522951188 31.10797727874411 0.0 3 0.9458323961508596 5.278522808645693 40263.0 38.33396329628766 0.0 - - - - - - - 310.6 80 5 KIF6 kinesin family member 6 345 44 B20140407_SF104_02 B20140407_SF104_02 TB499932.[MT7]-NLTLHQATTEEEALNLLFLGDTNR.3b4_1.heavy 953.165 / 586.368 11522.0 38.66239929199219 44 14 10 10 10 3.214609522951188 31.10797727874411 0.0 3 0.9458323961508596 5.278522808645693 11522.0 28.74514744567387 0.0 - - - - - - - 673.3 23 10 KIF6 kinesin family member 6 347 44 B20140407_SF104_02 B20140407_SF104_02 TB499932.[MT7]-NLTLHQATTEEEALNLLFLGDTNR.3y8_1.heavy 953.165 / 935.495 28611.0 38.66239929199219 44 14 10 10 10 3.214609522951188 31.10797727874411 0.0 3 0.9458323961508596 5.278522808645693 28611.0 59.46446671003085 0.0 - - - - - - - 668.8333333333334 57 12 KIF6 kinesin family member 6 349 44 B20140407_SF104_02 B20140407_SF104_02 TB499932.[MT7]-NLTLHQATTEEEALNLLFLGDTNR.3y10_1.heavy 953.165 / 1162.62 14759.0 38.66239929199219 44 14 10 10 10 3.214609522951188 31.10797727874411 0.0 3 0.9458323961508596 5.278522808645693 14759.0 28.49227799227799 0.0 - - - - - - - 702.8571428571429 29 7 KIF6 kinesin family member 6 351 45 B20140407_SF104_02 B20140407_SF104_02 TB499837.[MT7]-LFSFTPAWNWTC[CAM]K[MT7].3y3_1.heavy 649.334 / 552.293 214137.0 39.794700622558594 50 20 10 10 10 21.612519256138487 4.626947872890734 0.0 3 0.9969300541451146 22.26823748076305 214137.0 339.3379915081373 0.0 - - - - - - - 288.6666666666667 428 3 PYCARD PYD and CARD domain containing 353 45 B20140407_SF104_02 B20140407_SF104_02 TB499837.[MT7]-LFSFTPAWNWTC[CAM]K[MT7].3b5_1.heavy 649.334 / 740.41 123903.0 39.794700622558594 50 20 10 10 10 21.612519256138487 4.626947872890734 0.0 3 0.9969300541451146 22.26823748076305 123903.0 210.13161281274665 0.0 - - - - - - - 495.0 247 4 PYCARD PYD and CARD domain containing 355 45 B20140407_SF104_02 B20140407_SF104_02 TB499837.[MT7]-LFSFTPAWNWTC[CAM]K[MT7].3y4_1.heavy 649.334 / 738.372 90730.0 39.794700622558594 50 20 10 10 10 21.612519256138487 4.626947872890734 0.0 3 0.9969300541451146 22.26823748076305 90730.0 111.75377678949857 0.0 - - - - - - - 309.5 181 2 PYCARD PYD and CARD domain containing 357 45 B20140407_SF104_02 B20140407_SF104_02 TB499837.[MT7]-LFSFTPAWNWTC[CAM]K[MT7].3y5_1.heavy 649.334 / 852.415 67955.0 39.794700622558594 50 20 10 10 10 21.612519256138487 4.626947872890734 0.0 3 0.9969300541451146 22.26823748076305 67955.0 225.24129300207602 0.0 - - - - - - - 247.625 135 8 PYCARD PYD and CARD domain containing 359 46 B20140407_SF104_02 B20140407_SF104_02 TB499930.[MT7]-DNTAVHQVYYDIFEPLLSQFK[MT7].4y4_1.heavy 704.619 / 653.374 20247.0 42.66529846191406 35 5 10 10 10 0.4131913086504025 117.12324619599488 0.0 3 0.6139147858890323 1.918395630282784 20247.0 18.123076923076923 1.0 - - - - - - - 284.14285714285717 40 14 FAM151A family with sequence similarity 151, member A 361 46 B20140407_SF104_02 B20140407_SF104_02 TB499930.[MT7]-DNTAVHQVYYDIFEPLLSQFK[MT7].4b11_2.heavy 704.619 / 725.84 43235.0 42.66529846191406 35 5 10 10 10 0.4131913086504025 117.12324619599488 0.0 3 0.6139147858890323 1.918395630282784 43235.0 254.44533893963973 0.0 - - - - - - - 256.4 86 10 FAM151A family with sequence similarity 151, member A 363 46 B20140407_SF104_02 B20140407_SF104_02 TB499930.[MT7]-DNTAVHQVYYDIFEPLLSQFK[MT7].4b4_1.heavy 704.619 / 546.264 3360.0 42.66529846191406 35 5 10 10 10 0.4131913086504025 117.12324619599488 0.0 3 0.6139147858890323 1.918395630282784 3360.0 6.846344106108724 1.0 - - - - - - - 253.33333333333334 6 15 FAM151A family with sequence similarity 151, member A 365 46 B20140407_SF104_02 B20140407_SF104_02 TB499930.[MT7]-DNTAVHQVYYDIFEPLLSQFK[MT7].4b5_1.heavy 704.619 / 645.332 5570.0 42.66529846191406 35 5 10 10 10 0.4131913086504025 117.12324619599488 0.0 3 0.6139147858890323 1.918395630282784 5570.0 14.808463522499633 0.0 - - - - - - - 244.76923076923077 11 13 FAM151A family with sequence similarity 151, member A 367 47 B20140407_SF104_02 B20140407_SF104_02 TB150769.[MT7]-AVEIMGK[MT7].2y4_1.heavy 518.309 / 592.361 1497.0 27.962299346923828 33 5 10 10 8 0.5536117784229263 87.152139876522 0.0 4 0.6679541375216013 2.0794067140873094 1497.0 0.4399706098457017 35.0 - - - - - - - 851.0 38 4 PDILT protein disulfide isomerase-like, testis expressed 369 47 B20140407_SF104_02 B20140407_SF104_02 TB150769.[MT7]-AVEIMGK[MT7].2y5_1.heavy 518.309 / 721.404 30085.0 27.962299346923828 33 5 10 10 8 0.5536117784229263 87.152139876522 0.0 4 0.6679541375216013 2.0794067140873094 30085.0 18.27493880490214 0.0 - - - - - - - 272.0 60 5 PDILT protein disulfide isomerase-like, testis expressed 371 47 B20140407_SF104_02 B20140407_SF104_02 TB150769.[MT7]-AVEIMGK[MT7].2b4_1.heavy 518.309 / 557.341 87668.0 27.962299346923828 33 5 10 10 8 0.5536117784229263 87.152139876522 0.0 4 0.6679541375216013 2.0794067140873094 87668.0 24.056815744143424 0.0 - - - - - - - 862.3333333333334 175 3 PDILT protein disulfide isomerase-like, testis expressed 373 47 B20140407_SF104_02 B20140407_SF104_02 TB150769.[MT7]-AVEIMGK[MT7].2y6_1.heavy 518.309 / 820.472 16608.0 27.962299346923828 33 5 10 10 8 0.5536117784229263 87.152139876522 0.0 4 0.6679541375216013 2.0794067140873094 16608.0 50.50710833431569 1.0 - - - - - - - 1197.8 34 10 PDILT protein disulfide isomerase-like, testis expressed 375 48 B20140407_SF104_02 B20140407_SF104_02 TB151126.[MT7]-LIPSLEIILPR.2y5_1.heavy 704.456 / 611.424 11002.0 40.62150001525879 45 20 10 5 10 7.633884153254059 13.09949142434569 0.048999786376953125 3 0.9990965848595932 41.056884065426736 11002.0 21.06257770901156 0.0 - - - - - - - 226.8 22 5 KIF6 kinesin family member 6 377 48 B20140407_SF104_02 B20140407_SF104_02 TB151126.[MT7]-LIPSLEIILPR.2y9_1.heavy 704.456 / 1037.64 186572.0 40.62150001525879 45 20 10 5 10 7.633884153254059 13.09949142434569 0.048999786376953125 3 0.9990965848595932 41.056884065426736 186572.0 502.2274615368021 0.0 - - - - - - - 397.0 373 2 KIF6 kinesin family member 6 379 48 B20140407_SF104_02 B20140407_SF104_02 TB151126.[MT7]-LIPSLEIILPR.2y6_1.heavy 704.456 / 740.466 10208.0 40.62150001525879 45 20 10 5 10 7.633884153254059 13.09949142434569 0.048999786376953125 3 0.9990965848595932 41.056884065426736 10208.0 38.77896339805297 0.0 - - - - - - - 365.55555555555554 20 9 KIF6 kinesin family member 6 381 48 B20140407_SF104_02 B20140407_SF104_02 TB151126.[MT7]-LIPSLEIILPR.2y10_1.heavy 704.456 / 1150.72 26767.0 40.62150001525879 45 20 10 5 10 7.633884153254059 13.09949142434569 0.048999786376953125 3 0.9990965848595932 41.056884065426736 26767.0 161.81984453301635 0.0 - - - - - - - 207.75 53 12 KIF6 kinesin family member 6 383 49 B20140407_SF104_02 B20140407_SF104_02 TB499841.[MT7]-ATVTVEHNPAGGDYASVR.3b6_1.heavy 663.337 / 745.421 48082.0 24.564849853515625 41 15 10 6 10 1.9810234298891254 43.09125860856744 0.03900146484375 3 0.9505626136487269 5.527502896361773 48082.0 80.6999362761743 0.0 - - - - - - - 765.2857142857143 96 7 FAM151A family with sequence similarity 151, member A 385 49 B20140407_SF104_02 B20140407_SF104_02 TB499841.[MT7]-ATVTVEHNPAGGDYASVR.3b4_1.heavy 663.337 / 517.31 13600.0 24.564849853515625 41 15 10 6 10 1.9810234298891254 43.09125860856744 0.03900146484375 3 0.9505626136487269 5.527502896361773 13600.0 15.632183908045977 1.0 - - - - - - - 1261.2222222222222 27 9 FAM151A family with sequence similarity 151, member A 387 49 B20140407_SF104_02 B20140407_SF104_02 TB499841.[MT7]-ATVTVEHNPAGGDYASVR.3y8_1.heavy 663.337 / 824.39 24951.0 24.564849853515625 41 15 10 6 10 1.9810234298891254 43.09125860856744 0.03900146484375 3 0.9505626136487269 5.527502896361773 24951.0 46.66899668166021 0.0 - - - - - - - 262.6363636363636 49 11 FAM151A family with sequence similarity 151, member A 389 49 B20140407_SF104_02 B20140407_SF104_02 TB499841.[MT7]-ATVTVEHNPAGGDYASVR.3y5_1.heavy 663.337 / 595.32 16277.0 24.564849853515625 41 15 10 6 10 1.9810234298891254 43.09125860856744 0.03900146484375 3 0.9505626136487269 5.527502896361773 16277.0 23.0743006314014 0.0 - - - - - - - 763.125 32 8 FAM151A family with sequence similarity 151, member A 391 50 B20140407_SF104_02 B20140407_SF104_02 TB150766.[MT7]-AVGWWK[MT7].2y4_1.heavy 517.805 / 720.395 28192.0 31.71940040588379 42 20 2 10 10 7.2904135638383725 13.716642975649027 0.0 3 0.9930603385401167 14.806136625634364 28192.0 38.309210308590906 0.0 - - - - - - - 219.4 56 5 ARL6IP1 ADP-ribosylation factor-like 6 interacting protein 1 393 50 B20140407_SF104_02 B20140407_SF104_02 TB150766.[MT7]-AVGWWK[MT7].2y5_1.heavy 517.805 / 819.463 20987.0 31.71940040588379 42 20 2 10 10 7.2904135638383725 13.716642975649027 0.0 3 0.9930603385401167 14.806136625634364 20987.0 20.26325535587921 0.0 - - - - - - - 261.1111111111111 41 9 ARL6IP1 ADP-ribosylation factor-like 6 interacting protein 1 395 50 B20140407_SF104_02 B20140407_SF104_02 TB150766.[MT7]-AVGWWK[MT7].2b4_1.heavy 517.805 / 558.316 9711.0 31.71940040588379 42 20 2 10 10 7.2904135638383725 13.716642975649027 0.0 3 0.9930603385401167 14.806136625634364 9711.0 1.7832046298445114 4.0 - - - - - - - 470.0 149 2 ARL6IP1 ADP-ribosylation factor-like 6 interacting protein 1 397 50 B20140407_SF104_02 B20140407_SF104_02 TB150766.[MT7]-AVGWWK[MT7].2y3_1.heavy 517.805 / 663.373 12843.0 31.71940040588379 42 20 2 10 10 7.2904135638383725 13.716642975649027 0.0 3 0.9930603385401167 14.806136625634364 12843.0 5.139938313376414 0.0 - - - - - - - 261.0 25 3 ARL6IP1 ADP-ribosylation factor-like 6 interacting protein 1 399 51 B20140407_SF104_02 B20140407_SF104_02 TB150767.[MT7]-ETNALTSR.2b4_1.heavy 518.281 / 560.28 13988.0 21.56089973449707 46 16 10 10 10 3.178777196608099 31.458637650573493 0.0 3 0.9636972351748133 6.457580740386544 13988.0 20.460594892979028 0.0 - - - - - - - 690.0714285714286 27 14 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 401 51 B20140407_SF104_02 B20140407_SF104_02 TB150767.[MT7]-ETNALTSR.2y6_1.heavy 518.281 / 661.363 10158.0 21.56089973449707 46 16 10 10 10 3.178777196608099 31.458637650573493 0.0 3 0.9636972351748133 6.457580740386544 10158.0 10.370066143004495 0.0 - - - - - - - 768.6153846153846 20 13 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 403 51 B20140407_SF104_02 B20140407_SF104_02 TB150767.[MT7]-ETNALTSR.2b5_1.heavy 518.281 / 673.364 9991.0 21.56089973449707 46 16 10 10 10 3.178777196608099 31.458637650573493 0.0 3 0.9636972351748133 6.457580740386544 9991.0 24.838688507718697 0.0 - - - - - - - 589.4615384615385 19 13 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 405 51 B20140407_SF104_02 B20140407_SF104_02 TB150767.[MT7]-ETNALTSR.2y7_1.heavy 518.281 / 762.41 38717.0 21.56089973449707 46 16 10 10 10 3.178777196608099 31.458637650573493 0.0 3 0.9636972351748133 6.457580740386544 38717.0 51.147357886309045 0.0 - - - - - - - 666.1111111111111 77 9 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 407 52 B20140407_SF104_02 B20140407_SF104_02 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 1622040.0 18.744699478149414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1622040.0 2267.6595257878575 0.0 - - - - - - - 261.75 3244 4 409 52 B20140407_SF104_02 B20140407_SF104_02 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 3206510.0 18.744699478149414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 3206510.0 4622.254279185929 0.0 - - - - - - - 369.1666666666667 6413 6 411 52 B20140407_SF104_02 B20140407_SF104_02 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 1144060.0 18.744699478149414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1144060.0 3620.811010728402 0.0 - - - - - - - 241.57142857142858 2288 7 413 53 B20140407_SF104_02 B20140407_SF104_02 TB150560.[MT7]-FGADAR.2b3_1.heavy 390.71 / 420.236 28366.0 21.59869956970215 44 16 10 10 8 3.996222217363941 25.023633461995956 0.0 4 0.9610123706360257 6.229852305339836 28366.0 14.3845988556249 0.0 - - - - - - - 2764.4285714285716 56 7 HSPD1 heat shock 60kDa protein 1 (chaperonin) 415 53 B20140407_SF104_02 B20140407_SF104_02 TB150560.[MT7]-FGADAR.2y5_1.heavy 390.71 / 489.242 51688.0 21.59869956970215 44 16 10 10 8 3.996222217363941 25.023633461995956 0.0 4 0.9610123706360257 6.229852305339836 51688.0 24.92507906466006 1.0 - - - - - - - 496.0 138 1 HSPD1 heat shock 60kDa protein 1 (chaperonin) 417 53 B20140407_SF104_02 B20140407_SF104_02 TB150560.[MT7]-FGADAR.2b4_1.heavy 390.71 / 535.263 316246.0 21.59869956970215 44 16 10 10 8 3.996222217363941 25.023633461995956 0.0 4 0.9610123706360257 6.229852305339836 316246.0 276.10146303370766 0.0 - - - - - - - 455.0 632 2 HSPD1 heat shock 60kDa protein 1 (chaperonin) 419 53 B20140407_SF104_02 B20140407_SF104_02 TB150560.[MT7]-FGADAR.2b5_1.heavy 390.71 / 606.3 13232.0 21.59869956970215 44 16 10 10 8 3.996222217363941 25.023633461995956 0.0 4 0.9610123706360257 6.229852305339836 13232.0 11.601109830824054 1.0 - - - - - - - 815.1428571428571 26 7 HSPD1 heat shock 60kDa protein 1 (chaperonin) 421 54 B20140407_SF104_02 B20140407_SF104_02 TB499442.[MT7]-ATGRPPPTVTWR.3y7_1.heavy 494.948 / 856.468 22972.0 25.48040008544922 46 16 10 10 10 2.6185678923650784 29.912142119580423 0.0 3 0.9621237569149227 6.3211852190410855 22972.0 40.146769893423155 0.0 - - - - - - - 379.0 45 3 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 423 54 B20140407_SF104_02 B20140407_SF104_02 TB499442.[MT7]-ATGRPPPTVTWR.3y6_1.heavy 494.948 / 759.415 61410.0 25.48040008544922 46 16 10 10 10 2.6185678923650784 29.912142119580423 0.0 3 0.9621237569149227 6.3211852190410855 61410.0 22.832326139088728 0.0 - - - - - - - 739.0 122 2 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 425 54 B20140407_SF104_02 B20140407_SF104_02 TB499442.[MT7]-ATGRPPPTVTWR.3y8_1.heavy 494.948 / 953.52 36618.0 25.48040008544922 46 16 10 10 10 2.6185678923650784 29.912142119580423 0.0 3 0.9621237569149227 6.3211852190410855 36618.0 28.81303484791879 0.0 - - - - - - - 284.0 73 2 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 427 54 B20140407_SF104_02 B20140407_SF104_02 TB499442.[MT7]-ATGRPPPTVTWR.3y5_1.heavy 494.948 / 662.362 22858.0 25.48040008544922 46 16 10 10 10 2.6185678923650784 29.912142119580423 0.0 3 0.9621237569149227 6.3211852190410855 22858.0 18.347879771148374 0.0 - - - - - - - 2274.25 45 8 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 429 55 B20140407_SF104_02 B20140407_SF104_02 TB150562.[MT7]-STPVSR.2y4_1.heavy 395.731 / 458.272 32896.0 18.168399810791016 47 17 10 10 10 4.2874858581256685 23.32369209113061 0.0 3 0.9741804173706867 7.663882965749227 32896.0 23.523909212958987 0.0 - - - - - - - 881.3333333333334 65 3 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 431 55 B20140407_SF104_02 B20140407_SF104_02 TB150562.[MT7]-STPVSR.2y5_1.heavy 395.731 / 559.32 32210.0 18.168399810791016 47 17 10 10 10 4.2874858581256685 23.32369209113061 0.0 3 0.9741804173706867 7.663882965749227 32210.0 97.08003072709133 0.0 - - - - - - - 759.8888888888889 64 9 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 433 55 B20140407_SF104_02 B20140407_SF104_02 TB150562.[MT7]-STPVSR.2b4_1.heavy 395.731 / 529.31 14186.0 18.168399810791016 47 17 10 10 10 4.2874858581256685 23.32369209113061 0.0 3 0.9741804173706867 7.663882965749227 14186.0 21.19821053176617 0.0 - - - - - - - 661.0 28 12 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 435 55 B20140407_SF104_02 B20140407_SF104_02 TB150562.[MT7]-STPVSR.2b5_1.heavy 395.731 / 616.342 7093.0 18.168399810791016 47 17 10 10 10 4.2874858581256685 23.32369209113061 0.0 3 0.9741804173706867 7.663882965749227 7093.0 22.96929455416754 0.0 - - - - - - - 774.1818181818181 14 11 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 437 56 B20140407_SF104_02 B20140407_SF104_02 TB499593.[MT7]-LAENNIQPIFAVTSR.3b6_1.heavy 606.339 / 799.443 56435.0 34.128700256347656 50 20 10 10 10 7.33164613433569 13.639501711856807 0.0 3 0.995848323089197 19.14697748881173 56435.0 55.33602910025857 0.0 - - - - - - - 314.3333333333333 112 3 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 439 56 B20140407_SF104_02 B20140407_SF104_02 TB499593.[MT7]-LAENNIQPIFAVTSR.3b4_1.heavy 606.339 / 572.316 96438.0 34.128700256347656 50 20 10 10 10 7.33164613433569 13.639501711856807 0.0 3 0.995848323089197 19.14697748881173 96438.0 52.11496851810428 0.0 - - - - - - - 404.0 192 1 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 441 56 B20140407_SF104_02 B20140407_SF104_02 TB499593.[MT7]-LAENNIQPIFAVTSR.3b5_1.heavy 606.339 / 686.359 283522.0 34.128700256347656 50 20 10 10 10 7.33164613433569 13.639501711856807 0.0 3 0.995848323089197 19.14697748881173 283522.0 168.22174230932796 0.0 - - - - - - - 943.0 567 2 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 443 56 B20140407_SF104_02 B20140407_SF104_02 TB499593.[MT7]-LAENNIQPIFAVTSR.3y8_1.heavy 606.339 / 890.509 240017.0 34.128700256347656 50 20 10 10 10 7.33164613433569 13.639501711856807 0.0 3 0.995848323089197 19.14697748881173 240017.0 166.55203270135652 0.0 - - - - - - - 336.5 480 2 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 445 57 B20140407_SF104_02 B20140407_SF104_02 TB499846.[MT7]-LSSLGLLHWPVWVGAK[MT7].3y7_1.heavy 684.406 / 900.542 39003.0 39.84469985961914 38 11 9 10 8 1.592917582541813 44.004473050152725 0.0 4 0.8534277639990169 3.1833419600338115 39003.0 53.70024068071312 0.0 - - - - - - - 354.75 78 8 FAM151A family with sequence similarity 151, member A 447 57 B20140407_SF104_02 B20140407_SF104_02 TB499846.[MT7]-LSSLGLLHWPVWVGAK[MT7].3b6_1.heavy 684.406 / 715.447 28882.0 39.84469985961914 38 11 9 10 8 1.592917582541813 44.004473050152725 0.0 4 0.8534277639990169 3.1833419600338115 28882.0 26.213986283280377 1.0 - - - - - - - 339.375 90 8 FAM151A family with sequence similarity 151, member A 449 57 B20140407_SF104_02 B20140407_SF104_02 TB499846.[MT7]-LSSLGLLHWPVWVGAK[MT7].3b5_1.heavy 684.406 / 602.363 13577.0 39.84469985961914 38 11 9 10 8 1.592917582541813 44.004473050152725 0.0 4 0.8534277639990169 3.1833419600338115 13577.0 20.630952141512864 0.0 - - - - - - - 864.0 27 7 FAM151A family with sequence similarity 151, member A 451 57 B20140407_SF104_02 B20140407_SF104_02 TB499846.[MT7]-LSSLGLLHWPVWVGAK[MT7].3b7_1.heavy 684.406 / 828.531 32214.0 39.84469985961914 38 11 9 10 8 1.592917582541813 44.004473050152725 0.0 4 0.8534277639990169 3.1833419600338115 32214.0 50.5169014248328 0.0 - - - - - - - 385.75 64 8 FAM151A family with sequence similarity 151, member A 453 58 B20140407_SF104_02 B20140407_SF104_02 TB390120.[MT7]-GVVESAALVVWLR.2b4_1.heavy 771.96 / 529.31 10937.0 39.4995002746582 41 11 10 10 10 0.8732922363880842 76.3394702126271 0.0 3 0.8639322142966703 3.306987756415107 10937.0 16.66646453138435 0.0 - - - - - - - 799.875 21 8 PDILT protein disulfide isomerase-like, testis expressed 455 58 B20140407_SF104_02 B20140407_SF104_02 TB390120.[MT7]-GVVESAALVVWLR.2y9_1.heavy 771.96 / 1014.61 6166.0 39.4995002746582 41 11 10 10 10 0.8732922363880842 76.3394702126271 0.0 3 0.8639322142966703 3.306987756415107 6166.0 26.49596845183588 1.0 - - - - - - - 306.6363636363636 12 11 PDILT protein disulfide isomerase-like, testis expressed 457 58 B20140407_SF104_02 B20140407_SF104_02 TB390120.[MT7]-GVVESAALVVWLR.2y10_1.heavy 771.96 / 1143.65 8959.0 39.4995002746582 41 11 10 10 10 0.8732922363880842 76.3394702126271 0.0 3 0.8639322142966703 3.306987756415107 8959.0 20.459642867692672 0.0 - - - - - - - 302.5 17 10 PDILT protein disulfide isomerase-like, testis expressed 459 58 B20140407_SF104_02 B20140407_SF104_02 TB390120.[MT7]-GVVESAALVVWLR.2y11_1.heavy 771.96 / 1242.72 4072.0 39.4995002746582 41 11 10 10 10 0.8732922363880842 76.3394702126271 0.0 3 0.8639322142966703 3.306987756415107 4072.0 43.095266278035766 0.0 - - - - - - - 174.375 8 8 PDILT protein disulfide isomerase-like, testis expressed 461 59 B20140407_SF104_02 B20140407_SF104_02 TB499842.[MT7]-FLTPIY[MT7]HPNIDSAGR.4y5_1.heavy 498.025 / 505.237 60854.0 28.888900756835938 47 17 10 10 10 2.7574237705582045 26.20456094610256 0.0 3 0.9770580970996862 8.132308428445842 60854.0 10.129769258016953 0.0 - - - - - - - 1241.2 121 5 UBE2T ubiquitin-conjugating enzyme E2T (putative) 463 59 B20140407_SF104_02 B20140407_SF104_02 TB499842.[MT7]-FLTPIY[MT7]HPNIDSAGR.4y8_1.heavy 498.025 / 829.416 33303.0 28.888900756835938 47 17 10 10 10 2.7574237705582045 26.20456094610256 0.0 3 0.9770580970996862 8.132308428445842 33303.0 60.693835245564706 0.0 - - - - - - - 283.625 66 8 UBE2T ubiquitin-conjugating enzyme E2T (putative) 465 59 B20140407_SF104_02 B20140407_SF104_02 TB499842.[MT7]-FLTPIY[MT7]HPNIDSAGR.4y7_1.heavy 498.025 / 732.364 47987.0 28.888900756835938 47 17 10 10 10 2.7574237705582045 26.20456094610256 0.0 3 0.9770580970996862 8.132308428445842 47987.0 62.8855946440726 0.0 - - - - - - - 264.75 95 4 UBE2T ubiquitin-conjugating enzyme E2T (putative) 467 59 B20140407_SF104_02 B20140407_SF104_02 TB499842.[MT7]-FLTPIY[MT7]HPNIDSAGR.4b3_1.heavy 498.025 / 506.31 48592.0 28.888900756835938 47 17 10 10 10 2.7574237705582045 26.20456094610256 0.0 3 0.9770580970996862 8.132308428445842 48592.0 26.117660924063944 0.0 - - - - - - - 303.0 97 1 UBE2T ubiquitin-conjugating enzyme E2T (putative) 469 60 B20140407_SF104_02 B20140407_SF104_02 TB499903.[MT7]-RIQEIIEQLDVTTSEYEK[MT7].4b7_1.heavy 621.337 / 1026.61 9639.0 36.90570068359375 35 5 10 10 10 0.46570305777654863 100.32254939628035 0.0 3 0.6801142757101499 2.1210065453657205 9639.0 34.96010362694301 1.0 - - - - - - - 217.3125 29 16 HSPD1 heat shock 60kDa protein 1 (chaperonin) 471 60 B20140407_SF104_02 B20140407_SF104_02 TB499903.[MT7]-RIQEIIEQLDVTTSEYEK[MT7].4b4_1.heavy 621.337 / 671.396 10281.0 36.90570068359375 35 5 10 10 10 0.46570305777654863 100.32254939628035 0.0 3 0.6801142757101499 2.1210065453657205 10281.0 2.82637657885721 1.0 - - - - - - - 1188.875 23 8 HSPD1 heat shock 60kDa protein 1 (chaperonin) 473 60 B20140407_SF104_02 B20140407_SF104_02 TB499903.[MT7]-RIQEIIEQLDVTTSEYEK[MT7].4b5_1.heavy 621.337 / 784.48 17221.0 36.90570068359375 35 5 10 10 10 0.46570305777654863 100.32254939628035 0.0 3 0.6801142757101499 2.1210065453657205 17221.0 38.1527420665802 1.0 - - - - - - - 734.5714285714286 34 7 HSPD1 heat shock 60kDa protein 1 (chaperonin) 475 60 B20140407_SF104_02 B20140407_SF104_02 TB499903.[MT7]-RIQEIIEQLDVTTSEYEK[MT7].4y3_1.heavy 621.337 / 583.321 70683.0 36.90570068359375 35 5 10 10 10 0.46570305777654863 100.32254939628035 0.0 3 0.6801142757101499 2.1210065453657205 70683.0 92.17293226034667 0.0 - - - - - - - 386.0 141 1 HSPD1 heat shock 60kDa protein 1 (chaperonin) 477 61 B20140407_SF104_02 B20140407_SF104_02 TB499844.[MT7]-DAILDALENLTAEELK[MT7].3y6_1.heavy 682.712 / 834.469 172138.0 43.62889862060547 43 13 10 10 10 1.5662931283596986 54.92457501763447 0.0 3 0.9120757497979225 4.131172931495669 172138.0 440.68182115996956 0.0 - - - - - - - 331.1666666666667 344 6 PYCARD PYD and CARD domain containing 479 61 B20140407_SF104_02 B20140407_SF104_02 TB499844.[MT7]-DAILDALENLTAEELK[MT7].3b6_1.heavy 682.712 / 743.406 265051.0 43.62889862060547 43 13 10 10 10 1.5662931283596986 54.92457501763447 0.0 3 0.9120757497979225 4.131172931495669 265051.0 714.476730130176 0.0 - - - - - - - 323.22222222222223 530 9 PYCARD PYD and CARD domain containing 481 61 B20140407_SF104_02 B20140407_SF104_02 TB499844.[MT7]-DAILDALENLTAEELK[MT7].3b5_1.heavy 682.712 / 672.369 173982.0 43.62889862060547 43 13 10 10 10 1.5662931283596986 54.92457501763447 0.0 3 0.9120757497979225 4.131172931495669 173982.0 319.71153155293405 0.0 - - - - - - - 780.0 347 9 PYCARD PYD and CARD domain containing 483 61 B20140407_SF104_02 B20140407_SF104_02 TB499844.[MT7]-DAILDALENLTAEELK[MT7].3y5_1.heavy 682.712 / 733.421 170435.0 43.62889862060547 43 13 10 10 10 1.5662931283596986 54.92457501763447 0.0 3 0.9120757497979225 4.131172931495669 170435.0 517.0281874715128 0.0 - - - - - - - 292.75 340 8 PYCARD PYD and CARD domain containing 485 62 B20140407_SF104_02 B20140407_SF104_02 TB499845.[MT7]-DAILDALENLTAEELK[MT7].4y5_1.heavy 512.286 / 733.421 19438.0 43.609548568725586 39 13 10 6 10 1.6309960046758587 52.54004210806015 0.038700103759765625 3 0.9280416912921818 4.572803968168691 19438.0 123.44805200116855 1.0 - - - - - - - 239.08333333333334 38 12 PYCARD PYD and CARD domain containing 487 62 B20140407_SF104_02 B20140407_SF104_02 TB499845.[MT7]-DAILDALENLTAEELK[MT7].4b4_1.heavy 512.286 / 557.341 12655.0 43.609548568725586 39 13 10 6 10 1.6309960046758587 52.54004210806015 0.038700103759765625 3 0.9280416912921818 4.572803968168691 12655.0 26.398474932803552 0.0 - - - - - - - 167.9 25 10 PYCARD PYD and CARD domain containing 489 62 B20140407_SF104_02 B20140407_SF104_02 TB499845.[MT7]-DAILDALENLTAEELK[MT7].4b5_1.heavy 512.286 / 672.369 27199.0 43.609548568725586 39 13 10 6 10 1.6309960046758587 52.54004210806015 0.038700103759765625 3 0.9280416912921818 4.572803968168691 27199.0 112.68157142857143 0.0 - - - - - - - 192.5 54 16 PYCARD PYD and CARD domain containing 491 62 B20140407_SF104_02 B20140407_SF104_02 TB499845.[MT7]-DAILDALENLTAEELK[MT7].4b6_1.heavy 512.286 / 743.406 27968.0 43.609548568725586 39 13 10 6 10 1.6309960046758587 52.54004210806015 0.038700103759765625 3 0.9280416912921818 4.572803968168691 27968.0 447.1742266291848 0.0 - - - - - - - 265.8 55 10 PYCARD PYD and CARD domain containing 493 63 B20140407_SF104_02 B20140407_SF104_02 TB151216.[MT7]-ESQSYLVEDLER.2b4_1.heavy 806.403 / 576.275 13557.0 31.4960994720459 46 16 10 10 10 14.894651397244962 6.713819433095079 0.0 3 0.9620807446343329 6.317576138336279 13557.0 19.674314036478986 0.0 - - - - - - - 729.25 27 8 PYCARD PYD and CARD domain containing 495 63 B20140407_SF104_02 B20140407_SF104_02 TB151216.[MT7]-ESQSYLVEDLER.2y9_1.heavy 806.403 / 1123.56 9143.0 31.4960994720459 46 16 10 10 10 14.894651397244962 6.713819433095079 0.0 3 0.9620807446343329 6.317576138336279 9143.0 18.562827240238263 1.0 - - - - - - - 331.1 19 10 PYCARD PYD and CARD domain containing 497 63 B20140407_SF104_02 B20140407_SF104_02 TB151216.[MT7]-ESQSYLVEDLER.2b6_1.heavy 806.403 / 852.422 10562.0 31.4960994720459 46 16 10 10 10 14.894651397244962 6.713819433095079 0.0 3 0.9620807446343329 6.317576138336279 10562.0 24.116194503171243 0.0 - - - - - - - 343.90909090909093 21 11 PYCARD PYD and CARD domain containing 499 63 B20140407_SF104_02 B20140407_SF104_02 TB151216.[MT7]-ESQSYLVEDLER.2b5_1.heavy 806.403 / 739.338 11823.0 31.4960994720459 46 16 10 10 10 14.894651397244962 6.713819433095079 0.0 3 0.9620807446343329 6.317576138336279 11823.0 14.122610993657506 0.0 - - - - - - - 374.5 23 8 PYCARD PYD and CARD domain containing 501 64 B20140407_SF104_02 B20140407_SF104_02 TB151218.[MT7]-TLADVLVQEVIK[MT7].2b4_1.heavy 808.497 / 545.305 81170.0 39.597801208496094 50 20 10 10 10 9.077457729255565 11.016300266286223 0.0 3 0.9911110097221084 13.08018616955511 81170.0 121.98545675064777 0.0 - - - - - - - 324.0 162 5 INPP1 inositol polyphosphate-1-phosphatase 503 64 B20140407_SF104_02 B20140407_SF104_02 TB151218.[MT7]-TLADVLVQEVIK[MT7].2b6_1.heavy 808.497 / 757.458 37904.0 39.597801208496094 50 20 10 10 10 9.077457729255565 11.016300266286223 0.0 3 0.9911110097221084 13.08018616955511 37904.0 50.4024038914267 0.0 - - - - - - - 415.8333333333333 75 6 INPP1 inositol polyphosphate-1-phosphatase 505 64 B20140407_SF104_02 B20140407_SF104_02 TB151218.[MT7]-TLADVLVQEVIK[MT7].2b5_1.heavy 808.497 / 644.374 47256.0 39.597801208496094 50 20 10 10 10 9.077457729255565 11.016300266286223 0.0 3 0.9911110097221084 13.08018616955511 47256.0 60.08499556048835 0.0 - - - - - - - 837.1428571428571 94 7 INPP1 inositol polyphosphate-1-phosphatase 507 64 B20140407_SF104_02 B20140407_SF104_02 TB151218.[MT7]-TLADVLVQEVIK[MT7].2y7_1.heavy 808.497 / 972.621 26932.0 39.597801208496094 50 20 10 10 10 9.077457729255565 11.016300266286223 0.0 3 0.9911110097221084 13.08018616955511 26932.0 60.938043587113086 0.0 - - - - - - - 302.85714285714283 53 7 INPP1 inositol polyphosphate-1-phosphatase 509 65 B20140407_SF104_02 B20140407_SF104_02 TB151110.[MT7]-EVATDVFNSK[MT7].3b6_1.heavy 466.589 / 759.401 190994.0 28.206600189208984 48 18 10 10 10 6.046315574499854 16.53899780252074 0.0 3 0.9813723002721508 9.028306248120439 190994.0 242.5470084554135 0.0 - - - - - - - 449.0 381 1 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 511 65 B20140407_SF104_02 B20140407_SF104_02 TB151110.[MT7]-EVATDVFNSK[MT7].3y3_1.heavy 466.589 / 492.29 545936.0 28.206600189208984 48 18 10 10 10 6.046315574499854 16.53899780252074 0.0 3 0.9813723002721508 9.028306248120439 545936.0 217.9971482181062 0.0 - - - - - - - 1946.0 1091 1 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 513 65 B20140407_SF104_02 B20140407_SF104_02 TB151110.[MT7]-EVATDVFNSK[MT7].3b5_1.heavy 466.589 / 660.332 831697.0 28.206600189208984 48 18 10 10 10 6.046315574499854 16.53899780252074 0.0 3 0.9813723002721508 9.028306248120439 831697.0 247.81694539327367 0.0 - - - - - - - 748.0 1663 1 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 515 65 B20140407_SF104_02 B20140407_SF104_02 TB151110.[MT7]-EVATDVFNSK[MT7].3y4_1.heavy 466.589 / 639.358 181115.0 28.206600189208984 48 18 10 10 10 6.046315574499854 16.53899780252074 0.0 3 0.9813723002721508 9.028306248120439 181115.0 149.5370723937269 0.0 - - - - - - - 399.0 362 3 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 517 66 B20140407_SF104_02 B20140407_SF104_02 TB499458.[MT7]-FAVDFK[MT7].2y4_1.heavy 507.797 / 652.379 52784.0 30.900999069213867 43 13 10 10 10 1.0240397023417507 61.217005481986206 0.0 3 0.900810221100983 3.885724328913265 52784.0 54.779438040884315 0.0 - - - - - - - 809.75 105 8 INPP1 inositol polyphosphate-1-phosphatase 519 66 B20140407_SF104_02 B20140407_SF104_02 TB499458.[MT7]-FAVDFK[MT7].2y5_1.heavy 507.797 / 723.416 103830.0 30.900999069213867 43 13 10 10 10 1.0240397023417507 61.217005481986206 0.0 3 0.900810221100983 3.885724328913265 103830.0 78.14186846869148 0.0 - - - - - - - 395.0 207 4 INPP1 inositol polyphosphate-1-phosphatase 521 66 B20140407_SF104_02 B20140407_SF104_02 TB499458.[MT7]-FAVDFK[MT7].2b4_1.heavy 507.797 / 577.31 200864.0 30.900999069213867 43 13 10 10 10 1.0240397023417507 61.217005481986206 0.0 3 0.900810221100983 3.885724328913265 200864.0 163.3821648953477 0.0 - - - - - - - 1783.142857142857 401 7 INPP1 inositol polyphosphate-1-phosphatase 523 66 B20140407_SF104_02 B20140407_SF104_02 TB499458.[MT7]-FAVDFK[MT7].2y3_1.heavy 507.797 / 553.31 72381.0 30.900999069213867 43 13 10 10 10 1.0240397023417507 61.217005481986206 0.0 3 0.900810221100983 3.885724328913265 72381.0 42.09943674288498 0.0 - - - - - - - 895.3333333333334 144 3 INPP1 inositol polyphosphate-1-phosphatase 525 67 B20140407_SF104_02 B20140407_SF104_02 TB150770.[MT7]-DQMDDLR.2y5_1.heavy 518.746 / 649.297 5187.0 24.114874839782715 33 11 10 6 6 1.945501409111771 51.40063097957638 0.036701202392578125 5 0.862234994967239 3.2860645914796747 5187.0 5.811939759036145 0.0 - - - - - - - 259.3333333333333 10 6 UBE2T ubiquitin-conjugating enzyme E2T (putative) 527 67 B20140407_SF104_02 B20140407_SF104_02 TB150770.[MT7]-DQMDDLR.2b4_1.heavy 518.746 / 634.262 12656.0 24.114874839782715 33 11 10 6 6 1.945501409111771 51.40063097957638 0.036701202392578125 5 0.862234994967239 3.2860645914796747 12656.0 11.07301419122229 1.0 - - - - - - - 772.2222222222222 25 9 UBE2T ubiquitin-conjugating enzyme E2T (putative) 529 67 B20140407_SF104_02 B20140407_SF104_02 TB150770.[MT7]-DQMDDLR.2y6_1.heavy 518.746 / 777.356 8507.0 24.114874839782715 33 11 10 6 6 1.945501409111771 51.40063097957638 0.036701202392578125 5 0.862234994967239 3.2860645914796747 8507.0 14.206968451842048 2.0 - - - - - - - 1141.0 19 9 UBE2T ubiquitin-conjugating enzyme E2T (putative) 531 67 B20140407_SF104_02 B20140407_SF104_02 TB150770.[MT7]-DQMDDLR.2b5_1.heavy 518.746 / 749.289 71167.0 24.114874839782715 33 11 10 6 6 1.945501409111771 51.40063097957638 0.036701202392578125 5 0.862234994967239 3.2860645914796747 71167.0 158.1965741683133 0.0 - - - - - - - 715.7 142 10 UBE2T ubiquitin-conjugating enzyme E2T (putative) 533 68 B20140407_SF104_02 B20140407_SF104_02 TB151117.[MT7]-QQQEQQQAK[MT7].3b4_1.heavy 468.588 / 658.328 30632.0 16.357200622558594 50 20 10 10 10 11.622596291695576 8.603929577374265 0.0 3 0.9934485980951896 15.239048806977877 30632.0 182.09985900843637 0.0 - - - - - - - 143.6315789473684 61 19 RIBC1 RIB43A domain with coiled-coils 1 535 68 B20140407_SF104_02 B20140407_SF104_02 TB151117.[MT7]-QQQEQQQAK[MT7].3b5_1.heavy 468.588 / 786.386 13658.0 16.357200622558594 50 20 10 10 10 11.622596291695576 8.603929577374265 0.0 3 0.9934485980951896 15.239048806977877 13658.0 165.70367647058822 0.0 - - - - - - - 97.1 27 20 RIBC1 RIB43A domain with coiled-coils 1 537 68 B20140407_SF104_02 B20140407_SF104_02 TB151117.[MT7]-QQQEQQQAK[MT7].3y4_1.heavy 468.588 / 618.369 13030.0 16.357200622558594 50 20 10 10 10 11.622596291695576 8.603929577374265 0.0 3 0.9934485980951896 15.239048806977877 13030.0 139.61144140739808 0.0 - - - - - - - 148.91666666666666 26 24 RIBC1 RIB43A domain with coiled-coils 1 539 68 B20140407_SF104_02 B20140407_SF104_02 TB151117.[MT7]-QQQEQQQAK[MT7].3b3_1.heavy 468.588 / 529.285 38021.0 16.357200622558594 50 20 10 10 10 11.622596291695576 8.603929577374265 0.0 3 0.9934485980951896 15.239048806977877 38021.0 291.51270658491495 0.0 - - - - - - - 201.9 76 20 RIBC1 RIB43A domain with coiled-coils 1 541 69 B20140407_SF104_02 B20140407_SF104_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 2859330.0 20.59160041809082 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2859330.0 2692.9656518989445 0.0 - - - - - - - 2240.0 5718 3 543 69 B20140407_SF104_02 B20140407_SF104_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 1903560.0 20.59160041809082 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1903560.0 2820.348324934216 0.0 - - - - - - - 1166.0 3807 2 545 69 B20140407_SF104_02 B20140407_SF104_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 1780890.0 20.59160041809082 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1780890.0 2484.7809181472735 0.0 - - - - - - - 686.0 3561 1 547 70 B20140407_SF104_02 B20140407_SF104_02 TB151010.[MT7]-ELLC[CAM]VSEK[MT7].2b3_1.heavy 633.354 / 500.32 34741.0 28.29210090637207 48 18 10 10 10 4.442629587439854 22.50919146685529 0.0 3 0.9814645744216021 9.050821046343586 34741.0 27.024863389021732 0.0 - - - - - - - 301.0 69 1 INPP1 inositol polyphosphate-1-phosphatase 549 70 B20140407_SF104_02 B20140407_SF104_02 TB151010.[MT7]-ELLC[CAM]VSEK[MT7].2y5_1.heavy 633.354 / 766.389 43163.0 28.29210090637207 48 18 10 10 10 4.442629587439854 22.50919146685529 0.0 3 0.9814645744216021 9.050821046343586 43163.0 34.774637319744116 0.0 - - - - - - - 1224.857142857143 86 7 INPP1 inositol polyphosphate-1-phosphatase 551 70 B20140407_SF104_02 B20140407_SF104_02 TB151010.[MT7]-ELLC[CAM]VSEK[MT7].2y3_1.heavy 633.354 / 507.289 45118.0 28.29210090637207 48 18 10 10 10 4.442629587439854 22.50919146685529 0.0 3 0.9814645744216021 9.050821046343586 45118.0 53.51871023266857 0.0 - - - - - - - 338.25 90 4 INPP1 inositol polyphosphate-1-phosphatase 553 70 B20140407_SF104_02 B20140407_SF104_02 TB151010.[MT7]-ELLC[CAM]VSEK[MT7].2y6_1.heavy 633.354 / 879.473 21957.0 28.29210090637207 48 18 10 10 10 4.442629587439854 22.50919146685529 0.0 3 0.9814645744216021 9.050821046343586 21957.0 20.87317144294719 0.0 - - - - - - - 752.0 43 8 INPP1 inositol polyphosphate-1-phosphatase 555 71 B20140407_SF104_02 B20140407_SF104_02 TB150576.[MT7]-VQAEAR.2y4_1.heavy 409.236 / 446.236 29646.0 18.42060089111328 42 14 10 10 8 1.9542702771027598 51.16999484239803 0.0 4 0.9301676619761537 4.642733639683857 29646.0 51.66893368575411 0.0 - - - - - - - 843.6 59 10 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 557 71 B20140407_SF104_02 B20140407_SF104_02 TB150576.[MT7]-VQAEAR.2y5_1.heavy 409.236 / 574.294 128961.0 18.42060089111328 42 14 10 10 8 1.9542702771027598 51.16999484239803 0.0 4 0.9301676619761537 4.642733639683857 128961.0 370.8025436035732 0.0 - - - - - - - 360.375 257 8 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 559 71 B20140407_SF104_02 B20140407_SF104_02 TB150576.[MT7]-VQAEAR.2b4_1.heavy 409.236 / 572.316 124713.0 18.42060089111328 42 14 10 10 8 1.9542702771027598 51.16999484239803 0.0 4 0.9301676619761537 4.642733639683857 124713.0 131.2244342548921 1.0 - - - - - - - 273.0 275 1 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 561 71 B20140407_SF104_02 B20140407_SF104_02 TB150576.[MT7]-VQAEAR.2b5_1.heavy 409.236 / 643.353 15688.0 18.42060089111328 42 14 10 10 8 1.9542702771027598 51.16999484239803 0.0 4 0.9301676619761537 4.642733639683857 15688.0 5.936370799769342 1.0 - - - - - - - 409.5 151 4 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 563 72 B20140407_SF104_02 B20140407_SF104_02 TB499588.