Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140407_SF105_01 B20140407_SF105_01 TB499054.[MT7]-APK[MT7]PGGLSLR.3y7_1.heavy 428.606 / 699.415 423253.0 24.64109992980957 38 8 10 10 10 1.019091525836097 59.37438837996445 0.0 3 0.7804140600702029 2.583879311264792 423253.0 421.2528980345336 0.0 - - - - - - - 364.8 846 5 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 3 1 B20140407_SF105_01 B20140407_SF105_01 TB499054.[MT7]-APK[MT7]PGGLSLR.3y6_1.heavy 428.606 / 602.362 55547.0 24.64109992980957 38 8 10 10 10 1.019091525836097 59.37438837996445 0.0 3 0.7804140600702029 2.583879311264792 55547.0 58.644585895930945 0.0 - - - - - - - 268.0 111 2 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 5 1 B20140407_SF105_01 B20140407_SF105_01 TB499054.[MT7]-APK[MT7]PGGLSLR.3b4_1.heavy 428.606 / 682.449 21340.0 24.64109992980957 38 8 10 10 10 1.019091525836097 59.37438837996445 0.0 3 0.7804140600702029 2.583879311264792 21340.0 17.623482004331898 0.0 - - - - - - - 750.6363636363636 42 11 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 7 1 B20140407_SF105_01 B20140407_SF105_01 TB499054.[MT7]-APK[MT7]PGGLSLR.3y9_2.heavy 428.606 / 534.836 583571.0 24.64109992980957 38 8 10 10 10 1.019091525836097 59.37438837996445 0.0 3 0.7804140600702029 2.583879311264792 583571.0 401.3906940637394 0.0 - - - - - - - 322.0 1167 1 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 9 2 B20140407_SF105_01 B20140407_SF105_01 TB360508.[MT7]-NPTAFK[MT7].2b3_1.heavy 483.287 / 457.253 18694.0 23.510499954223633 44 14 10 10 10 3.275621806018863 30.52855485827235 0.0 3 0.9410138126257291 5.056254865929831 18694.0 2.3847032723239048 6.0 - - - - - - - 2657.0 78 1 UBE2C ubiquitin-conjugating enzyme E2C 11 2 B20140407_SF105_01 B20140407_SF105_01 TB360508.[MT7]-NPTAFK[MT7].2y4_1.heavy 483.287 / 610.368 25147.0 23.510499954223633 44 14 10 10 10 3.275621806018863 30.52855485827235 0.0 3 0.9410138126257291 5.056254865929831 25147.0 14.540395908314789 0.0 - - - - - - - 1708.0 50 8 UBE2C ubiquitin-conjugating enzyme E2C 13 2 B20140407_SF105_01 B20140407_SF105_01 TB360508.[MT7]-NPTAFK[MT7].2y5_1.heavy 483.287 / 707.421 210763.0 23.510499954223633 44 14 10 10 10 3.275621806018863 30.52855485827235 0.0 3 0.9410138126257291 5.056254865929831 210763.0 145.86236132639192 0.0 - - - - - - - 1735.142857142857 421 7 UBE2C ubiquitin-conjugating enzyme E2C 15 2 B20140407_SF105_01 B20140407_SF105_01 TB360508.[MT7]-NPTAFK[MT7].2y3_1.heavy 483.287 / 509.32 31410.0 23.510499954223633 44 14 10 10 10 3.275621806018863 30.52855485827235 0.0 3 0.9410138126257291 5.056254865929831 31410.0 24.73915115635827 0.0 - - - - - - - 1193.2857142857142 62 7 UBE2C ubiquitin-conjugating enzyme E2C 17 3 B20140407_SF105_01 B20140407_SF105_01 TB499327.[MT7]-ALPSTAQITEAQVAENRPGAFIK[MT7].4b7_1.heavy 675.879 / 813.459 382086.0 30.781400680541992 43 13 10 10 10 1.4614832175164107 53.63387943489931 0.0 3 0.9076178835798953 4.028718124161445 382086.0 29.518949370347066 0.0 - - - - - - - 152.0 764 1 PRND prion protein 2 (dublet) 19 3 B20140407_SF105_01 B20140407_SF105_01 TB499327.[MT7]-ALPSTAQITEAQVAENRPGAFIK[MT7].4y10_1.heavy 675.879 / 1246.7 33963.0 30.781400680541992 43 13 10 10 10 1.4614832175164107 53.63387943489931 0.0 3 0.9076178835798953 4.028718124161445 33963.0 47.06855325374226 0.0 - - - - - - - 303.42857142857144 67 7 PRND prion protein 2 (dublet) 21 3 B20140407_SF105_01 B20140407_SF105_01 TB499327.[MT7]-ALPSTAQITEAQVAENRPGAFIK[MT7].4y6_1.heavy 675.879 / 776.479 114777.0 30.781400680541992 43 13 10 10 10 1.4614832175164107 53.63387943489931 0.0 3 0.9076178835798953 4.028718124161445 114777.0 40.48501755352103 1.0 - - - - - - - 303.25 229 4 PRND prion protein 2 (dublet) 23 3 B20140407_SF105_01 B20140407_SF105_01 TB499327.[MT7]-ALPSTAQITEAQVAENRPGAFIK[MT7].4b6_1.heavy 675.879 / 685.4 206508.0 30.781400680541992 43 13 10 10 10 1.4614832175164107 53.63387943489931 0.0 3 0.9076178835798953 4.028718124161445 206508.0 36.19157265805311 0.0 - - - - - - - 455.0 413 1 PRND prion protein 2 (dublet) 25 4 B20140407_SF105_01 B20140407_SF105_01 TB499056.[MT7]-ALLQDVLPK[MT7].2b4_1.heavy 642.91 / 570.373 26810.0 33.74720001220703 43 13 10 10 10 2.386288807574013 41.906075946299055 0.0 3 0.9040206933168807 3.95127418313153 26810.0 16.60544535430474 0.0 - - - - - - - 821.3333333333334 53 3 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 27 4 B20140407_SF105_01 B20140407_SF105_01 TB499056.[MT7]-ALLQDVLPK[MT7].2y3_1.heavy 642.91 / 501.352 30970.0 33.74720001220703 43 13 10 10 10 2.386288807574013 41.906075946299055 0.0 3 0.9040206933168807 3.95127418313153 30970.0 9.141617115084124 0.0 - - - - - - - 616.0 61 2 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 29 4 B20140407_SF105_01 B20140407_SF105_01 TB499056.[MT7]-ALLQDVLPK[MT7].2b6_1.heavy 642.91 / 784.469 37133.0 33.74720001220703 43 13 10 10 10 2.386288807574013 41.906075946299055 0.0 3 0.9040206933168807 3.95127418313153 37133.0 32.364413537320345 0.0 - - - - - - - 808.5 74 4 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 31 4 B20140407_SF105_01 B20140407_SF105_01 TB499056.[MT7]-ALLQDVLPK[MT7].2b5_1.heavy 642.91 / 685.4 44221.0 33.74720001220703 43 13 10 10 10 2.386288807574013 41.906075946299055 0.0 3 0.9040206933168807 3.95127418313153 44221.0 17.551595445192117 0.0 - - - - - - - 462.0 88 1 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 33 5 B20140407_SF105_01 B20140407_SF105_01 TB361118.[MT7]-DDLFYGFLK[MT7]PWLGDGLLLSK[MT7].3b4_1.heavy 910.514 / 635.316 3965.0 44.25539970397949 39 13 10 6 10 1.1905184542045697 50.46918753992982 0.031002044677734375 3 0.9245751762758989 4.465159240447107 3965.0 12.999335108949492 0.0 - - - - - - - 666.4285714285714 7 7 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 35 5 B20140407_SF105_01 B20140407_SF105_01 TB361118.[MT7]-DDLFYGFLK[MT7]PWLGDGLLLSK[MT7].3b3_1.heavy 910.514 / 488.247 3498.0 44.25539970397949 39 13 10 6 10 1.1905184542045697 50.46918753992982 0.031002044677734375 3 0.9245751762758989 4.465159240447107 3498.0 12.977712711547932 0.0 - - - - - - - 623.875 6 8 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 37 5 B20140407_SF105_01 B20140407_SF105_01 TB361118.