[MT7]-TTTPNAQATR.2y9_1.heavy 602.824 / 959.49 46670.0 18.37809944152832 50 20 10 10 10 19.59241861120259 5.1040150776903985 0.0 3 0.9987013452160234 34.24273925136112 46670.0 299.8005710632857 0.0 - - - - - - - 152.3125 93 16 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 565 72 B20140407_SF104_02 B20140407_SF104_02 TB499588.[MT7]-TTTPNAQATR.2y6_1.heavy 602.824 / 660.342 6532.0 18.37809944152832 50 20 10 10 10 19.59241861120259 5.1040150776903985 0.0 3 0.9987013452160234 34.24273925136112 6532.0 65.69336516894582 0.0 - - - - - - - 176.64285714285714 13 14 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 567 72 B20140407_SF104_02 B20140407_SF104_02 TB499588.[MT7]-TTTPNAQATR.2b5_1.heavy 602.824 / 659.348 3621.0 18.37809944152832 50 20 10 10 10 19.59241861120259 5.1040150776903985 0.0 3 0.9987013452160234 34.24273925136112 3621.0 31.410779141283122 0.0 - - - - - - - 111.0 7 18 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 569 72 B20140407_SF104_02 B20140407_SF104_02 TB499588.[MT7]-TTTPNAQATR.2y7_1.heavy 602.824 / 757.395 76656.0 18.37809944152832 50 20 10 10 10 19.59241861120259 5.1040150776903985 0.0 3 0.9987013452160234 34.24273925136112 76656.0 110.09471162995192 0.0 - - - - - - - 110.9090909090909 153 11 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 571 73 B20140407_SF104_02 B20140407_SF104_02 TB499453.[MT7]-GANPVEIR.2y5_1.heavy 500.289 / 613.367 36778.0 24.015249252319336 35 9 10 6 10 0.9850100398677124 64.47421193612746 0.035900115966796875 3 0.8125799821347538 2.80495262810361 36778.0 10.62031785419681 0.0 - - - - - - - 657.6666666666666 73 3 HSPD1 heat shock 60kDa protein 1 (chaperonin) 573 73 B20140407_SF104_02 B20140407_SF104_02 TB499453.[MT7]-GANPVEIR.2b6_1.heavy 500.289 / 712.375 71374.0 24.015249252319336 35 9 10 6 10 0.9850100398677124 64.47421193612746 0.035900115966796875 3 0.8125799821347538 2.80495262810361 71374.0 104.43152835198259 0.0 - - - - - - - 1202.2857142857142 142 7 HSPD1 heat shock 60kDa protein 1 (chaperonin) 575 73 B20140407_SF104_02 B20140407_SF104_02 TB499453.[MT7]-GANPVEIR.2b5_1.heavy 500.289 / 583.332 16311.0 24.015249252319336 35 9 10 6 10 0.9850100398677124 64.47421193612746 0.035900115966796875 3 0.8125799821347538 2.80495262810361 16311.0 23.16198333510981 1.0 - - - - - - - 1291.142857142857 65 7 HSPD1 heat shock 60kDa protein 1 (chaperonin) 577 73 B20140407_SF104_02 B20140407_SF104_02 TB499453.[MT7]-GANPVEIR.2y7_1.heavy 500.289 / 798.447 16519.0 24.015249252319336 35 9 10 6 10 0.9850100398677124 64.47421193612746 0.035900115966796875 3 0.8125799821347538 2.80495262810361 16519.0 58.68540359485768 0.0 - - - - - - - 263.46666666666664 33 15 HSPD1 heat shock 60kDa protein 1 (chaperonin) 579 74 B20140407_SF104_02 B20140407_SF104_02 TB499583.[MT7]-LRIPAAQER.2y5_1.heavy 599.363 / 574.294 N/A 25.310199737548828 42 18 8 10 6 5.671504652654553 17.632005283323696 0.0 5 0.9861158232949515 10.461610208619506 1710.0 1.5545454545454542 23.0 - - - - - - - 1254.0 14 7 LOC100289200;LOC100292387;HMCN2 hemicentin-2-like;hemicentin-2-like;hemicentin 2 581 74 B20140407_SF104_02 B20140407_SF104_02 TB499583.[MT7]-LRIPAAQER.2b6_1.heavy 599.363 / 766.506 2963.0 25.310199737548828 42 18 8 10 6 5.671504652654553 17.632005283323696 0.0 5 0.9861158232949515 10.461610208619506 2963.0 6.873235867446393 2.0 - - - - - - - 423.42857142857144 22 7 LOC100289200;LOC100292387;HMCN2 hemicentin-2-like;hemicentin-2-like;hemicentin 2 583 74 B20140407_SF104_02 B20140407_SF104_02 TB499583.[MT7]-LRIPAAQER.2y6_1.heavy 599.363 / 671.347 8434.0 25.310199737548828 42 18 8 10 6 5.671504652654553 17.632005283323696 0.0 5 0.9861158232949515 10.461610208619506 8434.0 15.71716179337232 0.0 - - - - - - - 684.0 16 7 LOC100289200;LOC100292387;HMCN2 hemicentin-2-like;hemicentin-2-like;hemicentin 2 585 74 B20140407_SF104_02 B20140407_SF104_02 TB499583.[MT7]-LRIPAAQER.2y7_1.heavy 599.363 / 784.431 6838.0 25.310199737548828 42 18 8 10 6 5.671504652654553 17.632005283323696 0.0 5 0.9861158232949515 10.461610208619506 6838.0 11.903185185185185 0.0 - - - - - - - 700.2857142857143 13 7 LOC100289200;LOC100292387;HMCN2 hemicentin-2-like;hemicentin-2-like;hemicentin 2 587 75 B20140407_SF104_02 B20140407_SF104_02 TB499715.[MT7]-LTERPELANK[MT7].3y6_1.heavy 486.955 / 815.474 44654.0 24.197400093078613 37 11 10 6 10 1.7486088232674883 57.18831946251869 0.03660011291503906 3 0.8527703825065036 3.1760432102808993 44654.0 135.3596900221953 0.0 - - - - - - - 581.5 89 8 DHFRL1 dihydrofolate reductase-like 1 589 75 B20140407_SF104_02 B20140407_SF104_02 TB499715.[MT7]-LTERPELANK[MT7].3y4_1.heavy 486.955 / 589.379 42896.0 24.197400093078613 37 11 10 6 10 1.7486088232674883 57.18831946251869 0.03660011291503906 3 0.8527703825065036 3.1760432102808993 42896.0 39.755681282240914 0.0 - - - - - - - 769.5555555555555 85 9 DHFRL1 dihydrofolate reductase-like 1 591 75 B20140407_SF104_02 B20140407_SF104_02 TB499715.[MT7]-LTERPELANK[MT7].3y5_1.heavy 486.955 / 718.422 10026.0 24.197400093078613 37 11 10 6 10 1.7486088232674883 57.18831946251869 0.03660011291503906 3 0.8527703825065036 3.1760432102808993 10026.0 13.550907568124948 0.0 - - - - - - - 253.63636363636363 20 11 DHFRL1 dihydrofolate reductase-like 1 593 75 B20140407_SF104_02 B20140407_SF104_02 TB499715.[MT7]-LTERPELANK[MT7].3y9_2.heavy 486.955 / 601.336 182336.0 24.197400093078613 37 11 10 6 10 1.7486088232674883 57.18831946251869 0.03660011291503906 3 0.8527703825065036 3.1760432102808993 182336.0 28.365857519788918 2.0 - - - - - - - 1240.0 364 1 DHFRL1 dihydrofolate reductase-like 1 595 76 B20140407_SF104_02 B20140407_SF104_02 TB151017.[MT7]-LGAILTPNDGR.2y8_1.heavy 635.865 / 885.479 9801.0 30.9507999420166 43 17 8 10 8 4.220819832301374 23.69207973169413 0.0 4 0.9784896785936881 8.3995756738857 9801.0 26.053291139240507 0.0 - - - - - - - 276.5 19 8 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 597 76 B20140407_SF104_02 B20140407_SF104_02 TB151017.[MT7]-LGAILTPNDGR.2y5_1.heavy 635.865 / 558.263 7430.0 30.9507999420166 43 17 8 10 8 4.220819832301374 23.69207973169413 0.0 4 0.9784896785936881 8.3995756738857 7430.0 3.00437016557188 1.0 - - - - - - - 474.0 19 2 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 599 76 B20140407_SF104_02 B20140407_SF104_02 TB151017.[MT7]-LGAILTPNDGR.2y10_1.heavy 635.865 / 1013.54 16756.0 30.9507999420166 43 17 8 10 8 4.220819832301374 23.69207973169413 0.0 4 0.9784896785936881 8.3995756738857 16756.0 21.2665722033832 1.0 - - - - - - - 284.4 44 5 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 601 76 B20140407_SF104_02 B20140407_SF104_02 TB151017.[MT7]-LGAILTPNDGR.2y7_1.heavy 635.865 / 772.395 16756.0 30.9507999420166 43 17 8 10 8 4.220819832301374 23.69207973169413 0.0 4 0.9784896785936881 8.3995756738857 16756.0 37.37299754840646 0.0 - - - - - - - 296.25 33 8 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 603 77 B20140407_SF104_02 B20140407_SF104_02 TB499910.[MT7]-SIATTLIDDTSSEVLDELY[MT7]R.4y5_1.heavy 633.085 / 839.438 4993.0 40.49729919433594 41 14 9 10 8 1.3418154966342812 45.28946228983884 0.0 4 0.9393074112165122 4.983943870496843 4993.0 31.748207282913164 0.0 - - - - - - - 264.44444444444446 9 9 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 605 77 B20140407_SF104_02 B20140407_SF104_02 TB499910.[MT7]-SIATTLIDDTSSEVLDELY[MT7]R.4y4_1.heavy 633.085 / 724.411 9035.0 40.49729919433594 41 14 9 10 8 1.3418154966342812 45.28946228983884 0.0 4 0.9393074112165122 4.983943870496843 9035.0 32.767935924369745 1.0 - - - - - - - 247.91666666666666 25 12 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 607 77 B20140407_SF104_02 B20140407_SF104_02 TB499910.[MT7]-SIATTLIDDTSSEVLDELY[MT7]R.4b5_1.heavy 633.085 / 618.358 N/A 40.49729919433594 41 14 9 10 8 1.3418154966342812 45.28946228983884 0.0 4 0.9393074112165122 4.983943870496843 21993.0 14.741015825874982 2.0 - - - - - - - 238.0 52 1 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 609 77 B20140407_SF104_02 B20140407_SF104_02 TB499910.[MT7]-SIATTLIDDTSSEVLDELY[MT7]R.4y6_1.heavy 633.085 / 952.522 4517.0 40.49729919433594 41 14 9 10 8 1.3418154966342812 45.28946228983884 0.0 4 0.9393074112165122 4.983943870496843 4517.0 12.083091747740106 1.0 - - - - - - - 289.0 9 7 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 611 78 B20140407_SF104_02 B20140407_SF104_02 TB499718.[MT7]-ADRTTAEVWK[MT7].3y3_1.heavy 488.94 / 576.363 20619.0 24.860599517822266 36 14 4 10 8 2.4527808466951133 40.77005091373752 0.0 4 0.9335245196705839 4.759879194373195 20619.0 17.435068190623262 1.0 - - - - - - - 1206.5714285714287 57 7 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 613 78 B20140407_SF104_02 B20140407_SF104_02 TB499718.[MT7]-ADRTTAEVWK[MT7].3b4_1.heavy 488.94 / 588.322 N/A 24.860599517822266 36 14 4 10 8 2.4527808466951133 40.77005091373752 0.0 4 0.9335245196705839 4.759879194373195 7677.0 2.602649261977361 12.0 - - - - - - - 1864.5 75 2 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 615 78 B20140407_SF104_02 B20140407_SF104_02 TB499718.[MT7]-ADRTTAEVWK[MT7].3y4_1.heavy 488.94 / 705.405 10529.0 24.860599517822266 36 14 4 10 8 2.4527808466951133 40.77005091373752 0.0 4 0.9335245196705839 4.759879194373195 10529.0 11.012919924188582 0.0 - - - - - - - 795.125 21 8 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 617 78 B20140407_SF104_02 B20140407_SF104_02 TB499718.[MT7]-ADRTTAEVWK[MT7].3b7_1.heavy 488.94 / 889.45 21277.0 24.860599517822266 36 14 4 10 8 2.4527808466951133 40.77005091373752 0.0 4 0.9335245196705839 4.759879194373195 21277.0 49.78544492464539 1.0 - - - - - - - 269.1818181818182 42 11 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 619 79 B20140407_SF104_02 B20140407_SF104_02 TB499580.[MT7]-TLNDELEIIEGMK[MT7].3b4_1.heavy 598.325 / 588.311 21941.0 37.375099182128906 32 10 2 10 10 1.0347759849103582 58.28571087947453 0.0 3 0.8295912229981562 2.946095548594258 21941.0 23.85330255977398 1.0 - - - - - - - 779.0 326 7 HSPD1 heat shock 60kDa protein 1 (chaperonin) 621 79 B20140407_SF104_02 B20140407_SF104_02 TB499580.[MT7]-TLNDELEIIEGMK[MT7].3b5_1.heavy 598.325 / 717.354 41415.0 37.375099182128906 32 10 2 10 10 1.0347759849103582 58.28571087947453 0.0 3 0.8295912229981562 2.946095548594258 41415.0 114.88899774664446 0.0 - - - - - - - 363.2 82 5 HSPD1 heat shock 60kDa protein 1 (chaperonin) 623 79 B20140407_SF104_02 B20140407_SF104_02 TB499580.[MT7]-TLNDELEIIEGMK[MT7].3y4_1.heavy 598.325 / 608.319 55306.0 37.375099182128906 32 10 2 10 10 1.0347759849103582 58.28571087947453 0.0 3 0.8295912229981562 2.946095548594258 55306.0 60.12628190925024 0.0 - - - - - - - 340.5 110 8 HSPD1 heat shock 60kDa protein 1 (chaperonin) 625 79 B20140407_SF104_02 B20140407_SF104_02 TB499580.[MT7]-TLNDELEIIEGMK[MT7].3b7_1.heavy 598.325 / 959.48 40636.0 37.375099182128906 32 10 2 10 10 1.0347759849103582 58.28571087947453 0.0 3 0.8295912229981562 2.946095548594258 40636.0 32.11433679183065 0.0 - - - - - - - 1217.125 81 8 HSPD1 heat shock 60kDa protein 1 (chaperonin) 627 80 B20140407_SF104_02 B20140407_SF104_02 TB499855.[MT7]-LLVFATDDGFHFAGDGK[MT7].4y4_1.heavy 525.277 / 520.285 48803.0 36.73059844970703 47 17 10 10 10 3.370307692017965 29.67088145596736 0.0 3 0.9737859268536175 7.605745771627016 48803.0 13.19065568719041 0.0 - - - - - - - 786.75 97 8 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 629 80 B20140407_SF104_02 B20140407_SF104_02 TB499855.[MT7]-LLVFATDDGFHFAGDGK[MT7].4y5_1.heavy 525.277 / 591.322 51629.0 36.73059844970703 47 17 10 10 10 3.370307692017965 29.67088145596736 0.0 3 0.9737859268536175 7.605745771627016 51629.0 25.094226474694047 0.0 - - - - - - - 706.5 103 4 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 631 80 B20140407_SF104_02 B20140407_SF104_02 TB499855.[MT7]-LLVFATDDGFHFAGDGK[MT7].4b4_1.heavy 525.277 / 617.414 41996.0 36.73059844970703 47 17 10 10 10 3.370307692017965 29.67088145596736 0.0 3 0.9737859268536175 7.605745771627016 41996.0 37.728343463226025 0.0 - - - - - - - 385.0 83 2 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 633 80 B20140407_SF104_02 B20140407_SF104_02 TB499855.[MT7]-LLVFATDDGFHFAGDGK[MT7].4y6_1.heavy 525.277 / 738.39 40198.0 36.73059844970703 47 17 10 10 10 3.370307692017965 29.67088145596736 0.0 3 0.9737859268536175 7.605745771627016 40198.0 157.53552407993317 0.0 - - - - - - - 256.8 80 5 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 635 81 B20140407_SF104_02 B20140407_SF104_02 TB499856.[MT7]-SLLVLTPAGLTQMLNQTR.3y6_1.heavy 700.737 / 762.393 11950.0 41.8614501953125 41 16 10 5 10 3.6241545580329317 22.076726384197343 0.04109954833984375 3 0.9683416760237901 6.917767292150892 11950.0 46.71810699588477 0.0 - - - - - - - 388.7 23 10 PDILT protein disulfide isomerase-like, testis expressed 637 81 B20140407_SF104_02 B20140407_SF104_02 TB499856.[MT7]-SLLVLTPAGLTQMLNQTR.3b5_1.heavy 700.737 / 670.462 16225.0 41.8614501953125 41 16 10 5 10 3.6241545580329317 22.076726384197343 0.04109954833984375 3 0.9683416760237901 6.917767292150892 16225.0 46.52757352941176 0.0 - - - - - - - 693.8571428571429 32 7 PDILT protein disulfide isomerase-like, testis expressed 639 81 B20140407_SF104_02 B20140407_SF104_02 TB499856.[MT7]-SLLVLTPAGLTQMLNQTR.3y8_1.heavy 700.737 / 991.499 8356.0 41.8614501953125 41 16 10 5 10 3.6241545580329317 22.076726384197343 0.04109954833984375 3 0.9683416760237901 6.917767292150892 8356.0 95.72661976955732 0.0 - - - - - - - 242.8 16 10 PDILT protein disulfide isomerase-like, testis expressed 641 81 B20140407_SF104_02 B20140407_SF104_02 TB499856.[MT7]-SLLVLTPAGLTQMLNQTR.3y5_1.heavy 700.737 / 631.352 12145.0 41.8614501953125 41 16 10 5 10 3.6241545580329317 22.076726384197343 0.04109954833984375 3 0.9683416760237901 6.917767292150892 12145.0 31.183124150806915 0.0 - - - - - - - 282.54545454545456 24 11 PDILT protein disulfide isomerase-like, testis expressed 643 82 B20140407_SF104_02 B20140407_SF104_02 TB499913.[MT7]-VLEGQPVSLPC[CAM]IVLAGRPLPER.4y15_2.heavy 636.867 / 839.477 114594.0 36.02840042114258 46 16 10 10 10 3.041067405697988 25.820895392091852 0.0 3 0.9638267537280966 6.4692018813354775 114594.0 171.88430799484652 0.0 - - - - - - - 258.0 229 3 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 645 82 B20140407_SF104_02 B20140407_SF104_02 TB499913.[MT7]-VLEGQPVSLPC[CAM]IVLAGRPLPER.4b4_1.heavy 636.867 / 543.326 38413.0 36.02840042114258 46 16 10 10 10 3.041067405697988 25.820895392091852 0.0 3 0.9638267537280966 6.4692018813354775 38413.0 40.262283315872764 0.0 - - - - - - - 1215.2857142857142 76 7 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 647 82 B20140407_SF104_02 B20140407_SF104_02 TB499913.[MT7]-VLEGQPVSLPC[CAM]IVLAGRPLPER.4y13_2.heavy 636.867 / 739.419 214880.0 36.02840042114258 46 16 10 10 10 3.041067405697988 25.820895392091852 0.0 3 0.9638267537280966 6.4692018813354775 214880.0 238.343908045977 0.0 - - - - - - - 387.0 429 1 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 649 82 B20140407_SF104_02 B20140407_SF104_02 TB499913.[MT7]-VLEGQPVSLPC[CAM]IVLAGRPLPER.4b5_1.heavy 636.867 / 671.385 184588.0 36.02840042114258 46 16 10 10 10 3.041067405697988 25.820895392091852 0.0 3 0.9638267537280966 6.4692018813354775 184588.0 156.6108648747331 0.0 - - - - - - - 129.0 369 1 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 651 83 B20140407_SF104_02 B20140407_SF104_02 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 2322630.0 33.48540115356445 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2322630.0 170.7895741301142 0.0 - - - - - - - 280.0 4645 3 653 83 B20140407_SF104_02 B20140407_SF104_02 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 1023780.0 33.48540115356445 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1023780.0 185.29361699696773 0.0 - - - - - - - 303.3333333333333 2047 6 655 83 B20140407_SF104_02 B20140407_SF104_02 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1635880.0 33.48540115356445 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1635880.0 240.48585031147186 0.0 - - - - - - - 210.0 3271 2 657 84 B20140407_SF104_02 B20140407_SF104_02 TB151288.[MT7]-VFLDHNALPDTLK[MT7].3y3_1.heavy 591.005 / 505.347 102611.0 31.250699996948242 38 8 10 10 10 0.5640921027444636 89.57062389258266 0.0 3 0.7548876393712345 2.439949959432865 102611.0 59.71016825476599 0.0 - - - - - - - 783.0 205 1 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 659 84 B20140407_SF104_02 B20140407_SF104_02 TB151288.[MT7]-VFLDHNALPDTLK[MT7].3b4_1.heavy 591.005 / 619.357 49974.0 31.250699996948242 38 8 10 10 10 0.5640921027444636 89.57062389258266 0.0 3 0.7548876393712345 2.439949959432865 49974.0 25.554006398693083 0.0 - - - - - - - 940.0 99 1 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 661 84 B20140407_SF104_02 B20140407_SF104_02 TB151288.[MT7]-VFLDHNALPDTLK[MT7].3b5_1.heavy 591.005 / 756.416 15666.0 31.250699996948242 38 8 10 10 10 0.5640921027444636 89.57062389258266 0.0 3 0.7548876393712345 2.439949959432865 15666.0 15.943765957446807 0.0 - - - - - - - 1253.4285714285713 31 7 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 663 84 B20140407_SF104_02 B20140407_SF104_02 TB151288.[MT7]-VFLDHNALPDTLK[MT7].3y5_1.heavy 591.005 / 717.426 207258.0 31.250699996948242 38 8 10 10 10 0.5640921027444636 89.57062389258266 0.0 3 0.7548876393712345 2.439949959432865 207258.0 101.42412765957445 0.0 - - - - - - - 313.0 414 1 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 665 85 B20140407_SF104_02 B20140407_SF104_02 TB151409.[MT7]-ARDAILDALENLTAEELK[MT7].3y6_1.heavy 758.425 / 834.469 55008.0 40.69419860839844 35 7 10 10 8 0.8670023285383291 67.26316774688027 0.0 4 0.7368614368630235 2.350990683692902 55008.0 54.37085331300903 0.0 - - - - - - - 388.85714285714283 110 7 PYCARD PYD and CARD domain containing 667 85 B20140407_SF104_02 B20140407_SF104_02 TB151409.[MT7]-ARDAILDALENLTAEELK[MT7].3b8_1.heavy 758.425 / 970.544 20755.0 40.69419860839844 35 7 10 10 8 0.8670023285383291 67.26316774688027 0.0 4 0.7368614368630235 2.350990683692902 20755.0 41.82111736653698 1.0 - - - - - - - 283.5 41 8 PYCARD PYD and CARD domain containing 669 85 B20140407_SF104_02 B20140407_SF104_02 TB151409.[MT7]-ARDAILDALENLTAEELK[MT7].3y5_1.heavy 758.425 / 733.421 47182.0 40.69419860839844 35 7 10 10 8 0.8670023285383291 67.26316774688027 0.0 4 0.7368614368630235 2.350990683692902 47182.0 42.59005314209686 0.0 - - - - - - - 729.0 94 7 PYCARD PYD and CARD domain containing 671 85 B20140407_SF104_02 B20140407_SF104_02 TB151409.[MT7]-ARDAILDALENLTAEELK[MT7].3b7_1.heavy 758.425 / 899.507 19621.0 40.69419860839844 35 7 10 10 8 0.8670023285383291 67.26316774688027 0.0 4 0.7368614368630235 2.350990683692902 19621.0 82.9786784140969 0.0 - - - - - - - 217.16666666666666 39 12 PYCARD PYD and CARD domain containing 673 86 B20140407_SF104_02 B20140407_SF104_02 TB389805.[MT7]-QLTEEGK[MT7].2y4_1.heavy 546.811 / 606.321 12224.0 20.850799560546875 41 11 10 10 10 0.6627014435238999 83.38868682787884 0.0 3 0.8661222693486413 3.3345673276561034 12224.0 43.580044150110375 0.0 - - - - - - - 274.7857142857143 24 14 FAM151A family with sequence similarity 151, member A 675 86 B20140407_SF104_02 B20140407_SF104_02 TB389805.[MT7]-QLTEEGK[MT7].2y5_1.heavy 546.811 / 707.369 33426.0 20.850799560546875 41 11 10 10 10 0.6627014435238999 83.38868682787884 0.0 3 0.8661222693486413 3.3345673276561034 33426.0 94.47727854816875 0.0 - - - - - - - 743.7142857142857 66 7 FAM151A family with sequence similarity 151, member A 677 86 B20140407_SF104_02 B20140407_SF104_02 TB389805.[MT7]-QLTEEGK[MT7].2y6_1.heavy 546.811 / 820.453 47536.0 20.850799560546875 41 11 10 10 10 0.6627014435238999 83.38868682787884 0.0 3 0.8661222693486413 3.3345673276561034 47536.0 78.59957935051463 0.0 - - - - - - - 246.72727272727272 95 11 FAM151A family with sequence similarity 151, member A 679 86 B20140407_SF104_02 B20140407_SF104_02 TB389805.[MT7]-QLTEEGK[MT7].2b5_1.heavy 546.811 / 745.385 38331.0 20.850799560546875 41 11 10 10 10 0.6627014435238999 83.38868682787884 0.0 3 0.8661222693486413 3.3345673276561034 38331.0 174.24578104308478 0.0 - - - - - - - 219.91666666666666 76 12 FAM151A family with sequence similarity 151, member A 681 87 B20140407_SF104_02 B20140407_SF104_02 TB150643.[MT7]-GVITVK[MT7].2y4_1.heavy 452.807 / 604.415 47919.0 24.93779945373535 40 18 4 10 8 5.570018852751149 17.953260598141046 0.0 4 0.9825965540808782 9.341419480867112 47919.0 57.46651484005322 0.0 - - - - - - - 453.0 95 1 HSPD1 heat shock 60kDa protein 1 (chaperonin) 683 87 B20140407_SF104_02 B20140407_SF104_02 TB150643.[MT7]-GVITVK[MT7].2y5_1.heavy 452.807 / 703.483 14500.0 24.93779945373535 40 18 4 10 8 5.570018852751149 17.953260598141046 0.0 4 0.9825965540808782 9.341419480867112 14500.0 8.911375594547485 1.0 - - - - - - - 1116.857142857143 84 7 HSPD1 heat shock 60kDa protein 1 (chaperonin) 685 87 B20140407_SF104_02 B20140407_SF104_02 TB150643.[MT7]-GVITVK[MT7].2b4_1.heavy 452.807 / 515.331 33985.0 24.93779945373535 40 18 4 10 8 5.570018852751149 17.953260598141046 0.0 4 0.9825965540808782 9.341419480867112 33985.0 4.786314026483996 1.0 - - - - - - - 2249.5714285714284 111 7 HSPD1 heat shock 60kDa protein 1 (chaperonin) 687 87 B20140407_SF104_02 B20140407_SF104_02 TB150643.[MT7]-GVITVK[MT7].2y3_1.heavy 452.807 / 491.331 73635.0 24.93779945373535 40 18 4 10 8 5.570018852751149 17.953260598141046 0.0 4 0.9825965540808782 9.341419480867112 73635.0 49.60992939099735 1.0 - - - - - - - 1133.0 261 1 HSPD1 heat shock 60kDa protein 1 (chaperonin) 689 88 B20140407_SF104_02 B20140407_SF104_02 TB389800.[MT7]-DAGTYTC[CAM]R.2y4_1.heavy 544.252 / 599.261 6212.0 19.599300384521484 50 20 10 10 10 4.881672771664117 20.484781483194524 0.0 3 0.993499461857391 15.298616960466148 6212.0 26.210970464135023 0.0 - - - - - - - 194.05263157894737 12 19 LOC100289200;LOC100292387;HMCN2 hemicentin-2-like;hemicentin-2-like;hemicentin 2 691 88 B20140407_SF104_02 B20140407_SF104_02 TB389800.[MT7]-DAGTYTC[CAM]R.2y5_1.heavy 544.252 / 700.308 5633.0 19.599300384521484 50 20 10 10 10 4.881672771664117 20.484781483194524 0.0 3 0.993499461857391 15.298616960466148 5633.0 15.941194018802278 0.0 - - - - - - - 232.1764705882353 11 17 LOC100289200;LOC100292387;HMCN2 hemicentin-2-like;hemicentin-2-like;hemicentin 2 693 88 B20140407_SF104_02 B20140407_SF104_02 TB389800.[MT7]-DAGTYTC[CAM]R.2y6_1.heavy 544.252 / 757.33 11687.0 19.599300384521484 50 20 10 10 10 4.881672771664117 20.484781483194524 0.0 3 0.993499461857391 15.298616960466148 11687.0 60.45874157928772 0.0 - - - - - - - 207.52941176470588 23 17 LOC100289200;LOC100292387;HMCN2 hemicentin-2-like;hemicentin-2-like;hemicentin 2 695 88 B20140407_SF104_02 B20140407_SF104_02 TB389800.[MT7]-DAGTYTC[CAM]R.2y7_1.heavy 544.252 / 828.367 33796.0 19.599300384521484 50 20 10 10 10 4.881672771664117 20.484781483194524 0.0 3 0.993499461857391 15.298616960466148 33796.0 118.42236383180119 0.0 - - - - - - - 258.75 67 12 LOC100289200;LOC100292387;HMCN2 hemicentin-2-like;hemicentin-2-like;hemicentin 2 697 89 B20140407_SF104_02 B20140407_SF104_02 TB151008.[MT7]-LLPYVLEK[MT7].2b4_1.heavy 631.902 / 631.394 N/A 35.30039978027344 46 16 10 10 10 3.0981708546539775 32.27710952408679 0.0 3 0.9675885183574178 6.83648529100398 141203.0 6.116065687377666 0.0 - - - - - - - 16735.0 282 1 INHBB inhibin, beta B 699 89 B20140407_SF104_02 B20140407_SF104_02 TB151008.[MT7]-LLPYVLEK[MT7].2y3_1.heavy 631.902 / 533.341 25364.0 35.30039978027344 46 16 10 10 10 3.0981708546539775 32.27710952408679 0.0 3 0.9675885183574178 6.83648529100398 25364.0 18.74549992077422 1.0 - - - - - - - 1274.625 50 8 INHBB inhibin, beta B 701 89 B20140407_SF104_02 B20140407_SF104_02 TB151008.[MT7]-LLPYVLEK[MT7].2y6_1.heavy 631.902 / 892.526 103418.0 35.30039978027344 46 16 10 10 10 3.0981708546539775 32.27710952408679 0.0 3 0.9675885183574178 6.83648529100398 103418.0 157.13611642909166 0.0 - - - - - - - 261.0 206 1 INHBB inhibin, beta B 703 89 B20140407_SF104_02 B20140407_SF104_02 TB151008.[MT7]-LLPYVLEK[MT7].2y7_1.heavy 631.902 / 1005.61 18435.0 35.30039978027344 46 16 10 10 10 3.0981708546539775 32.27710952408679 0.0 3 0.9675885183574178 6.83648529100398 18435.0 35.80640166218597 0.0 - - - - - - - 653.6666666666666 36 9 INHBB inhibin, beta B 705 90 B20140407_SF104_02 B20140407_SF104_02 TB151005.[MT7]-GFLEC[CAM]GIC[CAM]R.2y8_1.heavy 628.306 / 1054.48 5508.0 30.31220054626465 44 14 10 10 10 2.452413469961381 40.776158353743966 0.0 3 0.9385444421427244 4.952587349101644 5508.0 41.55945601652608 0.0 - - - - - - - 267.5 11 10 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 707 90 B20140407_SF104_02 B20140407_SF104_02 TB151005.[MT7]-GFLEC[CAM]GIC[CAM]R.2y5_1.heavy 628.306 / 665.286 13690.0 30.31220054626465 44 14 10 10 10 2.452413469961381 40.776158353743966 0.0 3 0.9385444421427244 4.952587349101644 13690.0 18.990405926051245 0.0 - - - - - - - 1239.375 27 8 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 709 90 B20140407_SF104_02 B20140407_SF104_02 TB151005.[MT7]-GFLEC[CAM]GIC[CAM]R.2y6_1.heavy 628.306 / 794.328 16523.0 30.31220054626465 44 14 10 10 10 2.452413469961381 40.776158353743966 0.0 3 0.9385444421427244 4.952587349101644 16523.0 21.67912825874794 0.0 - - - - - - - 262.3333333333333 33 3 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 711 90 B20140407_SF104_02 B20140407_SF104_02 TB151005.[MT7]-GFLEC[CAM]GIC[CAM]R.2y7_1.heavy 628.306 / 907.412 7239.0 30.31220054626465 44 14 10 10 10 2.452413469961381 40.776158353743966 0.0 3 0.9385444421427244 4.952587349101644 7239.0 31.213944273007804 0.0 - - - - - - - 292.2857142857143 14 7 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 713 91 B20140407_SF104_02 B20140407_SF104_02 TB151000.[MT7]-APGFGDNRK[MT7].3y7_1.heavy 417.235 / 937.497 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 715 91 B20140407_SF104_02 B20140407_SF104_02 TB151000.[MT7]-APGFGDNRK[MT7].3y3_1.heavy 417.235 / 561.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 717 91 B20140407_SF104_02 B20140407_SF104_02 TB151000.[MT7]-APGFGDNRK[MT7].3b6_1.heavy 417.235 / 689.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 719 91 B20140407_SF104_02 B20140407_SF104_02 TB151000.[MT7]-APGFGDNRK[MT7].3y8_2.heavy 417.235 / 517.779 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 721 92 B20140407_SF104_02 B20140407_SF104_02 TB151274.[MT7]-GALLSMDALDLTDK[MT7].3y3_1.heavy 584.321 / 507.289 116289.0 36.255149841308594 40 14 10 6 10 1.5258486762341015 44.215658426774205 0.03910064697265625 3 0.9440952978472746 5.195099619726022 116289.0 48.778898731324546 0.0 - - - - - - - 772.5 232 2 PYCARD PYD and CARD domain containing 723 92 B20140407_SF104_02 B20140407_SF104_02 TB151274.[MT7]-GALLSMDALDLTDK[MT7].3b5_1.heavy 584.321 / 586.368 47906.0 36.255149841308594 40 14 10 6 10 1.5258486762341015 44.215658426774205 0.03910064697265625 3 0.9440952978472746 5.195099619726022 47906.0 34.94689097628132 0.0 - - - - - - - 1690.125 95 8 PYCARD PYD and CARD domain containing 725 92 B20140407_SF104_02 B20140407_SF104_02 TB151274.[MT7]-GALLSMDALDLTDK[MT7].3y5_1.heavy 584.321 / 735.401 73534.0 36.255149841308594 40 14 10 6 10 1.5258486762341015 44.215658426774205 0.03910064697265625 3 0.9440952978472746 5.195099619726022 73534.0 42.261540845118205 0.0 - - - - - - - 289.75 147 4 PYCARD PYD and CARD domain containing 727 92 B20140407_SF104_02 B20140407_SF104_02 TB151274.[MT7]-GALLSMDALDLTDK[MT7].3b7_1.heavy 584.321 / 832.435 58595.0 36.255149841308594 40 14 10 6 10 1.5258486762341015 44.215658426774205 0.03910064697265625 3 0.9440952978472746 5.195099619726022 58595.0 91.1964153076919 0.0 - - - - - - - 740.5 117 12 PYCARD PYD and CARD domain containing 729 93 B20140407_SF104_02 B20140407_SF104_02 TB151275.[MT7]-EQLSPTPVLLEINR.2b3_1.heavy 877.002 / 515.295 74025.0 34.595425605773926 36 10 10 6 10 0.8221078555501631 76.27764117313457 0.037899017333984375 3 0.8330423701289201 2.9773019389249247 74025.0 81.3914234224847 0.0 - - - - - - - 739.2857142857143 148 7 ASTN2 astrotactin 2 731 93 B20140407_SF104_02 B20140407_SF104_02 TB151275.[MT7]-EQLSPTPVLLEINR.2b4_1.heavy 877.002 / 602.327 108252.0 34.595425605773926 36 10 10 6 10 0.8221078555501631 76.27764117313457 0.037899017333984375 3 0.8330423701289201 2.9773019389249247 108252.0 104.88847951592405 0.0 - - - - - - - 133.0 216 2 ASTN2 astrotactin 2 733 93 B20140407_SF104_02 B20140407_SF104_02 TB151275.[MT7]-EQLSPTPVLLEINR.2y10_1.heavy 877.002 / 1151.68 82648.0 34.595425605773926 36 10 10 6 10 0.8221078555501631 76.27764117313457 0.037899017333984375 3 0.8330423701289201 2.9773019389249247 82648.0 408.47713822248784 0.0 - - - - - - - 298.25 165 4 ASTN2 astrotactin 2 735 93 B20140407_SF104_02 B20140407_SF104_02 TB151275.[MT7]-EQLSPTPVLLEINR.2y11_1.heavy 877.002 / 1238.71 42982.0 34.595425605773926 36 10 10 6 10 0.8221078555501631 76.27764117313457 0.037899017333984375 3 0.8330423701289201 2.9773019389249247 42982.0 165.0466188408104 0.0 - - - - - - - 238.9 85 10 ASTN2 astrotactin 2 737 94 B20140407_SF104_02 B20140407_SF104_02 TB390359.[MT7]-ARDAILDALENLTAEELK[MT7].4y5_1.heavy 569.07 / 733.421 70085.0 40.69419860839844 32 2 10 10 10 0.348332196314266 126.19969649945675 0.0 3 0.48104639135060717 1.6327534470273652 70085.0 147.01646804773554 0.0 - - - - - - - 187.3 140 10 PYCARD PYD and CARD domain containing 739 94 B20140407_SF104_02 B20140407_SF104_02 TB390359.[MT7]-ARDAILDALENLTAEELK[MT7].4b8_1.heavy 569.07 / 970.544 17391.0 40.69419860839844 32 2 10 10 10 0.348332196314266 126.19969649945675 0.0 3 0.48104639135060717 1.6327534470273652 17391.0 176.37684646153843 0.0 - - - - - - - 178.28571428571428 34 7 PYCARD PYD and CARD domain containing 741 94 B20140407_SF104_02 B20140407_SF104_02 TB390359.[MT7]-ARDAILDALENLTAEELK[MT7].4b7_1.heavy 569.07 / 899.507 21244.0 40.69419860839844 32 2 10 10 10 0.348332196314266 126.19969649945675 0.0 3 0.48104639135060717 1.6327534470273652 21244.0 257.37923076923073 0.0 - - - - - - - 197.8 42 10 PYCARD PYD and CARD domain containing 743 94 B20140407_SF104_02 B20140407_SF104_02 TB390359.[MT7]-ARDAILDALENLTAEELK[MT7].4b5_1.heavy 569.07 / 671.396 11559.0 40.69419860839844 32 2 10 10 10 0.348332196314266 126.19969649945675 0.0 3 0.48104639135060717 1.6327534470273652 11559.0 35.6649697874458 0.0 - - - - - - - 260.25 23 8 PYCARD PYD and CARD domain containing 745 95 B20140407_SF104_02 B20140407_SF104_02 TB151276.[MT7]-EQLSPTPVLLEINR.3y6_1.heavy 585.004 / 757.457 404865.0 34.60490036010742 48 18 10 10 10 4.525840378253113 18.822949811933707 0.0 3 0.9871311207773545 10.867387781433303 404865.0 386.74837449540627 0.0 - - - - - - - 333.0 809 2 ASTN2 astrotactin 2 747 95 B20140407_SF104_02 B20140407_SF104_02 TB151276.[MT7]-EQLSPTPVLLEINR.3b4_1.heavy 585.004 / 602.327 398471.0 34.60490036010742 48 18 10 10 10 4.525840378253113 18.822949811933707 0.0 3 0.9871311207773545 10.867387781433303 398471.0 273.4834063451533 0.0 - - - - - - - 666.0 796 2 ASTN2 astrotactin 2 749 95 B20140407_SF104_02 B20140407_SF104_02 TB151276.[MT7]-EQLSPTPVLLEINR.3b3_1.heavy 585.004 / 515.295 209294.0 34.60490036010742 48 18 10 10 10 4.525840378253113 18.822949811933707 0.0 3 0.9871311207773545 10.867387781433303 209294.0 130.12121017285654 0.0 - - - - - - - 666.0 418 1 ASTN2 astrotactin 2 751 95 B20140407_SF104_02 B20140407_SF104_02 TB151276.[MT7]-EQLSPTPVLLEINR.3y5_1.heavy 585.004 / 644.373 398604.0 34.60490036010742 48 18 10 10 10 4.525840378253113 18.822949811933707 0.0 3 0.9871311207773545 10.867387781433303 398604.0 196.85211999361167 0.0 - - - - - - - 666.0 797 1 ASTN2 astrotactin 2 753 96 B20140407_SF104_02 B20140407_SF104_02 TB151135.[MT7]-TAC[CAM]PLVDDNK[MT7].2y4_1.heavy 710.871 / 635.312 11389.0 24.468324661254883 44 18 10 6 10 3.5835738451005748 21.59816932551112 0.038299560546875 3 0.9885588014465816 11.526877198455237 11389.0 34.62604787927543 0.0 - - - - - - - 197.4 22 10 ASTN2 astrotactin 2 755 96 B20140407_SF104_02 B20140407_SF104_02 TB151135.[MT7]-TAC[CAM]PLVDDNK[MT7].2y5_1.heavy 710.871 / 734.38 5366.0 24.468324661254883 44 18 10 6 10 3.5835738451005748 21.59816932551112 0.038299560546875 3 0.9885588014465816 11.526877198455237 5366.0 34.204144564266976 0.0 - - - - - - - 178.375 10 8 ASTN2 astrotactin 2 757 96 B20140407_SF104_02 B20140407_SF104_02 TB151135.[MT7]-TAC[CAM]PLVDDNK[MT7].2y3_1.heavy 710.871 / 520.285 12813.0 24.468324661254883 44 18 10 6 10 3.5835738451005748 21.59816932551112 0.038299560546875 3 0.9885588014465816 11.526877198455237 12813.0 43.95700729927007 0.0 - - - - - - - 754.7777777777778 25 9 ASTN2 astrotactin 2 759 96 B20140407_SF104_02 B20140407_SF104_02 TB151135.[MT7]-TAC[CAM]PLVDDNK[MT7].2y7_1.heavy 710.871 / 944.517 27049.0 24.468324661254883 44 18 10 6 10 3.5835738451005748 21.59816932551112 0.038299560546875 3 0.9885588014465816 11.526877198455237 27049.0 52.99992593874934 0.0 - - - - - - - 239.0909090909091 54 11 ASTN2 astrotactin 2 761 97 B20140407_SF104_02 B20140407_SF104_02 TB151137.[MT7]-NLAVQAQK[MT7]K[MT7].3y6_1.heavy 477.972 / 989.635 N/A 21.229799270629883 40 20 0 10 10 18.794367099961057 5.32074314969655 0.0 2 0.995691190911189 18.79436597113468 83.0 0.45999999999999996 13.0 - - - - - - - 0.0 0 0 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 763 97 B20140407_SF104_02 B20140407_SF104_02 TB151137.[MT7]-NLAVQAQK[MT7]K[MT7].3y4_1.heavy 477.972 / 762.508 7763.0 21.229799270629883 40 20 0 10 10 18.794367099961057 5.32074314969655 0.0 2 0.995691190911189 18.79436597113468 7763.0 43.78923900293255 0.0 - - - - - - - 226.05263157894737 15 19 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 765 97 B20140407_SF104_02 B20140407_SF104_02 TB151137.[MT7]-NLAVQAQK[MT7]K[MT7].3y8_2.heavy 477.972 / 587.381 N/A 21.229799270629883 40 20 0 10 10 18.794367099961057 5.32074314969655 0.0 2 0.995691190911189 18.79436597113468 12223.0 5.64242023791591 1.0 - - - - - - - 757.0833333333334 165 12 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 767 97 B20140407_SF104_02 B20140407_SF104_02 TB151137.[MT7]-NLAVQAQK[MT7]K[MT7].3y5_1.heavy 477.972 / 890.566 3304.0 21.229799270629883 40 20 0 10 10 18.794367099961057 5.32074314969655 0.0 2 0.995691190911189 18.79436597113468 3304.0 19.927740051113545 0.0 - - - - - - - 130.91666666666666 6 12 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 769 98 B20140407_SF104_02 B20140407_SF104_02 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1587000.0 31.541099548339844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1587000.0 177.8959024907187 0.0 - - - - - - - 3237.5 3174 2 771 98 B20140407_SF104_02 B20140407_SF104_02 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 451359.0 31.541099548339844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 451359.0 136.90654209249192 0.0 - - - - - - - 474.0 902 1 773 98 B20140407_SF104_02 B20140407_SF104_02 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 611462.0 31.541099548339844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 611462.0 131.69467732979203 0.0 - - - - - - - 1737.0 1222 3 775 99 B20140407_SF104_02 B20140407_SF104_02 TB389905.[MT7]-LINDSTNK[MT7].2y4_1.heavy 596.842 / 593.338 15507.0 23.560675144195557 39 13 10 6 10 1.568302394222175 50.70462678517062 0.03529930114746094 3 0.9293517696757947 4.615524965450897 15507.0 12.612744618655327 0.0 - - - - - - - 1334.857142857143 31 7 PDILT protein disulfide isomerase-like, testis expressed 777 99 B20140407_SF104_02 B20140407_SF104_02 TB389905.[MT7]-LINDSTNK[MT7].2b4_1.heavy 596.842 / 600.347 15507.0 23.560675144195557 39 13 10 6 10 1.568302394222175 50.70462678517062 0.03529930114746094 3 0.9293517696757947 4.615524965450897 15507.0 17.32425812213911 0.0 - - - - - - - 770.25 31 8 PDILT protein disulfide isomerase-like, testis expressed 779 99 B20140407_SF104_02 B20140407_SF104_02 TB389905.[MT7]-LINDSTNK[MT7].2y6_1.heavy 596.842 / 822.407 10636.0 23.560675144195557 39 13 10 6 10 1.568302394222175 50.70462678517062 0.03529930114746094 3 0.9293517696757947 4.615524965450897 10636.0 17.349266942188688 0.0 - - - - - - - 1230.0 21 8 PDILT protein disulfide isomerase-like, testis expressed 781 99 B20140407_SF104_02 B20140407_SF104_02 TB389905.[MT7]-LINDSTNK[MT7].2y7_1.heavy 596.842 / 935.491 10139.0 23.560675144195557 39 13 10 6 10 1.568302394222175 50.70462678517062 0.03529930114746094 3 0.9293517696757947 4.615524965450897 10139.0 37.083464184711495 0.0 - - - - - - - 322.9166666666667 20 12 PDILT protein disulfide isomerase-like, testis expressed 783 100 B20140407_SF104_02 B20140407_SF104_02 TB150553.[MT7]-AALIAR.2y4_1.heavy 379.754 / 472.324 48882.0 24.14240074157715 45 15 10 10 10 1.9309866386785473 45.31369971641816 0.0 3 0.9579525516592262 5.997343590631762 48882.0 53.29547918363998 0.0 - - - - - - - 664.0 97 4 PYCARD PYD and CARD domain containing 785 100 B20140407_SF104_02 B20140407_SF104_02 TB150553.