[MT7]-DDLFYGFLK[MT7]PWLGDGLLLSK[MT7].3y8_1.heavy 910.514 / 946.569 2006.0 44.25539970397949 39 13 10 6 10 1.1905184542045697 50.46918753992982 0.031002044677734375 3 0.9245751762758989 4.465159240447107 2006.0 7.343983969825555 0.0 - - - - - - - 204.8695652173913 4 23 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 39 5 B20140407_SF105_01 B20140407_SF105_01 TB361118.[MT7]-DDLFYGFLK[MT7]PWLGDGLLLSK[MT7].3y9_1.heavy 910.514 / 1059.65 3871.0 44.25539970397949 39 13 10 6 10 1.1905184542045697 50.46918753992982 0.031002044677734375 3 0.9245751762758989 4.465159240447107 3871.0 13.16339424951267 0.0 - - - - - - - 613.0 7 7 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 41 6 B20140407_SF105_01 B20140407_SF105_01 TB361119.[MT7]-DDLFYGFLK[MT7]PWLGDGLLLSK[MT7].4b7_1.heavy 683.137 / 1002.47 1731.0 44.239898681640625 36 8 10 10 8 0.9278347233082931 69.61727234331607 0.0 4 0.7873936196316524 2.6276101476473346 1731.0 11.108021390374331 0.0 - - - - - - - 98.14285714285714 3 21 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 43 6 B20140407_SF105_01 B20140407_SF105_01 TB361119.[MT7]-DDLFYGFLK[MT7]PWLGDGLLLSK[MT7].4b9_2.heavy 683.137 / 694.379 13893.0 44.239898681640625 36 8 10 10 8 0.9278347233082931 69.61727234331607 0.0 4 0.7873936196316524 2.6276101476473346 13893.0 22.061151315789473 0.0 - - - - - - - 648.4285714285714 27 7 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 45 6 B20140407_SF105_01 B20140407_SF105_01 TB361119.[MT7]-DDLFYGFLK[MT7]PWLGDGLLLSK[MT7].4b6_1.heavy 683.137 / 855.401 3836.0 44.239898681640625 36 8 10 10 8 0.9278347233082931 69.61727234331607 0.0 4 0.7873936196316524 2.6276101476473346 3836.0 10.34536461442707 1.0 - - - - - - - 174.53846153846155 8 26 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 47 6 B20140407_SF105_01 B20140407_SF105_01 TB361119.[MT7]-DDLFYGFLK[MT7]PWLGDGLLLSK[MT7].4b4_1.heavy 683.137 / 635.316 8046.0 44.239898681640625 36 8 10 10 8 0.9278347233082931 69.61727234331607 0.0 4 0.7873936196316524 2.6276101476473346 8046.0 21.986220229400335 0.0 - - - - - - - 245.6 16 20 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 49 7 B20140407_SF105_01 B20140407_SF105_01 TB499058.[MT7]-IFYDSINK[MT7].2y4_1.heavy 644.363 / 605.374 34942.0 30.0935001373291 50 20 10 10 10 8.862600569369041 11.283369843567185 0.0 3 0.996652659063235 21.325104922374667 34942.0 28.082310590205104 0.0 - - - - - - - 697.0 69 3 IGSF22 immunoglobulin superfamily, member 22 51 7 B20140407_SF105_01 B20140407_SF105_01 TB499058.[MT7]-IFYDSINK[MT7].2y5_1.heavy 644.363 / 720.401 18666.0 30.0935001373291 50 20 10 10 10 8.862600569369041 11.283369843567185 0.0 3 0.996652659063235 21.325104922374667 18666.0 14.845695270569358 0.0 - - - - - - - 896.0 37 5 IGSF22 immunoglobulin superfamily, member 22 53 7 B20140407_SF105_01 B20140407_SF105_01 TB499058.[MT7]-IFYDSINK[MT7].2b4_1.heavy 644.363 / 683.352 27924.0 30.0935001373291 50 20 10 10 10 8.862600569369041 11.283369843567185 0.0 3 0.996652659063235 21.325104922374667 27924.0 16.37666095890411 0.0 - - - - - - - 1325.25 55 8 IGSF22 immunoglobulin superfamily, member 22 55 7 B20140407_SF105_01 B20140407_SF105_01 TB499058.[MT7]-IFYDSINK[MT7].2y7_1.heavy 644.363 / 1030.53 26580.0 30.0935001373291 50 20 10 10 10 8.862600569369041 11.283369843567185 0.0 3 0.996652659063235 21.325104922374667 26580.0 26.591559034572732 0.0 - - - - - - - 1232.125 53 8 IGSF22 immunoglobulin superfamily, member 22 57 8 B20140407_SF105_01 B20140407_SF105_01 TB149924.[MT7]-DTASC[CAM]PK[MT7].2y4_1.heavy 533.776 / 635.33 7376.0 17.601299285888672 48 18 10 10 10 3.6020619246509775 22.681666892051652 0.0 3 0.9825036552815639 9.316514228716066 7376.0 25.21719412465264 0.0 - - - - - - - 161.64705882352942 14 17 C14orf148 chromosome 14 open reading frame 148 59 8 B20140407_SF105_01 B20140407_SF105_01 TB149924.[MT7]-DTASC[CAM]PK[MT7].2y3_1.heavy 533.776 / 548.298 3619.0 17.601299285888672 48 18 10 10 10 3.6020619246509775 22.681666892051652 0.0 3 0.9825036552815639 9.316514228716066 3619.0 12.85128641211222 0.0 - - - - - - - 240.94736842105263 7 19 C14orf148 chromosome 14 open reading frame 148 61 8 B20140407_SF105_01 B20140407_SF105_01 TB149924.[MT7]-DTASC[CAM]PK[MT7].2y6_1.heavy 533.776 / 807.415 7880.0 17.601299285888672 48 18 10 10 10 3.6020619246509775 22.681666892051652 0.0 3 0.9825036552815639 9.316514228716066 7880.0 54.29030458855378 0.0 - - - - - - - 200.05263157894737 15 19 C14orf148 chromosome 14 open reading frame 148 63 8 B20140407_SF105_01 B20140407_SF105_01 TB149924.[MT7]-DTASC[CAM]PK[MT7].2b5_1.heavy 533.776 / 679.284 3986.0 17.601299285888672 48 18 10 10 10 3.6020619246509775 22.681666892051652 0.0 3 0.9825036552815639 9.316514228716066 3986.0 6.843647647545247 0.0 - - - - - - - 200.05263157894737 7 19 C14orf148 chromosome 14 open reading frame 148 65 9 B20140407_SF105_01 B20140407_SF105_01 TB499057.[MT7]-RLAADDPEVR.3b6_2.heavy 429.238 / 393.715 1645530.0 21.964599609375 40 10 10 10 10 1.0086523001270045 69.41347848231716 0.0 3 0.8446537306697589 3.0897436062909778 1645530.0 126.70062585730565 0.0 - - - - - - - 2613.0 3291 1 EFNA1 ephrin-A1 67 9 B20140407_SF105_01 B20140407_SF105_01 TB499057.[MT7]-RLAADDPEVR.3b6_1.heavy 429.238 / 786.423 218881.0 21.964599609375 40 10 10 10 10 1.0086523001270045 69.41347848231716 0.0 3 0.8446537306697589 3.0897436062909778 218881.0 429.78474783795775 0.0 - - - - - - - 338.42857142857144 437 7 EFNA1 ephrin-A1 69 9 B20140407_SF105_01 B20140407_SF105_01 TB499057.[MT7]-RLAADDPEVR.3b5_1.heavy 429.238 / 671.396 136586.0 21.964599609375 40 10 10 10 10 1.0086523001270045 69.41347848231716 0.0 3 0.8446537306697589 3.0897436062909778 136586.0 123.9214030898028 0.0 - - - - - - - 381.0 273 3 EFNA1 ephrin-A1 71 9 B20140407_SF105_01 B20140407_SF105_01 TB499057.[MT7]-RLAADDPEVR.3y4_1.heavy 429.238 / 500.283 1295210.0 21.964599609375 40 10 10 10 10 1.0086523001270045 69.41347848231716 0.0 3 0.8446537306697589 3.0897436062909778 1295210.0 436.29233610377884 0.0 - - - - - - - 2286.0 2590 2 EFNA1 ephrin-A1 73 10 B20140407_SF105_01 B20140407_SF105_01 TB360503.[MT7]-ILFPGK[MT7].2b3_1.heavy 481.817 / 518.346 117692.0 30.652700424194336 47 17 10 10 10 2.3106490133297912 43.27788401575265 0.0 3 0.9705975472542598 7.179607394929814 117692.0 28.00479016803739 0.0 - - - - - - - 1292.5 235 2 LOC100509822;PRPF4B hypothetical protein LOC100509822;PRP4 pre-mRNA processing factor 4 homolog B (yeast) 75 10 B20140407_SF105_01 B20140407_SF105_01 TB360503.