[MT7]-AALIAR.2b3_1.heavy 379.754 / 400.268 153661.0 24.14240074157715 45 15 10 10 10 1.9309866386785473 45.31369971641816 0.0 3 0.9579525516592262 5.997343590631762 153661.0 134.73274264114565 0.0 - - - - - - - 1260.0 307 7 PYCARD PYD and CARD domain containing 787 100 B20140407_SF104_02 B20140407_SF104_02 TB150553.[MT7]-AALIAR.2y5_1.heavy 379.754 / 543.361 228685.0 24.14240074157715 45 15 10 10 10 1.9309866386785473 45.31369971641816 0.0 3 0.9579525516592262 5.997343590631762 228685.0 111.00434583009196 0.0 - - - - - - - 106.0 457 1 PYCARD PYD and CARD domain containing 789 100 B20140407_SF104_02 B20140407_SF104_02 TB150553.[MT7]-AALIAR.2b4_1.heavy 379.754 / 513.352 102653.0 24.14240074157715 45 15 10 10 10 1.9309866386785473 45.31369971641816 0.0 3 0.9579525516592262 5.997343590631762 102653.0 61.57623813855146 0.0 - - - - - - - 319.0 205 2 PYCARD PYD and CARD domain containing 791 101 B20140407_SF104_02 B20140407_SF104_02 TB151263.[MT7]-LFPSGSQQAVLYK[MT7].3y3_1.heavy 575.997 / 567.362 135831.0 31.76460075378418 45 17 10 10 8 2.2129756840063286 36.30885503610552 0.0 4 0.9709343652334514 7.221291770411276 135831.0 43.02231291637568 0.0 - - - - - - - 2300.0 271 1 PDILT protein disulfide isomerase-like, testis expressed 793 101 B20140407_SF104_02 B20140407_SF104_02 TB151263.[MT7]-LFPSGSQQAVLYK[MT7].3b5_1.heavy 575.997 / 646.368 35108.0 31.76460075378418 45 17 10 10 8 2.2129756840063286 36.30885503610552 0.0 4 0.9709343652334514 7.221291770411276 35108.0 5.298835497728798 1.0 - - - - - - - 2255.8571428571427 124 7 PDILT protein disulfide isomerase-like, testis expressed 795 101 B20140407_SF104_02 B20140407_SF104_02 TB151263.[MT7]-LFPSGSQQAVLYK[MT7].3y4_1.heavy 575.997 / 666.431 65769.0 31.76460075378418 45 17 10 10 8 2.2129756840063286 36.30885503610552 0.0 4 0.9709343652334514 7.221291770411276 65769.0 68.80298987286862 0.0 - - - - - - - 766.5714285714286 131 7 PDILT protein disulfide isomerase-like, testis expressed 797 101 B20140407_SF104_02 B20140407_SF104_02 TB151263.[MT7]-LFPSGSQQAVLYK[MT7].3y5_1.heavy 575.997 / 737.468 34954.0 31.76460075378418 45 17 10 10 8 2.2129756840063286 36.30885503610552 0.0 4 0.9709343652334514 7.221291770411276 34954.0 31.768703995582023 0.0 - - - - - - - 732.4444444444445 69 9 PDILT protein disulfide isomerase-like, testis expressed 799 102 B20140407_SF104_02 B20140407_SF104_02 TB151264.[MT7]-MLFPLLEELGRK[MT7].3y6_1.heavy 578.679 / 875.507 4901.0 40.09320068359375 45 15 10 10 10 2.1873968060411344 45.716442359164475 0.0 3 0.954694163894036 5.7760617863158465 4901.0 81.43828333333335 0.0 - - - - - - - 155.7 9 10 PDILT protein disulfide isomerase-like, testis expressed 801 102 B20140407_SF104_02 B20140407_SF104_02 TB151264.[MT7]-MLFPLLEELGRK[MT7].3b3_1.heavy 578.679 / 536.302 14225.0 40.09320068359375 45 15 10 10 10 2.1873968060411344 45.716442359164475 0.0 3 0.954694163894036 5.7760617863158465 14225.0 67.004274425706 0.0 - - - - - - - 299.0 28 12 PDILT protein disulfide isomerase-like, testis expressed 803 102 B20140407_SF104_02 B20140407_SF104_02 TB151264.[MT7]-MLFPLLEELGRK[MT7].3y9_2.heavy 578.679 / 599.867 17572.0 40.09320068359375 45 15 10 10 10 2.1873968060411344 45.716442359164475 0.0 3 0.954694163894036 5.7760617863158465 17572.0 97.32086256839395 0.0 - - - - - - - 282.72727272727275 35 11 PDILT protein disulfide isomerase-like, testis expressed 805 102 B20140407_SF104_02 B20140407_SF104_02 TB151264.[MT7]-MLFPLLEELGRK[MT7].3y9_1.heavy 578.679 / 1198.73 N/A 40.09320068359375 45 15 10 10 10 2.1873968060411344 45.716442359164475 0.0 3 0.954694163894036 5.7760617863158465 0.0 0.0 12.0 - - - - - - - 0.0 0 0 PDILT protein disulfide isomerase-like, testis expressed 807 103 B20140407_SF104_02 B20140407_SF104_02 TB499403.[MT7]-DRVTDALNATR.3y6_1.heavy 459.252 / 645.368 56736.0 24.74799919128418 43 13 10 10 10 1.4116727631599661 56.3951867352329 0.0 3 0.9085165833216421 4.048771925169674 56736.0 12.586049730879127 0.0 - - - - - - - 430.0 113 1 HSPD1 heat shock 60kDa protein 1 (chaperonin) 809 103 B20140407_SF104_02 B20140407_SF104_02 TB499403.[MT7]-DRVTDALNATR.3b6_1.heavy 459.252 / 802.417 29335.0 24.74799919128418 43 13 10 10 10 1.4116727631599661 56.3951867352329 0.0 3 0.9085165833216421 4.048771925169674 29335.0 78.10611318770835 0.0 - - - - - - - 741.5 58 10 HSPD1 heat shock 60kDa protein 1 (chaperonin) 811 103 B20140407_SF104_02 B20140407_SF104_02 TB499403.[MT7]-DRVTDALNATR.3b5_1.heavy 459.252 / 731.38 32559.0 24.74799919128418 43 13 10 10 10 1.4116727631599661 56.3951867352329 0.0 3 0.9085165833216421 4.048771925169674 32559.0 37.26091563202073 0.0 - - - - - - - 354.5 65 10 HSPD1 heat shock 60kDa protein 1 (chaperonin) 813 103 B20140407_SF104_02 B20140407_SF104_02 TB499403.[MT7]-DRVTDALNATR.3y4_1.heavy 459.252 / 461.247 120993.0 24.74799919128418 43 13 10 10 10 1.4116727631599661 56.3951867352329 0.0 3 0.9085165833216421 4.048771925169674 120993.0 98.04763936528767 0.0 - - - - - - - 1581.0 241 7 HSPD1 heat shock 60kDa protein 1 (chaperonin) 815 104 B20140407_SF104_02 B20140407_SF104_02 TB499406.[MT7]-VDGDFLEAVK[MT7].3b6_1.heavy 460.925 / 791.406 33208.0 32.8468017578125 45 15 10 10 10 2.5952622633760045 38.531751265059675 0.0 3 0.9575576651172861 5.969179003786367 33208.0 103.71365517241378 0.0 - - - - - - - 265.8333333333333 66 6 INHBB inhibin, beta B 817 104 B20140407_SF104_02 B20140407_SF104_02 TB499406.[MT7]-VDGDFLEAVK[MT7].3b4_1.heavy 460.925 / 531.253 210411.0 32.8468017578125 45 15 10 10 10 2.5952622633760045 38.531751265059675 0.0 3 0.9575576651172861 5.969179003786367 210411.0 164.26948478701826 0.0 - - - - - - - 696.0 420 5 INHBB inhibin, beta B 819 104 B20140407_SF104_02 B20140407_SF104_02 TB499406.[MT7]-VDGDFLEAVK[MT7].3b5_1.heavy 460.925 / 678.321 170533.0 32.8468017578125 45 15 10 10 10 2.5952622633760045 38.531751265059675 0.0 3 0.9575576651172861 5.969179003786367 170533.0 84.57153793103448 0.0 - - - - - - - 725.0 341 5 INHBB inhibin, beta B 821 104 B20140407_SF104_02 B20140407_SF104_02 TB499406.[MT7]-VDGDFLEAVK[MT7].3y4_1.heavy 460.925 / 590.363 98028.0 32.8468017578125 45 15 10 10 10 2.5952622633760045 38.531751265059675 0.0 3 0.9575576651172861 5.969179003786367 98028.0 63.26178110944527 0.0 - - - - - - - 435.0 196 1 INHBB inhibin, beta B 823 105 B20140407_SF104_02 B20140407_SF104_02 TB499604.[MT7]-DRINLVLSR.2b4_1.heavy 615.376 / 643.364 2804.0 28.29210090637207 35 11 10 10 4 1.284537968376023 52.018584172705765 0.0 10 0.8753359711216091 3.4583842021277067 2804.0 3.96045197740113 8.0 - - - - - - - 1106.7 9 10 DHFRL1 dihydrofolate reductase-like 1 825 105 B20140407_SF104_02 B20140407_SF104_02 TB499604.[MT7]-DRINLVLSR.2y6_1.heavy 615.376 / 701.43 3984.0 28.29210090637207 35 11 10 10 4 1.284537968376023 52.018584172705765 0.0 10 0.8753359711216091 3.4583842021277067 3984.0 3.710990615224192 7.0 - - - - - - - 1180.4285714285713 11 7 DHFRL1 dihydrofolate reductase-like 1 827 105 B20140407_SF104_02 B20140407_SF104_02 TB499604.[MT7]-DRINLVLSR.2b5_1.heavy 615.376 / 756.448 3836.0 28.29210090637207 35 11 10 10 4 1.284537968376023 52.018584172705765 0.0 10 0.8753359711216091 3.4583842021277067 3836.0 3.3087060593093973 5.0 - - - - - - - 344.3333333333333 12 9 DHFRL1 dihydrofolate reductase-like 1 829 105 B20140407_SF104_02 B20140407_SF104_02 TB499604.[MT7]-DRINLVLSR.2y7_1.heavy 615.376 / 814.515 10181.0 28.29210090637207 35 11 10 10 4 1.284537968376023 52.018584172705765 0.0 10 0.8753359711216091 3.4583842021277067 10181.0 13.921871972509004 0.0 - - - - - - - 700.75 20 8 DHFRL1 dihydrofolate reductase-like 1 831 106 B20140407_SF104_02 B20140407_SF104_02 TB390362.[MT7]-DAVEQLLSC[CAM]FPNAFLASK[MT7].2b3_1.heavy 1149.61 / 430.242 1340.0 42.26312446594238 38 13 10 5 10 1.338789575473626 52.091609575629015 0.04470062255859375 3 0.9202906649673034 4.341900755328804 1340.0 17.368206916594016 1.0 - - - - - - - 168.53333333333333 2 15 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 833 106 B20140407_SF104_02 B20140407_SF104_02 TB390362.[MT7]-DAVEQLLSC[CAM]FPNAFLASK[MT7].2b5_1.heavy 1149.61 / 687.343 1266.0 42.26312446594238 38 13 10 5 10 1.338789575473626 52.091609575629015 0.04470062255859375 3 0.9202906649673034 4.341900755328804 1266.0 13.429864864864864 1.0 - - - - - - - 168.53333333333333 2 15 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 835 106 B20140407_SF104_02 B20140407_SF104_02 TB390362.[MT7]-DAVEQLLSC[CAM]FPNAFLASK[MT7].2b4_1.heavy 1149.61 / 559.284 893.0 42.26312446594238 38 13 10 5 10 1.338789575473626 52.091609575629015 0.04470062255859375 3 0.9202906649673034 4.341900755328804 893.0 7.551543624161074 1.0 - - - - - - - 0.0 1 0 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 837 106 B20140407_SF104_02 B20140407_SF104_02 TB390362.[MT7]-DAVEQLLSC[CAM]FPNAFLASK[MT7].2b6_1.heavy 1149.61 / 800.427 1564.0 42.26312446594238 38 13 10 5 10 1.338789575473626 52.091609575629015 0.04470062255859375 3 0.9202906649673034 4.341900755328804 1564.0 11.178926174496645 0.0 - - - - - - - 186.0 3 14 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 839 107 B20140407_SF104_02 B20140407_SF104_02 TB499606.[MT7]-ALNEITESGR.2y8_1.heavy 617.331 / 905.432 118602.0 26.228900909423828 50 20 10 10 10 6.768924478813227 14.773395731183083 0.0 3 0.9923126262137427 14.066782169362064 118602.0 145.68638343099244 0.0 - - - - - - - 255.125 237 8 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 841 107 B20140407_SF104_02 B20140407_SF104_02 TB499606.[MT7]-ALNEITESGR.2b4_1.heavy 617.331 / 572.316 103461.0 26.228900909423828 50 20 10 10 10 6.768924478813227 14.773395731183083 0.0 3 0.9923126262137427 14.066782169362064 103461.0 54.74953675480061 0.0 - - - - - - - 2403.0 206 1 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 843 107 B20140407_SF104_02 B20140407_SF104_02 TB499606.[MT7]-ALNEITESGR.2y9_1.heavy 617.331 / 1018.52 110070.0 26.228900909423828 50 20 10 10 10 6.768924478813227 14.773395731183083 0.0 3 0.9923126262137427 14.066782169362064 110070.0 256.3265105627835 0.0 - - - - - - - 312.3 220 10 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 845 107 B20140407_SF104_02 B20140407_SF104_02 TB499606.[MT7]-ALNEITESGR.2y6_1.heavy 617.331 / 662.347 83274.0 26.228900909423828 50 20 10 10 10 6.768924478813227 14.773395731183083 0.0 3 0.9923126262137427 14.066782169362064 83274.0 64.87901269999364 0.0 - - - - - - - 769.0 166 10 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 847 108 B20140407_SF104_02 B20140407_SF104_02 TB151168.[MT7]-RNLDESISTC[CAM]R.3y6_1.heavy 498.92 / 723.345 36763.0 22.632299423217773 47 17 10 10 10 13.353137499648488 7.488876678056556 0.0 3 0.9728013819859148 7.466200605648898 36763.0 37.75358227973241 0.0 - - - - - - - 835.3 73 10 KIF6 kinesin family member 6 849 108 B20140407_SF104_02 B20140407_SF104_02 TB151168.[MT7]-RNLDESISTC[CAM]R.3b4_1.heavy 498.92 / 643.364 25689.0 22.632299423217773 47 17 10 10 10 13.353137499648488 7.488876678056556 0.0 3 0.9728013819859148 7.466200605648898 25689.0 57.708021283267755 0.0 - - - - - - - 675.6666666666666 51 9 KIF6 kinesin family member 6 851 108 B20140407_SF104_02 B20140407_SF104_02 TB151168.[MT7]-RNLDESISTC[CAM]R.3y4_1.heavy 498.92 / 523.229 250897.0 22.632299423217773 47 17 10 10 10 13.353137499648488 7.488876678056556 0.0 3 0.9728013819859148 7.466200605648898 250897.0 288.95742979204886 0.0 - - - - - - - 272.0 501 1 KIF6 kinesin family member 6 853 108 B20140407_SF104_02 B20140407_SF104_02 TB151168.[MT7]-RNLDESISTC[CAM]R.3y5_1.heavy 498.92 / 636.313 41756.0 22.632299423217773 47 17 10 10 10 13.353137499648488 7.488876678056556 0.0 3 0.9728013819859148 7.466200605648898 41756.0 50.51284709160572 0.0 - - - - - - - 673.3333333333334 83 12 KIF6 kinesin family member 6 855 109 B20140407_SF104_02 B20140407_SF104_02 TB390365.[MT7]-NIFGEESNEFTNDWGEK[MT7].3b6_1.heavy 768.693 / 834.411 34979.0 34.40909957885742 48 18 10 10 10 4.0685838523796996 24.578576632139555 0.0 3 0.9827465983574613 9.382068458762728 34979.0 23.438847299470524 0.0 - - - - - - - 356.3333333333333 69 3 INPP1 inositol polyphosphate-1-phosphatase 857 109 B20140407_SF104_02 B20140407_SF104_02 TB390365.[MT7]-NIFGEESNEFTNDWGEK[MT7].3b5_1.heavy 768.693 / 705.369 45660.0 34.40909957885742 48 18 10 10 10 4.0685838523796996 24.578576632139555 0.0 3 0.9827465983574613 9.382068458762728 45660.0 27.296808739422463 0.0 - - - - - - - 2651.285714285714 91 7 INPP1 inositol polyphosphate-1-phosphatase 859 109 B20140407_SF104_02 B20140407_SF104_02 TB390365.[MT7]-NIFGEESNEFTNDWGEK[MT7].3b3_1.heavy 768.693 / 519.305 42990.0 34.40909957885742 48 18 10 10 10 4.0685838523796996 24.578576632139555 0.0 3 0.9827465983574613 9.382068458762728 42990.0 13.820239730700997 0.0 - - - - - - - 890.3333333333334 85 3 INPP1 inositol polyphosphate-1-phosphatase 861 109 B20140407_SF104_02 B20140407_SF104_02 TB390365.[MT7]-NIFGEESNEFTNDWGEK[MT7].3y4_1.heavy 768.693 / 663.358 72228.0 34.40909957885742 48 18 10 10 10 4.0685838523796996 24.578576632139555 0.0 3 0.9827465983574613 9.382068458762728 72228.0 41.81278213497358 0.0 - - - - - - - 801.0 144 1 INPP1 inositol polyphosphate-1-phosphatase 863 110 B20140407_SF104_02 B20140407_SF104_02 TB499603.[MT7]-FTLYAVDTR.2b3_1.heavy 615.336 / 506.31 125560.0 32.16360092163086 50 20 10 10 10 12.12906786752838 8.244656645686463 0.0 3 0.9902485276799428 12.48744888119446 125560.0 33.939305862130034 0.0 - - - - - - - 613.0 251 1 ASTN2 astrotactin 2 865 110 B20140407_SF104_02 B20140407_SF104_02 TB499603.[MT7]-FTLYAVDTR.2y8_1.heavy 615.336 / 938.494 126173.0 32.16360092163086 50 20 10 10 10 12.12906786752838 8.244656645686463 0.0 3 0.9902485276799428 12.48744888119446 126173.0 167.6012046122285 0.0 - - - - - - - 1743.875 252 8 ASTN2 astrotactin 2 867 110 B20140407_SF104_02 B20140407_SF104_02 TB499603.[MT7]-FTLYAVDTR.2b4_1.heavy 615.336 / 669.373 92752.0 32.16360092163086 50 20 10 10 10 12.12906786752838 8.244656645686463 0.0 3 0.9902485276799428 12.48744888119446 92752.0 79.99231946453388 0.0 - - - - - - - 792.3333333333334 185 6 ASTN2 astrotactin 2 869 110 B20140407_SF104_02 B20140407_SF104_02 TB499603.[MT7]-FTLYAVDTR.2y6_1.heavy 615.336 / 724.362 98117.0 32.16360092163086 50 20 10 10 10 12.12906786752838 8.244656645686463 0.0 3 0.9902485276799428 12.48744888119446 98117.0 66.44908513773828 0.0 - - - - - - - 383.5 196 2 ASTN2 astrotactin 2 871 111 B20140407_SF104_02 B20140407_SF104_02 TB390363.[MT7]-DAVEQLLSC[CAM]FPNAFLASK[MT7].3b6_1.heavy 766.74 / 800.427 61006.0 42.27429962158203 43 13 10 10 10 1.9864845908196733 41.14579926570625 0.0 3 0.9171357941977235 4.2572906307938645 61006.0 95.51503719379248 0.0 - - - - - - - 778.1111111111111 122 9 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 873 111 B20140407_SF104_02 B20140407_SF104_02 TB390363.[MT7]-DAVEQLLSC[CAM]FPNAFLASK[MT7].3b4_1.heavy 766.74 / 559.284 19507.0 42.27429962158203 43 13 10 10 10 1.9864845908196733 41.14579926570625 0.0 3 0.9171357941977235 4.2572906307938645 19507.0 45.196008076837195 0.0 - - - - - - - 764.8461538461538 39 13 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 875 111 B20140407_SF104_02 B20140407_SF104_02 TB390363.[MT7]-DAVEQLLSC[CAM]FPNAFLASK[MT7].3b5_1.heavy 766.74 / 687.343 59499.0 42.27429962158203 43 13 10 10 10 1.9864845908196733 41.14579926570625 0.0 3 0.9171357941977235 4.2572906307938645 59499.0 62.485618739667416 0.0 - - - - - - - 645.5714285714286 118 7 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 877 111 B20140407_SF104_02 B20140407_SF104_02 TB390363.[MT7]-DAVEQLLSC[CAM]FPNAFLASK[MT7].3y8_1.heavy 766.74 / 991.569 39465.0 42.27429962158203 43 13 10 10 10 1.9864845908196733 41.14579926570625 0.0 3 0.9171357941977235 4.2572906307938645 39465.0 112.358943331153 0.0 - - - - - - - 635.0 78 7 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 879 112 B20140407_SF104_02 B20140407_SF104_02 TB390163.[MT7]-SEMSLYAVLDLK[MT7].3b6_1.heavy 552.976 / 855.404 15356.0 38.124698638916016 44 14 10 10 10 1.9300239124751037 42.60184713912703 0.0 3 0.9319684771807673 4.70450389906271 15356.0 73.98437447618653 0.0 - - - - - - - 211.66666666666666 30 12 DNAJC5G DnaJ (Hsp40) homolog, subfamily C, member 5 gamma 881 112 B20140407_SF104_02 B20140407_SF104_02 TB390163.[MT7]-SEMSLYAVLDLK[MT7].3y3_1.heavy 552.976 / 519.326 39468.0 38.124698638916016 44 14 10 10 10 1.9300239124751037 42.60184713912703 0.0 3 0.9319684771807673 4.70450389906271 39468.0 52.25537644551584 0.0 - - - - - - - 1160.142857142857 78 7 DNAJC5G DnaJ (Hsp40) homolog, subfamily C, member 5 gamma 883 112 B20140407_SF104_02 B20140407_SF104_02 TB390163.[MT7]-SEMSLYAVLDLK[MT7].3b4_1.heavy 552.976 / 579.256 14594.0 38.124698638916016 44 14 10 10 10 1.9300239124751037 42.60184713912703 0.0 3 0.9319684771807673 4.70450389906271 14594.0 21.59168846015801 0.0 - - - - - - - 254.0 29 5 DNAJC5G DnaJ (Hsp40) homolog, subfamily C, member 5 gamma 885 112 B20140407_SF104_02 B20140407_SF104_02 TB390163.[MT7]-SEMSLYAVLDLK[MT7].3b5_1.heavy 552.976 / 692.341 26650.0 38.124698638916016 44 14 10 10 10 1.9300239124751037 42.60184713912703 0.0 3 0.9319684771807673 4.70450389906271 26650.0 62.50624336362508 0.0 - - - - - - - 228.6 53 10 DNAJC5G DnaJ (Hsp40) homolog, subfamily C, member 5 gamma 887 113 B20140407_SF104_02 B20140407_SF104_02 TB150663.[MT7]-RHILSR.2b3_1.heavy 463.294 / 551.353 2086.0 18.93160057067871 42 18 10 10 4 5.697518972096839 17.55149925603448 0.0 7 0.9848681199587623 10.019977775667314 2086.0 2.5713938411669366 4.0 - - - - - - - 279.0 9 9 INHBB inhibin, beta B 889 113 B20140407_SF104_02 B20140407_SF104_02 TB150663.[MT7]-RHILSR.2y4_1.heavy 463.294 / 488.319 2171.0 18.93160057067871 42 18 10 10 4 5.697518972096839 17.55149925603448 0.0 7 0.9848681199587623 10.019977775667314 2171.0 3.396444433100636 4.0 - - - - - - - 723.375 6 8 INHBB inhibin, beta B 891 113 B20140407_SF104_02 B20140407_SF104_02 TB150663.[MT7]-RHILSR.2y5_1.heavy 463.294 / 625.378 16345.0 18.93160057067871 42 18 10 10 4 5.697518972096839 17.55149925603448 0.0 7 0.9848681199587623 10.019977775667314 16345.0 110.03257088221233 0.0 - - - - - - - 220.875 32 16 INHBB inhibin, beta B 893 113 B20140407_SF104_02 B20140407_SF104_02 TB150663.[MT7]-RHILSR.2b4_1.heavy 463.294 / 664.438 1745.0 18.93160057067871 42 18 10 10 4 5.697518972096839 17.55149925603448 0.0 7 0.9848681199587623 10.019977775667314 1745.0 6.015795536178752 3.0 - - - - - - - 197.94117647058823 8 17 INHBB inhibin, beta B 895 114 B20140407_SF104_02 B20140407_SF104_02 TB499800.[MT7]-LITSFLEDQDSDSR.2y4_1.heavy 885.437 / 464.21 6082.0 35.86130142211914 45 15 10 10 10 1.8910221149825777 47.98041593724499 0.0 3 0.9532523251976592 5.685593661494402 6082.0 9.870778696174838 0.0 - - - - - - - 258.6666666666667 12 12 KIF6 kinesin family member 6 897 114 B20140407_SF104_02 B20140407_SF104_02 TB499800.[MT7]-LITSFLEDQDSDSR.2y6_1.heavy 885.437 / 707.295 5693.0 35.86130142211914 45 15 10 10 10 1.8910221149825777 47.98041593724499 0.0 3 0.9532523251976592 5.685593661494402 5693.0 22.302474226804122 0.0 - - - - - - - 318.38461538461536 11 13 KIF6 kinesin family member 6 899 114 B20140407_SF104_02 B20140407_SF104_02 TB499800.[MT7]-LITSFLEDQDSDSR.2y10_1.heavy 885.437 / 1211.52 3364.0 35.86130142211914 45 15 10 10 10 1.8910221149825777 47.98041593724499 0.0 3 0.9532523251976592 5.685593661494402 3364.0 15.586100386100387 0.0 - - - - - - - 201.11111111111111 6 9 KIF6 kinesin family member 6 901 114 B20140407_SF104_02 B20140407_SF104_02 TB499800.[MT7]-LITSFLEDQDSDSR.2y7_1.heavy 885.437 / 822.322 5435.0 35.86130142211914 45 15 10 10 10 1.8910221149825777 47.98041593724499 0.0 3 0.9532523251976592 5.685593661494402 5435.0 10.922566882837522 0.0 - - - - - - - 608.3 10 10 KIF6 kinesin family member 6 903 115 B20140407_SF104_02 B20140407_SF104_02 TB390267.[MT7]-VTNVEWLLDALYGK[MT7].2y9_1.heavy 955.037 / 1222.7 3888.0 42.71049880981445 48 18 10 10 10 4.243454308912652 23.56570678514602 0.0 3 0.9872576649106476 10.921332196153815 3888.0 30.19917525773196 0.0 - - - - - - - 145.91666666666666 7 12 PYCARD PYD and CARD domain containing 905 115 B20140407_SF104_02 B20140407_SF104_02 TB390267.[MT7]-VTNVEWLLDALYGK[MT7].2y3_1.heavy 955.037 / 511.3 9526.0 42.71049880981445 48 18 10 10 10 4.243454308912652 23.56570678514602 0.0 3 0.9872576649106476 10.921332196153815 9526.0 49.41110181610181 0.0 - - - - - - - 212.85714285714286 19 14 PYCARD PYD and CARD domain containing 907 115 B20140407_SF104_02 B20140407_SF104_02 TB390267.[MT7]-VTNVEWLLDALYGK[MT7].2b5_1.heavy 955.037 / 687.379 12313.0 42.71049880981445 48 18 10 10 10 4.243454308912652 23.56570678514602 0.0 3 0.9872576649106476 10.921332196153815 12313.0 16.105277299448666 1.0 - - - - - - - 254.64285714285714 29 14 PYCARD PYD and CARD domain containing 909 115 B20140407_SF104_02 B20140407_SF104_02 TB390267.[MT7]-VTNVEWLLDALYGK[MT7].2y7_1.heavy 955.037 / 923.532 6480.0 42.71049880981445 48 18 10 10 10 4.243454308912652 23.56570678514602 0.0 3 0.9872576649106476 10.921332196153815 6480.0 31.825192802056556 0.0 - - - - - - - 224.23076923076923 12 13 PYCARD PYD and CARD domain containing 911 116 B20140407_SF104_02 B20140407_SF104_02 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 963230.0 23.499000549316406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 963230.0 397.22931389032414 0.0 - - - - - - - 1156.5714285714287 1926 7 913 116 B20140407_SF104_02 B20140407_SF104_02 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 1711020.0 23.499000549316406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1711020.0 936.8335360262763 0.0 - - - - - - - 654.875 3422 8 915 116 B20140407_SF104_02 B20140407_SF104_02 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 5121560.0 23.499000549316406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 5121560.0 819.2912742007495 0.0 - - - - - - - 285.72222222222223 10243 18 917 117 B20140407_SF104_02 B20140407_SF104_02 TB499806.[MT7]-SIHVIQDLVNEEPR.3y6_1.heavy 598.327 / 743.368 116244.0 31.85140037536621 46 16 10 10 10 3.2985075270051407 24.864349326121015 0.0 3 0.9683922280750508 6.923326573626081 116244.0 62.650028818843246 0.0 - - - - - - - 2260.875 232 8 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 919 117 B20140407_SF104_02 B20140407_SF104_02 TB499806.[MT7]-SIHVIQDLVNEEPR.3b4_1.heavy 598.327 / 581.353 151164.0 31.85140037536621 46 16 10 10 10 3.2985075270051407 24.864349326121015 0.0 3 0.9683922280750508 6.923326573626081 151164.0 59.051321902882286 0.0 - - - - - - - 3303.285714285714 302 7 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 921 117 B20140407_SF104_02 B20140407_SF104_02 TB499806.[MT7]-SIHVIQDLVNEEPR.3y8_1.heavy 598.327 / 971.479 67796.0 31.85140037536621 46 16 10 10 10 3.2985075270051407 24.864349326121015 0.0 3 0.9683922280750508 6.923326573626081 67796.0 154.66972972972974 0.0 - - - - - - - 328.90909090909093 135 11 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 923 117 B20140407_SF104_02 B20140407_SF104_02 TB499806.[MT7]-SIHVIQDLVNEEPR.3y5_1.heavy 598.327 / 644.3 207949.0 31.85140037536621 46 16 10 10 10 3.2985075270051407 24.864349326121015 0.0 3 0.9683922280750508 6.923326573626081 207949.0 144.1753624394673 0.0 - - - - - - - 472.0 415 1 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 925 118 B20140407_SF104_02 B20140407_SF104_02 TB389619.[MT7]-GSADIK[MT7].2y5_1.heavy 439.763 / 677.395 17428.0 19.51650047302246 50 20 10 10 10 33.28389421436214 3.004456129921527 0.0 3 0.9997541921805075 78.71466040474259 17428.0 74.91981594912224 0.0 - - - - - - - 278.64285714285717 34 14 INPP1 inositol polyphosphate-1-phosphatase 927 118 B20140407_SF104_02 B20140407_SF104_02 TB389619.[MT7]-GSADIK[MT7].2b4_1.heavy 439.763 / 475.227 137361.0 19.51650047302246 50 20 10 10 10 33.28389421436214 3.004456129921527 0.0 3 0.9997541921805075 78.71466040474259 137361.0 81.82871298746599 0.0 - - - - - - - 860.0 274 1 INPP1 inositol polyphosphate-1-phosphatase 929 118 B20140407_SF104_02 B20140407_SF104_02 TB389619.[MT7]-GSADIK[MT7].2y3_1.heavy 439.763 / 519.326 11237.0 19.51650047302246 50 20 10 10 10 33.28389421436214 3.004456129921527 0.0 3 0.9997541921805075 78.71466040474259 11237.0 26.85042750263002 0.0 - - - - - - - 1269.5714285714287 22 7 INPP1 inositol polyphosphate-1-phosphatase 931 118 B20140407_SF104_02 B20140407_SF104_02 TB389619.[MT7]-GSADIK[MT7].2b5_1.heavy 439.763 / 588.311 11924.0 19.51650047302246 50 20 10 10 10 33.28389421436214 3.004456129921527 0.0 3 0.9997541921805075 78.71466040474259 11924.0 9.20669943372368 0.0 - - - - - - - 1187.5714285714287 23 7 INPP1 inositol polyphosphate-1-phosphatase 933 119 B20140407_SF104_02 B20140407_SF104_02 TB499418.[MT7]-LLDAVK[MT7].2y4_1.heavy 473.812 / 576.347 96914.0 29.268199920654297 46 20 8 10 8 37.907373482357436 2.6380092001504996 0.0 4 0.9949190028607156 17.30628437069362 96914.0 36.60368507614635 0.0 - - - - - - - 916.0 193 1 GMDS;RUNDC2A GDP-mannose 4,6-dehydratase;RUN domain containing 2A 935 119 B20140407_SF104_02 B20140407_SF104_02 TB499418.[MT7]-LLDAVK[MT7].2b3_1.heavy 473.812 / 486.304 127897.0 29.268199920654297 46 20 8 10 8 37.907373482357436 2.6380092001504996 0.0 4 0.9949190028607156 17.30628437069362 127897.0 66.85511412188167 1.0 - - - - - - - 763.0 357 1 GMDS;RUNDC2A GDP-mannose 4,6-dehydratase;RUN domain containing 2A 937 119 B20140407_SF104_02 B20140407_SF104_02 TB499418.[MT7]-LLDAVK[MT7].2y5_1.heavy 473.812 / 689.431 128812.0 29.268199920654297 46 20 8 10 8 37.907373482357436 2.6380092001504996 0.0 4 0.9949190028607156 17.30628437069362 128812.0 53.99801189025163 0.0 - - - - - - - 763.0 257 1 GMDS;RUNDC2A GDP-mannose 4,6-dehydratase;RUN domain containing 2A 939 119 B20140407_SF104_02 B20140407_SF104_02 TB499418.[MT7]-LLDAVK[MT7].2b4_1.heavy 473.812 / 557.341 36629.0 29.268199920654297 46 20 8 10 8 37.907373482357436 2.6380092001504996 0.0 4 0.9949190028607156 17.30628437069362 36629.0 15.18020011702562 0.0 - - - - - - - 916.0 73 1 GMDS;RUNDC2A GDP-mannose 4,6-dehydratase;RUN domain containing 2A 941 120 B20140407_SF104_02 B20140407_SF104_02 TB151157.[MT7]-C[CAM]HLEDNLYK[MT7].3y3_1.heavy 493.922 / 567.362 N/A 24.924832661946613 42 20 10 6 6 21.25304095955704 4.70520901880783 0.03890037536621094 5 0.9994903522473864 54.66493883967649 15850.0 11.366535819430814 2.0 - - - - - - - 641.6666666666666 31 3 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 943 120 B20140407_SF104_02 B20140407_SF104_02 TB151157.[MT7]-C[CAM]HLEDNLYK[MT7].3b6_1.heavy 493.922 / 913.395 6793.0 24.924832661946613 42 20 10 6 6 21.25304095955704 4.70520901880783 0.03890037536621094 5 0.9994903522473864 54.66493883967649 6793.0 85.06278761061947 0.0 - - - - - - - 260.3 13 10 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 945 120 B20140407_SF104_02 B20140407_SF104_02 TB151157.[MT7]-C[CAM]HLEDNLYK[MT7].3b4_1.heavy 493.922 / 684.326 4755.0 24.924832661946613 42 20 10 6 6 21.25304095955704 4.70520901880783 0.03890037536621094 5 0.9994903522473864 54.66493883967649 4755.0 3.314205924724413 2.0 - - - - - - - 453.0 11 1 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 947 120 B20140407_SF104_02 B20140407_SF104_02 TB151157.[MT7]-C[CAM]HLEDNLYK[MT7].3b5_1.heavy 493.922 / 799.352 7246.0 24.924832661946613 42 20 10 6 6 21.25304095955704 4.70520901880783 0.03890037536621094 5 0.9994903522473864 54.66493883967649 7246.0 19.194701986754964 1.0 - - - - - - - 319.09090909090907 14 11 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 949 121 B20140407_SF104_02 B20140407_SF104_02 TB499618.[MT7]-AAMVTALRK[MT7].3y6_1.heavy 416.928 / 831.553 3897.0 25.56410026550293 31 13 2 10 6 2.335384990462033 42.819492464159396 0.0 5 0.9064918404980574 4.003998298356459 3897.0 37.32004556673628 0.0 - - - - - - - 153.0 7 9 INHBB inhibin, beta B 951 121 B20140407_SF104_02 B20140407_SF104_02 TB499618.[MT7]-AAMVTALRK[MT7].3y7_2.heavy 416.928 / 481.801 22577.0 25.56410026550293 31 13 2 10 6 2.335384990462033 42.819492464159396 0.0 5 0.9064918404980574 4.003998298356459 22577.0 26.85353398627185 1.0 - - - - - - - 700.4444444444445 52 9 INHBB inhibin, beta B 953 121 B20140407_SF104_02 B20140407_SF104_02 TB499618.[MT7]-AAMVTALRK[MT7].3y4_1.heavy 416.928 / 631.437 7220.0 25.56410026550293 31 13 2 10 6 2.335384990462033 42.819492464159396 0.0 5 0.9064918404980574 4.003998298356459 7220.0 14.588635210874692 2.0 - - - - - - - 720.4285714285714 112 7 INHBB inhibin, beta B 955 121 B20140407_SF104_02 B20140407_SF104_02 TB499618.[MT7]-AAMVTALRK[MT7].3y5_1.heavy 416.928 / 732.485 22577.0 25.56410026550293 31 13 2 10 6 2.335384990462033 42.819492464159396 0.0 5 0.9064918404980574 4.003998298356459 22577.0 77.85819116425463 0.0 - - - - - - - 312.45454545454544 45 11 INHBB inhibin, beta B 957 122 B20140407_SF104_02 B20140407_SF104_02 TB151158.[MT7]-ELQQEFGITK[MT7].2b3_1.heavy 740.916 / 515.295 31956.0 30.21579933166504 48 20 10 10 8 8.529089326785728 11.724581156155624 0.0 4 0.9936832484589156 15.519817006270769 31956.0 71.35149206349206 0.0 - - - - - - - 708.7 63 10 PDILT protein disulfide isomerase-like, testis expressed 959 122 B20140407_SF104_02 B20140407_SF104_02 TB151158.[MT7]-ELQQEFGITK[MT7].2y5_1.heavy 740.916 / 709.437 22511.0 30.21579933166504 48 20 10 10 8 8.529089326785728 11.724581156155624 0.0 4 0.9936832484589156 15.519817006270769 22511.0 21.99945236276991 0.0 - - - - - - - 807.0 45 8 PDILT protein disulfide isomerase-like, testis expressed 961 122 B20140407_SF104_02 B20140407_SF104_02 TB151158.[MT7]-ELQQEFGITK[MT7].2b4_1.heavy 740.916 / 643.353 19205.0 30.21579933166504 48 20 10 10 8 8.529089326785728 11.724581156155624 0.0 4 0.9936832484589156 15.519817006270769 19205.0 25.19806682861794 1.0 - - - - - - - 445.8333333333333 43 6 PDILT protein disulfide isomerase-like, testis expressed 963 122 B20140407_SF104_02 B20140407_SF104_02 TB151158.[MT7]-ELQQEFGITK[MT7].2b5_1.heavy 740.916 / 772.396 16371.0 30.21579933166504 48 20 10 10 8 8.529089326785728 11.724581156155624 0.0 4 0.9936832484589156 15.519817006270769 16371.0 53.23250144024723 0.0 - - - - - - - 314.7 32 10 PDILT protein disulfide isomerase-like, testis expressed 965 123 B20140407_SF104_02 B20140407_SF104_02 TB390373.[MT7]-SIATTLIDDTSSEVLDELYR.3b6_1.heavy 795.743 / 731.442 184154.0 43.43130111694336 47 17 10 10 10 3.417346760899918 23.397827770620655 0.0 3 0.9799847173568385 8.708722577758465 184154.0 167.0845353927329 0.0 - - - - - - - 312.7142857142857 368 7 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 967 123 B20140407_SF104_02 B20140407_SF104_02 TB390373.[MT7]-SIATTLIDDTSSEVLDELYR.3y6_1.heavy 795.743 / 808.42 188302.0 43.43130111694336 47 17 10 10 10 3.417346760899918 23.397827770620655 0.0 3 0.9799847173568385 8.708722577758465 188302.0 300.56171634714735 1.0 - - - - - - - 312.57142857142856 379 7 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 969 123 B20140407_SF104_02 B20140407_SF104_02 TB390373.[MT7]-SIATTLIDDTSSEVLDELYR.3b5_1.heavy 795.743 / 618.358 143890.0 43.43130111694336 47 17 10 10 10 3.417346760899918 23.397827770620655 0.0 3 0.9799847173568385 8.708722577758465 143890.0 262.4715892247548 0.0 - - - - - - - 712.625 287 8 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 971 123 B20140407_SF104_02 B20140407_SF104_02 TB390373.[MT7]-SIATTLIDDTSSEVLDELYR.3y4_1.heavy 795.743 / 580.309 109905.0 43.43130111694336 47 17 10 10 10 3.417346760899918 23.397827770620655 0.0 3 0.9799847173568385 8.708722577758465 109905.0 271.5209861647362 0.0 - - - - - - - 180.125 219 8 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 973 124 B20140407_SF104_02 B20140407_SF104_02 TB151153.[MT7]-AWTDGFEDIK[MT7].2y8_1.heavy 735.379 / 1068.53 3910.0 32.701698303222656 42 12 10 10 10 1.5569366481778248 52.57196176935641 0.0 3 0.8825028040874255 3.564524196763612 3910.0 16.40893615332725 0.0 - - - - - - - 703.2857142857143 7 7 ESPNL espin-like 975 124 B20140407_SF104_02 B20140407_SF104_02 TB151153.[MT7]-AWTDGFEDIK[MT7].2b4_1.heavy 735.379 / 618.3 13611.0 32.701698303222656 42 12 10 10 10 1.5569366481778248 52.57196176935641 0.0 3 0.8825028040874255 3.564524196763612 13611.0 5.561555965031691 0.0 - - - - - - - 695.0 27 5 ESPNL espin-like 977 124 B20140407_SF104_02 B20140407_SF104_02 TB151153.[MT7]-AWTDGFEDIK[MT7].2y3_1.heavy 735.379 / 519.326 3475.0 32.701698303222656 42 12 10 10 10 1.5569366481778248 52.57196176935641 0.0 3 0.8825028040874255 3.564524196763612 3475.0 2.3532398958080245 6.0 - - - - - - - 1323.7142857142858 25 7 ESPNL espin-like 979 124 B20140407_SF104_02 B20140407_SF104_02 TB151153.[MT7]-AWTDGFEDIK[MT7].2y6_1.heavy 735.379 / 852.458 8398.0 32.701698303222656 42 12 10 10 10 1.5569366481778248 52.57196176935641 0.0 3 0.8825028040874255 3.564524196763612 8398.0 13.060731870255566 0.0 - - - - - - - 742.125 16 8 ESPNL espin-like 981 125 B20140407_SF104_02 B20140407_SF104_02 TB390376.[MT7]-RSGWHTFPLTEAIQALFER.4y5_1.heavy 601.573 / 635.351 29172.0 41.95392417907715 36 13 10 5 8 2.093159434465649 47.77466940807997 0.04109954833984375 4 0.9179853561919679 4.279596193297963 29172.0 23.20571592858763 1.0 - - - - - - - 422.0 58 2 INHBB inhibin, beta B 983 125 B20140407_SF104_02 B20140407_SF104_02 TB390376.[MT7]-RSGWHTFPLTEAIQALFER.4b7_1.heavy 601.573 / 1016.52 6070.0 41.95392417907715 36 13 10 5 8 2.093159434465649 47.77466940807997 0.04109954833984375 4 0.9179853561919679 4.279596193297963 6070.0 0.39875588132783796 3.0 - - - - - - - 196.66666666666666 12 3 INHBB inhibin, beta B 985 125 B20140407_SF104_02 B20140407_SF104_02 TB390376.[MT7]-RSGWHTFPLTEAIQALFER.4b4_1.heavy 601.573 / 631.343 1602.0 41.95392417907715 36 13 10 5 8 2.093159434465649 47.77466940807997 0.04109954833984375 4 0.9179853561919679 4.279596193297963 1602.0 1.4682041803951815 8.0 - - - - - - - 271.77777777777777 4 9 INHBB inhibin, beta B 987 125 B20140407_SF104_02 B20140407_SF104_02 TB390376.[MT7]-RSGWHTFPLTEAIQALFER.4y6_1.heavy 601.573 / 763.41 22005.0 41.95392417907715 36 13 10 5 8 2.093159434465649 47.77466940807997 0.04109954833984375 4 0.9179853561919679 4.279596193297963 22005.0 1.0570436851674825 3.0 - - - - - - - 337.0 47 1 INHBB inhibin, beta B 989 126 B20140407_SF104_02 B20140407_SF104_02 TB151156.[MT7]-GRPNITHAVPK[MT7].4b7_2.heavy 370.227 / 460.763 328511.0 21.3517328898112 40 14 10 6 10 3.1618795456559843 31.62675824807657 0.03700065612792969 3 0.93699068573942 4.8904947906703455 328511.0 460.1392499222152 0.0 - - - - - - - 254.0 657 2 INHBB inhibin, beta B 991 126 B20140407_SF104_02 B20140407_SF104_02 TB151156.[MT7]-GRPNITHAVPK[MT7].4b4_1.heavy 370.227 / 569.328 13723.0 21.3517328898112 40 14 10 6 10 3.1618795456559843 31.62675824807657 0.03700065612792969 3 0.93699068573942 4.8904947906703455 13723.0 12.14137255111073 0.0 - - - - - - - 282.3333333333333 27 6 INHBB inhibin, beta B 993 126 B20140407_SF104_02 B20140407_SF104_02 TB151156.[MT7]-GRPNITHAVPK[MT7].4b5_1.heavy 370.227 / 682.412 8641.0 21.3517328898112 40 14 10 6 10 3.1618795456559843 31.62675824807657 0.03700065612792969 3 0.93699068573942 4.8904947906703455 8641.0 32.11218177770357 0.0 - - - - - - - 247.08333333333334 17 12 INHBB inhibin, beta B 995 126 B20140407_SF104_02 B20140407_SF104_02 TB151156.[MT7]-GRPNITHAVPK[MT7].4b6_1.heavy 370.227 / 783.459 N/A 21.3517328898112 40 14 10 6 10 3.1618795456559843 31.62675824807657 0.03700065612792969 3 0.93699068573942 4.8904947906703455 169.0 0.0 3.0 - - - - - - - 0.0 0 0 INHBB inhibin, beta B 997 127 B20140407_SF104_02 B20140407_SF104_02 TB390174.[MT7]-GYISPYFINTSK[MT7].3b6_1.heavy 559.975 / 825.426 41992.0 32.514198303222656 48 18 10 10 10 3.359268667234357 23.78503688846722 0.0 3 0.9805358340543915 8.831561783759652 41992.0 26.587413660782808 0.0 - - - - - - - 241.33333333333334 83 3 HSPD1 heat shock 60kDa protein 1 (chaperonin) 999 127 B20140407_SF104_02 B20140407_SF104_02 TB390174.[MT7]-GYISPYFINTSK[MT7].3b4_1.heavy 559.975 / 565.31 42571.0 32.514198303222656 48 18 10 10 10 3.359268667234357 23.78503688846722 0.0 3 0.9805358340543915 8.831561783759652 42571.0 9.228680638247202 1.0 - - - - - - - 289.5 85 2 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1001 127 B20140407_SF104_02 B20140407_SF104_02 TB390174.[MT7]-GYISPYFINTSK[MT7].3y4_1.heavy 559.975 / 593.338 61395.0 32.514198303222656 48 18 10 10 10 3.359268667234357 23.78503688846722 0.0 3 0.9805358340543915 8.831561783759652 61395.0 52.29380177607142 0.0 - - - - - - - 1254.8333333333333 122 6 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1003 127 B20140407_SF104_02 B20140407_SF104_02 TB390174.[MT7]-GYISPYFINTSK[MT7].3b7_1.heavy 559.975 / 972.495 10425.0 32.514198303222656 48 18 10 10 10 3.359268667234357 23.78503688846722 0.0 3 0.9805358340543915 8.831561783759652 10425.0 22.801728506949207 0.0 - - - - - - - 250.27272727272728 20 11 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1005 128 B20140407_SF104_02 B20140407_SF104_02 TB151151.