[MT7]-ILFPGK[MT7].2y4_1.heavy 481.817 / 592.357 118756.0 30.652700424194336 47 17 10 10 10 2.3106490133297912 43.27788401575265 0.0 3 0.9705975472542598 7.179607394929814 118756.0 67.08212441065785 0.0 - - - - - - - 1781.5714285714287 237 7 LOC100509822;PRPF4B hypothetical protein LOC100509822;PRP4 pre-mRNA processing factor 4 homolog B (yeast) 77 10 B20140407_SF105_01 B20140407_SF105_01 TB360503.[MT7]-ILFPGK[MT7].2y5_1.heavy 481.817 / 705.442 97316.0 30.652700424194336 47 17 10 10 10 2.3106490133297912 43.27788401575265 0.0 3 0.9705975472542598 7.179607394929814 97316.0 52.56712067533911 0.0 - - - - - - - 456.0 194 2 LOC100509822;PRPF4B hypothetical protein LOC100509822;PRP4 pre-mRNA processing factor 4 homolog B (yeast) 79 10 B20140407_SF105_01 B20140407_SF105_01 TB360503.[MT7]-ILFPGK[MT7].2y3_1.heavy 481.817 / 445.289 372234.0 30.652700424194336 47 17 10 10 10 2.3106490133297912 43.27788401575265 0.0 3 0.9705975472542598 7.179607394929814 372234.0 99.3891229165918 0.0 - - - - - - - 1216.0 744 1 LOC100509822;PRPF4B hypothetical protein LOC100509822;PRP4 pre-mRNA processing factor 4 homolog B (yeast) 81 11 B20140407_SF105_01 B20140407_SF105_01 TB499099.[MT7]-ENVAFEQEK[MT7].3b4_1.heavy 461.245 / 558.3 603597.0 24.45240020751953 48 18 10 10 10 4.099213829577183 18.708075273058952 0.0 3 0.9803236420835933 8.783655999349671 603597.0 180.17685652705399 0.0 - - - - - - - 1347.0 1207 1 LACTB lactamase, beta 83 11 B20140407_SF105_01 B20140407_SF105_01 TB499099.[MT7]-ENVAFEQEK[MT7].3b5_1.heavy 461.245 / 705.369 128587.0 24.45240020751953 48 18 10 10 10 4.099213829577183 18.708075273058952 0.0 3 0.9803236420835933 8.783655999349671 128587.0 188.64516465650308 0.0 - - - - - - - 683.9 257 10 LACTB lactamase, beta 85 11 B20140407_SF105_01 B20140407_SF105_01 TB499099.[MT7]-ENVAFEQEK[MT7].3y4_1.heavy 461.245 / 677.359 124546.0 24.45240020751953 48 18 10 10 10 4.099213829577183 18.708075273058952 0.0 3 0.9803236420835933 8.783655999349671 124546.0 91.22448245614035 0.0 - - - - - - - 414.0 249 1 LACTB lactamase, beta 87 11 B20140407_SF105_01 B20140407_SF105_01 TB499099.[MT7]-ENVAFEQEK[MT7].3b3_1.heavy 461.245 / 487.263 454147.0 24.45240020751953 48 18 10 10 10 4.099213829577183 18.708075273058952 0.0 3 0.9803236420835933 8.783655999349671 454147.0 90.62336126300917 0.0 - - - - - - - 518.0 908 1 LACTB lactamase, beta 89 12 B20140407_SF105_01 B20140407_SF105_01 TB499194.[MT7]-LEADANQVLEWVR.3b4_1.heavy 562.969 / 573.3 233737.0 37.33399963378906 47 17 10 10 10 2.495500484899828 33.41607765323489 0.0 3 0.9700964462653427 7.118897502190847 233737.0 196.07596534439818 0.0 - - - - - - - 834.0 467 2 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 91 12 B20140407_SF105_01 B20140407_SF105_01 TB499194.[MT7]-LEADANQVLEWVR.3b5_1.heavy 562.969 / 644.337 125142.0 37.33399963378906 47 17 10 10 10 2.495500484899828 33.41607765323489 0.0 3 0.9700964462653427 7.118897502190847 125142.0 119.71565949616092 0.0 - - - - - - - 417.0 250 1 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 93 12 B20140407_SF105_01 B20140407_SF105_01 TB499194.