[MT7]-VLTDEQYQAVR.2b4_1.heavy 733.392 / 573.336 84495.0 26.99959945678711 43 13 10 10 10 0.8994042127942169 67.83047988062665 0.0 3 0.9052265024649028 3.9767450175996983 84495.0 143.20044466491282 0.0 - - - - - - - 250.66666666666666 168 6 PYCARD PYD and CARD domain containing 1007 128 B20140407_SF104_02 B20140407_SF104_02 TB151151.[MT7]-VLTDEQYQAVR.2y9_1.heavy 733.392 / 1109.52 62072.0 26.99959945678711 43 13 10 10 10 0.8994042127942169 67.83047988062665 0.0 3 0.9052265024649028 3.9767450175996983 62072.0 531.4375051708722 0.0 - - - - - - - 227.83333333333334 124 6 PYCARD PYD and CARD domain containing 1009 128 B20140407_SF104_02 B20140407_SF104_02 TB151151.[MT7]-VLTDEQYQAVR.2y10_1.heavy 733.392 / 1222.61 80257.0 26.99959945678711 43 13 10 10 10 0.8994042127942169 67.83047988062665 0.0 3 0.9052265024649028 3.9767450175996983 80257.0 734.6866090439736 0.0 - - - - - - - 253.85714285714286 160 7 PYCARD PYD and CARD domain containing 1011 128 B20140407_SF104_02 B20140407_SF104_02 TB151151.[MT7]-VLTDEQYQAVR.2y7_1.heavy 733.392 / 893.448 65080.0 26.99959945678711 43 13 10 10 10 0.8994042127942169 67.83047988062665 0.0 3 0.9052265024649028 3.9767450175996983 65080.0 87.58232927735625 0.0 - - - - - - - 364.3333333333333 130 3 PYCARD PYD and CARD domain containing 1013 129 B20140407_SF104_02 B20140407_SF104_02 TB390179.[MT7]-GVVESAALVVWLRR.3b6_1.heavy 567.009 / 687.379 23001.0 36.55720138549805 47 17 10 10 10 2.8063590939693355 27.58847153310612 0.0 3 0.9727333031906267 7.456831338832957 23001.0 26.148399380134652 0.0 - - - - - - - 765.5555555555555 46 9 PDILT protein disulfide isomerase-like, testis expressed 1015 129 B20140407_SF104_02 B20140407_SF104_02 TB390179.[MT7]-GVVESAALVVWLRR.3b4_1.heavy 567.009 / 529.31 14035.0 36.55720138549805 47 17 10 10 10 2.8063590939693355 27.58847153310612 0.0 3 0.9727333031906267 7.456831338832957 14035.0 16.330775989852853 0.0 - - - - - - - 325.0 28 2 PDILT protein disulfide isomerase-like, testis expressed 1017 129 B20140407_SF104_02 B20140407_SF104_02 TB390179.[MT7]-GVVESAALVVWLRR.3b5_1.heavy 567.009 / 616.342 10266.0 36.55720138549805 47 17 10 10 10 2.8063590939693355 27.58847153310612 0.0 3 0.9727333031906267 7.456831338832957 10266.0 14.74429999506587 3.0 - - - - - - - 722.2222222222222 31 9 PDILT protein disulfide isomerase-like, testis expressed 1019 129 B20140407_SF104_02 B20140407_SF104_02 TB390179.[MT7]-GVVESAALVVWLRR.3b7_1.heavy 567.009 / 758.417 44963.0 36.55720138549805 47 17 10 10 10 2.8063590939693355 27.58847153310612 0.0 3 0.9727333031906267 7.456831338832957 44963.0 83.53698511858512 0.0 - - - - - - - 682.5 89 8 PDILT protein disulfide isomerase-like, testis expressed 1021 130 B20140407_SF104_02 B20140407_SF104_02 TB150905.[MT7]-NLAVQAQK[MT7].3y3_1.heavy 387.239 / 490.311 405899.0 22.591400146484375 50 20 10 10 10 7.656307605202096 13.0611262186037 0.0 3 0.9956828165159772 18.776115511472195 405899.0 412.4274830099856 0.0 - - - - - - - 363.5 811 2 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1023 130 B20140407_SF104_02 B20140407_SF104_02 TB150905.[MT7]-NLAVQAQK[MT7].3b4_1.heavy 387.239 / 542.342 299609.0 22.591400146484375 50 20 10 10 10 7.656307605202096 13.0611262186037 0.0 3 0.9956828165159772 18.776115511472195 299609.0 267.34586859305125 0.0 - - - - - - - 908.0 599 1 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1025 130 B20140407_SF104_02 B20140407_SF104_02 TB150905.[MT7]-NLAVQAQK[MT7].3b5_1.heavy 387.239 / 670.4 46240.0 22.591400146484375 50 20 10 10 10 7.656307605202096 13.0611262186037 0.0 3 0.9956828165159772 18.776115511472195 46240.0 74.6569585213748 0.0 - - - - - - - 760.75 92 8 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1027 130 B20140407_SF104_02 B20140407_SF104_02 TB150905.[MT7]-NLAVQAQK[MT7].3b3_1.heavy 387.239 / 443.273 759229.0 22.591400146484375 50 20 10 10 10 7.656307605202096 13.0611262186037 0.0 3 0.9956828165159772 18.776115511472195 759229.0 317.1628210561151 0.0 - - - - - - - 908.0 1518 1 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1029 131 B20140407_SF104_02 B20140407_SF104_02 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 917413.0 29.773799896240234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 917413.0 813.5250562952983 0.0 - - - - - - - 1373.0 1834 3 1031 131 B20140407_SF104_02 B20140407_SF104_02 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 1081750.0 29.773799896240234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1081750.0 913.3695790345146 0.0 - - - - - - - 1906.75 2163 4 1033 131 B20140407_SF104_02 B20140407_SF104_02 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1720420.0 29.773799896240234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1720420.0 480.04228464419475 0.0 - - - - - - - 1602.0 3440 2 1035 132 B20140407_SF104_02 B20140407_SF104_02 TB389818.[MT7]-VDITIEK[MT7].2y4_1.heavy 553.339 / 634.389 49665.0 28.334800720214844 38 18 4 10 6 4.717134992679785 21.199308511455257 0.0 5 0.9849775520666222 10.056499397502861 49665.0 42.79750922509225 0.0 - - - - - - - 452.0 99 1 PDILT protein disulfide isomerase-like, testis expressed 1037 132 B20140407_SF104_02 B20140407_SF104_02 TB389818.[MT7]-VDITIEK[MT7].2y5_1.heavy 553.339 / 747.473 25736.0 28.334800720214844 38 18 4 10 6 4.717134992679785 21.199308511455257 0.0 5 0.9849775520666222 10.056499397502861 25736.0 18.48552749547429 2.0 - - - - - - - 376.5 171 2 PDILT protein disulfide isomerase-like, testis expressed 1039 132 B20140407_SF104_02 B20140407_SF104_02 TB389818.[MT7]-VDITIEK[MT7].2y3_1.heavy 553.339 / 533.341 18211.0 28.334800720214844 38 18 4 10 6 4.717134992679785 21.199308511455257 0.0 5 0.9849775520666222 10.056499397502861 18211.0 12.87340900701366 1.0 - - - - - - - 3217.125 36 8 PDILT protein disulfide isomerase-like, testis expressed 1041 132 B20140407_SF104_02 B20140407_SF104_02 TB389818.[MT7]-VDITIEK[MT7].2y6_1.heavy 553.339 / 862.5 34164.0 28.334800720214844 38 18 4 10 6 4.717134992679785 21.199308511455257 0.0 5 0.9849775520666222 10.056499397502861 34164.0 30.08694826767917 1.0 - - - - - - - 1225.857142857143 75 7 PDILT protein disulfide isomerase-like, testis expressed 1043 133 B20140407_SF104_02 B20140407_SF104_02 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 1089230.0 26.101999282836914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1089230.0 887.2390977756778 0.0 - - - - - - - 6139.0 2178 2 1045 133 B20140407_SF104_02 B20140407_SF104_02 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 1372930.0 26.101999282836914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1372930.0 857.4046675393729 0.0 - - - - - - - 7260.5 2745 2 1047 133 B20140407_SF104_02 B20140407_SF104_02 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 1692880.0 26.101999282836914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1692880.0 1240.1758402966575 0.0 - - - - - - - 9326.0 3385 1 1049 134 B20140407_SF104_02 B20140407_SF104_02 TB390055.[MT7]-EVATDVFNSK[MT7].2y4_1.heavy 699.379 / 639.358 N/A 28.206600189208984 47 17 10 10 10 3.202495664025154 31.225647273574126 0.0 3 0.9762363990848841 7.989920160496297 22315.0 11.534363536582157 0.0 - - - - - - - 292.0 44 5 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1051 134 B20140407_SF104_02 B20140407_SF104_02 TB390055.[MT7]-EVATDVFNSK[MT7].2y8_1.heavy 699.379 / 1025.54 21586.0 28.206600189208984 47 17 10 10 10 3.202495664025154 31.225647273574126 0.0 3 0.9762363990848841 7.989920160496297 21586.0 41.94257514403292 0.0 - - - - - - - 238.9090909090909 43 11 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1053 134 B20140407_SF104_02 B20140407_SF104_02 TB390055.[MT7]-EVATDVFNSK[MT7].2y5_1.heavy 699.379 / 738.427 23336.0 28.206600189208984 47 17 10 10 10 3.202495664025154 31.225647273574126 0.0 3 0.9762363990848841 7.989920160496297 23336.0 74.64478645331579 0.0 - - - - - - - 645.5714285714286 46 7 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1055 134 B20140407_SF104_02 B20140407_SF104_02 TB390055.[MT7]-EVATDVFNSK[MT7].2b5_1.heavy 699.379 / 660.332 25086.0 28.206600189208984 47 17 10 10 10 3.202495664025154 31.225647273574126 0.0 3 0.9762363990848841 7.989920160496297 25086.0 32.82399764965112 0.0 - - - - - - - 802.0 50 8 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1057 135 B20140407_SF104_02 B20140407_SF104_02 TB389634.[MT7]-LAILYR.2b3_1.heavy 446.79 / 442.315 86756.0 32.335899353027344 48 18 10 10 10 1.4156774841978952 42.63031142192813 0.0 3 0.9803633645139985 8.792564940309955 86756.0 54.61469305151359 0.0 - - - - - - - 734.0 173 1 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1059 135 B20140407_SF104_02 B20140407_SF104_02 TB389634.[MT7]-LAILYR.2y4_1.heavy 446.79 / 564.35 60773.0 32.335899353027344 48 18 10 10 10 1.4156774841978952 42.63031142192813 0.0 3 0.9803633645139985 8.792564940309955 60773.0 51.94089257909136 0.0 - - - - - - - 734.0 121 7 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1061 135 B20140407_SF104_02 B20140407_SF104_02 TB389634.[MT7]-LAILYR.2y5_1.heavy 446.79 / 635.388 287864.0 32.335899353027344 48 18 10 10 10 1.4156774841978952 42.63031142192813 0.0 3 0.9803633645139985 8.792564940309955 287864.0 435.32566757493186 0.0 - - - - - - - 367.0 575 2 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1063 135 B20140407_SF104_02 B20140407_SF104_02 TB389634.[MT7]-LAILYR.2b4_1.heavy 446.79 / 555.399 102756.0 32.335899353027344 48 18 10 10 10 1.4156774841978952 42.63031142192813 0.0 3 0.9803633645139985 8.792564940309955 102756.0 76.16746458484026 0.0 - - - - - - - 770.75 205 4 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1065 136 B20140407_SF104_02 B20140407_SF104_02 TB499633.[MT7]-LLLMGTPILR.2y8_1.heavy 635.906 / 900.534 27474.0 38.43840026855469 43 13 10 10 10 1.0520277902532844 58.64090080448162 0.0 3 0.9221857509222348 4.395168737373761 27474.0 75.68030730525768 0.0 - - - - - - - 722.0 54 7 ESPNL espin-like 1067 136 B20140407_SF104_02 B20140407_SF104_02 TB499633.[MT7]-LLLMGTPILR.2y9_1.heavy 635.906 / 1013.62 31361.0 38.43840026855469 43 13 10 10 10 1.0520277902532844 58.64090080448162 0.0 3 0.9221857509222348 4.395168737373761 31361.0 136.92714806800925 0.0 - - - - - - - 224.0 62 11 ESPNL espin-like 1069 136 B20140407_SF104_02 B20140407_SF104_02 TB499633.[MT7]-LLLMGTPILR.2y6_1.heavy 635.906 / 656.409 45616.0 38.43840026855469 43 13 10 10 10 1.0520277902532844 58.64090080448162 0.0 3 0.9221857509222348 4.395168737373761 45616.0 52.872618698222716 0.0 - - - - - - - 691.1111111111111 91 9 ESPNL espin-like 1071 136 B20140407_SF104_02 B20140407_SF104_02 TB499633.[MT7]-LLLMGTPILR.2y7_1.heavy 635.906 / 787.45 41858.0 38.43840026855469 43 13 10 10 10 1.0520277902532844 58.64090080448162 0.0 3 0.9221857509222348 4.395168737373761 41858.0 98.74992919583423 0.0 - - - - - - - 647.875 83 8 ESPNL espin-like 1073 137 B20140407_SF104_02 B20140407_SF104_02 TB150804.[MT7]-DC[CAM]AQYLR.2y5_1.heavy 535.264 / 650.362 50549.0 22.427799224853516 25 2 9 10 4 0.47249759383369466 108.21447496160157 0.0 7 0.4800889300798055 1.6310874925344212 50549.0 25.65198772966565 3.0 - - - - - - - 1243.6666666666667 119 12 ESPNL espin-like 1075 137 B20140407_SF104_02 B20140407_SF104_02 TB150804.[MT7]-DC[CAM]AQYLR.2b4_1.heavy 535.264 / 619.263 1030.0 22.427799224853516 25 2 9 10 4 0.47249759383369466 108.21447496160157 0.0 7 0.4800889300798055 1.6310874925344212 1030.0 1.7306410903584046 24.0 - - - - - - - 691.5714285714286 19 7 ESPNL espin-like 1077 137 B20140407_SF104_02 B20140407_SF104_02 TB150804.[MT7]-DC[CAM]AQYLR.2y6_1.heavy 535.264 / 810.393 3912.0 22.427799224853516 25 2 9 10 4 0.47249759383369466 108.21447496160157 0.0 7 0.4800889300798055 1.6310874925344212 3912.0 0.8270760008325815 1.0 - - - - - - - 676.8571428571429 34 7 ESPNL espin-like 1079 137 B20140407_SF104_02 B20140407_SF104_02 TB150804.[MT7]-DC[CAM]AQYLR.2b5_1.heavy 535.264 / 782.326 4530.0 22.427799224853516 25 2 9 10 4 0.47249759383369466 108.21447496160157 0.0 7 0.4800889300798055 1.6310874925344212 4530.0 11.141747572815534 1.0 - - - - - - - 709.5555555555555 12 9 ESPNL espin-like 1081 138 B20140407_SF104_02 B20140407_SF104_02 TB150932.[MT7]-EIVQYLK[MT7].3y3_1.heavy 394.244 / 567.362 139618.0 30.55299949645996 50 20 10 10 10 5.1858644332318935 19.28318822975455 0.0 3 0.9901406768570332 12.418849147773898 139618.0 497.76146671094136 0.0 - - - - - - - 264.0 279 3 GCNT2;GCNT6 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group);glucosaminyl (N-acetyl) transferase 6 1083 138 B20140407_SF104_02 B20140407_SF104_02 TB150932.[MT7]-EIVQYLK[MT7].3b4_1.heavy 394.244 / 614.363 141834.0 30.55299949645996 50 20 10 10 10 5.1858644332318935 19.28318822975455 0.0 3 0.9901406768570332 12.418849147773898 141834.0 242.50956522357467 0.0 - - - - - - - 339.2857142857143 283 7 GCNT2;GCNT6 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group);glucosaminyl (N-acetyl) transferase 6 1085 138 B20140407_SF104_02 B20140407_SF104_02 TB150932.[MT7]-EIVQYLK[MT7].3b5_1.heavy 394.244 / 777.426 5224.0 30.55299949645996 50 20 10 10 10 5.1858644332318935 19.28318822975455 0.0 3 0.9901406768570332 12.418849147773898 5224.0 38.635029349518824 0.0 - - - - - - - 180.71428571428572 10 7 GCNT2;GCNT6 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group);glucosaminyl (N-acetyl) transferase 6 1087 138 B20140407_SF104_02 B20140407_SF104_02 TB150932.[MT7]-EIVQYLK[MT7].3b3_1.heavy 394.244 / 486.304 198187.0 30.55299949645996 50 20 10 10 10 5.1858644332318935 19.28318822975455 0.0 3 0.9901406768570332 12.418849147773898 198187.0 614.3225453734713 0.0 - - - - - - - 263.8333333333333 396 6 GCNT2;GCNT6 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group);glucosaminyl (N-acetyl) transferase 6 1089 139 B20140407_SF104_02 B20140407_SF104_02 TB390442.[MT7]-EVAQPVPLLMTPPPPPFPPPPLLATR.3b6_1.heavy 972.89 / 768.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - ESPNL espin-like 1091 139 B20140407_SF104_02 B20140407_SF104_02 TB390442.[MT7]-EVAQPVPLLMTPPPPPFPPPPLLATR.3y11_1.heavy 972.89 / 1205.7 N/A N/A - - - - - - - - - 0.0 - - - - - - - ESPNL espin-like 1093 139 B20140407_SF104_02 B20140407_SF104_02 TB390442.[MT7]-EVAQPVPLLMTPPPPPFPPPPLLATR.3b4_1.heavy 972.89 / 572.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - ESPNL espin-like 1095 139 B20140407_SF104_02 B20140407_SF104_02 TB390442.[MT7]-EVAQPVPLLMTPPPPPFPPPPLLATR.3y9_1.heavy 972.89 / 961.583 N/A N/A - - - - - - - - - 0.0 - - - - - - - ESPNL espin-like 1097 140 B20140407_SF104_02 B20140407_SF104_02 TB390303.[MT7]-LSSLGLLHWPVWVGAK[MT7].4y4_1.heavy 513.557 / 518.342 18399.0 39.84469985961914 35 5 10 10 10 0.5671943481966856 91.1936748200988 0.0 3 0.6468701732839746 2.012316985218655 18399.0 46.34639710376838 0.0 - - - - - - - 785.0 36 7 FAM151A family with sequence similarity 151, member A 1099 140 B20140407_SF104_02 B20140407_SF104_02 TB390303.[MT7]-LSSLGLLHWPVWVGAK[MT7].4b7_1.heavy 513.557 / 828.531 10097.0 39.84469985961914 35 5 10 10 10 0.5671943481966856 91.1936748200988 0.0 3 0.6468701732839746 2.012316985218655 10097.0 162.2732142857143 0.0 - - - - - - - 238.375 20 8 FAM151A family with sequence similarity 151, member A 1101 140 B20140407_SF104_02 B20140407_SF104_02 TB390303.[MT7]-LSSLGLLHWPVWVGAK[MT7].4b5_1.heavy 513.557 / 602.363 4824.0 39.84469985961914 35 5 10 10 10 0.5671943481966856 91.1936748200988 0.0 3 0.6468701732839746 2.012316985218655 4824.0 15.222151274125753 0.0 - - - - - - - 314.3 9 10 FAM151A family with sequence similarity 151, member A 1103 140 B20140407_SF104_02 B20140407_SF104_02 TB390303.[MT7]-LSSLGLLHWPVWVGAK[MT7].4b6_1.heavy 513.557 / 715.447 7068.0 39.84469985961914 35 5 10 10 10 0.5671943481966856 91.1936748200988 0.0 3 0.6468701732839746 2.012316985218655 7068.0 28.53414747933163 0.0 - - - - - - - 244.8181818181818 14 11 FAM151A family with sequence similarity 151, member A 1105 141 B20140407_SF104_02 B20140407_SF104_02 TB390443.[MT7]-AVNELGDASAEIQLAVGHAPQLTELPR.4y8_1.heavy 736.647 / 953.542 46785.0 37.33209991455078 46 16 10 10 10 2.7163406179312983 28.823316321912184 0.0 3 0.9645628304900161 6.536449771407233 46785.0 105.88605128205128 0.0 - - - - - - - 742.8571428571429 93 7 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 1107 141 B20140407_SF104_02 B20140407_SF104_02 TB390443.[MT7]-AVNELGDASAEIQLAVGHAPQLTELPR.4b7_1.heavy 736.647 / 843.433 28721.0 37.33209991455078 46 16 10 10 10 2.7163406179312983 28.823316321912184 0.0 3 0.9645628304900161 6.536449771407233 28721.0 32.20692008332006 0.0 - - - - - - - 780.0 57 8 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 1109 141 B20140407_SF104_02 B20140407_SF104_02 TB390443.[MT7]-AVNELGDASAEIQLAVGHAPQLTELPR.4y9_1.heavy 736.647 / 1024.58 13516.0 37.33209991455078 46 16 10 10 10 2.7163406179312983 28.823316321912184 0.0 3 0.9645628304900161 6.536449771407233 13516.0 6.205669292800515 1.0 - - - - - - - 271.8181818181818 27 11 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 1111 141 B20140407_SF104_02 B20140407_SF104_02 TB390443.[MT7]-AVNELGDASAEIQLAVGHAPQLTELPR.4b4_1.heavy 736.647 / 558.3 67838.0 37.33209991455078 46 16 10 10 10 2.7163406179312983 28.823316321912184 0.0 3 0.9645628304900161 6.536449771407233 67838.0 67.58571675148313 0.0 - - - - - - - 715.0 135 6 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 1113 142 B20140407_SF104_02 B20140407_SF104_02 TB150809.[MT7]-LNISDPLR.2y5_1.heavy 536.318 / 587.315 11379.0 31.14940071105957 44 14 10 10 10 2.6353405312982034 37.945760258443215 0.0 3 0.9364035958596418 4.8676253367553395 11379.0 18.135817887831468 1.0 - - - - - - - 744.8571428571429 22 7 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1115 142 B20140407_SF104_02 B20140407_SF104_02 TB150809.[MT7]-LNISDPLR.2y6_1.heavy 536.318 / 700.399 4583.0 31.14940071105957 44 14 10 10 10 2.6353405312982034 37.945760258443215 0.0 3 0.9364035958596418 4.8676253367553395 4583.0 1.1270744914546813 5.0 - - - - - - - 744.8571428571429 12 7 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1117 142 B20140407_SF104_02 B20140407_SF104_02 TB150809.[MT7]-LNISDPLR.2b5_1.heavy 536.318 / 687.379 66854.0 31.14940071105957 44 14 10 10 10 2.6353405312982034 37.945760258443215 0.0 3 0.9364035958596418 4.8676253367553395 66854.0 62.239020088540855 0.0 - - - - - - - 474.0 133 1 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1119 142 B20140407_SF104_02 B20140407_SF104_02 TB150809.[MT7]-LNISDPLR.2y7_1.heavy 536.318 / 814.442 16437.0 31.14940071105957 44 14 10 10 10 2.6353405312982034 37.945760258443215 0.0 3 0.9364035958596418 4.8676253367553395 16437.0 47.30962929475587 0.0 - - - - - - - 347.6 32 5 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1121 143 B20140407_SF104_02 B20140407_SF104_02 TB150808.[MT7]-EYTQNK[MT7].2b3_1.heavy 535.79 / 538.263 2252.0 18.791400909423828 46 20 6 10 10 23.36921409527622 4.279134060405296 0.0 3 0.997812768126981 26.383704030809067 2252.0 9.07161581920904 1.0 - - - - - - - 239.3125 53 16 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1123 143 B20140407_SF104_02 B20140407_SF104_02 TB150808.[MT7]-EYTQNK[MT7].2y4_1.heavy 535.79 / 634.364 9794.0 18.791400909423828 46 20 6 10 10 23.36921409527622 4.279134060405296 0.0 3 0.997812768126981 26.383704030809067 9794.0 50.4244526077039 0.0 - - - - - - - 203.33333333333334 19 12 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1125 143 B20140407_SF104_02 B20140407_SF104_02 TB150808.[MT7]-EYTQNK[MT7].2y5_1.heavy 535.79 / 797.427 17224.0 18.791400909423828 46 20 6 10 10 23.36921409527622 4.279134060405296 0.0 3 0.997812768126981 26.383704030809067 17224.0 75.05594223247417 0.0 - - - - - - - 232.3125 34 16 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1127 143 B20140407_SF104_02 B20140407_SF104_02 TB150808.[MT7]-EYTQNK[MT7].2y3_1.heavy 535.79 / 533.316 4165.0 18.791400909423828 46 20 6 10 10 23.36921409527622 4.279134060405296 0.0 3 0.997812768126981 26.383704030809067 4165.0 23.13818504435995 0.0 - - - - - - - 219.6 8 20 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1129 144 B20140407_SF104_02 B20140407_SF104_02 TB150613.[MT7]-LPTVFR.2b3_1.heavy 438.775 / 456.294 7028.0 31.629899978637695 50 20 10 10 10 3.8656027840007443 25.869186667054286 0.0 3 0.999446003194145 52.431065986761325 7028.0 7.662452520910396 2.0 - - - - - - - 798.3333333333334 14 9 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1131 144 B20140407_SF104_02 B20140407_SF104_02 TB150613.[MT7]-LPTVFR.2y4_1.heavy 438.775 / 522.304 10620.0 31.629899978637695 50 20 10 10 10 3.8656027840007443 25.869186667054286 0.0 3 0.999446003194145 52.431065986761325 10620.0 22.82415809698079 0.0 - - - - - - - 354.90909090909093 21 11 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1133 144 B20140407_SF104_02 B20140407_SF104_02 TB150613.[MT7]-LPTVFR.2y5_1.heavy 438.775 / 619.356 204908.0 31.629899978637695 50 20 10 10 10 3.8656027840007443 25.869186667054286 0.0 3 0.999446003194145 52.431065986761325 204908.0 226.36961794787942 0.0 - - - - - - - 312.0 409 1 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1135 144 B20140407_SF104_02 B20140407_SF104_02 TB150613.[MT7]-LPTVFR.2b4_1.heavy 438.775 / 555.362 9215.0 31.629899978637695 50 20 10 10 10 3.8656027840007443 25.869186667054286 0.0 3 0.999446003194145 52.431065986761325 9215.0 11.190875625334298 0.0 - - - - - - - 1227.0 18 7 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1137 145 B20140407_SF104_02 B20140407_SF104_02 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 602155.0 33.03860092163086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 602155.0 65.8951006992718 0.0 - - - - - - - 338.0 1204 3 1139 145 B20140407_SF104_02 B20140407_SF104_02 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 1293100.0 33.03860092163086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1293100.0 190.9744999769462 0.0 - - - - - - - 326.0 2586 4 1141 145 B20140407_SF104_02 B20140407_SF104_02 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 1237730.0 33.03860092163086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1237730.0 97.20088615838387 0.0 - - - - - - - 869.0 2475 1 1143 146 B20140407_SF104_02 B20140407_SF104_02 TB390042.[MT7]-DRVTDALNATR.2y6_1.heavy 688.374 / 645.368 17713.0 24.74799919128418 47 17 10 10 10 6.3094404794693695 15.849265925464456 0.0 3 0.975849759139594 7.925446057211743 17713.0 20.947144543984393 0.0 - - - - - - - 1119.4 35 10 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1145 146 B20140407_SF104_02 B20140407_SF104_02 TB390042.[MT7]-DRVTDALNATR.2y8_1.heavy 688.374 / 861.443 1521.0 24.74799919128418 47 17 10 10 10 6.3094404794693695 15.849265925464456 0.0 3 0.975849759139594 7.925446057211743 1521.0 16.339191223100663 2.0 - - - - - - - 163.07142857142858 3 14 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1147 146 B20140407_SF104_02 B20140407_SF104_02 TB390042.[MT7]-DRVTDALNATR.2b5_1.heavy 688.374 / 731.38 17169.0 24.74799919128418 47 17 10 10 10 6.3094404794693695 15.849265925464456 0.0 3 0.975849759139594 7.925446057211743 17169.0 58.99910009151611 0.0 - - - - - - - 275.84615384615387 34 13 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1149 146 B20140407_SF104_02 B20140407_SF104_02 TB390042.[MT7]-DRVTDALNATR.2y10_2.heavy 688.374 / 558.81 15865.0 24.74799919128418 47 17 10 10 10 6.3094404794693695 15.849265925464456 0.0 3 0.975849759139594 7.925446057211743 15865.0 40.14915644171779 0.0 - - - - - - - 248.42857142857142 31 14 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1151 147 B20140407_SF104_02 B20140407_SF104_02 TB389946.[MT7]-IFGAAGAGYK[MT7].2y8_1.heavy 621.858 / 838.454 24675.0 28.97920036315918 47 17 10 10 10 7.061891970915884 14.160511150814251 0.0 3 0.9766281980324348 8.056877662481565 24675.0 60.95409511228533 0.0 - - - - - - - 302.625 49 8 INPP1 inositol polyphosphate-1-phosphatase 1153 147 B20140407_SF104_02 B20140407_SF104_02 TB389946.[MT7]-IFGAAGAGYK[MT7].2y9_1.heavy 621.858 / 985.522 38753.0 28.97920036315918 47 17 10 10 10 7.061891970915884 14.160511150814251 0.0 3 0.9766281980324348 8.056877662481565 38753.0 55.35466485660398 0.0 - - - - - - - 302.625 77 8 INPP1 inositol polyphosphate-1-phosphatase 1155 147 B20140407_SF104_02 B20140407_SF104_02 TB389946.[MT7]-IFGAAGAGYK[MT7].2y3_1.heavy 621.858 / 511.3 23615.0 28.97920036315918 47 17 10 10 10 7.061891970915884 14.160511150814251 0.0 3 0.9766281980324348 8.056877662481565 23615.0 12.97871064173406 0.0 - - - - - - - 340.5 47 4 INPP1 inositol polyphosphate-1-phosphatase 1157 147 B20140407_SF104_02 B20140407_SF104_02 TB389946.[MT7]-IFGAAGAGYK[MT7].2y6_1.heavy 621.858 / 710.395 29670.0 28.97920036315918 47 17 10 10 10 7.061891970915884 14.160511150814251 0.0 3 0.9766281980324348 8.056877662481565 29670.0 32.585549132947975 0.0 - - - - - - - 719.25 59 8 INPP1 inositol polyphosphate-1-phosphatase 1159 148 B20140407_SF104_02 B20140407_SF104_02 TB390047.[MT7]-C[CAM]LEPDGLYK[MT7].2y4_1.heavy 691.865 / 624.384 23318.0 28.121700286865234 46 16 10 10 10 2.518468478252862 31.884510174968575 0.0 3 0.9605241535855359 6.190953075322647 23318.0 29.732289720109677 0.0 - - - - - - - 1129.5 46 8 ASTN2 astrotactin 2 1161 148 B20140407_SF104_02 B20140407_SF104_02 TB390047.[MT7]-C[CAM]LEPDGLYK[MT7].2b3_1.heavy 691.865 / 547.267 42410.0 28.121700286865234 46 16 10 10 10 2.518468478252862 31.884510174968575 0.0 3 0.9605241535855359 6.190953075322647 42410.0 32.488813642639 0.0 - - - - - - - 772.3 84 10 ASTN2 astrotactin 2 1163 148 B20140407_SF104_02 B20140407_SF104_02 TB390047.[MT7]-C[CAM]LEPDGLYK[MT7].2y6_1.heavy 691.865 / 836.463 33957.0 28.121700286865234 46 16 10 10 10 2.518468478252862 31.884510174968575 0.0 3 0.9605241535855359 6.190953075322647 33957.0 61.424610694570326 0.0 - - - - - - - 270.42857142857144 67 7 ASTN2 astrotactin 2 1165 148 B20140407_SF104_02 B20140407_SF104_02 TB390047.[MT7]-C[CAM]LEPDGLYK[MT7].2b5_1.heavy 691.865 / 759.346 10639.0 28.121700286865234 46 16 10 10 10 2.518468478252862 31.884510174968575 0.0 3 0.9605241535855359 6.190953075322647 10639.0 24.083796031594773 0.0 - - - - - - - 247.7 21 10 ASTN2 astrotactin 2 1167 149 B20140407_SF104_02 B20140407_SF104_02 TB390045.[MT7]-DLADGFVNNK[MT7].3b6_1.heavy 460.917 / 763.374 72610.0 28.716899871826172 46 16 10 10 10 3.406413762832723 22.669025025553026 0.0 3 0.9608208685745125 6.214507716132465 72610.0 37.95195031888304 0.0 - - - - - - - 338.25 145 4 KIF6 kinesin family member 6 1169 149 B20140407_SF104_02 B20140407_SF104_02 TB390045.[MT7]-DLADGFVNNK[MT7].3y3_1.heavy 460.917 / 519.301 185960.0 28.716899871826172 46 16 10 10 10 3.406413762832723 22.669025025553026 0.0 3 0.9608208685745125 6.214507716132465 185960.0 39.227920822954886 0.0 - - - - - - - 451.0 371 1 KIF6 kinesin family member 6 1171 149 B20140407_SF104_02 B20140407_SF104_02 TB390045.[MT7]-DLADGFVNNK[MT7].3b4_1.heavy 460.917 / 559.284 62538.0 28.716899871826172 46 16 10 10 10 3.406413762832723 22.669025025553026 0.0 3 0.9608208685745125 6.214507716132465 62538.0 7.7036215816703635 0.0 - - - - - - - 1729.0 125 2 KIF6 kinesin family member 6 1173 149 B20140407_SF104_02 B20140407_SF104_02 TB390045.[MT7]-DLADGFVNNK[MT7].3b5_1.heavy 460.917 / 616.306 149580.0 28.716899871826172 46 16 10 10 10 3.406413762832723 22.669025025553026 0.0 3 0.9608208685745125 6.214507716132465 149580.0 48.26320225926422 0.0 - - - - - - - 789.25 299 4 KIF6 kinesin family member 6 1175 150 B20140407_SF104_02 B20140407_SF104_02 TB390069.[MT7]-YNK[MT7]PAFLK[MT7].3y3_1.heavy 471.626 / 551.367 38419.0 27.438199996948242 44 16 10 10 8 2.520505887916743 39.67457504439807 0.0 4 0.9687692292907163 6.965209949309402 38419.0 6.570860034187807 1.0 - - - - - - - 957.0 98 1 UBE2T ubiquitin-conjugating enzyme E2T (putative) 1177 150 B20140407_SF104_02 B20140407_SF104_02 TB390069.[MT7]-YNK[MT7]PAFLK[MT7].3y7_2.heavy 471.626 / 553.352 38283.0 27.438199996948242 44 16 10 10 8 2.520505887916743 39.67457504439807 0.0 4 0.9687692292907163 6.965209949309402 38283.0 18.9878737619328 0.0 - - - - - - - 774.6666666666666 76 3 UBE2T ubiquitin-conjugating enzyme E2T (putative) 1179 150 B20140407_SF104_02 B20140407_SF104_02 TB390069.[MT7]-YNK[MT7]PAFLK[MT7].3y4_1.heavy 471.626 / 622.404 17774.0 27.438199996948242 44 16 10 10 8 2.520505887916743 39.67457504439807 0.0 4 0.9687692292907163 6.965209949309402 17774.0 11.004374803866975 0.0 - - - - - - - 273.25 35 4 UBE2T ubiquitin-conjugating enzyme E2T (putative) 1181 150 B20140407_SF104_02 B20140407_SF104_02 TB390069.[MT7]-YNK[MT7]PAFLK[MT7].3y5_1.heavy 471.626 / 719.457 71096.0 27.438199996948242 44 16 10 10 8 2.520505887916743 39.67457504439807 0.0 4 0.9687692292907163 6.965209949309402 71096.0 82.29830828913182 0.0 - - - - - - - 256.125 142 8 UBE2T ubiquitin-conjugating enzyme E2T (putative) 1183 151 B20140407_SF104_02 B20140407_SF104_02 TB151172.[MT7]-ITTFDFSGVTK[MT7].3b6_1.heavy 501.948 / 869.453 26661.0 33.3036994934082 47 17 10 10 10 4.329210982942416 23.09889732655936 0.0 3 0.9719607316517961 7.35290574858091 26661.0 28.986707193194082 0.0 - - - - - - - 306.6666666666667 53 9 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 1185 151 B20140407_SF104_02 B20140407_SF104_02 TB151172.[MT7]-ITTFDFSGVTK[MT7].3b5_1.heavy 501.948 / 722.384 276008.0 33.3036994934082 47 17 10 10 10 4.329210982942416 23.09889732655936 0.0 3 0.9719607316517961 7.35290574858091 276008.0 52.55604399345495 0.0 - - - - - - - 322.0 552 3 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 1187 151 B20140407_SF104_02 B20140407_SF104_02 TB151172.[MT7]-ITTFDFSGVTK[MT7].3y4_1.heavy 501.948 / 548.352 220889.0 33.3036994934082 47 17 10 10 10 4.329210982942416 23.09889732655936 0.0 3 0.9719607316517961 7.35290574858091 220889.0 48.696503243395696 0.0 - - - - - - - 829.0 441 2 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 1189 151 B20140407_SF104_02 B20140407_SF104_02 TB151172.[MT7]-ITTFDFSGVTK[MT7].3y5_1.heavy 501.948 / 635.385 105541.0 33.3036994934082 47 17 10 10 10 4.329210982942416 23.09889732655936 0.0 3 0.9719607316517961 7.35290574858091 105541.0 66.47364517636576 0.0 - - - - - - - 345.0 211 2 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 1191 152 B20140407_SF104_02 B20140407_SF104_02 TB390457.[MT7]-VVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIK[MT7].4b5_1.heavy 1209.12 / 723.391 3428.0 43.360074043273926 34 9 10 5 10 0.7601314381902518 75.5104442521006 0.040699005126953125 3 0.8006608198832961 2.7168931397807703 3428.0 24.51832131509877 0.0 - - - - - - - 142.78947368421052 6 19 INPP1 inositol polyphosphate-1-phosphatase 1193 152 B20140407_SF104_02 B20140407_SF104_02 TB390457.[MT7]-VVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIK[MT7].4y3_1.heavy 1209.12 / 567.362 7618.0 43.360074043273926 34 9 10 5 10 0.7601314381902518 75.5104442521006 0.040699005126953125 3 0.8006608198832961 2.7168931397807703 7618.0 48.89536311366652 0.0 - - - - - - - 241.0 15 16 INPP1 inositol polyphosphate-1-phosphatase 1195 152 B20140407_SF104_02 B20140407_SF104_02 TB390457.[MT7]-VVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIK[MT7].4b6_1.heavy 1209.12 / 822.459 2809.0 43.360074043273926 34 9 10 5 10 0.7601314381902518 75.5104442521006 0.040699005126953125 3 0.8006608198832961 2.7168931397807703 2809.0 14.680245244951127 0.0 - - - - - - - 163.8125 5 16 INPP1 inositol polyphosphate-1-phosphatase 1197 152 B20140407_SF104_02 B20140407_SF104_02 TB390457.[MT7]-VVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIK[MT7].4b4_1.heavy 1209.12 / 608.364 1762.0 43.360074043273926 34 9 10 5 10 0.7601314381902518 75.5104442521006 0.040699005126953125 3 0.8006608198832961 2.7168931397807703 1762.0 14.3781070322866 0.0 - - - - - - - 148.875 3 16 INPP1 inositol polyphosphate-1-phosphatase 1199 153 B20140407_SF104_02 B20140407_SF104_02 TB499628.[MT7]-LC[CAM]STEEETAELLSK[MT7].3b6_1.heavy 633.327 / 864.389 99399.0 32.701698303222656 43 13 10 10 10 0.9148538140050334 65.58061497683723 0.0 3 0.9005302951115106 3.880158954083248 99399.0 103.20075098243794 0.0 - - - - - - - 332.0 198 4 INPP1 inositol polyphosphate-1-phosphatase 1201 153 B20140407_SF104_02 B20140407_SF104_02 TB499628.[MT7]-LC[CAM]STEEETAELLSK[MT7].3b5_1.heavy 633.327 / 735.346 104568.0 32.701698303222656 43 13 10 10 10 0.9148538140050334 65.58061497683723 0.0 3 0.9005302951115106 3.880158954083248 104568.0 68.55181955799678 0.0 - - - - - - - 443.0 209 1 INPP1 inositol polyphosphate-1-phosphatase 1203 153 B20140407_SF104_02 B20140407_SF104_02 TB499628.[MT7]-LC[CAM]STEEETAELLSK[MT7].3y4_1.heavy 633.327 / 604.415 141049.0 32.701698303222656 43 13 10 10 10 0.9148538140050334 65.58061497683723 0.0 3 0.9005302951115106 3.880158954083248 141049.0 55.500143396665536 0.0 - - - - - - - 1230.8333333333333 282 6 INPP1 inositol polyphosphate-1-phosphatase 1205 153 B20140407_SF104_02 B20140407_SF104_02 TB499628.[MT7]-LC[CAM]STEEETAELLSK[MT7].3b7_1.heavy 633.327 / 993.432 70008.0 32.701698303222656 43 13 10 10 10 0.9148538140050334 65.58061497683723 0.0 3 0.9005302951115106 3.880158954083248 70008.0 126.12753549357447 0.0 - - - - - - - 295.25 140 8 INPP1 inositol polyphosphate-1-phosphatase 1207 154 B20140407_SF104_02 B20140407_SF104_02 TB151177.[MT7]-DNEGATALHFAAR.3y6_1.heavy 506.259 / 714.405 17388.0 26.725400924682617 41 11 10 10 10 1.1031350317645534 55.07036969547039 0.0 3 0.8636891597296787 3.3039676487921668 17388.0 14.866947565414225 0.0 - - - - - - - 292.0 34 5 ESPNL espin-like 1209 154 B20140407_SF104_02 B20140407_SF104_02 TB151177.[MT7]-DNEGATALHFAAR.3b4_1.heavy 506.259 / 560.243 9822.0 26.725400924682617 41 11 10 10 10 1.1031350317645534 55.07036969547039 0.0 3 0.8636891597296787 3.3039676487921668 9822.0 8.73325933778669 3.0 - - - - - - - 840.3333333333334 39 6 ESPNL espin-like 1211 154 B20140407_SF104_02 B20140407_SF104_02 TB151177.[MT7]-DNEGATALHFAAR.3b5_1.heavy 506.259 / 631.28 21237.0 26.725400924682617 41 11 10 10 10 1.1031350317645534 55.07036969547039 0.0 3 0.8636891597296787 3.3039676487921668 21237.0 13.070011646489245 0.0 - - - - - - - 331.5 42 2 ESPNL espin-like 1213 154 B20140407_SF104_02 B20140407_SF104_02 TB151177.[MT7]-DNEGATALHFAAR.3y5_1.heavy 506.259 / 601.32 40218.0 26.725400924682617 41 11 10 10 10 1.1031350317645534 55.07036969547039 0.0 3 0.8636891597296787 3.3039676487921668 40218.0 22.04080944846293 0.0 - - - - - - - 398.0 80 1 ESPNL espin-like 1215 155 B20140407_SF104_02 B20140407_SF104_02 TB150711.[MT7]-EAAAIEAR.2b6_1.heavy 487.773 / 729.39 172058.0 21.91710090637207 43 13 10 10 10 2.0369499854651165 49.09300705150403 0.0 3 0.919169559252108 4.3112698061046055 172058.0 341.00810211810057 0.0 - - - - - - - 719.4444444444445 344 9 RIBC1 RIB43A domain with coiled-coils 1 1217 155 B20140407_SF104_02 B20140407_SF104_02 TB150711.[MT7]-EAAAIEAR.2y6_1.heavy 487.773 / 630.357 58446.0 21.91710090637207 43 13 10 10 10 2.0369499854651165 49.09300705150403 0.0 3 0.919169559252108 4.3112698061046055 58446.0 71.03053543918244 0.0 - - - - - - - 1218.4444444444443 116 9 RIBC1 RIB43A domain with coiled-coils 1 1219 155 B20140407_SF104_02 B20140407_SF104_02 TB150711.[MT7]-EAAAIEAR.2b5_1.heavy 487.773 / 600.347 72950.0 21.91710090637207 43 13 10 10 10 2.0369499854651165 49.09300705150403 0.0 3 0.919169559252108 4.3112698061046055 72950.0 41.86608483086511 0.0 - - - - - - - 259.0 145 1 RIBC1 RIB43A domain with coiled-coils 1 1221 155 B20140407_SF104_02 B20140407_SF104_02 TB150711.[MT7]-EAAAIEAR.2y7_1.heavy 487.773 / 701.394 224806.0 21.91710090637207 43 13 10 10 10 2.0369499854651165 49.09300705150403 0.0 3 0.919169559252108 4.3112698061046055 224806.0 188.60691808860048 0.0 - - - - - - - 345.0 449 1 RIBC1 RIB43A domain with coiled-coils 1 1223 156 B20140407_SF104_02 B20140407_SF104_02 TB151176.[MT7]-HEASSLEDLPK[MT7].3y3_1.heavy 505.275 / 501.352 40182.0 25.56410026550293 24 8 0 10 6 1.8234702156331044 54.840489931051735 0.0 5 0.7530956366252545 2.4306799117600235 40182.0 17.40747533882047 0.0 - - - - - - - 1885.0 80 1 KIF6 kinesin family member 6 1225 156 B20140407_SF104_02 B20140407_SF104_02 TB151176.[MT7]-HEASSLEDLPK[MT7].3b4_1.heavy 505.275 / 569.28 7306.0 25.56410026550293 24 8 0 10 6 1.8234702156331044 54.840489931051735 0.0 5 0.7530956366252545 2.4306799117600235 7306.0 7.6715731777157465 2.0 - - - - - - - 825.0 288 1 KIF6 kinesin family member 6 1227 156 B20140407_SF104_02 B20140407_SF104_02 TB151176.[MT7]-HEASSLEDLPK[MT7].3b5_1.heavy 505.275 / 656.312 8602.0 25.56410026550293 24 8 0 10 6 1.8234702156331044 54.840489931051735 0.0 5 0.7530956366252545 2.4306799117600235 8602.0 10.510882384941791 0.0 - - - - - - - 795.5 17 8 KIF6 kinesin family member 6 1229 156 B20140407_SF104_02 B20140407_SF104_02 TB151176.[MT7]-HEASSLEDLPK[MT7].3b8_1.heavy 505.275 / 1013.47 6363.0 25.56410026550293 24 8 0 10 6 1.8234702156331044 54.840489931051735 0.0 5 0.7530956366252545 2.4306799117600235 6363.0 77.65016949152542 0.0 - - - - - - - 118.0 12 3 KIF6 kinesin family member 6 1231 157 B20140407_SF104_02 B20140407_SF104_02 TB150717.[MT7]-FPGLEK[MT7].2y4_1.heavy 489.797 / 590.363 25510.0 29.049449920654297 38 17 10 5 6 0.8501502737829025 56.26936507717254 0.047298431396484375 5 0.9752902089983979 7.834828195111592 25510.0 17.000050318940275 1.0 - - - - - - - 304.0 139 1 INPP1 inositol polyphosphate-1-phosphatase 1233 157 B20140407_SF104_02 B20140407_SF104_02 TB150717.[MT7]-FPGLEK[MT7].2y5_2.heavy 489.797 / 344.211 29307.0 29.049449920654297 38 17 10 5 6 0.8501502737829025 56.26936507717254 0.047298431396484375 5 0.9752902089983979 7.834828195111592 29307.0 30.486180772657058 1.0 - - - - - - - 759.0 134 2 INPP1 inositol polyphosphate-1-phosphatase 1235 157 B20140407_SF104_02 B20140407_SF104_02 TB150717.[MT7]-FPGLEK[MT7].2y5_1.heavy 489.797 / 687.416 268316.0 29.049449920654297 38 17 10 5 6 0.8501502737829025 56.26936507717254 0.047298431396484375 5 0.9752902089983979 7.834828195111592 268316.0 312.71297748822906 0.0 - - - - - - - 304.0 536 2 INPP1 inositol polyphosphate-1-phosphatase 1237 157 B20140407_SF104_02 B20140407_SF104_02 TB150717.[MT7]-FPGLEK[MT7].2y3_1.heavy 489.797 / 533.341 10326.0 29.049449920654297 38 17 10 5 6 0.8501502737829025 56.26936507717254 0.047298431396484375 5 0.9752902089983979 7.834828195111592 10326.0 6.764693240901213 2.0 - - - - - - - 607.0 20 1 INPP1 inositol polyphosphate-1-phosphatase 1239 158 B20140407_SF104_02 B20140407_SF104_02 TB389649.[MT7]-GPPVQK[MT7].2y4_1.heavy 457.289 / 615.395 12315.0 20.278725147247314 38 16 10 6 6 2.2574885597813754 39.00396676031383 0.03489875793457031 6 0.9653545369043961 6.6111541292814575 12315.0 20.736041806342104 0.0 - - - - - - - 347.5 24 2 PDILT protein disulfide isomerase-like, testis expressed 1241 158 B20140407_SF104_02 B20140407_SF104_02 TB389649.[MT7]-GPPVQK[MT7].2y5_1.heavy 457.289 / 712.447 17394.0 20.278725147247314 38 16 10 6 6 2.2574885597813754 39.00396676031383 0.03489875793457031 6 0.9653545369043961 6.6111541292814575 17394.0 46.3874791310786 0.0 - - - - - - - 347.6666666666667 34 6 PDILT protein disulfide isomerase-like, testis expressed 1243 158 B20140407_SF104_02 B20140407_SF104_02 TB389649.[MT7]-GPPVQK[MT7].2y3_1.heavy 457.289 / 518.342 2574.0 20.278725147247314 38 16 10 6 6 2.2574885597813754 39.00396676031383 0.03489875793457031 6 0.9653545369043961 6.6111541292814575 2574.0 1.915036581796898 7.0 - - - - - - - 1229.3333333333333 12 3 PDILT protein disulfide isomerase-like, testis expressed 1245 158 B20140407_SF104_02 B20140407_SF104_02 TB389649.[MT7]-GPPVQK[MT7].2b5_1.heavy 457.289 / 623.363 2505.0 20.278725147247314 38 16 10 6 6 2.2574885597813754 39.00396676031383 0.03489875793457031 6 0.9653545369043961 6.6111541292814575 2505.0 5.178936527311565 2.0 - - - - - - - 452.0 18 2 PDILT protein disulfide isomerase-like, testis expressed 1247 159 B20140407_SF104_02 B20140407_SF104_02 TB150810.[MT7]-SFAFWK[MT7].2y4_1.heavy 537.305 / 695.4 12786.0 34.27722358703613 42 16 10 6 10 2.5525134060952994 39.17707141565017 0.03910064697265625 3 0.9686538169644711 6.952308010629385 12786.0 28.176585419688465 0.0 - - - - - - - 762.6666666666666 25 9 ESPNL espin-like 1249 159 B20140407_SF104_02 B20140407_SF104_02 TB150810.[MT7]-SFAFWK[MT7].2y5_1.heavy 537.305 / 842.468 17227.0 34.27722358703613 42 16 10 6 10 2.5525134060952994 39.17707141565017 0.03910064697265625 3 0.9686538169644711 6.952308010629385 17227.0 64.14410964647728 0.0 - - - - - - - 269.3333333333333 34 12 ESPNL espin-like 1251 159 B20140407_SF104_02 B20140407_SF104_02 TB150810.[MT7]-SFAFWK[MT7].2b4_1.heavy 537.305 / 597.315 14939.0 34.27722358703613 42 16 10 6 10 2.5525134060952994 39.17707141565017 0.03910064697265625 3 0.9686538169644711 6.952308010629385 14939.0 19.40110706954453 0.0 - - - - - - - 653.7142857142857 29 7 ESPNL espin-like 1253 159 B20140407_SF104_02 B20140407_SF104_02 TB150810.[MT7]-SFAFWK[MT7].2y3_1.heavy 537.305 / 624.363 21130.0 34.27722358703613 42 16 10 6 10 2.5525134060952994 39.17707141565017 0.03910064697265625 3 0.9686538169644711 6.952308010629385 21130.0 32.21846398015598 0.0 - - - - - - - 723.375 42 16 ESPNL espin-like 1255 160 B20140407_SF104_02 B20140407_SF104_02 TB390313.[MT7]-DFPELTFGVITIGNVIGR.3y6_1.heavy 698.057 / 615.357 7368.0 43.34989929199219 50 20 10 10 10 5.5849103354544845 17.90539041695506 0.0 3 0.9919421204167738 13.739151962611164 7368.0 19.744387938562696 0.0 - - - - - - - 195.21428571428572 14 14 PDILT protein disulfide isomerase-like, testis expressed 1257 160 B20140407_SF104_02 B20140407_SF104_02 TB390313.[MT7]-DFPELTFGVITIGNVIGR.3b4_1.heavy 698.057 / 633.3 2834.0 43.34989929199219 50 20 10 10 10 5.5849103354544845 17.90539041695506 0.0 3 0.9919421204167738 13.739151962611164 2834.0 4.366956613893681 0.0 - - - - - - - 257.73333333333335 5 15 PDILT protein disulfide isomerase-like, testis expressed 1259 160 B20140407_SF104_02 B20140407_SF104_02 TB390313.[MT7]-DFPELTFGVITIGNVIGR.3y8_1.heavy 698.057 / 829.489 7574.0 43.34989929199219 50 20 10 10 10 5.5849103354544845 17.90539041695506 0.0 3 0.9919421204167738 13.739151962611164 7574.0 28.122960302256278 0.0 - - - - - - - 262.1666666666667 15 12 PDILT protein disulfide isomerase-like, testis expressed 1261 160 B20140407_SF104_02 B20140407_SF104_02 TB390313.[MT7]-DFPELTFGVITIGNVIGR.3y9_1.heavy 698.057 / 942.573 2113.0 43.34989929199219 50 20 10 10 10 5.5849103354544845 17.90539041695506 0.0 3 0.9919421204167738 13.739151962611164 2113.0 6.104718923402185 1.0 - - - - - - - 177.1875 4 16 PDILT protein disulfide isomerase-like, testis expressed 1263 161 B20140407_SF104_02 B20140407_SF104_02 TB499381.[MT7]-AHLILR.2b3_1.heavy 433.788 / 466.289 19991.0 25.101499557495117 48 18 10 10 10 5.644585092347044 17.716093984583647 0.0 3 0.9883332425627179 11.414690630358812 19991.0 16.346807291666668 0.0 - - - - - - - 452.0 39 1 ASTN2 astrotactin 2 1265 161 B20140407_SF104_02 B20140407_SF104_02 TB499381.[MT7]-AHLILR.2y4_1.heavy 433.788 / 514.371 24509.0 25.101499557495117 48 18 10 10 10 5.644585092347044 17.716093984583647 0.0 3 0.9883332425627179 11.414690630358812 24509.0 9.980275684072112 2.0 - - - - - - - 452.0 49 1 ASTN2 astrotactin 2 1267 161 B20140407_SF104_02 B20140407_SF104_02 TB499381.[MT7]-AHLILR.2y5_1.heavy 433.788 / 651.43 59635.0 25.101499557495117 48 18 10 10 10 5.644585092347044 17.716093984583647 0.0 3 0.9883332425627179 11.414690630358812 59635.0 215.36955330804886 0.0 - - - - - - - 703.1111111111111 119 9 ASTN2 astrotactin 2 1269 161 B20140407_SF104_02 B20140407_SF104_02 TB499381.[MT7]-AHLILR.2b4_1.heavy 433.788 / 579.373 14231.0 25.101499557495117 48 18 10 10 10 5.644585092347044 17.716093984583647 0.0 3 0.9883332425627179 11.414690630358812 14231.0 4.743488390246211 2.0 - - - - - - - 1216.888888888889 77 9 ASTN2 astrotactin 2 1271 162 B20140407_SF104_02 B20140407_SF104_02 TB499510.[MT7]-DLLLQALR.2y5_1.heavy 543.344 / 600.383 199363.0 35.903099060058594 50 20 10 10 10 5.794269918739502 17.258429690440487 0.0 3 0.9926067460909846 14.344209672366846 199363.0 220.06862884095727 0.0 - - - - - - - 292.0 398 4 PYCARD PYD and CARD domain containing 1273 162 B20140407_SF104_02 B20140407_SF104_02 TB499510.[MT7]-DLLLQALR.2b4_1.heavy 543.344 / 599.388 73982.0 35.903099060058594 50 20 10 10 10 5.794269918739502 17.258429690440487 0.0 3 0.9926067460909846 14.344209672366846 73982.0 101.48741445708468 0.0 - - - - - - - 324.5 147 2 PYCARD PYD and CARD domain containing 1275 162 B20140407_SF104_02 B20140407_SF104_02 TB499510.[MT7]-DLLLQALR.2y6_1.heavy 543.344 / 713.467 137062.0 35.903099060058594 50 20 10 10 10 5.794269918739502 17.258429690440487 0.0 3 0.9926067460909846 14.344209672366846 137062.0 232.3023737715815 0.0 - - - - - - - 649.0 274 7 PYCARD PYD and CARD domain containing 1277 162 B20140407_SF104_02 B20140407_SF104_02 TB499510.[MT7]-DLLLQALR.2y7_1.heavy 543.344 / 826.551 194301.0 35.903099060058594 50 20 10 10 10 5.794269918739502 17.258429690440487 0.0 3 0.9926067460909846 14.344209672366846 194301.0 723.7709219539585 0.0 - - - - - - - 204.14285714285714 388 7 PYCARD PYD and CARD domain containing 1279 163 B20140407_SF104_02 B20140407_SF104_02 TB389913.[MT7]-LRIPAAQER.3y6_1.heavy 399.911 / 671.347 170742.0 25.310199737548828 43 13 10 10 10 1.0910049819382657 58.06094597637619 0.0 3 0.9243209817006144 4.457556904569333 170742.0 153.7479997274745 0.0 - - - - - - - 730.25 341 8 LOC100289200;LOC100292387;HMCN2 hemicentin-2-like;hemicentin-2-like;hemicentin 2 1281 163 B20140407_SF104_02 B20140407_SF104_02 TB389913.[MT7]-LRIPAAQER.3b3_1.heavy 399.911 / 527.379 281020.0 25.310199737548828 43 13 10 10 10 1.0910049819382657 58.06094597637619 0.0 3 0.9243209817006144 4.457556904569333 281020.0 114.2419654238794 0.0 - - - - - - - 3321.0 562 1 LOC100289200;LOC100292387;HMCN2 hemicentin-2-like;hemicentin-2-like;hemicentin 2 1283 163 B20140407_SF104_02 B20140407_SF104_02 TB389913.[MT7]-LRIPAAQER.3y4_1.heavy 399.911 / 503.257 276783.0 25.310199737548828 43 13 10 10 10 1.0910049819382657 58.06094597637619 0.0 3 0.9243209817006144 4.457556904569333 276783.0 152.68514378034973 0.0 - - - - - - - 1183.3333333333333 553 3 LOC100289200;LOC100292387;HMCN2 hemicentin-2-like;hemicentin-2-like;hemicentin 2 1285 163 B20140407_SF104_02 B20140407_SF104_02 TB389913.[MT7]-LRIPAAQER.3y5_1.heavy 399.911 / 574.294 169826.0 25.310199737548828 43 13 10 10 10 1.0910049819382657 58.06094597637619 0.0 3 0.9243209817006144 4.457556904569333 169826.0 172.86451988393912 0.0 - - - - - - - 1245.625 339 8 LOC100289200;LOC100292387;HMCN2 hemicentin-2-like;hemicentin-2-like;hemicentin 2 1287 164 B20140407_SF104_02 B20140407_SF104_02 TB499389.[MT7]-LLASSPR.2y4_1.heavy 444.275 / 446.236 33025.0 25.1835994720459 48 20 10 10 8 27.751569437964307 3.603399808559996 0.0 4 0.9983649354973257 30.516570969424446 33025.0 9.657228567389623 1.0 - - - - - - - 1231.6666666666667 69 9 FAM151A family with sequence similarity 151, member A 1289 164 B20140407_SF104_02 B20140407_SF104_02 TB499389.[MT7]-LLASSPR.2y5_1.heavy 444.275 / 517.273 73591.0 25.1835994720459 48 20 10 10 8 27.751569437964307 3.603399808559996 0.0 4 0.9983649354973257 30.516570969424446 73591.0 31.179629195154405 1.0 - - - - - - - 571.0 308 1 FAM151A family with sequence similarity 151, member A 1291 164 B20140407_SF104_02 B20140407_SF104_02 TB499389.[MT7]-LLASSPR.2b6_1.heavy 444.275 / 713.431 3885.0 25.1835994720459 48 20 10 10 8 27.751569437964307 3.603399808559996 0.0 4 0.9983649354973257 30.516570969424446 3885.0 5.697050084366879 4.0 - - - - - - - 751.0 37 7 FAM151A family with sequence similarity 151, member A 1293 164 B20140407_SF104_02 B20140407_SF104_02 TB499389.[MT7]-LLASSPR.2y6_1.heavy 444.275 / 630.357 152897.0 25.1835994720459 48 20 10 10 8 27.751569437964307 3.603399808559996 0.0 4 0.9983649354973257 30.516570969424446 152897.0 98.2001789249546 0.0 - - - - - - - 1325.8 305 5 FAM151A family with sequence similarity 151, member A 1295 165 B20140407_SF104_02 B20140407_SF104_02 TB499650.[MT7]-TWFSIPEK[MT7].2b3_1.heavy 648.366 / 579.305 35586.0 34.208099365234375 47 17 10 10 10 4.780194332597447 20.919651596185695 0.0 3 0.9794208566508216 8.58817951133386 35586.0 30.949132961794234 0.0 - - - - - - - 406.0 71 1 DHFR;DHFRL1 dihydrofolate reductase;dihydrofolate reductase-like 1 1297 165 B20140407_SF104_02 B20140407_SF104_02 TB499650.[MT7]-TWFSIPEK[MT7].2y5_1.heavy 648.366 / 717.426 47358.0 34.208099365234375 47 17 10 10 10 4.780194332597447 20.919651596185695 0.0 3 0.9794208566508216 8.58817951133386 47358.0 68.47067978214845 0.0 - - - - - - - 338.5 94 2 DHFR;DHFRL1 dihydrofolate reductase;dihydrofolate reductase-like 1 1299 165 B20140407_SF104_02 B20140407_SF104_02 TB499650.[MT7]-TWFSIPEK[MT7].2b4_1.heavy 648.366 / 666.337 31662.0 34.208099365234375 47 17 10 10 10 4.780194332597447 20.919651596185695 0.0 3 0.9794208566508216 8.58817951133386 31662.0 40.83546798029556 0.0 - - - - - - - 715.4285714285714 63 7 DHFR;DHFRL1 dihydrofolate reductase;dihydrofolate reductase-like 1 1301 165 B20140407_SF104_02 B20140407_SF104_02 TB499650.[MT7]-TWFSIPEK[MT7].2y3_1.heavy 648.366 / 517.31 183480.0 34.208099365234375 47 17 10 10 10 4.780194332597447 20.919651596185695 0.0 3 0.9794208566508216 8.58817951133386 183480.0 92.17769113142018 0.0 - - - - - - - 2223.1428571428573 366 7 DHFR;DHFRL1 dihydrofolate reductase;dihydrofolate reductase-like 1 1303 166 B20140407_SF104_02 B20140407_SF104_02 TB390099.[MT7]-YQQNVQSQPPR.2b3_1.heavy 744.887 / 564.29 2715.0 20.841249465942383 46 20 10 6 10 7.469494136255287 13.387787469384563 0.03820037841796875 3 0.9935797540521186 15.394085935508578 2715.0 4.386467953803173 0.0 - - - - - - - 214.85714285714286 5 14 DNAJC5G DnaJ (Hsp40) homolog, subfamily C, member 5 gamma 1305 166 B20140407_SF104_02 B20140407_SF104_02 TB390099.[MT7]-YQQNVQSQPPR.2b4_1.heavy 744.887 / 678.333 2495.0 20.841249465942383 46 20 10 6 10 7.469494136255287 13.387787469384563 0.03820037841796875 3 0.9935797540521186 15.394085935508578 2495.0 17.143962729896046 0.0 - - - - - - - 180.0909090909091 4 11 DNAJC5G DnaJ (Hsp40) homolog, subfamily C, member 5 gamma 1307 166 B20140407_SF104_02 B20140407_SF104_02 TB390099.[MT7]-YQQNVQSQPPR.2y9_1.heavy 744.887 / 1053.54 3082.0 20.841249465942383 46 20 10 6 10 7.469494136255287 13.387787469384563 0.03820037841796875 3 0.9935797540521186 15.394085935508578 3082.0 13.86823656180332 0.0 - - - - - - - 142.0625 6 16 DNAJC5G DnaJ (Hsp40) homolog, subfamily C, member 5 gamma 1309 166 B20140407_SF104_02 B20140407_SF104_02 TB390099.[MT7]-YQQNVQSQPPR.2y10_1.heavy 744.887 / 1181.6 4109.0 20.841249465942383 46 20 10 6 10 7.469494136255287 13.387787469384563 0.03820037841796875 3 0.9935797540521186 15.394085935508578 4109.0 9.658855585831063 0.0 - - - - - - - 186.72727272727272 8 11 DNAJC5G DnaJ (Hsp40) homolog, subfamily C, member 5 gamma 1311 167 B20140407_SF104_02 B20140407_SF104_02 TB390419.[MT7]-GPNMLISTEVNATQFLALVQEK[MT7].4y5_1.heavy 673.621 / 760.469 8095.0 42.44810104370117 50 20 10 10 10 5.4807831562460825 18.245567676954465 0.0 3 0.9907193523424309 12.800790106251878 8095.0 19.885203094777562 0.0 - - - - - - - 696.5454545454545 16 11 FAM151A family with sequence similarity 151, member A 1313 167 B20140407_SF104_02 B20140407_SF104_02 TB390419.[MT7]-GPNMLISTEVNATQFLALVQEK[MT7].4y4_1.heavy 673.621 / 647.385 17130.0 42.44810104370117 50 20 10 10 10 5.4807831562460825 18.245567676954465 0.0 3 0.9907193523424309 12.800790106251878 17130.0 22.00445290519529 0.0 - - - - - - - 751.6 34 10 FAM151A family with sequence similarity 151, member A 1315 167 B20140407_SF104_02 B20140407_SF104_02 TB390419.[MT7]-GPNMLISTEVNATQFLALVQEK[MT7].4b5_1.heavy 673.621 / 657.351 26598.0 42.44810104370117 50 20 10 10 10 5.4807831562460825 18.245567676954465 0.0 3 0.9907193523424309 12.800790106251878 26598.0 37.78177711893966 0.0 - - - - - - - 686.625 53 8 FAM151A family with sequence similarity 151, member A 1317 167 B20140407_SF104_02 B20140407_SF104_02 TB390419.[MT7]-GPNMLISTEVNATQFLALVQEK[MT7].4b6_1.heavy 673.621 / 770.435 14889.0 42.44810104370117 50 20 10 10 10 5.4807831562460825 18.245567676954465 0.0 3 0.9907193523424309 12.800790106251878 14889.0 45.948747426218254 0.0 - - - - - - - 228.75 29 12 FAM151A family with sequence similarity 151, member A 1319 168 B20140407_SF104_02 B20140407_SF104_02 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 763051.0 34.94150161743164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 763051.0 161.2877115273937 0.0 - - - - - - - 2399.0 1526 1 1321 168 B20140407_SF104_02 B20140407_SF104_02 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 1535900.0 34.94150161743164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1535900.0 173.926769648747 0.0 - - - - - - - 2666.0 3071 1 1323 168 B20140407_SF104_02 B20140407_SF104_02 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 1749710.0 34.94150161743164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1749710.0 161.6721670860852 0.0 - - - - - - - 4399.0 3499 1 1325 169 B20140407_SF104_02 B20140407_SF104_02 TB499654.[MT7]-IILILLQGDR.2y8_1.heavy 649.42 / 927.562 18383.0 40.837398529052734 43 13 10 10 10 1.0940150098458652 60.93761608998333 0.0 3 0.9150458417873691 4.203842300062589 18383.0 110.19217451901227 0.0 - - - - - - - 246.42857142857142 36 7 RWDD3 RWD domain containing 3 1327 169 B20140407_SF104_02 B20140407_SF104_02 TB499654.[MT7]-IILILLQGDR.2y9_1.heavy 649.42 / 1040.65 20451.0 40.837398529052734 43 13 10 10 10 1.0940150098458652 60.93761608998333 0.0 3 0.9150458417873691 4.203842300062589 20451.0 110.2962810626617 0.0 - - - - - - - 219.54545454545453 40 11 RWDD3 RWD domain containing 3 1329 169 B20140407_SF104_02 B20140407_SF104_02 TB499654.[MT7]-IILILLQGDR.2y6_1.heavy 649.42 / 701.394 26655.0 40.837398529052734 43 13 10 10 10 1.0940150098458652 60.93761608998333 0.0 3 0.9150458417873691 4.203842300062589 26655.0 45.67014667446179 0.0 - - - - - - - 287.5 53 6 RWDD3 RWD domain containing 3 1331 169 B20140407_SF104_02 B20140407_SF104_02 TB499654.[MT7]-IILILLQGDR.2y7_1.heavy 649.42 / 814.478 20910.0 40.837398529052734 43 13 10 10 10 1.0940150098458652 60.93761608998333 0.0 3 0.9150458417873691 4.203842300062589 20910.0 25.842938202883225 0.0 - - - - - - - 705.4285714285714 41 7 RWDD3 RWD domain containing 3 1333 170 B20140407_SF104_02 B20140407_SF104_02 TB150950.[MT7]-TFTITGGAER.2y8_1.heavy 598.823 / 804.421 74735.0 27.34939956665039 50 20 10 10 10 10.10261834542264 9.898424010574313 0.0 3 0.9978028583680884 26.32411587703225 74735.0 35.62976187764662 0.0 - - - - - - - 666.3333333333334 149 9 KIF6 kinesin family member 6 1335 170 B20140407_SF104_02 B20140407_SF104_02 TB150950.[MT7]-TFTITGGAER.2y9_1.heavy 598.823 / 951.489 119492.0 27.34939956665039 50 20 10 10 10 10.10261834542264 9.898424010574313 0.0 3 0.9978028583680884 26.32411587703225 119492.0 126.00700585725062 0.0 - - - - - - - 348.5 238 8 KIF6 kinesin family member 6 1337 170 B20140407_SF104_02 B20140407_SF104_02 TB150950.[MT7]-TFTITGGAER.2y6_1.heavy 598.823 / 590.289 N/A 27.34939956665039 50 20 10 10 10 10.10261834542264 9.898424010574313 0.0 3 0.9978028583680884 26.32411587703225 147656.0 24.647972914952 0.0 - - - - - - - 3207.0 295 1 KIF6 kinesin family member 6 1339 170 B20140407_SF104_02 B20140407_SF104_02 TB150950.[MT7]-TFTITGGAER.2y7_1.heavy 598.823 / 703.373 58282.0 27.34939956665039 50 20 10 10 10 10.10261834542264 9.898424010574313 0.0 3 0.9978028583680884 26.32411587703225 58282.0 59.77610879687999 0.0 - - - - - - - 714.75 116 8 KIF6 kinesin family member 6 1341 171 B20140407_SF104_02 B20140407_SF104_02 TB390428.[MT7]-RPVSSIPLTGDSQTDSDIIAFIK[MT7].4y4_1.heavy 687.881 / 622.404 39711.0 35.70954990386963 33 7 10 6 10 0.4969485745410581 101.87251219944541 0.039402008056640625 3 0.731085631630534 2.3243642799831865 39711.0 31.509133644091627 0.0 - - - - - - - 1303.7142857142858 79 7 KIF6 kinesin family member 6 1343 171 B20140407_SF104_02 B20140407_SF104_02 TB390428.[MT7]-RPVSSIPLTGDSQTDSDIIAFIK[MT7].4b5_1.heavy 687.881 / 671.396 3727.0 35.70954990386963 33 7 10 6 10 0.4969485745410581 101.87251219944541 0.039402008056640625 3 0.731085631630534 2.3243642799831865 3727.0 2.9265538153170665 4.0 - - - - - - - 2184.714285714286 9 7 KIF6 kinesin family member 6 1345 171 B20140407_SF104_02 B20140407_SF104_02 TB390428.[MT7]-RPVSSIPLTGDSQTDSDIIAFIK[MT7].4y3_1.heavy 687.881 / 551.367 30072.0 35.70954990386963 33 7 10 6 10 0.4969485745410581 101.87251219944541 0.039402008056640625 3 0.731085631630534 2.3243642799831865 30072.0 25.963548165266573 0.0 - - - - - - - 1707.4285714285713 60 7 KIF6 kinesin family member 6 1347 171 B20140407_SF104_02 B20140407_SF104_02 TB390428.[MT7]-RPVSSIPLTGDSQTDSDIIAFIK[MT7].4b6_1.heavy 687.881 / 784.48 17349.0 35.70954990386963 33 7 10 6 10 0.4969485745410581 101.87251219944541 0.039402008056640625 3 0.731085631630534 2.3243642799831865 17349.0 18.769329265310972 0.0 - - - - - - - 785.5555555555555 34 9 KIF6 kinesin family member 6 1349 172 B20140407_SF104_02 B20140407_SF104_02 TB390422.[MT7]-SLC[CAM]VVQGLVDIYIFSEDTTFK[MT7].3b4_1.heavy 908.147 / 604.325 9322.0 45.38740158081055 50 20 10 10 10 6.055006343838358 16.515259327805843 0.0 3 0.9928447072299194 14.581069048121877 9322.0 27.05629008451219 0.0 - - - - - - - 242.6216216216216 18 37 INPP1 inositol polyphosphate-1-phosphatase 1351 172 B20140407_SF104_02 B20140407_SF104_02 TB390422.[MT7]-SLC[CAM]VVQGLVDIYIFSEDTTFK[MT7].3b10_1.heavy 908.147 / 1215.65 6154.0 45.38740158081055 50 20 10 10 10 6.055006343838358 16.515259327805843 0.0 3 0.9928447072299194 14.581069048121877 6154.0 50.344719007883455 0.0 - - - - - - - 146.97619047619048 12 42 INPP1 inositol polyphosphate-1-phosphatase 1353 172 B20140407_SF104_02 B20140407_SF104_02 TB390422.[MT7]-SLC[CAM]VVQGLVDIYIFSEDTTFK[MT7].3b5_1.heavy 908.147 / 703.393 10607.0 45.38740158081055 50 20 10 10 10 6.055006343838358 16.515259327805843 0.0 3 0.9928447072299194 14.581069048121877 10607.0 67.90973883338582 0.0 - - - - - - - 214.89743589743588 21 39 INPP1 inositol polyphosphate-1-phosphatase 1355 172 B20140407_SF104_02 B20140407_SF104_02 TB390422.[MT7]-SLC[CAM]VVQGLVDIYIFSEDTTFK[MT7].3b7_1.heavy 908.147 / 888.473 9956.0 45.38740158081055 50 20 10 10 10 6.055006343838358 16.515259327805843 0.0 3 0.9928447072299194 14.581069048121877 9956.0 22.530003844406387 0.0 - - - - - - - 207.07692307692307 19 39 INPP1 inositol polyphosphate-1-phosphatase 1357 173 B20140407_SF104_02 B20140407_SF104_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 929334.0 31.541099548339844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 929334.0 332.7197302928037 0.0 - - - - - - - 237.0 1858 2 1359 173 B20140407_SF104_02 B20140407_SF104_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 166107.0 31.541099548339844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 166107.0 197.38731316409496 1.0 - - - - - - - 395.0 332 2 1361 173 B20140407_SF104_02 B20140407_SF104_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 110158.0 31.541099548339844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 110158.0 52.66289248944265 0.0 - - - - - - - 237.0 220 2 1363 174 B20140407_SF104_02 B20140407_SF104_02 TB390327.[MT7]-FELNTYPLTVEC[CAM]LELR.3b4_1.heavy 714.374 / 648.347 27707.0 38.35110092163086 46 16 10 10 10 2.8866311055744327 27.562803243732237 0.0 3 0.9614751270287546 6.267401930002258 27707.0 41.31745614035088 0.0 - - - - - - - 734.4285714285714 55 7 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1365 174 B20140407_SF104_02 B20140407_SF104_02 TB390327.[MT7]-FELNTYPLTVEC[CAM]LELR.3b5_1.heavy 714.374 / 749.395 32472.0 38.35110092163086 46 16 10 10 10 2.8866311055744327 27.562803243732237 0.0 3 0.9614751270287546 6.267401930002258 32472.0 57.528259264758915 0.0 - - - - - - - 626.7777777777778 64 9 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1367 174 B20140407_SF104_02 B20140407_SF104_02 TB390327.[MT7]-FELNTYPLTVEC[CAM]LELR.3y8_1.heavy 714.374 / 1019.52 21439.0 38.35110092163086 46 16 10 10 10 2.8866311055744327 27.562803243732237 0.0 3 0.9614751270287546 6.267401930002258 21439.0 79.54097074468085 0.0 - - - - - - - 304.57142857142856 42 7 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1369 174 B20140407_SF104_02 B20140407_SF104_02 TB390327.[MT7]-FELNTYPLTVEC[CAM]LELR.3y10_1.heavy 714.374 / 1229.66 16298.0 38.35110092163086 46 16 10 10 10 2.8866311055744327 27.562803243732237 0.0 3 0.9614751270287546 6.267401930002258 16298.0 66.73931173436492 0.0 - - - - - - - 286.57142857142856 32 7 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1371 175 B20140407_SF104_02 B20140407_SF104_02 TB150826.[MT7]-TVIIEQSWGSPK[MT7].3b4_1.heavy 544.978 / 571.394 107844.0 30.5039005279541 48 18 10 10 10 4.575089334011295 21.85749669555045 0.0 3 0.9841559586925341 9.791614321232467 107844.0 68.899621531176 0.0 - - - - - - - 1372.3333333333333 215 3 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1373 175 B20140407_SF104_02 B20140407_SF104_02 TB150826.[MT7]-TVIIEQSWGSPK[MT7].3b5_1.heavy 544.978 / 700.436 71896.0 30.5039005279541 48 18 10 10 10 4.575089334011295 21.85749669555045 0.0 3 0.9841559586925341 9.791614321232467 71896.0 36.775576625999065 0.0 - - - - - - - 886.8 143 5 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1375 175 B20140407_SF104_02 B20140407_SF104_02 TB150826.[MT7]-TVIIEQSWGSPK[MT7].3y4_1.heavy 544.978 / 532.321 180216.0 30.5039005279541 48 18 10 10 10 4.575089334011295 21.85749669555045 0.0 3 0.9841559586925341 9.791614321232467 180216.0 83.13160104339633 0.0 - - - - - - - 1821.0 360 2 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1377 175 B20140407_SF104_02 B20140407_SF104_02 TB150826.[MT7]-TVIIEQSWGSPK[MT7].3y5_1.heavy 544.978 / 718.4 36423.0 30.5039005279541 48 18 10 10 10 4.575089334011295 21.85749669555045 0.0 3 0.9841559586925341 9.791614321232467 36423.0 16.800253960275892 1.0 - - - - - - - 831.5 80 4 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1379 176 B20140407_SF104_02 B20140407_SF104_02 TB150955.[MT7]-ALGESINEAR.2y8_1.heavy 602.326 / 875.422 23213.0 24.93779945373535 46 20 8 10 8 7.324402769038752 13.652990305600563 0.0 4 0.9955655147703841 18.52593531789643 23213.0 41.68995637109228 0.0 - - - - - - - 248.0 46 10 KIF6 kinesin family member 6 1381 176 B20140407_SF104_02 B20140407_SF104_02 TB150955.[MT7]-ALGESINEAR.2y9_1.heavy 602.326 / 988.506 24904.0 24.93779945373535 46 20 8 10 8 7.324402769038752 13.652990305600563 0.0 4 0.9955655147703841 18.52593531789643 24904.0 71.29239539968623 1.0 - - - - - - - 286.8181818181818 63 11 KIF6 kinesin family member 6 1383 176 B20140407_SF104_02 B20140407_SF104_02 TB150955.[MT7]-ALGESINEAR.2y6_1.heavy 602.326 / 689.358 13860.0 24.93779945373535 46 20 8 10 8 7.324402769038752 13.652990305600563 0.0 4 0.9955655147703841 18.52593531789643 13860.0 24.4482319391635 0.0 - - - - - - - 713.5555555555555 27 9 KIF6 kinesin family member 6 1385 176 B20140407_SF104_02 B20140407_SF104_02 TB150955.[MT7]-ALGESINEAR.2b7_1.heavy 602.326 / 829.454 3944.0 24.93779945373535 46 20 8 10 8 7.324402769038752 13.652990305600563 0.0 4 0.9955655147703841 18.52593531789643 3944.0 9.80538745309889 2.0 - - - - - - - 643.7142857142857 25 7 KIF6 kinesin family member 6 1387 177 B20140407_SF104_02 B20140407_SF104_02 TB151291.[MT7]-DVFVMFYAPWSK[MT7].2y4_1.heavy 889.465 / 661.379 3858.0 41.478248596191406 34 15 8 5 6 1.6819704529280153 41.294136064620055 0.041900634765625 5 0.9585321383320252 6.039406130959683 3858.0 2.2678038379530916 1.0 - - - - - - - 612.5 7 8 PDILT protein disulfide isomerase-like, testis expressed 1389 177 B20140407_SF104_02 B20140407_SF104_02 TB151291.[MT7]-DVFVMFYAPWSK[MT7].2b3_1.heavy 889.465 / 506.273 3858.0 41.478248596191406 34 15 8 5 6 1.6819704529280153 41.294136064620055 0.041900634765625 5 0.9585321383320252 6.039406130959683 3858.0 18.398917049419584 0.0 - - - - - - - 264.7692307692308 7 13 PDILT protein disulfide isomerase-like, testis expressed 1391 177 B20140407_SF104_02 B20140407_SF104_02 TB151291.[MT7]-DVFVMFYAPWSK[MT7].2y8_1.heavy 889.465 / 1173.59 1460.0 41.478248596191406 34 15 8 5 6 1.6819704529280153 41.294136064620055 0.041900634765625 5 0.9585321383320252 6.039406130959683 1460.0 4.7399398720159835 3.0 - - - - - - - 200.6153846153846 3 13 PDILT protein disulfide isomerase-like, testis expressed 1393 177 B20140407_SF104_02 B20140407_SF104_02 TB151291.[MT7]-DVFVMFYAPWSK[MT7].2b4_1.heavy 889.465 / 605.341 4067.0 41.478248596191406 34 15 8 5 6 1.6819704529280153 41.294136064620055 0.041900634765625 5 0.9585321383320252 6.039406130959683 4067.0 12.794298208412265 2.0 - - - - - - - 292.1 11 10 PDILT protein disulfide isomerase-like, testis expressed 1395 178 B20140407_SF104_02 B20140407_SF104_02 TB150635.[MT7]-GGLIAYR.2y4_1.heavy 447.27 / 522.304 30767.0 27.04319953918457 43 13 10 10 10 1.5777026673083618 50.30278720596728 0.0 3 0.9159967690512613 4.227915132362807 30767.0 23.182048091945163 1.0 - - - - - - - 407.0 65 1 INPP1 inositol polyphosphate-1-phosphatase 1397 178 B20140407_SF104_02 B20140407_SF104_02 TB150635.[MT7]-GGLIAYR.2b4_1.heavy 447.27 / 485.32 56791.0 27.04319953918457 43 13 10 10 10 1.5777026673083618 50.30278720596728 0.0 3 0.9159967690512613 4.227915132362807 56791.0 19.644442932883592 0.0 - - - - - - - 1898.0 113 2 INPP1 inositol polyphosphate-1-phosphatase 1399 178 B20140407_SF104_02 B20140407_SF104_02 TB150635.[MT7]-GGLIAYR.2y6_1.heavy 447.27 / 692.409 46083.0 27.04319953918457 43 13 10 10 10 1.5777026673083618 50.30278720596728 0.0 3 0.9159967690512613 4.227915132362807 46083.0 38.450748567456166 0.0 - - - - - - - 203.5 92 2 INPP1 inositol polyphosphate-1-phosphatase 1401 178 B20140407_SF104_02 B20140407_SF104_02 TB150635.[MT7]-GGLIAYR.2b5_1.heavy 447.27 / 556.357 88100.0 27.04319953918457 43 13 10 10 10 1.5777026673083618 50.30278720596728 0.0 3 0.9159967690512613 4.227915132362807 88100.0 41.83654154635868 0.0 - - - - - - - 678.0 176 1 INPP1 inositol polyphosphate-1-phosphatase 1403 179 B20140407_SF104_02 B20140407_SF104_02 TB499391.[MT7]-WASDLR.2b3_1.heavy 446.244 / 489.258 24439.0 27.770099639892578 43 15 10 10 8 2.486631369035847 40.21504805465938 0.0 4 0.9580834297616566 6.00676572791348 24439.0 10.8241130714338 2.0 - - - - - - - 419.0 70 1 RWDD3 RWD domain containing 3 1405 179 B20140407_SF104_02 B20140407_SF104_02 TB499391.[MT7]-WASDLR.2b3_2.heavy 446.244 / 245.133 N/A 27.770099639892578 43 15 10 10 8 2.486631369035847 40.21504805465938 0.0 4 0.9580834297616566 6.00676572791348 10334.0 1.8282061072732754 9.0 - - - - - - - 838.0 311 1 RWDD3 RWD domain containing 3 1407 179 B20140407_SF104_02 B20140407_SF104_02 TB499391.[MT7]-WASDLR.2y5_1.heavy 446.244 / 561.299 95523.0 27.770099639892578 43 15 10 10 8 2.486631369035847 40.21504805465938 0.0 4 0.9580834297616566 6.00676572791348 95523.0 79.20053289127586 0.0 - - - - - - - 279.5 191 2 RWDD3 RWD domain containing 3 1409 179 B20140407_SF104_02 B20140407_SF104_02 TB499391.[MT7]-WASDLR.2b4_1.heavy 446.244 / 604.285 690712.0 27.770099639892578 43 15 10 10 8 2.486631369035847 40.21504805465938 0.0 4 0.9580834297616566 6.00676572791348 690712.0 258.3194562992704 0.0 - - - - - - - 838.0 1381 5 RWDD3 RWD domain containing 3 1411 180 B20140407_SF104_02 B20140407_SF104_02 TB150939.[MT7]-C[CAM]EESFVK[MT7].2b3_1.heavy 593.804 / 563.225 N/A 24.67289924621582 48 18 10 10 10 4.6278026753477555 21.608527202920445 0.0 3 0.9898745146887986 12.254266193570613 5298.0 4.079601690539846 4.0 - - - - - - - 1724.625 10 8 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 1413 180 B20140407_SF104_02 B20140407_SF104_02 TB150939.[MT7]-C[CAM]EESFVK[MT7].2y4_1.heavy 593.804 / 624.384 5519.0 24.67289924621582 48 18 10 10 10 4.6278026753477555 21.608527202920445 0.0 3 0.9898745146887986 12.254266193570613 5519.0 23.09902846445168 0.0 - - - - - - - 748.0 11 9 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 1415 180 B20140407_SF104_02 B20140407_SF104_02 TB150939.[MT7]-C[CAM]EESFVK[MT7].2y5_1.heavy 593.804 / 753.426 4857.0 24.67289924621582 48 18 10 10 10 4.6278026753477555 21.608527202920445 0.0 3 0.9898745146887986 12.254266193570613 4857.0 15.838043478260872 0.0 - - - - - - - 648.5 9 8 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 1417 180 B20140407_SF104_02 B20140407_SF104_02 TB150939.[MT7]-C[CAM]EESFVK[MT7].2b5_1.heavy 593.804 / 797.326 2980.0 24.67289924621582 48 18 10 10 10 4.6278026753477555 21.608527202920445 0.0 3 0.9898745146887986 12.254266193570613 2980.0 12.559214501510574 0.0 - - - - - - - 214.11764705882354 5 17 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 1419 181 B20140407_SF104_02 B20140407_SF104_02 TB390188.[MT7]-LFPSGSQQAVLYK[MT7].2y4_1.heavy 863.492 / 666.431 2894.0 31.76460075378418 48 20 10 10 8 11.482445660991338 8.708946068843533 0.0 4 0.9921293930448974 13.90186281659839 2894.0 4.561554508772497 2.0 - - - - - - - 361.875 5 8 PDILT protein disulfide isomerase-like, testis expressed 1421 181 B20140407_SF104_02 B20140407_SF104_02 TB390188.[MT7]-LFPSGSQQAVLYK[MT7].2y5_1.heavy 863.492 / 737.468 2589.0 31.76460075378418 48 20 10 10 8 11.482445660991338 8.708946068843533 0.0 4 0.9921293930448974 13.90186281659839 2589.0 6.756780186959388 2.0 - - - - - - - 304.6363636363636 6 11 PDILT protein disulfide isomerase-like, testis expressed 1423 181 B20140407_SF104_02 B20140407_SF104_02 TB390188.[MT7]-LFPSGSQQAVLYK[MT7].2y9_1.heavy 863.492 / 1137.64 1066.0 31.76460075378418 48 20 10 10 8 11.482445660991338 8.708946068843533 0.0 4 0.9921293930448974 13.90186281659839 1066.0 1.1894521805463971 4.0 - - - - - - - 304.625 2 8 PDILT protein disulfide isomerase-like, testis expressed 1425 181 B20140407_SF104_02 B20140407_SF104_02 TB390188.[MT7]-LFPSGSQQAVLYK[MT7].2y3_1.heavy 863.492 / 567.362 6397.0 31.76460075378418 48 20 10 10 8 11.482445660991338 8.708946068843533 0.0 4 0.9921293930448974 13.90186281659839 6397.0 16.097483588621444 0.0 - - - - - - - 289.4 12 10 PDILT protein disulfide isomerase-like, testis expressed 1427 182 B20140407_SF104_02 B20140407_SF104_02 TB151293.[MT7]-EFSLWDPGQVWK[MT7].3y3_1.heavy 593.982 / 576.363 131480.0 38.21630096435547 44 14 10 10 10 4.214805576845301 23.725886799942984 0.0 3 0.9482408253332417 5.401040552791502 131480.0 63.854235711400776 0.0 - - - - - - - 650.0 262 1 RIBC1 RIB43A domain with coiled-coils 1 1429 182 B20140407_SF104_02 B20140407_SF104_02 TB151293.[MT7]-EFSLWDPGQVWK[MT7].3b6_1.heavy 593.982 / 922.443 140324.0 38.21630096435547 44 14 10 10 10 4.214805576845301 23.725886799942984 0.0 3 0.9482408253332417 5.401040552791502 140324.0 180.3964820824965 0.0 - - - - - - - 260.0 280 4 RIBC1 RIB43A domain with coiled-coils 1 1431 182 B20140407_SF104_02 B20140407_SF104_02 TB151293.[MT7]-EFSLWDPGQVWK[MT7].3b4_1.heavy 593.982 / 621.336 82321.0 38.21630096435547 44 14 10 10 10 4.214805576845301 23.725886799942984 0.0 3 0.9482408253332417 5.401040552791502 82321.0 91.510708303347 0.0 - - - - - - - 1202.875 164 8 RIBC1 RIB43A domain with coiled-coils 1 1433 182 B20140407_SF104_02 B20140407_SF104_02 TB151293.[MT7]-EFSLWDPGQVWK[MT7].3b3_1.heavy 593.982 / 508.252 61774.0 38.21630096435547 44 14 10 10 10 4.214805576845301 23.725886799942984 0.0 3 0.9482408253332417 5.401040552791502 61774.0 86.23953243025318 0.0 - - - - - - - 1207.2857142857142 123 7 RIBC1 RIB43A domain with coiled-coils 1 1435 183 B20140407_SF104_02 B20140407_SF104_02 TB151195.[MT7]-STITHLLGNWK[MT7].3b4_1.heavy 519.971 / 547.321 38765.0 32.654598236083984 50 20 10 10 10 10.989334905677712 9.099731772514671 0.0 3 0.9976651051010818 25.53548804671482 38765.0 26.471645984607015 0.0 - - - - - - - 285.25 77 4 ESPNL espin-like 1437 183 B20140407_SF104_02 B20140407_SF104_02 TB151195.[MT7]-STITHLLGNWK[MT7].3b5_1.heavy 519.971 / 684.38 18527.0 32.654598236083984 50 20 10 10 10 10.989334905677712 9.099731772514671 0.0 3 0.9976651051010818 25.53548804671482 18527.0 10.47522495480056 0.0 - - - - - - - 428.0 37 2 ESPNL espin-like 1439 183 B20140407_SF104_02 B20140407_SF104_02 TB151195.[MT7]-STITHLLGNWK[MT7].3y4_1.heavy 519.971 / 648.359 64418.0 32.654598236083984 50 20 10 10 10 10.989334905677712 9.099731772514671 0.0 3 0.9976651051010818 25.53548804671482 64418.0 55.60290526315789 0.0 - - - - - - - 380.3333333333333 128 3 ESPNL espin-like 1441 183 B20140407_SF104_02 B20140407_SF104_02 TB151195.[MT7]-STITHLLGNWK[MT7].3y5_1.heavy 519.971 / 761.443 45890.0 32.654598236083984 50 20 10 10 10 10.989334905677712 9.099731772514671 0.0 3 0.9976651051010818 25.53548804671482 45890.0 75.81584989258862 0.0 - - - - - - - 712.5714285714286 91 7 ESPNL espin-like 1443 184 B20140407_SF104_02 B20140407_SF104_02 TB389926.[MT7]-VDENYTGK[MT7].2y4_1.heavy 607.319 / 612.347 8683.0 21.95840072631836 45 15 10 10 10 3.7427819057146015 26.71809432639309 0.0 3 0.9537692619590733 5.71754308252635 8683.0 25.241279069767444 0.0 - - - - - - - 219.77777777777777 17 9 RIBC1 RIB43A domain with coiled-coils 1 1445 184 B20140407_SF104_02 B20140407_SF104_02 TB389926.[MT7]-VDENYTGK[MT7].2b4_1.heavy 607.319 / 602.29 10316.0 21.95840072631836 45 15 10 10 10 3.7427819057146015 26.71809432639309 0.0 3 0.9537692619590733 5.71754308252635 10316.0 18.17961757105943 0.0 - - - - - - - 711.4545454545455 20 11 RIBC1 RIB43A domain with coiled-coils 1 1447 184 B20140407_SF104_02 B20140407_SF104_02 TB389926.[MT7]-VDENYTGK[MT7].2y6_1.heavy 607.319 / 855.433 11520.0 21.95840072631836 45 15 10 10 10 3.7427819057146015 26.71809432639309 0.0 3 0.9537692619590733 5.71754308252635 11520.0 73.56279069767442 0.0 - - - - - - - 250.1818181818182 23 11 RIBC1 RIB43A domain with coiled-coils 1 1449 184 B20140407_SF104_02 B20140407_SF104_02 TB389926.