[MT7]-LEADANQVLEWVR.3y4_1.heavy 562.969 / 589.309 145860.0 37.33399963378906 47 17 10 10 10 2.495500484899828 33.41607765323489 0.0 3 0.9700964462653427 7.118897502190847 145860.0 103.24080669384253 0.0 - - - - - - - 417.0 291 1 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 95 12 B20140407_SF105_01 B20140407_SF105_01 TB499194.[MT7]-LEADANQVLEWVR.3y5_1.heavy 562.969 / 702.393 319390.0 37.33399963378906 47 17 10 10 10 2.495500484899828 33.41607765323489 0.0 3 0.9700964462653427 7.118897502190847 319390.0 230.40708691378188 0.0 - - - - - - - 787.6666666666666 638 3 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 97 13 B20140407_SF105_01 B20140407_SF105_01 TB499094.[MT7]-IINLLGFPGDR.2y9_1.heavy 679.899 / 988.521 9076.0 38.41809844970703 41 13 10 10 8 1.408195071584431 48.87374658849829 0.0 4 0.9227486861132084 4.411366621223935 9076.0 3.801403087478559 1.0 - - - - - - - 378.0 18 1 TTC39C tetratricopeptide repeat domain 39C 99 13 B20140407_SF105_01 B20140407_SF105_01 TB499094.[MT7]-IINLLGFPGDR.2y6_1.heavy 679.899 / 648.31 18909.0 38.41809844970703 41 13 10 10 8 1.408195071584431 48.87374658849829 0.0 4 0.9227486861132084 4.411366621223935 18909.0 26.21883131372378 0.0 - - - - - - - 756.0 37 5 TTC39C tetratricopeptide repeat domain 39C 101 13 B20140407_SF105_01 B20140407_SF105_01 TB499094.[MT7]-IINLLGFPGDR.2y10_1.heavy 679.899 / 1101.61 11471.0 38.41809844970703 41 13 10 10 8 1.408195071584431 48.87374658849829 0.0 4 0.9227486861132084 4.411366621223935 11471.0 18.798290748898676 1.0 - - - - - - - 1166.25 24 8 TTC39C tetratricopeptide repeat domain 39C 103 13 B20140407_SF105_01 B20140407_SF105_01 TB499094.[MT7]-IINLLGFPGDR.2y7_1.heavy 679.899 / 761.394 15127.0 38.41809844970703 41 13 10 10 8 1.408195071584431 48.87374658849829 0.0 4 0.9227486861132084 4.411366621223935 15127.0 33.966487179487174 0.0 - - - - - - - 283.5 30 4 TTC39C tetratricopeptide repeat domain 39C 105 14 B20140407_SF105_01 B20140407_SF105_01 TB360646.[MT7]-TPEALLQVR.2y4_1.heavy 585.852 / 515.33 7417.0 31.154625415802002 44 20 10 6 8 5.58313662411185 17.911078795408795 0.03849983215332031 4 0.9924468886003374 14.191414635935729 7417.0 1.1761264650102947 7.0 - - - - - - - 1665.0 26 2 GP9 glycoprotein IX (platelet) 107 14 B20140407_SF105_01 B20140407_SF105_01 TB360646.[MT7]-TPEALLQVR.2y8_1.heavy 585.852 / 925.547 97628.0 31.154625415802002 44 20 10 6 8 5.58313662411185 17.911078795408795 0.03849983215332031 4 0.9924468886003374 14.191414635935729 97628.0 92.27036585365853 0.0 - - - - - - - 151.0 195 1 GP9 glycoprotein IX (platelet) 109 14 B20140407_SF105_01 B20140407_SF105_01 TB360646.[MT7]-TPEALLQVR.2y6_1.heavy 585.852 / 699.451 12109.0 31.154625415802002 44 20 10 6 8 5.58313662411185 17.911078795408795 0.03849983215332031 4 0.9924468886003374 14.191414635935729 12109.0 10.200281360349601 1.0 - - - - - - - 454.0 34 1 GP9 glycoprotein IX (platelet) 111 14 B20140407_SF105_01 B20140407_SF105_01 TB360646.