[MT7]-VDENYTGK[MT7].2y7_1.heavy 607.319 / 970.46 19772.0 21.95840072631836 45 15 10 10 10 3.7427819057146015 26.71809432639309 0.0 3 0.9537692619590733 5.71754308252635 19772.0 81.23379844961241 0.0 - - - - - - - 225.75 39 16 RIBC1 RIB43A domain with coiled-coils 1 1451 185 B20140407_SF104_02 B20140407_SF104_02 TB390087.[MT7]-MLFPLLEELGR.2b3_1.heavy 731.416 / 536.302 3610.0 43.360074043273926 36 13 10 5 8 0.9262267288051744 69.02892437182552 0.040699005126953125 4 0.9097331812162853 4.076392435039269 3610.0 17.06834834550109 1.0 - - - - - - - 696.625 7 8 PDILT protein disulfide isomerase-like, testis expressed 1453 185 B20140407_SF104_02 B20140407_SF104_02 TB390087.[MT7]-MLFPLLEELGR.2y8_1.heavy 731.416 / 926.531 4725.0 43.360074043273926 36 13 10 5 8 0.9262267288051744 69.02892437182552 0.040699005126953125 4 0.9097331812162853 4.076392435039269 4725.0 28.83971956577927 0.0 - - - - - - - 245.375 9 16 PDILT protein disulfide isomerase-like, testis expressed 1455 185 B20140407_SF104_02 B20140407_SF104_02 TB390087.[MT7]-MLFPLLEELGR.2y9_1.heavy 731.416 / 1073.6 1221.0 43.360074043273926 36 13 10 5 8 0.9262267288051744 69.02892437182552 0.040699005126953125 4 0.9097331812162853 4.076392435039269 1221.0 15.435283018867924 1.0 - - - - - - - 144.86666666666667 2 15 PDILT protein disulfide isomerase-like, testis expressed 1457 185 B20140407_SF104_02 B20140407_SF104_02 TB390087.[MT7]-MLFPLLEELGR.2y7_1.heavy 731.416 / 829.478 637.0 43.360074043273926 36 13 10 5 8 0.9262267288051744 69.02892437182552 0.040699005126953125 4 0.9097331812162853 4.076392435039269 637.0 2.2898924731182797 25.0 - - - - - - - 241.77777777777777 3 18 PDILT protein disulfide isomerase-like, testis expressed 1459 186 B20140407_SF104_02 B20140407_SF104_02 TB151190.[MT7]-ILFILVDADEPR.3y6_1.heavy 515.632 / 702.305 72873.0 41.15489959716797 47 17 10 10 10 3.204880464270748 24.704601707545848 0.0 3 0.9762267037930247 7.988284247736852 72873.0 371.38557770451297 0.0 - - - - - - - 284.57142857142856 145 7 PDILT protein disulfide isomerase-like, testis expressed 1461 186 B20140407_SF104_02 B20140407_SF104_02 TB151190.[MT7]-ILFILVDADEPR.3b4_1.heavy 515.632 / 631.43 96758.0 41.15489959716797 47 17 10 10 10 3.204880464270748 24.704601707545848 0.0 3 0.9762267037930247 7.988284247736852 96758.0 247.3445606195432 0.0 - - - - - - - 331.6666666666667 193 6 PDILT protein disulfide isomerase-like, testis expressed 1463 186 B20140407_SF104_02 B20140407_SF104_02 TB151190.[MT7]-ILFILVDADEPR.3b5_1.heavy 515.632 / 744.514 30852.0 41.15489959716797 47 17 10 10 10 3.204880464270748 24.704601707545848 0.0 3 0.9762267037930247 7.988284247736852 30852.0 292.5751210104577 0.0 - - - - - - - 166.16666666666666 61 6 PDILT protein disulfide isomerase-like, testis expressed 1465 186 B20140407_SF104_02 B20140407_SF104_02 TB151190.[MT7]-ILFILVDADEPR.3y5_1.heavy 515.632 / 587.278 47992.0 41.15489959716797 47 17 10 10 10 3.204880464270748 24.704601707545848 0.0 3 0.9762267037930247 7.988284247736852 47992.0 225.59371882034606 0.0 - - - - - - - 258.0 95 6 PDILT protein disulfide isomerase-like, testis expressed 1467 187 B20140407_SF104_02 B20140407_SF104_02 TB499646.[MT7]-AVTDEVAAGRR.3y3_1.heavy 430.241 / 388.241 96005.0 21.450199127197266 40 10 10 10 10 0.6486525399280834 81.8105044098692 0.0 3 0.8416990094141502 3.0599725324070404 96005.0 20.24988480524485 0.0 - - - - - - - 2806.0 192 1 ESPNL espin-like 1469 187 B20140407_SF104_02 B20140407_SF104_02 TB499646.[MT7]-AVTDEVAAGRR.3b4_1.heavy 430.241 / 531.289 72790.0 21.450199127197266 40 10 10 10 10 0.6486525399280834 81.8105044098692 0.0 3 0.8416990094141502 3.0599725324070404 72790.0 32.84904565941396 0.0 - - - - - - - 1233.0 145 2 ESPNL espin-like 1471 187 B20140407_SF104_02 B20140407_SF104_02 TB499646.[MT7]-AVTDEVAAGRR.3b5_1.heavy 430.241 / 660.332 83420.0 21.450199127197266 40 10 10 10 10 0.6486525399280834 81.8105044098692 0.0 3 0.8416990094141502 3.0599725324070404 83420.0 81.5300955118752 0.0 - - - - - - - 783.8888888888889 166 9 ESPNL espin-like 1473 187 B20140407_SF104_02 B20140407_SF104_02 TB499646.[MT7]-AVTDEVAAGRR.3y5_1.heavy 430.241 / 530.316 54678.0 21.450199127197266 40 10 10 10 10 0.6486525399280834 81.8105044098692 0.0 3 0.8416990094141502 3.0599725324070404 54678.0 10.202132958875623 0.0 - - - - - - - 595.0 109 1 ESPNL espin-like 1475 188 B20140407_SF104_02 B20140407_SF104_02 TB499644.[MT7]-LRNPC[CAM]PNK[MT7].3y3_1.heavy 429.58 / 502.311 154571.0 20.77429962158203 50 20 10 10 10 1.8988938328083456 37.990504291825104 0.0 3 0.9930359385356511 14.780145581854276 154571.0 113.41920138880037 0.0 - - - - - - - 228.0 309 1 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1477 188 B20140407_SF104_02 B20140407_SF104_02 TB499644.[MT7]-LRNPC[CAM]PNK[MT7].3b3_2.heavy 429.58 / 264.672 27496.0 20.77429962158203 50 20 10 10 10 1.8988938328083456 37.990504291825104 0.0 3 0.9930359385356511 14.780145581854276 27496.0 58.154307992202725 1.0 - - - - - - - 354.6666666666667 54 9 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1479 188 B20140407_SF104_02 B20140407_SF104_02 TB499644.[MT7]-LRNPC[CAM]PNK[MT7].3b3_1.heavy 429.58 / 528.337 14052.0 20.77429962158203 50 20 10 10 10 1.8988938328083456 37.990504291825104 0.0 3 0.9930359385356511 14.780145581854276 14052.0 15.098016051614472 0.0 - - - - - - - 456.0 28 1 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1481 188 B20140407_SF104_02 B20140407_SF104_02 TB499644.[MT7]-LRNPC[CAM]PNK[MT7].3y5_1.heavy 429.58 / 759.394 10026.0 20.77429962158203 50 20 10 10 10 1.8988938328083456 37.990504291825104 0.0 3 0.9930359385356511 14.780145581854276 10026.0 41.08398496240602 0.0 - - - - - - - 618.7142857142857 20 7 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1483 189 B20140407_SF104_02 B20140407_SF104_02 TB499649.[MT7]-EC[CAM]QPPFAFR.2b3_1.heavy 648.32 / 562.241 N/A 30.75149917602539 42 20 2 10 10 8.143969606084115 12.279024215082165 0.0 3 0.9941181007455897 16.083867103744517 71522.0 32.24230534645167 1.0 - - - - - - - 1108.0 488 1 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1485 189 B20140407_SF104_02 B20140407_SF104_02 TB499649.[MT7]-EC[CAM]QPPFAFR.2y8_1.heavy 648.32 / 1022.49 34178.0 30.75149917602539 42 20 2 10 10 8.143969606084115 12.279024215082165 0.0 3 0.9941181007455897 16.083867103744517 34178.0 24.11771907763989 0.0 - - - - - - - 830.5 68 8 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1487 189 B20140407_SF104_02 B20140407_SF104_02 TB499649.[MT7]-EC[CAM]QPPFAFR.2y5_1.heavy 648.32 / 637.346 16773.0 30.75149917602539 42 20 2 10 10 8.143969606084115 12.279024215082165 0.0 3 0.9941181007455897 16.083867103744517 16773.0 15.499743964219507 0.0 - - - - - - - 316.5 33 2 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1489 189 B20140407_SF104_02 B20140407_SF104_02 TB499649.[MT7]-EC[CAM]QPPFAFR.2y6_1.heavy 648.32 / 734.398 86712.0 30.75149917602539 42 20 2 10 10 8.143969606084115 12.279024215082165 0.0 3 0.9941181007455897 16.083867103744517 86712.0 62.73439574340633 0.0 - - - - - - - 896.3333333333334 173 3 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1491 190 B20140407_SF104_02 B20140407_SF104_02 TB390336.[MT7]-VTLYLRPGQAAAFNVTFR.3y7_1.heavy 723.408 / 854.452 18063.0 34.845149993896484 41 15 10 6 10 4.211299044319287 23.745642127906393 0.03790283203125 3 0.954633412891186 5.7721633727853225 18063.0 17.458095298683123 0.0 - - - - - - - 731.25 36 8 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1493 190 B20140407_SF104_02 B20140407_SF104_02 TB390336.[MT7]-VTLYLRPGQAAAFNVTFR.3y17_2.heavy 723.408 / 963.023 150481.0 34.845149993896484 41 15 10 6 10 4.211299044319287 23.745642127906393 0.03790283203125 3 0.954633412891186 5.7721633727853225 150481.0 320.78656019254134 0.0 - - - - - - - 325.0 300 2 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1495 190 B20140407_SF104_02 B20140407_SF104_02 TB390336.[MT7]-VTLYLRPGQAAAFNVTFR.3y16_2.heavy 723.408 / 912.499 31448.0 34.845149993896484 41 15 10 6 10 4.211299044319287 23.745642127906393 0.03790283203125 3 0.954633412891186 5.7721633727853225 31448.0 66.22223076923076 0.0 - - - - - - - 697.2727272727273 62 11 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1497 190 B20140407_SF104_02 B20140407_SF104_02 TB390336.[MT7]-VTLYLRPGQAAAFNVTFR.3y9_1.heavy 723.408 / 996.526 11046.0 34.845149993896484 41 15 10 6 10 4.211299044319287 23.745642127906393 0.03790283203125 3 0.954633412891186 5.7721633727853225 11046.0 21.529807815660924 0.0 - - - - - - - 249.16666666666666 22 12 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1499 191 B20140407_SF104_02 B20140407_SF104_02 TB151385.[MT7]-ATLSPGWTTFYMSTSPNR.3y6_1.heavy 721.022 / 661.326 33959.0 35.57849884033203 45 15 10 10 10 1.789043294656624 37.870299920539075 0.0 3 0.951606268537139 5.587282591577234 33959.0 50.39474694815918 0.0 - - - - - - - 260.0 67 1 FAM151A family with sequence similarity 151, member A 1501 191 B20140407_SF104_02 B20140407_SF104_02 TB151385.[MT7]-ATLSPGWTTFYMSTSPNR.3b6_1.heavy 721.022 / 671.385 21859.0 35.57849884033203 45 15 10 10 10 1.789043294656624 37.870299920539075 0.0 3 0.951606268537139 5.587282591577234 21859.0 8.803255680385918 1.0 - - - - - - - 1784.5714285714287 43 7 FAM151A family with sequence similarity 151, member A 1503 191 B20140407_SF104_02 B20140407_SF104_02 TB151385.[MT7]-ATLSPGWTTFYMSTSPNR.3b4_1.heavy 721.022 / 517.31 25762.0 35.57849884033203 45 15 10 10 10 1.789043294656624 37.870299920539075 0.0 3 0.951606268537139 5.587282591577234 25762.0 21.494274957288255 0.0 - - - - - - - 390.0 51 1 FAM151A family with sequence similarity 151, member A 1505 191 B20140407_SF104_02 B20140407_SF104_02 TB151385.[MT7]-ATLSPGWTTFYMSTSPNR.3y8_1.heavy 721.022 / 955.43 15093.0 35.57849884033203 45 15 10 10 10 1.789043294656624 37.870299920539075 0.0 3 0.951606268537139 5.587282591577234 15093.0 28.097746688433798 0.0 - - - - - - - 748.375 30 8 FAM151A family with sequence similarity 151, member A 1507 192 B20140407_SF104_02 B20140407_SF104_02 TB150832.[MT7]-DDAMLLK[MT7].2y4_1.heavy 547.312 / 648.424 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1509 192 B20140407_SF104_02 B20140407_SF104_02 TB150832.[MT7]-DDAMLLK[MT7].2y5_1.heavy 547.312 / 719.461 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1511 192 B20140407_SF104_02 B20140407_SF104_02 TB150832.[MT7]-DDAMLLK[MT7].2b4_1.heavy 547.312 / 577.241 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1513 192 B20140407_SF104_02 B20140407_SF104_02 TB150832.[MT7]-DDAMLLK[MT7].2y3_1.heavy 547.312 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1515 193 B20140407_SF104_02 B20140407_SF104_02 TB499784.[MT7]-GVMLAVDAVIAELK[MT7].3b4_1.heavy 573.011 / 545.324 6955.0 45.250301361083984 41 11 10 10 10 0.9494474242597186 60.93365086658114 0.0 3 0.874141948269384 3.4415811067304207 6955.0 -1.084298440979957 1.0 - - - - - - - 303.875 13 16 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1517 193 B20140407_SF104_02 B20140407_SF104_02 TB499784.[MT7]-GVMLAVDAVIAELK[MT7].3b5_1.heavy 573.011 / 616.361 13348.0 45.250301361083984 41 11 10 10 10 0.9494474242597186 60.93365086658114 0.0 3 0.874141948269384 3.4415811067304207 13348.0 -4.075725190839691 1.0 - - - - - - - 212.76923076923077 26 13 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1519 193 B20140407_SF104_02 B20140407_SF104_02 TB499784.[MT7]-GVMLAVDAVIAELK[MT7].3y4_1.heavy 573.011 / 604.379 19406.0 45.250301361083984 41 11 10 10 10 0.9494474242597186 60.93365086658114 0.0 3 0.874141948269384 3.4415811067304207 19406.0 -13.861428571428576 0.0 - - - - - - - 109.0 38 12 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1521 193 B20140407_SF104_02 B20140407_SF104_02 TB499784.[MT7]-GVMLAVDAVIAELK[MT7].3b7_1.heavy 573.011 / 830.456 11404.0 45.250301361083984 41 11 10 10 10 0.9494474242597186 60.93365086658114 0.0 3 0.874141948269384 3.4415811067304207 11404.0 -36.590374331550805 0.0 - - - - - - - 108.72727272727273 22 11 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1523 194 B20140407_SF104_02 B20140407_SF104_02 TB150833.[MT7]-AQC[CAM]VTVK[MT7].2y4_1.heavy 547.318 / 590.399 14654.0 21.43174934387207 44 18 10 6 10 2.8410256946880486 27.976732804685504 0.036899566650390625 3 0.9832084428242845 9.5105864421935 14654.0 27.978508927891657 0.0 - - - - - - - 629.1111111111111 29 9 RWDD3 RWD domain containing 3 1525 194 B20140407_SF104_02 B20140407_SF104_02 TB150833.[MT7]-AQC[CAM]VTVK[MT7].2b3_1.heavy 547.318 / 504.236 14987.0 21.43174934387207 44 18 10 6 10 2.8410256946880486 27.976732804685504 0.036899566650390625 3 0.9832084428242845 9.5105864421935 14987.0 18.3189111924961 1.0 - - - - - - - 1165.5714285714287 29 7 RWDD3 RWD domain containing 3 1527 194 B20140407_SF104_02 B20140407_SF104_02 TB150833.[MT7]-AQC[CAM]VTVK[MT7].2y5_1.heavy 547.318 / 750.43 23563.0 21.43174934387207 44 18 10 6 10 2.8410256946880486 27.976732804685504 0.036899566650390625 3 0.9832084428242845 9.5105864421935 23563.0 59.03185941417074 0.0 - - - - - - - 326.53846153846155 47 13 RWDD3 RWD domain containing 3 1529 194 B20140407_SF104_02 B20140407_SF104_02 TB150833.[MT7]-AQC[CAM]VTVK[MT7].2y6_1.heavy 547.318 / 878.489 19983.0 21.43174934387207 44 18 10 6 10 2.8410256946880486 27.976732804685504 0.036899566650390625 3 0.9832084428242845 9.5105864421935 19983.0 20.103018018018016 0.0 - - - - - - - 678.0 39 7 RWDD3 RWD domain containing 3 1531 195 B20140407_SF104_02 B20140407_SF104_02 TB150947.[MT7]-LINDSTNK[MT7].3y3_1.heavy 398.231 / 506.306 41587.0 23.569499969482422 50 20 10 10 10 5.447095592602576 18.358407393438245 0.0 3 0.992262965673649 14.021507133974943 41587.0 20.49628299513716 0.0 - - - - - - - 497.0 83 1 PDILT protein disulfide isomerase-like, testis expressed 1533 195 B20140407_SF104_02 B20140407_SF104_02 TB150947.[MT7]-LINDSTNK[MT7].3b4_1.heavy 398.231 / 600.347 49944.0 23.569499969482422 50 20 10 10 10 5.447095592602576 18.358407393438245 0.0 3 0.992262965673649 14.021507133974943 49944.0 90.35095477386935 0.0 - - - - - - - 417.4 99 5 PDILT protein disulfide isomerase-like, testis expressed 1535 195 B20140407_SF104_02 B20140407_SF104_02 TB150947.[MT7]-LINDSTNK[MT7].3b3_1.heavy 398.231 / 485.32 44373.0 23.569499969482422 50 20 10 10 10 5.447095592602576 18.358407393438245 0.0 3 0.992262965673649 14.021507133974943 44373.0 21.23649581304385 0.0 - - - - - - - 796.0 88 1 PDILT protein disulfide isomerase-like, testis expressed 1537 196 B20140407_SF104_02 B20140407_SF104_02 TB150834.[MT7]-K[MT7]VQEFR.3y3_1.heavy 365.557 / 451.23 83581.0 21.413299560546875 46 16 10 10 10 2.776518628136262 36.016325979820635 0.0 3 0.9659719826366298 6.671212525567692 83581.0 98.40474403335995 0.0 - - - - - - - 1280.25 167 8 RIBC1 RIB43A domain with coiled-coils 1 1539 196 B20140407_SF104_02 B20140407_SF104_02 TB150834.[MT7]-K[MT7]VQEFR.3b3_1.heavy 365.557 / 644.433 13792.0 21.413299560546875 46 16 10 10 10 2.776518628136262 36.016325979820635 0.0 3 0.9659719826366298 6.671212525567692 13792.0 46.25162227602906 0.0 - - - - - - - 247.8125 27 16 RIBC1 RIB43A domain with coiled-coils 1 1541 196 B20140407_SF104_02 B20140407_SF104_02 TB150834.[MT7]-K[MT7]VQEFR.3y4_1.heavy 365.557 / 579.289 88536.0 21.413299560546875 46 16 10 10 10 2.776518628136262 36.016325979820635 0.0 3 0.9659719826366298 6.671212525567692 88536.0 150.24843246795925 0.0 - - - - - - - 735.8181818181819 177 11 RIBC1 RIB43A domain with coiled-coils 1 1543 196 B20140407_SF104_02 B20140407_SF104_02 TB150834.[MT7]-K[MT7]VQEFR.3y5_1.heavy 365.557 / 678.357 96630.0 21.413299560546875 46 16 10 10 10 2.776518628136262 36.016325979820635 0.0 3 0.9659719826366298 6.671212525567692 96630.0 241.61430434735448 0.0 - - - - - - - 291.8 193 15 RIBC1 RIB43A domain with coiled-coils 1 1545 197 B20140407_SF104_02 B20140407_SF104_02 TB499503.[MT7]-FGDFVWR.2y5_1.heavy 535.781 / 722.362 13507.0 35.287166595458984 42 18 10 6 8 6.627665042383956 15.08827005596985 0.039699554443359375 4 0.9878044604703408 11.163991552107971 13507.0 22.356914543559 1.0 - - - - - - - 778.125 27 8 ASTN2 astrotactin 2 1547 197 B20140407_SF104_02 B20140407_SF104_02 TB499503.[MT7]-FGDFVWR.2y6_1.heavy 535.781 / 779.383 89117.0 35.287166595458984 42 18 10 6 8 6.627665042383956 15.08827005596985 0.039699554443359375 4 0.9878044604703408 11.163991552107971 89117.0 89.35935725835886 0.0 - - - - - - - 728.5 178 10 ASTN2 astrotactin 2 1549 197 B20140407_SF104_02 B20140407_SF104_02 TB499503.[MT7]-FGDFVWR.2b5_1.heavy 535.781 / 710.363 50849.0 35.287166595458984 42 18 10 6 8 6.627665042383956 15.08827005596985 0.039699554443359375 4 0.9878044604703408 11.163991552107971 50849.0 104.72217573426147 0.0 - - - - - - - 719.1428571428571 101 7 ASTN2 astrotactin 2 1551 198 B20140407_SF104_02 B20140407_SF104_02 TB151094.[MT7]-NFNVVVFDK[MT7].2b3_1.heavy 685.39 / 520.264 21501.0 32.7495002746582 31 13 0 10 8 2.0411565917219012 39.092876689781 0.0 4 0.9091496535996942 4.063075707376559 21501.0 17.21346832845989 0.0 - - - - - - - 949.3333333333334 43 3 PDILT protein disulfide isomerase-like, testis expressed 1553 198 B20140407_SF104_02 B20140407_SF104_02 TB151094.[MT7]-NFNVVVFDK[MT7].2y5_1.heavy 685.39 / 751.447 29190.0 32.7495002746582 31 13 0 10 8 2.0411565917219012 39.092876689781 0.0 4 0.9091496535996942 4.063075707376559 29190.0 11.438866853342008 0.0 - - - - - - - 284.5 58 2 PDILT protein disulfide isomerase-like, testis expressed 1555 198 B20140407_SF104_02 B20140407_SF104_02 TB151094.[MT7]-NFNVVVFDK[MT7].2b4_1.heavy 685.39 / 619.332 34316.0 32.7495002746582 31 13 0 10 8 2.0411565917219012 39.092876689781 0.0 4 0.9091496535996942 4.063075707376559 34316.0 10.610039243933334 1.0 - - - - - - - 1637.5 235 4 PDILT protein disulfide isomerase-like, testis expressed 1557 198 B20140407_SF104_02 B20140407_SF104_02 TB151094.[MT7]-NFNVVVFDK[MT7].2y3_1.heavy 685.39 / 553.31 22498.0 32.7495002746582 31 13 0 10 8 2.0411565917219012 39.092876689781 0.0 4 0.9091496535996942 4.063075707376559 22498.0 7.402773137673785 0.0 - - - - - - - 712.3333333333334 44 3 PDILT protein disulfide isomerase-like, testis expressed 1559 199 B20140407_SF104_02 B20140407_SF104_02 TB150944.[MT7]-TTEGC[CAM]LNPR.2y8_1.heavy 596.299 / 946.441 18029.0 21.404074668884277 46 20 10 6 10 11.323602670713814 8.831111697218905 0.036899566650390625 3 0.9948277882982073 17.15287240990345 18029.0 105.77497983870968 0.0 - - - - - - - 220.46666666666667 36 15 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1561 199 B20140407_SF104_02 B20140407_SF104_02 TB150944.[MT7]-TTEGC[CAM]LNPR.2y6_1.heavy 596.299 / 716.351 17946.0 21.404074668884277 46 20 10 6 10 11.323602670713814 8.831111697218905 0.036899566650390625 3 0.9948277882982073 17.15287240990345 17946.0 123.38922383960451 0.0 - - - - - - - 267.2307692307692 35 13 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1563 199 B20140407_SF104_02 B20140407_SF104_02 TB150944.[MT7]-TTEGC[CAM]LNPR.2b5_1.heavy 596.299 / 693.299 4383.0 21.404074668884277 46 20 10 6 10 11.323602670713814 8.831111697218905 0.036899566650390625 3 0.9948277882982073 17.15287240990345 4383.0 2.7375352585627937 0.0 - - - - - - - 226.06666666666666 8 15 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1565 199 B20140407_SF104_02 B20140407_SF104_02 TB150944.[MT7]-TTEGC[CAM]LNPR.2y7_1.heavy 596.299 / 845.393 5458.0 21.404074668884277 46 20 10 6 10 11.323602670713814 8.831111697218905 0.036899566650390625 3 0.9948277882982073 17.15287240990345 5458.0 45.93054655314474 0.0 - - - - - - - 206.6 10 10 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1567 200 B20140407_SF104_02 B20140407_SF104_02 TB499879.[MT7]-LEVIIPERYPFEPPQIR.3b4_1.heavy 747.424 / 599.388 80531.0 36.27470016479492 45 15 10 10 10 1.3111378203325534 48.82864674860712 0.0 3 0.9583025681537769 6.022640842757498 80531.0 33.88115324760021 0.0 - - - - - - - 708.5 161 2 UBE2T ubiquitin-conjugating enzyme E2T (putative) 1569 200 B20140407_SF104_02 B20140407_SF104_02 TB499879.[MT7]-LEVIIPERYPFEPPQIR.3y8_1.heavy 747.424 / 983.531 31955.0 36.27470016479492 45 15 10 10 10 1.3111378203325534 48.82864674860712 0.0 3 0.9583025681537769 6.022640842757498 31955.0 37.62069336906889 0.0 - - - - - - - 290.25 63 4 UBE2T ubiquitin-conjugating enzyme E2T (putative) 1571 200 B20140407_SF104_02 B20140407_SF104_02 TB499879.[MT7]-LEVIIPERYPFEPPQIR.3y5_1.heavy 747.424 / 610.367 122794.0 36.27470016479492 45 15 10 10 10 1.3111378203325534 48.82864674860712 0.0 3 0.9583025681537769 6.022640842757498 122794.0 53.238454137825954 0.0 - - - - - - - 644.0 245 1 UBE2T ubiquitin-conjugating enzyme E2T (putative) 1573 200 B20140407_SF104_02 B20140407_SF104_02 TB499879.[MT7]-LEVIIPERYPFEPPQIR.3y9_1.heavy 747.424 / 1146.59 12241.0 36.27470016479492 45 15 10 10 10 1.3111378203325534 48.82864674860712 0.0 3 0.9583025681537769 6.022640842757498 12241.0 21.628728077862135 0.0 - - - - - - - 290.25 24 8 UBE2T ubiquitin-conjugating enzyme E2T (putative) 1575 201 B20140407_SF104_02 B20140407_SF104_02 TB499671.[MT7]-QIQEWGVSVR.2y8_1.heavy 673.371 / 960.49 26694.0 30.142849922180176 43 18 10 5 10 2.709692563723091 29.331494595156652 0.04870033264160156 3 0.9810703917704916 8.955793711775495 26694.0 80.3935570767261 0.0 - - - - - - - 343.2 53 5 ESPNL espin-like 1577 201 B20140407_SF104_02 B20140407_SF104_02 TB499671.[MT7]-QIQEWGVSVR.2y9_1.heavy 673.371 / 1073.57 32938.0 30.142849922180176 43 18 10 5 10 2.709692563723091 29.331494595156652 0.04870033264160156 3 0.9810703917704916 8.955793711775495 32938.0 89.93309195289015 0.0 - - - - - - - 326.1818181818182 65 11 ESPNL espin-like 1579 201 B20140407_SF104_02 B20140407_SF104_02 TB499671.[MT7]-QIQEWGVSVR.2y6_1.heavy 673.371 / 703.389 18733.0 30.142849922180176 43 18 10 5 10 2.709692563723091 29.331494595156652 0.04870033264160156 3 0.9810703917704916 8.955793711775495 18733.0 9.083615097107645 1.0 - - - - - - - 312.0 37 3 ESPNL espin-like 1581 201 B20140407_SF104_02 B20140407_SF104_02 TB499671.[MT7]-QIQEWGVSVR.2y7_1.heavy 673.371 / 832.431 17172.0 30.142849922180176 43 18 10 5 10 2.709692563723091 29.331494595156652 0.04870033264160156 3 0.9810703917704916 8.955793711775495 17172.0 30.05558164354322 0.0 - - - - - - - 364.0 34 6 ESPNL espin-like 1583 202 B20140407_SF104_02 B20140407_SF104_02 TB390015.[MT7]-SEDELGPRK[MT7].3y7_1.heavy 440.245 / 958.544 N/A 20.88990020751953 48 18 10 10 10 3.8653503790415744 25.870875908743702 0.0 3 0.9832136275525811 9.51205920922457 77.0 1.63 22.0 - - - - - - - 0.0 0 0 ASTN2 astrotactin 2 1585 202 B20140407_SF104_02 B20140407_SF104_02 TB390015.[MT7]-SEDELGPRK[MT7].3b4_1.heavy 440.245 / 605.253 129065.0 20.88990020751953 48 18 10 10 10 3.8653503790415744 25.870875908743702 0.0 3 0.9832136275525811 9.51205920922457 129065.0 141.41599477204053 0.0 - - - - - - - 1305.0 258 8 ASTN2 astrotactin 2 1587 202 B20140407_SF104_02 B20140407_SF104_02 TB390015.[MT7]-SEDELGPRK[MT7].3y4_1.heavy 440.245 / 601.39 16661.0 20.88990020751953 48 18 10 10 10 3.8653503790415744 25.870875908743702 0.0 3 0.9832136275525811 9.51205920922457 16661.0 28.52656281971766 0.0 - - - - - - - 759.2222222222222 33 9 ASTN2 astrotactin 2 1589 202 B20140407_SF104_02 B20140407_SF104_02 TB390015.[MT7]-SEDELGPRK[MT7].3b3_1.heavy 440.245 / 476.211 129142.0 20.88990020751953 48 18 10 10 10 3.8653503790415744 25.870875908743702 0.0 3 0.9832136275525811 9.51205920922457 129142.0 117.69615213284841 0.0 - - - - - - - 1742.8 258 10 ASTN2 astrotactin 2 1591 203 B20140407_SF104_02 B20140407_SF104_02 TB499464.[MT7]-ELSYVIR.2b3_1.heavy 512.301 / 474.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1593 203 B20140407_SF104_02 B20140407_SF104_02 TB499464.[MT7]-ELSYVIR.2y4_1.heavy 512.301 / 550.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1595 203 B20140407_SF104_02 B20140407_SF104_02 TB499464.[MT7]-ELSYVIR.2y6_1.heavy 512.301 / 750.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1597 203 B20140407_SF104_02 B20140407_SF104_02 TB499464.[MT7]-ELSYVIR.2b5_1.heavy 512.301 / 736.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1599 204 B20140407_SF104_02 B20140407_SF104_02 TB499574.[MT7]-AVGPSLDLLR.2y8_1.heavy 592.86 / 870.504 162605.0 33.46255111694336 43 18 10 5 10 3.818722585523744 26.186767370608788 0.0457000732421875 3 0.9864224971139594 10.579369941540964 162605.0 457.9727528901734 0.0 - - - - - - - 242.0 325 4 FAM151A family with sequence similarity 151, member A 1601 204 B20140407_SF104_02 B20140407_SF104_02 TB499574.[MT7]-AVGPSLDLLR.2y9_1.heavy 592.86 / 969.573 108634.0 33.46255111694336 43 18 10 5 10 3.818722585523744 26.186767370608788 0.0457000732421875 3 0.9864224971139594 10.579369941540964 108634.0 103.41272451691398 0.0 - - - - - - - 276.8333333333333 217 6 FAM151A family with sequence similarity 151, member A 1603 204 B20140407_SF104_02 B20140407_SF104_02 TB499574.[MT7]-AVGPSLDLLR.2b7_1.heavy 592.86 / 784.432 77082.0 33.46255111694336 43 18 10 5 10 3.818722585523744 26.186767370608788 0.0457000732421875 3 0.9864224971139594 10.579369941540964 77082.0 115.54135166251632 0.0 - - - - - - - 323.0 154 3 FAM151A family with sequence similarity 151, member A 1605 204 B20140407_SF104_02 B20140407_SF104_02 TB499574.[MT7]-AVGPSLDLLR.2y7_1.heavy 592.86 / 813.483 89398.0 33.46255111694336 43 18 10 5 10 3.818722585523744 26.186767370608788 0.0457000732421875 3 0.9864224971139594 10.579369941540964 89398.0 175.91002712798146 0.0 - - - - - - - 1759.4285714285713 178 7 FAM151A family with sequence similarity 151, member A 1607 205 B20140407_SF104_02 B20140407_SF104_02 TB389779.[MT7]-GSGTTSGTTR.2y8_1.heavy 534.774 / 780.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 1609 205 B20140407_SF104_02 B20140407_SF104_02 TB389779.[MT7]-GSGTTSGTTR.2y9_1.heavy 534.774 / 867.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 1611 205 B20140407_SF104_02 B20140407_SF104_02 TB389779.[MT7]-GSGTTSGTTR.2y6_1.heavy 534.774 / 622.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 1613 205 B20140407_SF104_02 B20140407_SF104_02 TB389779.[MT7]-GSGTTSGTTR.2y7_1.heavy 534.774 / 723.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 1615 206 B20140407_SF104_02 B20140407_SF104_02 TB499770.[MT7]-TLSYIFEQLQK[MT7].3b6_1.heavy 553.318 / 869.489 48549.0 38.80149841308594 46 16 10 10 10 1.9907680470768745 34.56785591399271 0.0 3 0.9665138528661165 6.72527992575579 48549.0 457.89108527131776 0.0 - - - - - - - 206.4 97 10 KIF6 kinesin family member 6 1617 206 B20140407_SF104_02 B20140407_SF104_02 TB499770.[MT7]-TLSYIFEQLQK[MT7].3y3_1.heavy 553.318 / 532.357 192259.0 38.80149841308594 46 16 10 10 10 1.9907680470768745 34.56785591399271 0.0 3 0.9665138528661165 6.72527992575579 192259.0 180.13099398478028 0.0 - - - - - - - 322.5 384 2 KIF6 kinesin family member 6 1619 206 B20140407_SF104_02 B20140407_SF104_02 TB499770.[MT7]-TLSYIFEQLQK[MT7].3b4_1.heavy 553.318 / 609.336 190064.0 38.80149841308594 46 16 10 10 10 1.9907680470768745 34.56785591399271 0.0 3 0.9665138528661165 6.72527992575579 190064.0 748.570352326707 0.0 - - - - - - - 225.75 380 4 KIF6 kinesin family member 6 1621 206 B20140407_SF104_02 B20140407_SF104_02 TB499770.[MT7]-TLSYIFEQLQK[MT7].3b5_1.heavy 553.318 / 722.42 277478.0 38.80149841308594 46 16 10 10 10 1.9907680470768745 34.56785591399271 0.0 3 0.9665138528661165 6.72527992575579 277478.0 588.8612869000078 0.0 - - - - - - - 258.0 554 6 KIF6 kinesin family member 6 1623 207 B20140407_SF104_02 B20140407_SF104_02 TB151458.[MT7]-NLTLHQATTEEEALNLLFLGDTNR.4y5_1.heavy 715.126 / 562.258 125980.0 38.66239929199219 46 16 10 10 10 2.403206127468909 28.621460501160925 0.0 3 0.9648661069816142 6.56476862517737 125980.0 80.36722809249255 0.0 - - - - - - - 1271.2222222222222 251 9 KIF6 kinesin family member 6 1625 207 B20140407_SF104_02 B20140407_SF104_02 TB151458.[MT7]-NLTLHQATTEEEALNLLFLGDTNR.4b12_2.heavy 715.126 / 756.377 89986.0 38.66239929199219 46 16 10 10 10 2.403206127468909 28.621460501160925 0.0 3 0.9648661069816142 6.56476862517737 89986.0 66.35475281124734 0.0 - - - - - - - 707.1666666666666 179 6 KIF6 kinesin family member 6 1627 207 B20140407_SF104_02 B20140407_SF104_02 TB151458.[MT7]-NLTLHQATTEEEALNLLFLGDTNR.4y7_1.heavy 715.126 / 822.41 89086.0 38.66239929199219 46 16 10 10 10 2.403206127468909 28.621460501160925 0.0 3 0.9648661069816142 6.56476862517737 89086.0 90.834439763865 0.0 - - - - - - - 386.0 178 2 KIF6 kinesin family member 6 1629 207 B20140407_SF104_02 B20140407_SF104_02 TB151458.[MT7]-NLTLHQATTEEEALNLLFLGDTNR.4y6_1.heavy 715.126 / 675.342 61833.0 38.66239929199219 46 16 10 10 10 2.403206127468909 28.621460501160925 0.0 3 0.9648661069816142 6.56476862517737 61833.0 77.67168825974673 0.0 - - - - - - - 822.8 123 10 KIF6 kinesin family member 6 1631 208 B20140407_SF104_02 B20140407_SF104_02 TB151356.[MT7]-NNQFNQDELALMEK[MT7].3y3_1.heavy 661.335 / 551.298 48274.0 31.89590072631836 44 14 10 10 10 3.0835378212737976 32.43028164275617 0.0 3 0.9430212961256452 5.145434722004732 48274.0 23.78875639745477 0.0 - - - - - - - 453.0 96 1 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1633 208 B20140407_SF104_02 B20140407_SF104_02 TB151356.[MT7]-NNQFNQDELALMEK[MT7].3b4_1.heavy 661.335 / 648.322 17801.0 31.89590072631836 44 14 10 10 10 3.0835378212737976 32.43028164275617 0.0 3 0.9430212961256452 5.145434722004732 17801.0 13.416917264524425 1.0 - - - - - - - 1681.0 35 7 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1635 208 B20140407_SF104_02 B20140407_SF104_02 TB151356.[MT7]-NNQFNQDELALMEK[MT7].3b5_1.heavy 661.335 / 762.365 13275.0 31.89590072631836 44 14 10 10 10 3.0835378212737976 32.43028164275617 0.0 3 0.9430212961256452 5.145434722004732 13275.0 15.386766636450549 0.0 - - - - - - - 1223.7777777777778 26 9 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1637 208 B20140407_SF104_02 B20140407_SF104_02 TB151356.[MT7]-NNQFNQDELALMEK[MT7].3b3_1.heavy 661.335 / 501.254 23534.0 31.89590072631836 44 14 10 10 10 3.0835378212737976 32.43028164275617 0.0 3 0.9430212961256452 5.145434722004732 23534.0 21.490391160293708 0.0 - - - - - - - 1207.0 47 7 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1639 209 B20140407_SF104_02 B20140407_SF104_02 TB151313.[MT7]-HQQGIYSIDEDEK[MT7].3y3_1.heavy 617.311 / 535.284 29273.0 25.1835994720459 46 16 10 10 10 2.8009803235113413 28.55743410339852 0.0 3 0.9697204052121624 7.074330583507428 29273.0 74.27814617355433 0.0 - - - - - - - 362.0 58 6 KIF6 kinesin family member 6 1641 209 B20140407_SF104_02 B20140407_SF104_02 TB151313.[MT7]-HQQGIYSIDEDEK[MT7].3b4_1.heavy 617.311 / 595.307 41508.0 25.1835994720459 46 16 10 10 10 2.8009803235113413 28.55743410339852 0.0 3 0.9697204052121624 7.074330583507428 41508.0 27.03811411911704 0.0 - - - - - - - 1372.0 83 1 KIF6 kinesin family member 6 1643 209 B20140407_SF104_02 B20140407_SF104_02 TB151313.[MT7]-HQQGIYSIDEDEK[MT7].3b5_1.heavy 617.311 / 708.391 39564.0 25.1835994720459 46 16 10 10 10 2.8009803235113413 28.55743410339852 0.0 3 0.9697204052121624 7.074330583507428 39564.0 61.44379045476458 0.0 - - - - - - - 314.375 79 8 KIF6 kinesin family member 6 1645 209 B20140407_SF104_02 B20140407_SF104_02 TB151313.[MT7]-HQQGIYSIDEDEK[MT7].3y5_1.heavy 617.311 / 779.354 48369.0 25.1835994720459 46 16 10 10 10 2.8009803235113413 28.55743410339852 0.0 3 0.9697204052121624 7.074330583507428 48369.0 60.077096510477176 0.0 - - - - - - - 637.1428571428571 96 7 KIF6 kinesin family member 6 1647 210 B20140407_SF104_02 B20140407_SF104_02 TB499469.[MT7]-DVTVELGR.2y5_1.heavy 516.794 / 573.336 38987.0 26.865299224853516 48 18 10 10 10 3.4213067872172918 29.228597790066836 0.0 3 0.9820055791146728 9.186287508398692 38987.0 20.005195410838844 0.0 - - - - - - - 1177.0 77 1 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 1649 210 B20140407_SF104_02 B20140407_SF104_02 TB499469.[MT7]-DVTVELGR.2y6_1.heavy 516.794 / 674.383 93280.0 26.865299224853516 48 18 10 10 10 3.4213067872172918 29.228597790066836 0.0 3 0.9820055791146728 9.186287508398692 93280.0 91.123201648876 0.0 - - - - - - - 392.0 186 2 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 1651 210 B20140407_SF104_02 B20140407_SF104_02 TB499469.[MT7]-DVTVELGR.2b5_1.heavy 516.794 / 688.363 66199.0 26.865299224853516 48 18 10 10 10 3.4213067872172918 29.228597790066836 0.0 3 0.9820055791146728 9.186287508398692 66199.0 54.81972495566314 0.0 - - - - - - - 1759.111111111111 132 9 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 1653 210 B20140407_SF104_02 B20140407_SF104_02 TB499469.[MT7]-DVTVELGR.2y7_1.heavy 516.794 / 773.452 99037.0 26.865299224853516 48 18 10 10 10 3.4213067872172918 29.228597790066836 0.0 3 0.9820055791146728 9.186287508398692 99037.0 51.4597477316012 0.0 - - - - - - - 262.0 198 1 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 1655 211 B20140407_SF104_02 B20140407_SF104_02 TB151311.[MT7]-FLTPIYHPNIDSAGR.3y7_1.heavy 615.664 / 732.364 53003.0 31.76460075378418 50 20 10 10 10 17.33843657282 5.767532705732046 0.0 3 0.9962251920472177 20.080671408054016 53003.0 43.58250654470568 0.0 - - - - - - - 254.33333333333334 106 3 UBE2T ubiquitin-conjugating enzyme E2T (putative) 1657 211 B20140407_SF104_02 B20140407_SF104_02 TB151311.[MT7]-FLTPIYHPNIDSAGR.3b5_1.heavy 615.664 / 716.446 110589.0 31.76460075378418 50 20 10 10 10 17.33843657282 5.767532705732046 0.0 3 0.9962251920472177 20.080671408054016 110589.0 143.8923977086743 0.0 - - - - - - - 458.0 221 1 UBE2T ubiquitin-conjugating enzyme E2T (putative) 1659 211 B20140407_SF104_02 B20140407_SF104_02 TB151311.[MT7]-FLTPIYHPNIDSAGR.3b3_1.heavy 615.664 / 506.31 149693.0 31.76460075378418 50 20 10 10 10 17.33843657282 5.767532705732046 0.0 3 0.9962251920472177 20.080671408054016 149693.0 110.56762651510903 0.0 - - - - - - - 305.0 299 1 UBE2T ubiquitin-conjugating enzyme E2T (putative) 1661 211 B20140407_SF104_02 B20140407_SF104_02 TB151311.[MT7]-FLTPIYHPNIDSAGR.3y8_1.heavy 615.664 / 829.416 320770.0 31.76460075378418 50 20 10 10 10 17.33843657282 5.767532705732046 0.0 3 0.9962251920472177 20.080671408054016 320770.0 398.2476933018589 0.0 - - - - - - - 229.0 641 2 UBE2T ubiquitin-conjugating enzyme E2T (putative) 1663 212 B20140407_SF104_02 B20140407_SF104_02 TB151082.[MT7]-AVDLLQWSK[MT7].2b8_2.heavy 674.397 / 529.294 127580.0 34.40909957885742 42 12 10 10 10 1.3379482839200363 47.35097847740245 0.0 3 0.8897382262278174 3.6819354095735375 127580.0 93.99239635157545 0.0 - - - - - - - 770.5 255 4 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1665 212 B20140407_SF104_02 B20140407_SF104_02 TB151082.[MT7]-AVDLLQWSK[MT7].2y8_1.heavy 674.397 / 1132.65 104664.0 34.40909957885742 42 12 10 10 10 1.3379482839200363 47.35097847740245 0.0 3 0.8897382262278174 3.6819354095735375 104664.0 304.6191044776119 0.0 - - - - - - - 309.2307692307692 209 13 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1667 212 B20140407_SF104_02 B20140407_SF104_02 TB151082.[MT7]-AVDLLQWSK[MT7].2b4_1.heavy 674.397 / 543.326 30153.0 34.40909957885742 42 12 10 10 10 1.3379482839200363 47.35097847740245 0.0 3 0.8897382262278174 3.6819354095735375 30153.0 13.627132196162048 1.0 - - - - - - - 1206.0 60 2 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1669 212 B20140407_SF104_02 B20140407_SF104_02 TB151082.[MT7]-AVDLLQWSK[MT7].2y3_1.heavy 674.397 / 564.326 23050.0 34.40909957885742 42 12 10 10 10 1.3379482839200363 47.35097847740245 0.0 3 0.8897382262278174 3.6819354095735375 23050.0 20.985820895522387 0.0 - - - - - - - 804.0 46 11 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1671 213 B20140407_SF104_02 B20140407_SF104_02 TB150842.[MT7]-LTEIIPK[MT7].2b4_1.heavy 551.36 / 601.368 78723.0 30.801300048828125 46 16 10 10 10 2.311065657221518 36.66727949927259 0.0 3 0.9698193318780421 7.085974345299038 78723.0 55.409246252087385 0.0 - - - - - - - 869.0 157 2 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1673 213 B20140407_SF104_02 B20140407_SF104_02 TB150842.[MT7]-LTEIIPK[MT7].2y3_1.heavy 551.36 / 501.352 53114.0 30.801300048828125 46 16 10 10 10 2.311065657221518 36.66727949927259 0.0 3 0.9698193318780421 7.085974345299038 53114.0 22.186458881813152 0.0 - - - - - - - 1686.3333333333333 106 3 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1675 213 B20140407_SF104_02 B20140407_SF104_02 TB150842.[MT7]-LTEIIPK[MT7].2y6_1.heavy 551.36 / 844.526 42207.0 30.801300048828125 46 16 10 10 10 2.311065657221518 36.66727949927259 0.0 3 0.9698193318780421 7.085974345299038 42207.0 82.91949965788572 0.0 - - - - - - - 770.25 84 8 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1677 213 B20140407_SF104_02 B20140407_SF104_02 TB150842.[MT7]-LTEIIPK[MT7].2b5_1.heavy 551.36 / 714.452 55169.0 30.801300048828125 46 16 10 10 10 2.311065657221518 36.66727949927259 0.0 3 0.9698193318780421 7.085974345299038 55169.0 72.88666198172874 0.0 - - - - - - - 1279.3636363636363 110 11 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1679 214 B20140407_SF104_02 B20140407_SF104_02 TB150745.[MT7]-LNSASLK[MT7].2y4_1.heavy 510.818 / 562.368 6582.0 24.729249954223633 44 20 10 6 8 5.582660223066806 17.912607252509005 0.03749847412109375 4 0.9913648510330085 13.271329755876458 6582.0 1.9338948047410436 1.0 - - - - - - - 409.0 24 3 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 1681 214 B20140407_SF104_02 B20140407_SF104_02 TB150745.[MT7]-LNSASLK[MT7].2y5_1.heavy 510.818 / 649.4 5689.0 24.729249954223633 44 20 10 6 8 5.582660223066806 17.912607252509005 0.03749847412109375 4 0.9913648510330085 13.271329755876458 5689.0 4.172266972211874 4.0 - - - - - - - 1243.142857142857 11 7 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 1683 214 B20140407_SF104_02 B20140407_SF104_02 TB150745.[MT7]-LNSASLK[MT7].2b4_1.heavy 510.818 / 530.305 4574.0 24.729249954223633 44 20 10 6 8 5.582660223066806 17.912607252509005 0.03749847412109375 4 0.9913648510330085 13.271329755876458 4574.0 2.051121076233184 4.0 - - - - - - - 1205.0 10 10 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 1685 214 B20140407_SF104_02 B20140407_SF104_02 TB150745.[MT7]-LNSASLK[MT7].2y6_1.heavy 510.818 / 763.443 17179.0 24.729249954223633 44 20 10 6 8 5.582660223066806 17.912607252509005 0.03749847412109375 4 0.9913648510330085 13.271329755876458 17179.0 8.7415421398685 1.0 - - - - - - - 736.2 34 5 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 1687 215 B20140407_SF104_02 B20140407_SF104_02 TB150749.[MT7]-ALQEHAGR.2y5_1.heavy 513.284 / 569.279 4290.0 18.651199340820312 42 20 2 10 10 5.092421215757591 19.637024465016324 0.0 3 0.9910251892036216 13.01740371100036 4290.0 30.908267716535434 0.0 - - - - - - - 171.44444444444446 8 18 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 1689 215 B20140407_SF104_02 B20140407_SF104_02 TB150749.[MT7]-ALQEHAGR.2b4_1.heavy 513.284 / 586.332 5381.0 18.651199340820312 42 20 2 10 10 5.092421215757591 19.637024465016324 0.0 3 0.9910251892036216 13.01740371100036 5381.0 28.0692377675841 0.0 - - - - - - - 224.05555555555554 10 18 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 1691 215 B20140407_SF104_02 B20140407_SF104_02 TB150749.[MT7]-ALQEHAGR.2y6_1.heavy 513.284 / 697.338 N/A 18.651199340820312 42 20 2 10 10 5.092421215757591 19.637024465016324 0.0 3 0.9910251892036216 13.01740371100036 7998.0 6.013786723221657 2.0 - - - - - - - 1269.0 42 10 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 1693 215 B20140407_SF104_02 B20140407_SF104_02 TB150749.[MT7]-ALQEHAGR.2y7_1.heavy 513.284 / 810.422 8180.0 18.651199340820312 42 20 2 10 10 5.092421215757591 19.637024465016324 0.0 3 0.9910251892036216 13.01740371100036 8180.0 40.10373818897638 0.0 - - - - - - - 201.77777777777777 16 18 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 1695 216 B20140407_SF104_02 B20140407_SF104_02 TB150748.[MT7]-DLLAHVGR.2y5_1.heavy 512.805 / 539.305 21100.0 26.99959945678711 38 16 4 10 8 2.43948047178593 32.608582415004605 0.0 4 0.962910401969054 6.388292122926596 21100.0 11.432115839908047 1.0 - - - - - - - 1361.0 72 8 FAM151A family with sequence similarity 151, member A 1697 216 B20140407_SF104_02 B20140407_SF104_02 TB150748.[MT7]-DLLAHVGR.2b4_1.heavy 512.805 / 557.341 11707.0 26.99959945678711 38 16 4 10 8 2.43948047178593 32.608582415004605 0.0 4 0.962910401969054 6.388292122926596 11707.0 11.719014033191442 0.0 - - - - - - - 340.0 23 2 FAM151A family with sequence similarity 151, member A 1699 216 B20140407_SF104_02 B20140407_SF104_02 TB150748.[MT7]-DLLAHVGR.2y6_1.heavy 512.805 / 652.389 10754.0 26.99959945678711 38 16 4 10 8 2.43948047178593 32.608582415004605 0.0 4 0.962910401969054 6.388292122926596 10754.0 12.175581395348837 0.0 - - - - - - - 778.1428571428571 21 7 FAM151A family with sequence similarity 151, member A 1701 216 B20140407_SF104_02 B20140407_SF104_02 TB150748.[MT7]-DLLAHVGR.2y7_1.heavy 512.805 / 765.473 15247.0 26.99959945678711 38 16 4 10 8 2.43948047178593 32.608582415004605 0.0 4 0.962910401969054 6.388292122926596 15247.0 8.257951289463971 0.0 - - - - - - - 689.5 30 16 FAM151A family with sequence similarity 151, member A 1703 217 B20140407_SF104_02 B20140407_SF104_02 TB389873.[MT7]-K[MT7]LGGDLLR.3y7_1.heavy 387.252 / 743.441 47267.0 26.955699920654297 45 15 10 10 10 2.1589416896269116 36.984443021583886 0.0 3 0.9527973478580198 5.65790784681407 47267.0 149.99458932933558 0.0 - - - - - - - 286.6666666666667 94 6 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1705 217 B20140407_SF104_02 B20140407_SF104_02 TB389873.[MT7]-K[MT7]LGGDLLR.3y6_1.heavy 387.252 / 630.357 94667.0 26.955699920654297 45 15 10 10 10 2.1589416896269116 36.984443021583886 0.0 3 0.9527973478580198 5.65790784681407 94667.0 131.02652443631473 0.0 - - - - - - - 331.0 189 2 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1707 217 B20140407_SF104_02 B20140407_SF104_02 TB389873.[MT7]-K[MT7]LGGDLLR.3y3_1.heavy 387.252 / 401.287 99963.0 26.955699920654297 45 15 10 10 10 2.1589416896269116 36.984443021583886 0.0 3 0.9527973478580198 5.65790784681407 99963.0 21.060212497236016 0.0 - - - - - - - 1324.0 199 2 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1709 217 B20140407_SF104_02 B20140407_SF104_02 TB389873.[MT7]-K[MT7]LGGDLLR.3b5_1.heavy 387.252 / 759.46 14564.0 26.955699920654297 45 15 10 10 10 2.1589416896269116 36.984443021583886 0.0 3 0.9527973478580198 5.65790784681407 14564.0 84.08649056603774 0.0 - - - - - - - 198.5 29 12 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1711 218 B20140407_SF104_02 B20140407_SF104_02 TB390215.[MT7]-LITSFLEDQDSDSR.3y7_1.heavy 590.627 / 822.322 30439.0 35.86130142211914 46 16 10 10 10 3.130024425157811 25.532530032252787 0.0 3 0.9601596865340045 6.162380046936944 30439.0 64.37875582363097 0.0 - - - - - - - 642.4444444444445 60 9 KIF6 kinesin family member 6 1713 218 B20140407_SF104_02 B20140407_SF104_02 TB390215.[MT7]-LITSFLEDQDSDSR.3b4_1.heavy 590.627 / 559.357 34678.0 35.86130142211914 46 16 10 10 10 3.130024425157811 25.532530032252787 0.0 3 0.9601596865340045 6.162380046936944 34678.0 31.67518408053108 0.0 - - - - - - - 1302.7142857142858 69 7 KIF6 kinesin family member 6 1715 218 B20140407_SF104_02 B20140407_SF104_02 TB390215.[MT7]-LITSFLEDQDSDSR.3y8_1.heavy 590.627 / 951.365 19907.0 35.86130142211914 46 16 10 10 10 3.130024425157811 25.532530032252787 0.0 3 0.9601596865340045 6.162380046936944 19907.0 73.4103344256989 0.0 - - - - - - - 266.53846153846155 39 13 KIF6 kinesin family member 6 1717 218 B20140407_SF104_02 B20140407_SF104_02 TB390215.[MT7]-LITSFLEDQDSDSR.3y5_1.heavy 590.627 / 579.237 39943.0 35.86130142211914 46 16 10 10 10 3.130024425157811 25.532530032252787 0.0 3 0.9601596865340045 6.162380046936944 39943.0 61.96160124402331 0.0 - - - - - - - 1174.0 79 7 KIF6 kinesin family member 6 1719 219 B20140407_SF104_02 B20140407_SF104_02 TB389986.[MT7]-LTC[CAM]LQNLK[MT7].2b3_1.heavy 639.378 / 519.272 16328.0 30.118499755859375 46 16 10 10 10 2.8082331205989237 35.60957929969595 0.0 3 0.9640796372986699 6.4920725585355035 16328.0 19.51238095238095 0.0 - - - - - - - 1188.7142857142858 32 7 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 1721 219 B20140407_SF104_02 B20140407_SF104_02 TB389986.[MT7]-LTC[CAM]LQNLK[MT7].2y3_1.heavy 639.378 / 518.342 18840.0 30.118499755859375 46 16 10 10 10 2.8082331205989237 35.60957929969595 0.0 3 0.9640796372986699 6.4920725585355035 18840.0 27.225974025974025 0.0 - - - - - - - 366.3333333333333 37 3 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 1723 219 B20140407_SF104_02 B20140407_SF104_02 TB389986.[MT7]-LTC[CAM]LQNLK[MT7].2y6_1.heavy 639.378 / 919.515 13659.0 30.118499755859375 46 16 10 10 10 2.8082331205989237 35.60957929969595 0.0 3 0.9640796372986699 6.4920725585355035 13659.0 20.735 0.0 - - - - - - - 296.55555555555554 27 9 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 1725 219 B20140407_SF104_02 B20140407_SF104_02 TB389986.[MT7]-LTC[CAM]LQNLK[MT7].2y7_1.heavy 639.378 / 1020.56 35011.0 30.118499755859375 46 16 10 10 10 2.8082331205989237 35.60957929969595 0.0 3 0.9640796372986699 6.4920725585355035 35011.0 60.21 0.0 - - - - - - - 762.5714285714286 70 7 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 1727 220 B20140407_SF104_02 B20140407_SF104_02 TB499869.[MT7]-VTEVDIPSVQILNLSSDAR.3y7_1.heavy 734.07 / 762.374 118273.0 37.03239822387695 44 14 10 10 10 3.2757090006486695 30.527742232352622 0.0 3 0.9443078670529799 5.205098801087883 118273.0 61.38852044868317 0.0 - - - - - - - 844.0 236 2 PDILT protein disulfide isomerase-like, testis expressed 1729 220 B20140407_SF104_02 B20140407_SF104_02 TB499869.[MT7]-VTEVDIPSVQILNLSSDAR.3b6_1.heavy 734.07 / 801.447 230054.0 37.03239822387695 44 14 10 10 10 3.2757090006486695 30.527742232352622 0.0 3 0.9443078670529799 5.205098801087883 230054.0 83.53887248996256 0.0 - - - - - - - 1298.0 460 2 PDILT protein disulfide isomerase-like, testis expressed 1731 220 B20140407_SF104_02 B20140407_SF104_02 TB499869.[MT7]-VTEVDIPSVQILNLSSDAR.3b5_1.heavy 734.07 / 688.363 288217.0 37.03239822387695 44 14 10 10 10 3.2757090006486695 30.527742232352622 0.0 3 0.9443078670529799 5.205098801087883 288217.0 68.26017652255719 0.0 - - - - - - - 2337.0 576 2 PDILT protein disulfide isomerase-like, testis expressed 1733 220 B20140407_SF104_02 B20140407_SF104_02 TB499869.[MT7]-VTEVDIPSVQILNLSSDAR.3y8_1.heavy 734.07 / 875.458 106329.0 37.03239822387695 44 14 10 10 10 3.2757090006486695 30.527742232352622 0.0 3 0.9443078670529799 5.205098801087883 106329.0 62.05937355584082 0.0 - - - - - - - 649.0 212 6 PDILT protein disulfide isomerase-like, testis expressed 1735 221 B20140407_SF104_02 B20140407_SF104_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 900530.0 37.24679946899414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 900530.0 444.4485993533975 0.0 - - - - - - - 775.0 1801 2 1737 221 B20140407_SF104_02 B20140407_SF104_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 1521490.0 37.24679946899414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1521490.0 101.64867206286024 1.0 - - - - - - - 2455.0 3252 1 1739 221 B20140407_SF104_02 B20140407_SF104_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 1427390.0 37.24679946899414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1427390.0 649.6645786011981 0.0 - - - - - - - 1292.0 2854 1 1741 222 B20140407_SF104_02 B20140407_SF104_02 TB389687.[MT7]-EPGSATVR.2y5_1.heavy 480.765 / 533.304 6914.0 20.850799560546875 42 14 10 10 8 1.5563317107825707 52.16911502334838 0.0 4 0.9354158407284395 4.829851822372941 6914.0 -0.6200896860986544 0.0 - - - - - - - 689.4545454545455 13 11 KIF6 kinesin family member 6 1743 222 B20140407_SF104_02 B20140407_SF104_02 TB389687.[MT7]-EPGSATVR.2y3_1.heavy 480.765 / 375.235 2007.0 20.850799560546875 42 14 10 10 8 1.5563317107825707 52.16911502334838 0.0 4 0.9354158407284395 4.829851822372941 2007.0 1.8526898734177215 4.0 - - - - - - - 742.1538461538462 4 13 KIF6 kinesin family member 6 1745 222 B20140407_SF104_02 B20140407_SF104_02 TB389687.[MT7]-EPGSATVR.2y6_1.heavy 480.765 / 590.326 N/A 20.850799560546875 42 14 10 10 8 1.5563317107825707 52.16911502334838 0.0 4 0.9354158407284395 4.829851822372941 502.0 0.6901273670732528 26.0 - - - - - - - 669.125 7 8 KIF6 kinesin family member 6 1747 222 B20140407_SF104_02 B20140407_SF104_02 TB389687.[MT7]-EPGSATVR.2b5_1.heavy 480.765 / 586.295 4349.0 20.850799560546875 42 14 10 10 8 1.5563317107825707 52.16911502334838 0.0 4 0.9354158407284395 4.829851822372941 4349.0 2.8053675978466464 2.0 - - - - - - - 1201.888888888889 9 9 KIF6 kinesin family member 6 1749 223 B20140407_SF104_02 B20140407_SF104_02 TB499378.[MT7]-ALVAAK[MT7].2y4_1.heavy 430.794 / 532.357 112339.0 23.094200134277344 48 18 10 10 10 3.5665245880816467 23.207189886693744 0.0 3 0.9860516206585231 10.437449571485342 112339.0 62.235080703946686 0.0 - - - - - - - 824.5 224 2 ESPNL;ATR;LOC651921 espin-like;ataxia telangiectasia and Rad3 related;serine/threonine-protein kinase ATR-like 1751 223 B20140407_SF104_02 B20140407_SF104_02 TB499378.[MT7]-ALVAAK[MT7].2y5_1.heavy 430.794 / 645.442 114182.0 23.094200134277344 48 18 10 10 10 3.5665245880816467 23.207189886693744 0.0 3 0.9860516206585231 10.437449571485342 114182.0 82.28381428839953 0.0 - - - - - - - 1870.7142857142858 228 7 ESPNL;ATR;LOC651921 espin-like;ataxia telangiectasia and Rad3 related;serine/threonine-protein kinase ATR-like 1753 223 B20140407_SF104_02 B20140407_SF104_02 TB499378.[MT7]-ALVAAK[MT7].2y3_1.heavy 430.794 / 433.289 185194.0 23.094200134277344 48 18 10 10 10 3.5665245880816467 23.207189886693744 0.0 3 0.9860516206585231 10.437449571485342 185194.0 162.05282035957964 0.0 - - - - - - - 452.6666666666667 370 3 ESPNL;ATR;LOC651921 espin-like;ataxia telangiectasia and Rad3 related;serine/threonine-protein kinase ATR-like 1755 223 B20140407_SF104_02 B20140407_SF104_02 TB499378.[MT7]-ALVAAK[MT7].2b5_1.heavy 430.794 / 570.373 14843.0 23.094200134277344 48 18 10 10 10 3.5665245880816467 23.207189886693744 0.0 3 0.9860516206585231 10.437449571485342 14843.0 17.31318998527246 1.0 - - - - - - - 1635.142857142857 166 7 ESPNL;ATR;LOC651921 espin-like;ataxia telangiectasia and Rad3 related;serine/threonine-protein kinase ATR-like 1757 224 B20140407_SF104_02 B20140407_SF104_02 TB390218.[MT7]-DVFVMFYAPWSK[MT7].3b4_1.heavy 593.312 / 605.341 26833.0 41.457298278808594 42 12 10 10 10 1.12294900240724 55.760921489328915 0.0 3 0.8911738633006109 3.7066040037954022 26833.0 81.93121664050236 0.0 - - - - - - - 280.5833333333333 53 12 PDILT protein disulfide isomerase-like, testis expressed 1759 224 B20140407_SF104_02 B20140407_SF104_02 TB390218.[MT7]-DVFVMFYAPWSK[MT7].3b5_1.heavy 593.312 / 736.382 26015.0 41.457298278808594 42 12 10 10 10 1.12294900240724 55.760921489328915 0.0 3 0.8911738633006109 3.7066040037954022 26015.0 63.846336996336994 0.0 - - - - - - - 256.45454545454544 52 11 PDILT protein disulfide isomerase-like, testis expressed 1761 224 B20140407_SF104_02 B20140407_SF104_02 TB390218.[MT7]-DVFVMFYAPWSK[MT7].3y4_1.heavy 593.312 / 661.379 36566.0 41.457298278808594 42 12 10 10 10 1.12294900240724 55.760921489328915 0.0 3 0.8911738633006109 3.7066040037954022 36566.0 71.59167399267399 0.0 - - - - - - - 257.8333333333333 73 6 PDILT protein disulfide isomerase-like, testis expressed 1763 224 B20140407_SF104_02 B20140407_SF104_02 TB390218.[MT7]-DVFVMFYAPWSK[MT7].3b3_1.heavy 593.312 / 506.273 15372.0 41.457298278808594 42 12 10 10 10 1.12294900240724 55.760921489328915 0.0 3 0.8911738633006109 3.7066040037954022 15372.0 27.300699300699304 0.0 - - - - - - - 280.5833333333333 30 12 PDILT protein disulfide isomerase-like, testis expressed 1765 225 B20140407_SF104_02 B20140407_SF104_02 TB389685.[MT7]-INLVLSR.2b3_1.heavy 479.812 / 485.32 13528.0 31.14940071105957 50 20 10 10 10 17.34098246167065 5.7666859545607245 0.0 3 0.9976250982642344 25.31940871073692 13528.0 7.7270507179508865 0.0 - - - - - - - 1258.4 27 5 DHFR;DHFRL1 dihydrofolate reductase;dihydrofolate reductase-like 1 1767 225 B20140407_SF104_02 B20140407_SF104_02 TB389685.[MT7]-INLVLSR.2y5_1.heavy 479.812 / 587.388 8337.0 31.14940071105957 50 20 10 10 10 17.34098246167065 5.7666859545607245 0.0 3 0.9976250982642344 25.31940871073692 8337.0 8.50173127250314 0.0 - - - - - - - 831.2857142857143 16 7 DHFR;DHFRL1 dihydrofolate reductase;dihydrofolate reductase-like 1 1769 225 B20140407_SF104_02 B20140407_SF104_02 TB389685.[MT7]-INLVLSR.2b4_1.heavy 479.812 / 584.389 9123.0 31.14940071105957 50 20 10 10 10 17.34098246167065 5.7666859545607245 0.0 3 0.9976250982642344 25.31940871073692 9123.0 10.90352193261284 0.0 - - - - - - - 1707.857142857143 18 7 DHFR;DHFRL1 dihydrofolate reductase;dihydrofolate reductase-like 1 1771 225 B20140407_SF104_02 B20140407_SF104_02 TB389685.[MT7]-INLVLSR.2y6_1.heavy 479.812 / 701.43 35078.0 31.14940071105957 50 20 10 10 10 17.34098246167065 5.7666859545607245 0.0 3 0.9976250982642344 25.31940871073692 35078.0 43.17129734394253 0.0 - - - - - - - 1325.857142857143 70 7 DHFR;DHFRL1 dihydrofolate reductase;dihydrofolate reductase-like 1 1773 226 B20140407_SF104_02 B20140407_SF104_02 TB499561.[MT7]-NLAVQAQK[MT7].2y4_1.heavy 580.355 / 618.369 45477.0 22.591400146484375 48 18 10 10 10 5.122975068609534 19.51990760461416 0.0 3 0.9818630593268654 9.15001407708373 45477.0 91.27817188704782 0.0 - - - - - - - 716.2222222222222 90 9 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1775 226 B20140407_SF104_02 B20140407_SF104_02 TB499561.[MT7]-NLAVQAQK[MT7].2y5_1.heavy 580.355 / 717.438 40666.0 22.591400146484375 48 18 10 10 10 5.122975068609534 19.51990760461416 0.0 3 0.9818630593268654 9.15001407708373 40666.0 110.45034146764712 0.0 - - - - - - - 264.8333333333333 81 12 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1777 226 B20140407_SF104_02 B20140407_SF104_02 TB499561.[MT7]-NLAVQAQK[MT7].2b4_1.heavy 580.355 / 542.342 39032.0 22.591400146484375 48 18 10 10 10 5.122975068609534 19.51990760461416 0.0 3 0.9818630593268654 9.15001407708373 39032.0 34.39784577723378 0.0 - - - - - - - 680.5 78 2 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1779 226 B20140407_SF104_02 B20140407_SF104_02 TB499561.[MT7]-NLAVQAQK[MT7].2y6_1.heavy 580.355 / 788.475 33314.0 22.591400146484375 48 18 10 10 10 5.122975068609534 19.51990760461416 0.0 3 0.9818630593268654 9.15001407708373 33314.0 105.02462290648782 0.0 - - - - - - - 766.6666666666666 66 9 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1781 227 B20140407_SF104_02 B20140407_SF104_02 TB151360.[MT7]-LLPEYPGVLSDVQEGK[MT7].3y10_2.heavy 678.045 / 588.323 64408.0 34.98099899291992 48 18 10 10 10 4.276551151121766 23.38332840325536 0.0 3 0.9821882799836871 9.233422254954636 64408.0 57.45122619301718 0.0 - - - - - - - 856.25 128 4 DHFRL1 dihydrofolate reductase-like 1 1783 227 B20140407_SF104_02 B20140407_SF104_02 TB151360.[MT7]-LLPEYPGVLSDVQEGK[MT7].3b4_1.heavy 678.045 / 597.373 93517.0 34.98099899291992 48 18 10 10 10 4.276551151121766 23.38332840325536 0.0 3 0.9821882799836871 9.233422254954636 93517.0 95.62135338800933 0.0 - - - - - - - 856.0 187 2 DHFRL1 dihydrofolate reductase-like 1 1785 227 B20140407_SF104_02 B20140407_SF104_02 TB151360.[MT7]-LLPEYPGVLSDVQEGK[MT7].3b5_1.heavy 678.045 / 760.436 143963.0 34.98099899291992 48 18 10 10 10 4.276551151121766 23.38332840325536 0.0 3 0.9821882799836871 9.233422254954636 143963.0 88.23206226482212 0.0 - - - - - - - 659.0 287 2 DHFRL1 dihydrofolate reductase-like 1 1787 227 B20140407_SF104_02 B20140407_SF104_02 TB151360.[MT7]-LLPEYPGVLSDVQEGK[MT7].3b7_1.heavy 678.045 / 914.51 65462.0 34.98099899291992 48 18 10 10 10 4.276551151121766 23.38332840325536 0.0 3 0.9821882799836871 9.233422254954636 65462.0 144.80968690702088 0.0 - - - - - - - 263.25 130 4 DHFRL1 dihydrofolate reductase-like 1 1789 228 B20140407_SF104_02 B20140407_SF104_02 TB499566.[MT7]-NLAEELGK[MT7].2y4_1.heavy 581.34 / 590.363 15443.0 28.58799934387207 49 20 9 10 10 4.078071564747732 19.5435674455956 0.0 3 0.9920420456443169 13.825257175928995 15443.0 19.83464844475233 1.0 - - - - - - - 1370.4285714285713 30 7 PDILT protein disulfide isomerase-like, testis expressed 1791 228 B20140407_SF104_02 B20140407_SF104_02 TB499566.[MT7]-NLAEELGK[MT7].2b4_1.heavy 581.34 / 572.316 N/A 28.58799934387207 49 20 9 10 10 4.078071564747732 19.5435674455956 0.0 3 0.9920420456443169 13.825257175928995 31037.0 7.364417834601184 2.0 - - - - - - - 4798.0 72 1 PDILT protein disulfide isomerase-like, testis expressed 1793 228 B20140407_SF104_02 B20140407_SF104_02 TB499566.[MT7]-NLAEELGK[MT7].2y6_1.heavy 581.34 / 790.443 18292.0 28.58799934387207 49 20 9 10 10 4.078071564747732 19.5435674455956 0.0 3 0.9920420456443169 13.825257175928995 18292.0 7.985576217817487 1.0 - - - - - - - 787.5 36 4 PDILT protein disulfide isomerase-like, testis expressed 1795 228 B20140407_SF104_02 B20140407_SF104_02 TB499566.[MT7]-NLAEELGK[MT7].2b5_1.heavy 581.34 / 701.359 11695.0 28.58799934387207 49 20 9 10 10 4.078071564747732 19.5435674455956 0.0 3 0.9920420456443169 13.825257175928995 11695.0 3.541089398218987 1.0 - - - - - - - 375.0 34 4 PDILT protein disulfide isomerase-like, testis expressed 1797 229 B20140407_SF104_02 B20140407_SF104_02 TB389788.[MT7]-IGIEIIK[MT7].2y4_1.heavy 537.362 / 646.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1799 229 B20140407_SF104_02 B20140407_SF104_02 TB389788.[MT7]-IGIEIIK[MT7].2b4_1.heavy 537.362 / 557.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1801 229 B20140407_SF104_02 B20140407_SF104_02 TB389788.[MT7]-IGIEIIK[MT7].2y3_1.heavy 537.362 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1803 229 B20140407_SF104_02 B20140407_SF104_02 TB389788.[MT7]-IGIEIIK[MT7].2y6_1.heavy 537.362 / 816.531 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1805 230 B20140407_SF104_02 B20140407_SF104_02 TB499769.[MT7]-NITPGVLPPAHAIGR.3y7_1.heavy 552.994 / 721.41 106536.0 28.163799285888672 48 18 10 10 10 11.895354043862412 8.406643436695061 0.0 3 0.9810224365921076 8.944435179571416 106536.0 62.5233525073147 0.0 - - - - - - - 299.0 213 1 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1807 230 B20140407_SF104_02 B20140407_SF104_02 TB499769.[MT7]-NITPGVLPPAHAIGR.3b6_1.heavy 552.994 / 726.427 90249.0 28.163799285888672 48 18 10 10 10 11.895354043862412 8.406643436695061 0.0 3 0.9810224365921076 8.944435179571416 90249.0 39.32306391669083 1.0 - - - - - - - 373.5 180 2 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1809 230 B20140407_SF104_02 B20140407_SF104_02 TB499769.[MT7]-NITPGVLPPAHAIGR.3b5_1.heavy 552.994 / 627.358 92042.0 28.163799285888672 48 18 10 10 10 11.895354043862412 8.406643436695061 0.0 3 0.9810224365921076 8.944435179571416 92042.0 87.36133039071846 0.0 - - - - - - - 224.0 184 2 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1811 230 B20140407_SF104_02 B20140407_SF104_02 TB499769.[MT7]-NITPGVLPPAHAIGR.3y8_1.heavy 552.994 / 818.463 125363.0 28.163799285888672 48 18 10 10 10 11.895354043862412 8.406643436695061 0.0 3 0.9810224365921076 8.944435179571416 125363.0 134.697543873452 0.0 - - - - - - - 248.66666666666666 250 3 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1813 231 B20140407_SF104_02 B20140407_SF104_02 TB151367.[MT7]-LIVTGHAPPQIASSAPTVR.3y11_1.heavy 687.064 / 1126.62 22427.0 28.845399856567383 35 5 10 10 10 0.5259579151461976 85.32341132174156 0.0 3 0.6437051611458439 2.002750264120957 22427.0 36.633469169919934 0.0 - - - - - - - 283.57142857142856 44 7 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 1815 231 B20140407_SF104_02 B20140407_SF104_02 TB151367.[MT7]-LIVTGHAPPQIASSAPTVR.3b5_1.heavy 687.064 / 628.415 35701.0 28.845399856567383 35 5 10 10 10 0.5259579151461976 85.32341132174156 0.0 3 0.6437051611458439 2.002750264120957 35701.0 21.39385767790262 0.0 - - - - - - - 305.0 71 1 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 1817 231 B20140407_SF104_02 B20140407_SF104_02 TB151367.[MT7]-LIVTGHAPPQIASSAPTVR.3y8_1.heavy 687.064 / 788.426 46533.0 28.845399856567383 35 5 10 10 10 0.5259579151461976 85.32341132174156 0.0 3 0.6437051611458439 2.002750264120957 46533.0 38.07949902089276 0.0 - - - - - - - 153.0 93 1 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 1819 231 B20140407_SF104_02 B20140407_SF104_02 TB151367.[MT7]-LIVTGHAPPQIASSAPTVR.3y12_2.heavy 687.064 / 612.341 178657.0 28.845399856567383 35 5 10 10 10 0.5259579151461976 85.32341132174156 0.0 3 0.6437051611458439 2.002750264120957 178657.0 161.25064687721428 0.0 - - - - - - - 458.0 357 1 LOC100292387;HMCN2 hemicentin-2-like;hemicentin 2 1821 232 B20140407_SF104_02 B20140407_SF104_02 TB151320.[MT7]-LTNNSNQFQTEVGK[MT7].3b6_1.heavy 623.33 / 788.402 34092.0 26.493200302124023 46 16 10 10 10 3.4608942797407005 28.894266024067125 0.0 3 0.9658255043372025 6.656817850836447 34092.0 24.10623064139289 0.0 - - - - - - - 1236.0 68 8 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1823 232 B20140407_SF104_02 B20140407_SF104_02 TB151320.[MT7]-LTNNSNQFQTEVGK[MT7].3b4_1.heavy 623.33 / 587.327 33702.0 26.493200302124023 46 16 10 10 10 3.4608942797407005 28.894266024067125 0.0 3 0.9658255043372025 6.656817850836447 33702.0 25.526262287315937 1.0 - - - - - - - 260.0 72 1 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1825 232 B20140407_SF104_02 B20140407_SF104_02 TB151320.[MT7]-LTNNSNQFQTEVGK[MT7].3b7_1.heavy 623.33 / 916.461 34353.0 26.493200302124023 46 16 10 10 10 3.4608942797407005 28.894266024067125 0.0 3 0.9658255043372025 6.656817850836447 34353.0 226.62276046738071 0.0 - - - - - - - 216.66666666666666 68 3 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1827 232 B20140407_SF104_02 B20140407_SF104_02 TB151320.[MT7]-LTNNSNQFQTEVGK[MT7].3y5_1.heavy 623.33 / 677.395 63630.0 26.493200302124023 46 16 10 10 10 3.4608942797407005 28.894266024067125 0.0 3 0.9658255043372025 6.656817850836447 63630.0 20.629775788778666 0.0 - - - - - - - 390.0 127 1 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 1829 233 B20140407_SF104_02 B20140407_SF104_02 TB150853.[MT7]-SEPISC[CAM]K[MT7].2y6_1.heavy 554.799 / 877.457 3270.0 20.746925354003906 38 14 10 6 8 3.000083001252213 33.332411122712514 0.0364990234375 4 0.9428738968571031 5.138727723439927 3270.0 1.6991708126036482 1.0 - - - - - - - 226.08333333333334 8 12 PDILT protein disulfide isomerase-like, testis expressed 1831 233 B20140407_SF104_02 B20140407_SF104_02 TB150853.[MT7]-SEPISC[CAM]K[MT7].2y4_1.heavy 554.799 / 651.362 1670.0 20.746925354003906 38 14 10 6 8 3.000083001252213 33.332411122712514 0.0364990234375 4 0.9428738968571031 5.138727723439927 1670.0 1.546977709228453 2.0 - - - - - - - 278.1875 4 16 PDILT protein disulfide isomerase-like, testis expressed 1833 233 B20140407_SF104_02 B20140407_SF104_02 TB150853.[MT7]-SEPISC[CAM]K[MT7].2y5_1.heavy 554.799 / 748.414 19898.0 20.746925354003906 38 14 10 6 8 3.000083001252213 33.332411122712514 0.0364990234375 4 0.9428738968571031 5.138727723439927 19898.0 14.72874462089448 0.0 - - - - - - - 220.33333333333334 39 6 PDILT protein disulfide isomerase-like, testis expressed 1835 233 B20140407_SF104_02 B20140407_SF104_02 TB150853.[MT7]-SEPISC[CAM]K[MT7].2y3_1.heavy 554.799 / 538.278 5914.0 20.746925354003906 38 14 10 6 8 3.000083001252213 33.332411122712514 0.0364990234375 4 0.9428738968571031 5.138727723439927 5914.0 5.767426789132208 0.0 - - - - - - - 753.6666666666666 11 12 PDILT protein disulfide isomerase-like, testis expressed 1837 234 B20140407_SF104_02 B20140407_SF104_02 TB150750.[MT7]-LFFEGNR.2b3_1.heavy 513.778 / 552.33 18436.0 31.98579978942871 50 20 10 10 10 4.218971819060884 23.702457444302002 0.0 3 0.994344802523505 16.40338965104558 18436.0 10.560975054361965 0.0 - - - - - - - 413.3333333333333 36 3 PDILT protein disulfide isomerase-like, testis expressed 1839 234 B20140407_SF104_02 B20140407_SF104_02 TB150750.[MT7]-LFFEGNR.2y5_1.heavy 513.778 / 622.294 48491.0 31.98579978942871 50 20 10 10 10 4.218971819060884 23.702457444302002 0.0 3 0.994344802523505 16.40338965104558 48491.0 0.5596059486339087 1.0 - - - - - - - 1770.4285714285713 109 7 PDILT protein disulfide isomerase-like, testis expressed 1841 234 B20140407_SF104_02 B20140407_SF104_02 TB150750.[MT7]-LFFEGNR.2b4_1.heavy 513.778 / 681.373 28661.0 31.98579978942871 50 20 10 10 10 4.218971819060884 23.702457444302002 0.0 3 0.994344802523505 16.40338965104558 28661.0 14.428359498732078 0.0 - - - - - - - 797.1428571428571 57 7 PDILT protein disulfide isomerase-like, testis expressed 1843 234 B20140407_SF104_02 B20140407_SF104_02 TB150750.[MT7]-LFFEGNR.2y6_1.heavy 513.778 / 769.363 152290.0 31.98579978942871 50 20 10 10 10 4.218971819060884 23.702457444302002 0.0 3 0.994344802523505 16.40338965104558 152290.0 82.29465041262968 0.0 - - - - - - - 465.0 304 1 PDILT protein disulfide isomerase-like, testis expressed 1845 235 B20140407_SF104_02 B20140407_SF104_02 TB151325.[MT7]-RGVMLAVDAVIAELK[MT7].3b9_1.heavy 625.044 / 1057.59 2079.0 40.89560127258301 33 8 10 5 10 1.0937938052210423 60.28592479865893 0.04599761962890625 3 0.7940890146832555 2.671603453463197 2079.0 15.663698630136984 0.0 - - - - - - - 153.0 4 5 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1847 235 B20140407_SF104_02 B20140407_SF104_02 TB151325.[MT7]-RGVMLAVDAVIAELK[MT7].3y4_1.heavy 625.044 / 604.379 9084.0 40.89560127258301 33 8 10 5 10 1.0937938052210423 60.28592479865893 0.04599761962890625 3 0.7940890146832555 2.671603453463197 9084.0 16.188401340027283 0.0 - - - - - - - 394.0 18 10 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1849 235 B20140407_SF104_02 B20140407_SF104_02 TB151325.[MT7]-RGVMLAVDAVIAELK[MT7].3b8_1.heavy 625.044 / 986.557 2079.0 40.89560127258301 33 8 10 5 10 1.0937938052210423 60.28592479865893 0.04599761962890625 3 0.7940890146832555 2.671603453463197 2079.0 20.586202086213397 0.0 - - - - - - - 203.14285714285714 4 7 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1851 235 B20140407_SF104_02 B20140407_SF104_02 TB151325.[MT7]-RGVMLAVDAVIAELK[MT7].3y5_1.heavy 625.044 / 717.463 7989.0 40.89560127258301 33 8 10 5 10 1.0937938052210423 60.28592479865893 0.04599761962890625 3 0.7940890146832555 2.671603453463197 7989.0 21.251265126315914 0.0 - - - - - - - 243.0 15 9 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1853 236 B20140407_SF104_02 B20140407_SF104_02 TB151327.[MT7]-TEALTEAELLQLEK[MT7].3b6_1.heavy 626.022 / 789.411 103897.0 33.3036994934082 43 13 10 10 10 1.7491270485355963 46.05008398805046 0.0 3 0.9111658474567876 4.10963916650988 103897.0 105.62114168933175 0.0 - - - - - - - 958.0 207 4 KIF6 kinesin family member 6 1855 236 B20140407_SF104_02 B20140407_SF104_02 TB151327.[MT7]-TEALTEAELLQLEK[MT7].3y3_1.heavy 626.022 / 533.341 253789.0 33.3036994934082 43 13 10 10 10 1.7491270485355963 46.05008398805046 0.0 3 0.9111658474567876 4.10963916650988 253789.0 92.44916744685108 0.0 - - - - - - - 1916.0 507 1 KIF6 kinesin family member 6 1857 236 B20140407_SF104_02 B20140407_SF104_02 TB151327.[MT7]-TEALTEAELLQLEK[MT7].3b4_1.heavy 626.022 / 559.321 93220.0 33.3036994934082 43 13 10 10 10 1.7491270485355963 46.05008398805046 0.0 3 0.9111658474567876 4.10963916650988 93220.0 62.61064574578088 0.0 - - - - - - - 411.0 186 1 KIF6 kinesin family member 6 1859 236 B20140407_SF104_02 B20140407_SF104_02 TB151327.[MT7]-TEALTEAELLQLEK[MT7].3b8_1.heavy 626.022 / 989.491 148112.0 33.3036994934082 43 13 10 10 10 1.7491270485355963 46.05008398805046 0.0 3 0.9111658474567876 4.10963916650988 148112.0 172.51681818181817 0.0 - - - - - - - 246.6 296 5 KIF6 kinesin family member 6 1861 237 B20140407_SF104_02 B20140407_SF104_02 TB151462.[MT7]-LSPTVEPSSTVVSLEWVDVQPAIGTK[MT7].4b4_1.heavy 757.668 / 543.326 24208.0 37.50019836425781 47 17 10 10 10 3.629598406629787 27.551257411106704 0.0 3 0.9719336527875853 7.349341034670447 24208.0 19.14324446452779 1.0 - - - - - - - 390.0 51 1 ASTN2 astrotactin 2 1863 237 B20140407_SF104_02 B20140407_SF104_02 TB151462.[MT7]-LSPTVEPSSTVVSLEWVDVQPAIGTK[MT7].4b5_1.heavy 757.668 / 642.394 61431.0 37.50019836425781 47 17 10 10 10 3.629598406629787 27.551257411106704 0.0 3 0.9719336527875853 7.349341034670447 61431.0 33.60104653028002 0.0 - - - - - - - 1747.7142857142858 122 7 ASTN2 astrotactin 2 1865 237 B20140407_SF104_02 B20140407_SF104_02 TB151462.[MT7]-LSPTVEPSSTVVSLEWVDVQPAIGTK[MT7].4y3_1.heavy 757.668 / 449.284 134966.0 37.50019836425781 47 17 10 10 10 3.629598406629787 27.551257411106704 0.0 3 0.9719336527875853 7.349341034670447 134966.0 53.86807275211527 0.0 - - - - - - - 325.0 269 2 ASTN2 astrotactin 2 1867 237 B20140407_SF104_02 B20140407_SF104_02 TB151462.[MT7]-LSPTVEPSSTVVSLEWVDVQPAIGTK[MT7].4y6_1.heavy 757.668 / 730.458 185855.0 37.50019836425781 47 17 10 10 10 3.629598406629787 27.551257411106704 0.0 3 0.9719336527875853 7.349341034670447 185855.0 63.965744755173546 0.0 - - - - - - - 1041.0 371 1 ASTN2 astrotactin 2 1869 238 B20140407_SF104_02 B20140407_SF104_02 TB499860.[MT7]-SLTQSLWLNNNVLNDLR.3b6_1.heavy 715.391 / 774.448 22462.0 39.16889953613281 45 15 10 10 10 2.2471220089044714 30.857244153529553 0.0 3 0.9542041610346973 5.744838967353821 22462.0 20.034661326329612 0.0 - - - - - - - 254.0 44 1 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 1871 238 B20140407_SF104_02 B20140407_SF104_02 TB499860.[MT7]-SLTQSLWLNNNVLNDLR.3b5_1.heavy 715.391 / 661.364 19670.0 39.16889953613281 45 15 10 10 10 2.2471220089044714 30.857244153529553 0.0 3 0.9542041610346973 5.744838967353821 19670.0 19.58261686808842 0.0 - - - - - - - 381.0 39 1 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 1873 238 B20140407_SF104_02 B20140407_SF104_02 TB499860.[MT7]-SLTQSLWLNNNVLNDLR.3y5_1.heavy 715.391 / 630.357 27158.0 39.16889953613281 45 15 10 10 10 2.2471220089044714 30.857244153529553 0.0 3 0.9542041610346973 5.744838967353821 27158.0 28.176839178136063 0.0 - - - - - - - 381.0 54 1 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 1875 238 B20140407_SF104_02 B20140407_SF104_02 TB499860.[MT7]-SLTQSLWLNNNVLNDLR.3y9_1.heavy 715.391 / 1071.55 12183.0 39.16889953613281 45 15 10 10 10 2.2471220089044714 30.857244153529553 0.0 3 0.9542041610346973 5.744838967353821 12183.0 36.472609651618775 0.0 - - - - - - - 254.0 24 7 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 1877 239 B20140407_SF104_02 B20140407_SF104_02 TB151463.[MT7]-LSPTVEPSSTVVSLEWVDVQPAIGTK[MT7].3y6_1.heavy 1009.89 / 730.458 74188.0 37.50019836425781 50 20 10 10 10 9.237765370693461 10.825128804120428 0.0 3 0.9904971418576505 12.650005839772115 74188.0 41.90627040331265 0.0 - - - - - - - 260.0 148 2 ASTN2 astrotactin 2 1879 239 B20140407_SF104_02 B20140407_SF104_02 TB151463.[MT7]-LSPTVEPSSTVVSLEWVDVQPAIGTK[MT7].3b5_1.heavy 1009.89 / 642.394 30326.0 37.50019836425781 50 20 10 10 10 9.237765370693461 10.825128804120428 0.0 3 0.9904971418576505 12.650005839772115 30326.0 89.29957141801522 0.0 - - - - - - - 274.44444444444446 60 9 ASTN2 astrotactin 2 1881 239 B20140407_SF104_02 B20140407_SF104_02 TB151463.[MT7]-LSPTVEPSSTVVSLEWVDVQPAIGTK[MT7].3y4_1.heavy 1009.89 / 562.368 13536.0 37.50019836425781 50 20 10 10 10 9.237765370693461 10.825128804120428 0.0 3 0.9904971418576505 12.650005839772115 13536.0 32.75251367442189 0.0 - - - - - - - 664.0 27 10 ASTN2 astrotactin 2 1883 239 B20140407_SF104_02 B20140407_SF104_02 TB151463.[MT7]-LSPTVEPSSTVVSLEWVDVQPAIGTK[MT7].3y9_1.heavy 1009.89 / 1072.61 13796.0 37.50019836425781 50 20 10 10 10 9.237765370693461 10.825128804120428 0.0 3 0.9904971418576505 12.650005839772115 13796.0 59.73131679073614 0.0 - - - - - - - 222.85714285714286 27 7 ASTN2 astrotactin 2 1885 240 B20140407_SF104_02 B20140407_SF104_02 TB150851.[MT7]-LC[CAM]DGINK[MT7].2b3_1.heavy 554.307 / 533.251 47089.0 24.4778995513916 46 16 10 10 10 3.2506332622862106 24.49300528604776 0.0 3 0.969136858067316 7.0067876036699115 47089.0 20.89097914072229 0.0 - - - - - - - 2778.875 94 8 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1887 240 B20140407_SF104_02 B20140407_SF104_02 TB150851.[MT7]-LC[CAM]DGINK[MT7].2y4_1.heavy 554.307 / 575.363 53440.0 24.4778995513916 46 16 10 10 10 3.2506332622862106 24.49300528604776 0.0 3 0.969136858067316 7.0067876036699115 53440.0 51.7286637248133 0.0 - - - - - - - 1289.888888888889 106 9 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1889 240 B20140407_SF104_02 B20140407_SF104_02 TB150851.[MT7]-LC[CAM]DGINK[MT7].2b4_1.heavy 554.307 / 590.273 7666.0 24.4778995513916 46 16 10 10 10 3.2506332622862106 24.49300528604776 0.0 3 0.969136858067316 7.0067876036699115 7666.0 12.16545297080475 0.0 - - - - - - - 862.5 15 8 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1891 240 B20140407_SF104_02 B20140407_SF104_02 TB150851.[MT7]-LC[CAM]DGINK[MT7].2y6_1.heavy 554.307 / 850.421 35152.0 24.4778995513916 46 16 10 10 10 3.2506332622862106 24.49300528604776 0.0 3 0.969136858067316 7.0067876036699115 35152.0 58.74717808219177 0.0 - - - - - - - 778.8888888888889 70 9 TNFAIP8 tumor necrosis factor, alpha-induced protein 8 1893 241 B20140407_SF104_02 B20140407_SF104_02 TB499759.[MT7]-TLADVLVQEVIK[MT7].3y3_1.heavy 539.334 / 503.367 661080.0 39.597801208496094 41 11 10 10 10 0.9717392650798212 60.98903883870742 0.0 3 0.8648221426534972 3.318114521483985 661080.0 690.505056448885 0.0 - - - - - - - 281.25 1322 4 INPP1 inositol polyphosphate-1-phosphatase 1895 241 B20140407_SF104_02 B20140407_SF104_02 TB499759.[MT7]-TLADVLVQEVIK[MT7].3b6_1.heavy 539.334 / 757.458 904897.0 39.597801208496094 41 11 10 10 10 0.9717392650798212 60.98903883870742 0.0 3 0.8648221426534972 3.318114521483985 904897.0 6627.204420618557 0.0 - - - - - - - 125.0 1809 1 INPP1 inositol polyphosphate-1-phosphatase 1897 241 B20140407_SF104_02 B20140407_SF104_02 TB499759.[MT7]-TLADVLVQEVIK[MT7].3b4_1.heavy 539.334 / 545.305 892640.0 39.597801208496094 41 11 10 10 10 0.9717392650798212 60.98903883870742 0.0 3 0.8648221426534972 3.318114521483985 892640.0 3313.561429048414 0.0 - - - - - - - 250.0 1785 6 INPP1 inositol polyphosphate-1-phosphatase 1899 241 B20140407_SF104_02 B20140407_SF104_02 TB499759.[MT7]-TLADVLVQEVIK[MT7].3b5_1.heavy 539.334 / 644.374 1360960.0 39.597801208496094 41 11 10 10 10 0.9717392650798212 60.98903883870742 0.0 3 0.8648221426534972 3.318114521483985 1360960.0 2505.3373711588197 0.0 - - - - - - - 250.0 2721 5 INPP1 inositol polyphosphate-1-phosphatase 1901 242 B20140407_SF104_02 B20140407_SF104_02 TB389558.[MT7]-AANIAR.2b3_1.heavy 380.233 / 401.227 157817.0 19.387399673461914 41 11 10 10 10 0.9784625238424642 60.43970724595235 0.0 3 0.8507765144778393 3.154198820312251 157817.0 53.301561561511505 0.0 - - - - - - - 682.0 315 1 INPP1 inositol polyphosphate-1-phosphatase 1903 242 B20140407_SF104_02 B20140407_SF104_02 TB389558.[MT7]-AANIAR.2y5_1.heavy 380.233 / 544.32 264451.0 19.387399673461914 41 11 10 10 10 0.9784625238424642 60.43970724595235 0.0 3 0.8507765144778393 3.154198820312251 264451.0 188.38669338392117 0.0 - - - - - - - 341.0 528 1 INPP1 inositol polyphosphate-1-phosphatase 1905 242 B20140407_SF104_02 B20140407_SF104_02 TB389558.[MT7]-AANIAR.2b4_1.heavy 380.233 / 514.311 189665.0 19.387399673461914 41 11 10 10 10 0.9784625238424642 60.43970724595235 0.0 3 0.8507765144778393 3.154198820312251 189665.0 121.49804725987701 0.0 - - - - - - - 455.0 379 1 INPP1 inositol polyphosphate-1-phosphatase 1907 242 B20140407_SF104_02 B20140407_SF104_02 TB389558.[MT7]-AANIAR.2b5_1.heavy 380.233 / 585.348 112093.0 19.387399673461914 41 11 10 10 10 0.9784625238424642 60.43970724595235 0.0 3 0.8507765144778393 3.154198820312251 112093.0 99.11896895760063 0.0 - - - - - - - 398.0 224 2 INPP1 inositol polyphosphate-1-phosphatase 1909 243 B20140407_SF104_02 B20140407_SF104_02 TB499557.[MT7]-SETDGTVFR.2y8_1.heavy 578.292 / 924.442 44210.0 24.82309913635254 45 15 10 10 10 3.82894004504445 26.11688844003278 0.0 3 0.9560084703501666 5.862363357022334 44210.0 101.12319805194804 0.0 - - - - - - - 814.0 88 10 RWDD3 RWD domain containing 3 1911 243 B20140407_SF104_02 B20140407_SF104_02 TB499557.[MT7]-SETDGTVFR.2b4_1.heavy 578.292 / 577.259 114374.0 24.82309913635254 45 15 10 10 10 3.82894004504445 26.11688844003278 0.0 3 0.9560084703501666 5.862363357022334 114374.0 77.98883854967967 0.0 - - - - - - - 935.0 228 2 RWDD3 RWD domain containing 3 1913 243 B20140407_SF104_02 B20140407_SF104_02 TB499557.[MT7]-SETDGTVFR.2b6_1.heavy 578.292 / 735.328 17706.0 24.82309913635254 45 15 10 10 10 3.82894004504445 26.11688844003278 0.0 3 0.9560084703501666 5.862363357022334 17706.0 54.08378181818182 1.0 - - - - - - - 644.2857142857143 36 7 RWDD3 RWD domain containing 3 1915 243 B20140407_SF104_02 B20140407_SF104_02 TB499557.[MT7]-SETDGTVFR.2y7_1.heavy 578.292 / 795.399 40581.0 24.82309913635254 45 15 10 10 10 3.82894004504445 26.11688844003278 0.0 3 0.9560084703501666 5.862363357022334 40581.0 41.99346379911944 0.0 - - - - - - - 1246.6666666666667 81 9 RWDD3 RWD domain containing 3 1917 244 B20140407_SF104_02 B20140407_SF104_02 TB151333.[MT7]-C[CAM]EFQDAYVLLSEK[MT7].3y3_1.heavy 630.657 / 507.289 113894.0 35.53839874267578 41 11 10 10 10 1.619369801177712 49.1279612206006 0.0 3 0.8703350883473148 3.389555012233065 113894.0 58.97244008589351 0.0 - - - - - - - 1190.0 227 7 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1919 244 B20140407_SF104_02 B20140407_SF104_02 TB151333.[MT7]-C[CAM]EFQDAYVLLSEK[MT7].3b6_1.heavy 630.657 / 895.374 61959.0 35.53839874267578 41 11 10 10 10 1.619369801177712 49.1279612206006 0.0 3 0.8703350883473148 3.389555012233065 61959.0 289.04639367674577 0.0 - - - - - - - 638.0 123 10 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1921 244 B20140407_SF104_02 B20140407_SF104_02 TB151333.[MT7]-C[CAM]EFQDAYVLLSEK[MT7].3b5_1.heavy 630.657 / 824.336 36967.0 35.53839874267578 41 11 10 10 10 1.619369801177712 49.1279612206006 0.0 3 0.8703350883473148 3.389555012233065 36967.0 47.483758231539554 0.0 - - - - - - - 325.0 73 8 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1923 244 B20140407_SF104_02 B20140407_SF104_02 TB151333.[MT7]-C[CAM]EFQDAYVLLSEK[MT7].3y4_1.heavy 630.657 / 620.374 59355.0 35.53839874267578 41 11 10 10 10 1.619369801177712 49.1279612206006 0.0 3 0.8703350883473148 3.389555012233065 59355.0 32.27628366751943 0.0 - - - - - - - 260.0 118 2 HSPD1 heat shock 60kDa protein 1 (chaperonin) 1925 245 B20140407_SF104_02 B20140407_SF104_02 TB150996.[MT7]-LQADLNC[CAM]IR.2y8_1.heavy 623.838 / 989.483 64952.0 29.168899536132812 44 14 10 10 10 1.9408999889515446 41.58061961543283 0.0 3 0.943590627042328 5.171586142954377 64952.0 70.84109880729847 0.0 - - - - - - - 381.0 129 4 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1927 245 B20140407_SF104_02 B20140407_SF104_02 TB150996.[MT7]-LQADLNC[CAM]IR.2y5_1.heavy 623.838 / 675.361 51840.0 29.168899536132812 44 14 10 10 10 1.9408999889515446 41.58061961543283 0.0 3 0.943590627042328 5.171586142954377 51840.0 54.95606557377049 0.0 - - - - - - - 1162.5 103 8 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1929 245 B20140407_SF104_02 B20140407_SF104_02 TB150996.[MT7]-LQADLNC[CAM]IR.2b4_1.heavy 623.838 / 572.316 48485.0 29.168899536132812 44 14 10 10 10 1.9408999889515446 41.58061961543283 0.0 3 0.943590627042328 5.171586142954377 48485.0 39.87427595628415 0.0 - - - - - - - 1808.0 96 7 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1931 245 B20140407_SF104_02 B20140407_SF104_02 TB150996.[MT7]-LQADLNC[CAM]IR.2y7_1.heavy 623.838 / 861.425 42387.0 29.168899536132812 44 14 10 10 10 1.9408999889515446 41.58061961543283 0.0 3 0.943590627042328 5.171586142954377 42387.0 69.58534932623218 0.0 - - - - - - - 743.25 84 8 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 1933 246 B20140407_SF104_02 B20140407_SF104_02 TB499890.[MT7]-ALMLQGVDLLADAVAVTMGPK[MT7].3b9_1.heavy 801.119 / 1085.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1935 246 B20140407_SF104_02 B20140407_SF104_02 TB499890.[MT7]-ALMLQGVDLLADAVAVTMGPK[MT7].3b4_1.heavy 801.119 / 573.355 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1937 246 B20140407_SF104_02 B20140407_SF104_02 TB499890.[MT7]-ALMLQGVDLLADAVAVTMGPK[MT7].3b5_1.heavy 801.119 / 701.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1939 246 B20140407_SF104_02 B20140407_SF104_02 TB499890.[MT7]-ALMLQGVDLLADAVAVTMGPK[MT7].3b8_1.heavy 801.119 / 972.531 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSPD1 heat shock 60kDa protein 1 (chaperonin) 1941 247 B20140407_SF104_02 B20140407_SF104_02 TB499891.[MT7]-RSGWHTFPLTEAIQALFER.3y6_1.heavy 801.761 / 763.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBB inhibin, beta B 1943 247 B20140407_SF104_02 B20140407_SF104_02 TB499891.[MT7]-RSGWHTFPLTEAIQALFER.3y8_1.heavy 801.761 / 947.531 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBB inhibin, beta B 1945 247 B20140407_SF104_02 B20140407_SF104_02 TB499891.[MT7]-RSGWHTFPLTEAIQALFER.3b7_1.heavy 801.761 / 1016.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBB inhibin, beta B 1947 247 B20140407_SF104_02 B20140407_SF104_02 TB499891.[MT7]-RSGWHTFPLTEAIQALFER.3y10_1.heavy 801.761 / 1177.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - INHBB inhibin, beta B 1949 248 B20140407_SF104_02 B20140407_SF104_02 TB389890.[MT7]-EIVQYLK[MT7].2y5_1.heavy 590.863 / 794.489 35156.0 30.55299949645996 50 20 10 10 10 40.68782118004856 2.457737895511481 0.0 3 0.9966555923256994 21.33445984425286 35156.0 29.450485847953214 0.0 - - - - - - - 343.1666666666667 70 6 GCNT2;GCNT6 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group);glucosaminyl (N-acetyl) transferase 6 1951 248 B20140407_SF104_02 B20140407_SF104_02 TB389890.[MT7]-EIVQYLK[MT7].2b4_1.heavy 590.863 / 614.363 29455.0 30.55299949645996 50 20 10 10 10 40.68782118004856 2.457737895511481 0.0 3 0.9966555923256994 21.33445984425286 29455.0 21.547682807933725 0.0 - - - - - - - 348.4 58 5 GCNT2;GCNT6 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group);glucosaminyl (N-acetyl) transferase 6 1953 248 B20140407_SF104_02 B20140407_SF104_02 TB389890.[MT7]-EIVQYLK[MT7].2y3_1.heavy 590.863 / 567.362 50201.0 30.55299949645996 50 20 10 10 10 40.68782118004856 2.457737895511481 0.0 3 0.9966555923256994 21.33445984425286 50201.0 28.628736334521722 0.0 - - - - - - - 1267.0 100 2 GCNT2;GCNT6 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group);glucosaminyl (N-acetyl) transferase 6 1955 248 B20140407_SF104_02 B20140407_SF104_02 TB389890.[MT7]-EIVQYLK[MT7].2y6_1.heavy 590.863 / 907.573 22329.0 30.55299949645996 50 20 10 10 10 40.68782118004856 2.457737895511481 0.0 3 0.9966555923256994 21.33445984425286 22329.0 37.95512600839114 0.0 - - - - - - - 316.6 44 10 GCNT2;GCNT6 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group);glucosaminyl (N-acetyl) transferase 6 1957 249 B20140407_SF104_02 B20140407_SF104_02 TB499683.[MT7]-NFNVVVFDK[MT7].3y3_1.heavy 457.262 / 553.31 245566.0 32.7495002746582 44 14 10 10 10 2.105251436117855 39.98380470313071 0.0 3 0.9445504583395488 5.2165801631866655 245566.0 61.60936534333232 0.0 - - - - - - - 729.0 491 1 PDILT protein disulfide isomerase-like, testis expressed 1959 249 B20140407_SF104_02 B20140407_SF104_02 TB499683.[MT7]-NFNVVVFDK[MT7].3b4_1.heavy 457.262 / 619.332 285230.0 32.7495002746582 44 14 10 10 10 2.105251436117855 39.98380470313071 0.0 3 0.9445504583395488 5.2165801631866655 285230.0 69.02942652974421 0.0 - - - - - - - 583.0 570 1 PDILT protein disulfide isomerase-like, testis expressed 1961 249 B20140407_SF104_02 B20140407_SF104_02 TB499683.[MT7]-NFNVVVFDK[MT7].3y4_1.heavy 457.262 / 652.379 187820.0 32.7495002746582 44 14 10 10 10 2.105251436117855 39.98380470313071 0.0 3 0.9445504583395488 5.2165801631866655 187820.0 290.004687971613 0.0 - - - - - - - 400.75 375 4 PDILT protein disulfide isomerase-like, testis expressed 1963 249 B20140407_SF104_02 B20140407_SF104_02 TB499683.[MT7]-NFNVVVFDK[MT7].3b3_1.heavy 457.262 / 520.264 268169.0 32.7495002746582 44 14 10 10 10 2.105251436117855 39.98380470313071 0.0 3 0.9445504583395488 5.2165801631866655 268169.0 108.25735092269326 0.0 - - - - - - - 328.0 536 4 PDILT protein disulfide isomerase-like, testis expressed 1965 250 B20140407_SF104_02 B20140407_SF104_02 TB499356.[MT7]-LAVLPR.2y4_1.heavy 406.777 / 484.324 51873.0 29.025800704956055 47 17 10 10 10 2.489926093888402 40.16183462049456 0.0 3 0.9759354549693328 7.939602305221886 51873.0 69.54836044148615 0.0 - - - - - - - 343.5 103 4 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 1967 250 B20140407_SF104_02 B20140407_SF104_02 TB499356.[MT7]-LAVLPR.2b3_1.heavy 406.777 / 428.299 82234.0 29.025800704956055 47 17 10 10 10 2.489926093888402 40.16183462049456 0.0 3 0.9759354549693328 7.939602305221886 82234.0 47.542339474015264 0.0 - - - - - - - 305.0 164 1 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 1969 250 B20140407_SF104_02 B20140407_SF104_02 TB499356.[MT7]-LAVLPR.2y5_1.heavy 406.777 / 555.361 310780.0 29.025800704956055 47 17 10 10 10 2.489926093888402 40.16183462049456 0.0 3 0.9759354549693328 7.939602305221886 310780.0 203.5742816817269 0.0 - - - - - - - 458.0 621 2 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 1971 250 B20140407_SF104_02 B20140407_SF104_02 TB499356.[MT7]-LAVLPR.2b4_1.heavy 406.777 / 541.383 63010.0 29.025800704956055 47 17 10 10 10 2.489926093888402 40.16183462049456 0.0 3 0.9759354549693328 7.939602305221886 63010.0 87.50555834140758 0.0 - - - - - - - 458.0 126 1 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 1973 251 B20140407_SF104_02 B20140407_SF104_02 TB499887.[MT7]-DAILDALENLTAEELK[MT7]K[MT7].4b4_1.heavy 580.335 / 557.341 13452.0 41.15489959716797 39 9 10 10 10 0.9854510259214606 65.54973231954888 0.0 3 0.8169476046665912 2.8393276426204332 13452.0 29.699534927740604 0.0 - - - - - - - 257.6 26 10 PYCARD PYD and CARD domain containing 1975 251 B20140407_SF104_02 B20140407_SF104_02 TB499887.[MT7]-DAILDALENLTAEELK[MT7]K[MT7].4y6_2.heavy 580.335 / 503.313 34078.0 41.15489959716797 39 9 10 10 10 0.9854510259214606 65.54973231954888 0.0 3 0.8169476046665912 2.8393276426204332 34078.0 58.69208938893796 0.0 - - - - - - - 714.875 68 8 PYCARD PYD and CARD domain containing 1977 251 B20140407_SF104_02 B20140407_SF104_02 TB499887.[MT7]-DAILDALENLTAEELK[MT7]K[MT7].4y7_2.heavy 580.335 / 553.837 83738.0 41.15489959716797 39 9 10 10 10 0.9854510259214606 65.54973231954888 0.0 3 0.8169476046665912 2.8393276426204332 83738.0 83.32624587147686 0.0 - - - - - - - 246.4 167 5 PYCARD PYD and CARD domain containing 1979 251 B20140407_SF104_02 B20140407_SF104_02 TB499887.[MT7]-DAILDALENLTAEELK[MT7]K[MT7].4b6_1.heavy 580.335 / 743.406 47082.0 41.15489959716797 39 9 10 10 10 0.9854510259214606 65.54973231954888 0.0 3 0.8169476046665912 2.8393276426204332 47082.0 100.86000000000001 0.0 - - - - - - - 254.54545454545453 94 11 PYCARD PYD and CARD domain containing 1981 252 B20140407_SF104_02 B20140407_SF104_02 TB499747.[MT7]-GFSDFLESHIK[MT7].3b6_1.heavy 523.283 / 811.411 14880.0 33.700801849365234 32 14 2 10 6 2.408854559856966 41.513506737383864 0.0 5 0.940627347690789 5.039606147700296 14880.0 63.42002699781224 0.0 - - - - - - - 252.72727272727272 29 11 PDILT protein disulfide isomerase-like, testis expressed 1983 252 B20140407_SF104_02 B20140407_SF104_02 TB499747.[MT7]-GFSDFLESHIK[MT7].3b4_1.heavy 523.283 / 551.258 63273.0 33.700801849365234 32 14 2 10 6 2.408854559856966 41.513506737383864 0.0 5 0.940627347690789 5.039606147700296 63273.0 32.32645578848792 0.0 - - - - - - - 1748.4285714285713 126 7 PDILT protein disulfide isomerase-like, testis expressed 1985 252 B20140407_SF104_02 B20140407_SF104_02 TB499747.[MT7]-GFSDFLESHIK[MT7].3b5_1.heavy 523.283 / 698.327 50340.0 33.700801849365234 32 14 2 10 6 2.408854559856966 41.513506737383864 0.0 5 0.940627347690789 5.039606147700296 50340.0 73.98210862619808 0.0 - - - - - - - 741.3333333333334 100 12 PDILT protein disulfide isomerase-like, testis expressed 1987 252 B20140407_SF104_02 B20140407_SF104_02 TB499747.[MT7]-GFSDFLESHIK[MT7].3y4_1.heavy 523.283 / 628.39 25309.0 33.700801849365234 32 14 2 10 6 2.408854559856966 41.513506737383864 0.0 5 0.940627347690789 5.039606147700296 25309.0 17.9505083040081 2.0 - - - - - - - 695.0 320 1 PDILT protein disulfide isomerase-like, testis expressed 1989 253 B20140407_SF104_02 B20140407_SF104_02 TB389769.[MT7]-SLSLLLK[MT7].2y4_1.heavy 531.362 / 630.467 22366.0 34.158400535583496 41 15 10 6 10 1.8501513043627766 42.559406967276686 0.039600372314453125 3 0.9591112128718652 6.082319382422364 22366.0 26.931682294124485 0.0 - - - - - - - 399.0 44 1 ESPNL espin-like 1991 253 B20140407_SF104_02 B20140407_SF104_02 TB389769.[MT7]-SLSLLLK[MT7].2y5_1.heavy 531.362 / 717.499 17307.0 34.158400535583496 41 15 10 6 10 1.8501513043627766 42.559406967276686 0.039600372314453125 3 0.9591112128718652 6.082319382422364 17307.0 20.440233708466913 0.0 - - - - - - - 266.0 34 4 ESPNL espin-like 1993 253 B20140407_SF104_02 B20140407_SF104_02 TB389769.[MT7]-SLSLLLK[MT7].2b4_1.heavy 531.362 / 545.341 16375.0 34.158400535583496 41 15 10 6 10 1.8501513043627766 42.559406967276686 0.039600372314453125 3 0.9591112128718652 6.082319382422364 16375.0 21.21830985915493 1.0 - - - - - - - 332.5 33 2 ESPNL espin-like 1995 253 B20140407_SF104_02 B20140407_SF104_02 TB389769.[MT7]-SLSLLLK[MT7].2y3_1.heavy 531.362 / 517.383 30354.0 34.158400535583496 41 15 10 6 10 1.8501513043627766 42.559406967276686 0.039600372314453125 3 0.9591112128718652 6.082319382422364 30354.0 12.520919563490748 0.0 - - - - - - - 1231.25 60 4 ESPNL espin-like 1997 254 B20140407_SF104_02 B20140407_SF104_02 TB150989.[MT7]-GQPIPEWK[MT7].2y4_1.heavy 621.858 / 703.39 39360.0 28.418699264526367 44 14 10 10 10 2.4236290804242864 41.260439069535245 0.0 3 0.9341018642562593 4.780920525803681 39360.0 60.8986871097717 0.0 - - - - - - - 301.6 78 5 ESPNL espin-like 1999 254 B20140407_SF104_02 B20140407_SF104_02 TB150989.[MT7]-GQPIPEWK[MT7].2b4_1.heavy 621.858 / 540.326 23827.0 28.418699264526367 44 14 10 10 10 2.4236290804242864 41.260439069535245 0.0 3 0.9341018642562593 4.780920525803681 23827.0 3.0424769678842805 2.0 - - - - - - - 339.25 47 4 ESPNL espin-like 2001 254 B20140407_SF104_02 B20140407_SF104_02 TB150989.[MT7]-GQPIPEWK[MT7].2y3_1.heavy 621.858 / 606.337 5278.0 28.418699264526367 44 14 10 10 10 2.4236290804242864 41.260439069535245 0.0 3 0.9341018642562593 4.780920525803681 5278.0 3.4912358947265067 13.0 - - - - - - - 867.25 20 4 ESPNL espin-like 2003 254 B20140407_SF104_02 B20140407_SF104_02 TB150989.[MT7]-GQPIPEWK[MT7].2y6_1.heavy 621.858 / 913.526 22621.0 28.418699264526367 44 14 10 10 10 2.4236290804242864 41.260439069535245 0.0 3 0.9341018642562593 4.780920525803681 22621.0 39.49909508706645 0.0 - - - - - - - 366.14285714285717 45 7 ESPNL espin-like 2005 255 B20140407_SF104_02 B20140407_SF104_02 TB151342.[MT7]-IILILLQGDRNNLK[MT7].4y8_2.heavy 478.555 / 544.8 140585.0 38.170501708984375 38 8 10 10 10 0.8021698191183532 82.15269640059296 0.0 3 0.778888357643102 2.5745928324177387 140585.0 1081.198620740727 0.0 - - - - - - - 650.0 281 3 RWDD3 RWD domain containing 3 2007 255 B20140407_SF104_02 B20140407_SF104_02 TB151342.[MT7]-IILILLQGDRNNLK[MT7].4y9_2.heavy 478.555 / 601.342 77510.0 38.170501708984375 38 8 10 10 10 0.8021698191183532 82.15269640059296 0.0 3 0.778888357643102 2.5745928324177387 77510.0 246.40080549478705 0.0 - - - - - - - 676.0 155 5 RWDD3 RWD domain containing 3 2009 255 B20140407_SF104_02 B20140407_SF104_02 TB151342.[MT7]-IILILLQGDRNNLK[MT7].4b4_1.heavy 478.555 / 597.446 74909.0 38.170501708984375 38 8 10 10 10 0.8021698191183532 82.15269640059296 0.0 3 0.778888357643102 2.5745928324177387 74909.0 116.64073516821513 0.0 - - - - - - - 260.0 149 1 RWDD3 RWD domain containing 3 2011 255 B20140407_SF104_02 B20140407_SF104_02 TB151342.[MT7]-IILILLQGDRNNLK[MT7].4b3_1.heavy 478.555 / 484.362 92726.0 38.170501708984375 38 8 10 10 10 0.8021698191183532 82.15269640059296 0.0 3 0.778888357643102 2.5745928324177387 92726.0 42.29470321888991 0.0 - - - - - - - 390.0 185 1 RWDD3 RWD domain containing 3 2013 256 B20140407_SF104_02 B20140407_SF104_02 TB150878.[MT7]-AVTDEVAAGR.2y8_1.heavy 566.808 / 818.4 40511.0 22.75909996032715 43 17 6 10 10 3.0485658559032545 27.244006252869447 0.0 3 0.9764153212356597 8.020290782357648 40511.0 127.27986720081624 0.0 - - - - - - - 199.16666666666666 81 12 ESPNL espin-like 2015 256 B20140407_SF104_02 B20140407_SF104_02 TB150878.[MT7]-AVTDEVAAGR.2b4_1.heavy 566.808 / 531.289 N/A 22.75909996032715 43 17 6 10 10 3.0485658559032545 27.244006252869447 0.0 3 0.9764153212356597 8.020290782357648 29120.0 8.089721948404584 1.0 - - - - - - - 1654.0 124 1 ESPNL espin-like 2017 256 B20140407_SF104_02 B20140407_SF104_02 TB150878.[MT7]-AVTDEVAAGR.2y9_1.heavy 566.808 / 917.469 28477.0 22.75909996032715 43 17 6 10 10 3.0485658559032545 27.244006252869447 0.0 3 0.9764153212356597 8.020290782357648 28477.0 100.28186319980705 0.0 - - - - - - - 318.3333333333333 56 15 ESPNL espin-like 2019 256 B20140407_SF104_02 B20140407_SF104_02 TB150878.[MT7]-AVTDEVAAGR.2y6_1.heavy 566.808 / 602.326 24711.0 22.75909996032715 43 17 6 10 10 3.0485658559032545 27.244006252869447 0.0 3 0.9764153212356597 8.020290782357648 24711.0 59.844326530612236 0.0 - - - - - - - 735.0 49 7 ESPNL espin-like 2021 257 B20140407_SF104_02 B20140407_SF104_02 TB151343.[MT7]-IILILLQGDRNNLK[MT7].2y5_1.heavy 956.103 / 788.486 N/A N/A - - - - - - - - - 0.0 - - - - - - - RWDD3 RWD domain containing 3 2023 257 B20140407_SF104_02 B20140407_SF104_02 TB151343.[MT7]-IILILLQGDRNNLK[MT7].2y9_1.heavy 956.103 / 1201.68 N/A N/A - - - - - - - - - 0.0 - - - - - - - RWDD3 RWD domain containing 3 2025 257 B20140407_SF104_02 B20140407_SF104_02 TB151343.[MT7]-IILILLQGDRNNLK[MT7].2b4_1.heavy 956.103 / 597.446 N/A N/A - - - - - - - - - 0.0 - - - - - - - RWDD3 RWD domain containing 3 2027 257 B20140407_SF104_02 B20140407_SF104_02 TB151343.[MT7]-IILILLQGDRNNLK[MT7].2y7_1.heavy 956.103 / 960.534 N/A N/A - - - - - - - - - 0.0 - - - - - - - RWDD3 RWD domain containing 3 2029 258 B20140407_SF104_02 B20140407_SF104_02 TB389764.[MT7]-SLDDALK[MT7].2y4_1.heavy 525.308 / 590.363 51376.0 26.7721004486084 50 20 10 10 10 12.253648927544864 8.16083442501857 0.0 3 0.9935541370194989 15.363433158621334 51376.0 70.89379520365436 0.0 - - - - - - - 575.0 102 4 DHFR;DHFRL1 dihydrofolate reductase;dihydrofolate reductase-like 1 2031 258 B20140407_SF104_02 B20140407_SF104_02 TB389764.[MT7]-SLDDALK[MT7].2y5_1.heavy 525.308 / 705.39 22621.0 26.7721004486084 50 20 10 10 10 12.253648927544864 8.16083442501857 0.0 3 0.9935541370194989 15.363433158621334 22621.0 19.908741357271047 0.0 - - - - - - - 255.75 45 4 DHFR;DHFRL1 dihydrofolate reductase;dihydrofolate reductase-like 1 2033 258 B20140407_SF104_02 B20140407_SF104_02 TB389764.[MT7]-SLDDALK[MT7].2b4_1.heavy 525.308 / 575.279 60323.0 26.7721004486084 50 20 10 10 10 12.253648927544864 8.16083442501857 0.0 3 0.9935541370194989 15.363433158621334 60323.0 25.05236674045346 0.0 - - - - - - - 639.0 120 3 DHFR;DHFRL1 dihydrofolate reductase;dihydrofolate reductase-like 1 2035 258 B20140407_SF104_02 B20140407_SF104_02 TB389764.[MT7]-SLDDALK[MT7].2b5_1.heavy 525.308 / 646.316 17381.0 26.7721004486084 50 20 10 10 10 12.253648927544864 8.16083442501857 0.0 3 0.9935541370194989 15.363433158621334 17381.0 9.148600101525856 1.0 - - - - - - - 1278.0 34 1 DHFR;DHFRL1 dihydrofolate reductase;dihydrofolate reductase-like 1 2037 259 B20140407_SF104_02 B20140407_SF104_02 TB151346.[MT7]-VTILEDPDQNIHLK[MT7].3b6_1.heavy 641.698 / 815.463 67802.0 31.09869956970215 50 20 10 10 10 11.699004163770196 8.547736080792484 0.0 3 0.9977890576988827 26.241799693742585 67802.0 103.52678797468354 0.0 - - - - - - - 410.8 135 5 KIF6 kinesin family member 6 2039 259 B20140407_SF104_02 B20140407_SF104_02 TB151346.[MT7]-VTILEDPDQNIHLK[MT7].3y3_1.heavy 641.698 / 541.358 76811.0 31.09869956970215 50 20 10 10 10 11.699004163770196 8.547736080792484 0.0 3 0.9977890576988827 26.241799693742585 76811.0 43.59675466775694 0.0 - - - - - - - 790.0 153 3 KIF6 kinesin family member 6 2041 259 B20140407_SF104_02 B20140407_SF104_02 TB151346.[MT7]-VTILEDPDQNIHLK[MT7].3b4_1.heavy 641.698 / 571.394 42515.0 31.09869956970215 50 20 10 10 10 11.699004163770196 8.547736080792484 0.0 3 0.9977890576988827 26.241799693742585 42515.0 19.539817676900242 1.0 - - - - - - - 316.0 85 1 KIF6 kinesin family member 6 2043 259 B20140407_SF104_02 B20140407_SF104_02 TB151346.[MT7]-VTILEDPDQNIHLK[MT7].3b5_1.heavy 641.698 / 700.436 26078.0 31.09869956970215 50 20 10 10 10 11.699004163770196 8.547736080792484 0.0 3 0.9977890576988827 26.241799693742585 26078.0 24.939112668418485 0.0 - - - - - - - 368.6666666666667 52 3 KIF6 kinesin family member 6 2045 260 B20140407_SF104_02 B20140407_SF104_02 TB150982.[MT7]-DRINLVLSR.3y3_1.heavy 410.586 / 375.235 445265.0 28.29210090637207 46 16 10 10 10 3.0267003086936013 33.03928033864789 0.0 3 0.96980911062344 7.084768648071217 445265.0 222.0564046708377 0.0 - - - - - - - 1837.6 890 5 DHFRL1 dihydrofolate reductase-like 1 2047 260 B20140407_SF104_02 B20140407_SF104_02 TB150982.[MT7]-DRINLVLSR.3b4_1.heavy 410.586 / 643.364 88571.0 28.29210090637207 46 16 10 10 10 3.0267003086936013 33.03928033864789 0.0 3 0.96980911062344 7.084768648071217 88571.0 54.82283209594371 0.0 - - - - - - - 791.125 177 8 DHFRL1 dihydrofolate reductase-like 1 2049 260 B20140407_SF104_02 B20140407_SF104_02 TB150982.[MT7]-DRINLVLSR.3b5_1.heavy 410.586 / 756.448 68838.0 28.29210090637207 46 16 10 10 10 3.0267003086936013 33.03928033864789 0.0 3 0.96980911062344 7.084768648071217 68838.0 179.27103493004725 0.0 - - - - - - - 301.25 137 8 DHFRL1 dihydrofolate reductase-like 1 2051 260 B20140407_SF104_02 B20140407_SF104_02 TB150982.[MT7]-DRINLVLSR.3y4_1.heavy 410.586 / 474.303 237545.0 28.29210090637207 46 16 10 10 10 3.0267003086936013 33.03928033864789 0.0 3 0.96980911062344 7.084768648071217 237545.0 119.03036680798422 0.0 - - - - - - - 753.0 475 1 DHFRL1 dihydrofolate reductase-like 1 2053 261 B20140407_SF104_02 B20140407_SF104_02 TB151348.[MT7]-VTATEC[CAM]IQEQSFVIR.3y7_1.heavy 642.335 / 878.473 77982.0 31.629899978637695 48 18 10 10 10 4.608837084544772 17.337851775331977 0.0 3 0.9882035553201064 11.351648847543956 77982.0 58.98646481860965 0.0 - - - - - - - 154.0 155 1 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 2055 261 B20140407_SF104_02 B20140407_SF104_02 TB151348.[MT7]-VTATEC[CAM]IQEQSFVIR.3b6_1.heavy 642.335 / 806.383 81379.0 31.629899978637695 48 18 10 10 10 4.608837084544772 17.337851775331977 0.0 3 0.9882035553201064 11.351648847543956 81379.0 37.999229720518066 0.0 - - - - - - - 385.75 162 4 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 2057 261 B20140407_SF104_02 B20140407_SF104_02 TB151348.[MT7]-VTATEC[CAM]IQEQSFVIR.3b5_1.heavy 642.335 / 646.353 74430.0 31.629899978637695 48 18 10 10 10 4.608837084544772 17.337851775331977 0.0 3 0.9882035553201064 11.351648847543956 74430.0 79.48476238030216 0.0 - - - - - - - 1257.5714285714287 148 7 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 2059 261 B20140407_SF104_02 B20140407_SF104_02 TB151348.[MT7]-VTATEC[CAM]IQEQSFVIR.3y8_1.heavy 642.335 / 1006.53 56826.0 31.629899978637695 48 18 10 10 10 4.608837084544772 17.337851775331977 0.0 3 0.9882035553201064 11.351648847543956 56826.0 64.13244312569843 0.0 - - - - - - - 309.0 113 4 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 2061 262 B20140407_SF104_02 B20140407_SF104_02 TB499881.[MT7]-LEVIIPERYPFEPPQIR.4y4_1.heavy 560.819 / 513.314 89070.0 36.27470016479492 42 12 10 10 10 1.20657877184118 59.15199682090751 0.0 3 0.8988581234222562 3.8473933332499457 89070.0 64.59766205409721 0.0 - - - - - - - 0.0 178 0 UBE2T ubiquitin-conjugating enzyme E2T (putative) 2063 262 B20140407_SF104_02 B20140407_SF104_02 TB499881.[MT7]-LEVIIPERYPFEPPQIR.4y5_1.heavy 560.819 / 610.367 142873.0 36.27470016479492 42 12 10 10 10 1.20657877184118 59.15199682090751 0.0 3 0.8988581234222562 3.8473933332499457 142873.0 79.89574127489593 0.0 - - - - - - - 0.0 285 0 UBE2T ubiquitin-conjugating enzyme E2T (putative) 2065 262 B20140407_SF104_02 B20140407_SF104_02 TB499881.[MT7]-LEVIIPERYPFEPPQIR.4y12_2.heavy 560.819 / 764.899 239151.0 36.27470016479492 42 12 10 10 10 1.20657877184118 59.15199682090751 0.0 3 0.8988581234222562 3.8473933332499457 239151.0 96.46564499093495 0.0 - - - - - - - 0.0 478 0 UBE2T ubiquitin-conjugating enzyme E2T (putative) 2067 262 B20140407_SF104_02 B20140407_SF104_02 TB499881.[MT7]-LEVIIPERYPFEPPQIR.4b4_1.heavy 560.819 / 599.388 146991.0 36.27470016479492 42 12 10 10 10 1.20657877184118 59.15199682090751 0.0 3 0.8988581234222562 3.8473933332499457 146991.0 103.93521444789152 0.0 - - - - - - - 0.0 293 0 UBE2T ubiquitin-conjugating enzyme E2T (putative) 2069 263 B20140407_SF104_02 B20140407_SF104_02 TB150870.[MT7]-TTAEVWK[MT7].2b4_1.heavy 561.823 / 547.284 N/A 26.358699798583984 46 17 9 10 10 2.1388347534405754 33.29607211633573 0.0 3 0.9731438470329251 7.513870242516907 39155.0 12.543523940181347 1.0 - - - - - - - 2189.5 93 2 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 2071 263 B20140407_SF104_02 B20140407_SF104_02 TB150870.[MT7]-TTAEVWK[MT7].2y3_1.heavy 561.823 / 576.363 24019.0 26.358699798583984 46 17 9 10 10 2.1388347534405754 33.29607211633573 0.0 3 0.9731438470329251 7.513870242516907 24019.0 28.50885840493205 0.0 - - - - - - - 1172.875 48 8 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 2073 263 B20140407_SF104_02 B20140407_SF104_02 TB150870.[MT7]-TTAEVWK[MT7].2y6_1.heavy 561.823 / 877.49 30774.0 26.358699798583984 46 17 9 10 10 2.1388347534405754 33.29607211633573 0.0 3 0.9731438470329251 7.513870242516907 30774.0 78.44449390609391 0.0 - - - - - - - 300.0 61 5 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 2075 263 B20140407_SF104_02 B20140407_SF104_02 TB150870.[MT7]-TTAEVWK[MT7].2b5_1.heavy 561.823 / 646.353 27396.0 26.358699798583984 46 17 9 10 10 2.1388347534405754 33.29607211633573 0.0 3 0.9731438470329251 7.513870242516907 27396.0 39.06172766438012 0.0 - - - - - - - 750.75 54 8 LRTOMT leucine rich transmembrane and 0-methyltransferase domain containing 2077 264 B20140407_SF104_02 B20140407_SF104_02 TB499688.[MT7]-NTYYLTLSK[MT7].2b3_1.heavy 695.895 / 523.263 18369.0 30.21579933166504 48 18 10 10 10 4.45165209562614 22.463570344648566 0.0 3 0.9865283518104853 10.620946947781865 18369.0 20.474999999999998 0.0 - - - - - - - 376.8 36 5 ASTN2 astrotactin 2 2079 264 B20140407_SF104_02 B20140407_SF104_02 TB499688.[MT7]-NTYYLTLSK[MT7].2y4_1.heavy 695.895 / 592.379 24335.0 30.21579933166504 48 18 10 10 10 4.45165209562614 22.463570344648566 0.0 3 0.9865283518104853 10.620946947781865 24335.0 36.83095238095238 0.0 - - - - - - - 366.3333333333333 48 3 ASTN2 astrotactin 2 2081 264 B20140407_SF104_02 B20140407_SF104_02 TB499688.[MT7]-NTYYLTLSK[MT7].2y5_1.heavy 695.895 / 705.463 22451.0 30.21579933166504 48 18 10 10 10 4.45165209562614 22.463570344648566 0.0 3 0.9865283518104853 10.620946947781865 22451.0 38.490833333333335 0.0 - - - - - - - 235.5 44 4 ASTN2 astrotactin 2 2083 264 B20140407_SF104_02 B20140407_SF104_02 TB499688.[MT7]-NTYYLTLSK[MT7].2y6_1.heavy 695.895 / 868.526 18055.0 30.21579933166504 48 18 10 10 10 4.45165209562614 22.463570344648566 0.0 3 0.9865283518104853 10.620946947781865 18055.0 31.049999999999997 0.0 - - - - - - - 314.0 36 9 ASTN2 astrotactin 2 2085 265 B20140407_SF104_02 B20140407_SF104_02 TB150983.[MT7]-ASQLVGIEK[MT7].2y4_1.heavy 616.876 / 590.363 78917.0 27.170700073242188 50 20 10 10 10 11.538562022663438 8.666591192523406 0.0 3 0.9980796001826446 28.15768950747549 78917.0 25.70776697608698 0.0 - - - - - - - 2300.5 157 2 UBE2T ubiquitin-conjugating enzyme E2T (putative) 2087 265 B20140407_SF104_02 B20140407_SF104_02 TB150983.[MT7]-ASQLVGIEK[MT7].2y5_1.heavy 616.876 / 689.431 57027.0 27.170700073242188 50 20 10 10 10 11.538562022663438 8.666591192523406 0.0 3 0.9980796001826446 28.15768950747549 57027.0 60.16585343702106 0.0 - - - - - - - 348.5 114 4 UBE2T ubiquitin-conjugating enzyme E2T (putative) 2089 265 B20140407_SF104_02 B20140407_SF104_02 TB150983.[MT7]-ASQLVGIEK[MT7].2b4_1.heavy 616.876 / 544.321 55354.0 27.170700073242188 50 20 10 10 10 11.538562022663438 8.666591192523406 0.0 3 0.9980796001826446 28.15768950747549 55354.0 30.69272795758438 0.0 - - - - - - - 836.75 110 4 UBE2T ubiquitin-conjugating enzyme E2T (putative) 2091 265 B20140407_SF104_02 B20140407_SF104_02 TB150983.[MT7]-ASQLVGIEK[MT7].2y6_1.heavy 616.876 / 802.516 22588.0 27.170700073242188 50 20 10 10 10 11.538562022663438 8.666591192523406 0.0 3 0.9980796001826446 28.15768950747549 22588.0 24.41442639823221 0.0 - - - - - - - 801.875 45 8 UBE2T ubiquitin-conjugating enzyme E2T (putative) 2093 266 B20140407_SF104_02 B20140407_SF104_02 TB151305.[MT7]-AAVEEGIVLGGGC[CAM]ALLR.3b6_1.heavy 610.341 / 701.359 202426.0 34.90290069580078 47 17 10 10 10 4.074462786173656 24.54311285879 0.0 3 0.9780561265184635 8.315882316200012 202426.0 238.39530506969805 0.0 - - - - - - - 746.5 404 6 HSPD1 heat shock 60kDa protein 1 (chaperonin) 2095 266 B20140407_SF104_02 B20140407_SF104_02 TB151305.[MT7]-AAVEEGIVLGGGC[CAM]ALLR.3b4_1.heavy 610.341 / 515.295 42540.0 34.90290069580078 47 17 10 10 10 4.074462786173656 24.54311285879 0.0 3 0.9780561265184635 8.315882316200012 42540.0 45.70546697038724 0.0 - - - - - - - 395.0 85 1 HSPD1 heat shock 60kDa protein 1 (chaperonin) 2097 266 B20140407_SF104_02 B20140407_SF104_02 TB151305.[MT7]-AAVEEGIVLGGGC[CAM]ALLR.3y8_1.heavy 610.341 / 803.419 221128.0 34.90290069580078 47 17 10 10 10 4.074462786173656 24.54311285879 0.0 3 0.9780561265184635 8.315882316200012 221128.0 237.47945161481132 0.0 - - - - - - - 263.3333333333333 442 3 HSPD1 heat shock 60kDa protein 1 (chaperonin) 2099 266 B20140407_SF104_02 B20140407_SF104_02 TB151305.[MT7]-AAVEEGIVLGGGC[CAM]ALLR.3b7_1.heavy 610.341 / 814.443 110498.0 34.90290069580078 47 17 10 10 10 4.074462786173656 24.54311285879 0.0 3 0.9780561265184635 8.315882316200012 110498.0 157.3536593652845 0.0 - - - - - - - 236.8 220 5 HSPD1 heat shock 60kDa protein 1 (chaperonin) 2101 267 B20140407_SF104_02 B20140407_SF104_02 TB499885.[MT7]-DAVEQLLSC[CAM]FPNAFLASK[MT7].4y4_1.heavy 575.307 / 562.368 30509.0 42.27429962158203 43 13 10 10 10 0.9703280014435166 61.33617251089777 0.0 3 0.9099739331962218 4.0819241421768515 30509.0 77.41089552238806 0.0 - - - - - - - 286.8888888888889 61 9 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 2103 267 B20140407_SF104_02 B20140407_SF104_02 TB499885.[MT7]-DAVEQLLSC[CAM]FPNAFLASK[MT7].4b4_1.heavy 575.307 / 559.284 22582.0 42.27429962158203 43 13 10 10 10 0.9703280014435166 61.33617251089777 0.0 3 0.9099739331962218 4.0819241421768515 22582.0 89.77942321315797 0.0 - - - - - - - 305.0 45 13 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 2105 267 B20140407_SF104_02 B20140407_SF104_02 TB499885.[MT7]-DAVEQLLSC[CAM]FPNAFLASK[MT7].4b5_1.heavy 575.307 / 687.343 27191.0 42.27429962158203 43 13 10 10 10 0.9703280014435166 61.33617251089777 0.0 3 0.9099739331962218 4.0819241421768515 27191.0 161.04761126275525 0.0 - - - - - - - 245.88888888888889 54 9 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 2107 267 B20140407_SF104_02 B20140407_SF104_02 TB499885.[MT7]-DAVEQLLSC[CAM]FPNAFLASK[MT7].4b6_1.heavy 575.307 / 800.427 21753.0 42.27429962158203 43 13 10 10 10 0.9703280014435166 61.33617251089777 0.0 3 0.9099739331962218 4.0819241421768515 21753.0 133.26061503918288 0.0 - - - - - - - 230.4 43 10 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 2109 268 B20140407_SF104_02 B20140407_SF104_02 TB150871.[MT7]-DSVIC[CAM]LK[MT7].2y4_1.heavy 561.825 / 677.414 29091.0 28.377599716186523 42 20 2 10 10 12.34712661750073 8.0990503376114 0.0 3 0.9973773841025104 24.09350944917496 29091.0 35.50878847689901 0.0 - - - - - - - 391.6 58 5 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 2111 268 B20140407_SF104_02 B20140407_SF104_02 TB150871.[MT7]-DSVIC[CAM]LK[MT7].2b4_1.heavy 561.825 / 559.321 13415.0 28.377599716186523 42 20 2 10 10 12.34712661750073 8.0990503376114 0.0 3 0.9973773841025104 24.09350944917496 13415.0 5.302692168654902 2.0 - - - - - - - 351.3333333333333 183 3 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 2113 268 B20140407_SF104_02 B20140407_SF104_02 TB150871.[MT7]-DSVIC[CAM]LK[MT7].2y3_1.heavy 561.825 / 564.33 31955.0 28.377599716186523 42 20 2 10 10 12.34712661750073 8.0990503376114 0.0 3 0.9973773841025104 24.09350944917496 31955.0 26.433542744796725 0.0 - - - - - - - 1227.5714285714287 63 7 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 2115 268 B20140407_SF104_02 B20140407_SF104_02 TB150871.[MT7]-DSVIC[CAM]LK[MT7].2y6_1.heavy 561.825 / 863.514 19143.0 28.377599716186523 42 20 2 10 10 12.34712661750073 8.0990503376114 0.0 3 0.9973773841025104 24.09350944917496 19143.0 49.276340461491515 0.0 - - - - - - - 385.0 38 9 CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) 2117 269 B20140407_SF104_02 B20140407_SF104_02 TB150873.[MT7]-GLC[CAM]FC[CAM]GK[MT7].2y4_1.heavy 565.29 / 655.335 10863.0 28.249300003051758 33 5 10 10 8 0.5704564069270425 90.41653056572642 0.0 4 0.6782918517398968 2.114625655623002 10863.0 8.071933844700348 0.0 - - - - - - - 870.5 21 8 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 2119 269 B20140407_SF104_02 B20140407_SF104_02 TB150873.[MT7]-GLC[CAM]FC[CAM]GK[MT7].2y5_1.heavy 565.29 / 815.366 2368.0 28.249300003051758 33 5 10 10 8 0.5704564069270425 90.41653056572642 0.0 4 0.6782918517398968 2.114625655623002 2368.0 1.7429743589743592 8.0 - - - - - - - 835.75 10 8 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 2121 269 B20140407_SF104_02 B20140407_SF104_02 TB150873.[MT7]-GLC[CAM]FC[CAM]GK[MT7].2y3_1.heavy 565.29 / 508.267 8356.0 28.249300003051758 33 5 10 10 8 0.5704564069270425 90.41653056572642 0.0 4 0.6782918517398968 2.114625655623002 8356.0 2.762974963181149 5.0 - - - - - - - 1346.3333333333333 21 3 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 2123 269 B20140407_SF104_02 B20140407_SF104_02 TB150873.[MT7]-GLC[CAM]FC[CAM]GK[MT7].2y6_1.heavy 565.29 / 928.45 36211.0 28.249300003051758 33 5 10 10 8 0.5704564069270425 90.41653056572642 0.0 4 0.6782918517398968 2.114625655623002 36211.0 84.76508611279016 0.0 - - - - - - - 576.8571428571429 72 7 ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)