[MT7]-TPEALLQVR.2y7_1.heavy 585.852 / 828.494 7871.0 31.154625415802002 44 20 10 6 8 5.58313662411185 17.911078795408795 0.03849983215332031 4 0.9924468886003374 14.191414635935729 7871.0 7.71501981707317 0.0 - - - - - - - 739.8888888888889 15 9 GP9 glycoprotein IX (platelet) 113 15 B20140407_SF105_01 B20140407_SF105_01 TB499095.[MT7]-NNFTDFTNVR.2y5_1.heavy 686.342 / 636.346 103678.0 29.852500915527344 46 16 10 10 10 3.0399589068602926 32.8951815020688 0.0 3 0.9664518484928003 6.71902700198807 103678.0 68.34205243445693 0.0 - - - - - - - 1298.0 207 4 HINT3 histidine triad nucleotide binding protein 3 115 15 B20140407_SF105_01 B20140407_SF105_01 TB499095.[MT7]-NNFTDFTNVR.2y9_1.heavy 686.342 / 1113.53 40196.0 29.852500915527344 46 16 10 10 10 3.0399589068602926 32.8951815020688 0.0 3 0.9664518484928003 6.71902700198807 40196.0 72.27117403823254 0.0 - - - - - - - 333.75 80 8 HINT3 histidine triad nucleotide binding protein 3 117 15 B20140407_SF105_01 B20140407_SF105_01 TB499095.[MT7]-NNFTDFTNVR.2b5_1.heavy 686.342 / 736.338 76683.0 29.852500915527344 46 16 10 10 10 3.0399589068602926 32.8951815020688 0.0 3 0.9664518484928003 6.71902700198807 76683.0 54.219983063450094 0.0 - - - - - - - 297.0 153 2 HINT3 histidine triad nucleotide binding protein 3 119 15 B20140407_SF105_01 B20140407_SF105_01 TB499095.[MT7]-NNFTDFTNVR.2y7_1.heavy 686.342 / 852.421 47612.0 29.852500915527344 46 16 10 10 10 3.0399589068602926 32.8951815020688 0.0 3 0.9664518484928003 6.71902700198807 47612.0 90.93345315827835 0.0 - - - - - - - 297.0 95 1 HINT3 histidine triad nucleotide binding protein 3 121 16 B20140407_SF105_01 B20140407_SF105_01 TB498892.[MT7]-Y[MT7]LVDEDPER.3b6_2.heavy 475.248 / 512.266 73242.0 24.61282444000244 37 11 10 6 10 1.471782034892047 54.061383691073075 0.037700653076171875 3 0.8727894186225937 3.422831704091047 73242.0 31.67964274031946 0.0 - - - - - - - 1721.3333333333333 146 3 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 123 16 B20140407_SF105_01 B20140407_SF105_01 TB498892.[MT7]-Y[MT7]LVDEDPER.3y7_1.heavy 475.248 / 859.379 6112.0 24.61282444000244 37 11 10 6 10 1.471782034892047 54.061383691073075 0.037700653076171875 3 0.8727894186225937 3.422831704091047 6112.0 21.099053090289534 0.0 - - - - - - - 287.45454545454544 12 11 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 125 16 B20140407_SF105_01 B20140407_SF105_01 TB498892.[MT7]-Y[MT7]LVDEDPER.3y6_1.heavy 475.248 / 760.311 29507.0 24.61282444000244 37 11 10 6 10 1.471782034892047 54.061383691073075 0.037700653076171875 3 0.8727894186225937 3.422831704091047 29507.0 17.96245523169606 0.0 - - - - - - - 843.0 59 1 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 127 16 B20140407_SF105_01 B20140407_SF105_01 TB498892.[MT7]-Y[MT7]LVDEDPER.3y5_1.heavy 475.248 / 645.284 26557.0 24.61282444000244 37 11 10 6 10 1.471782034892047 54.061383691073075 0.037700653076171875 3 0.8727894186225937 3.422831704091047 26557.0 19.311161956943025 0.0 - - - - - - - 1701.4285714285713 53 7 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 129 17 B20140407_SF105_01 B20140407_SF105_01 TB150160.[MT7]-RQDSQNENER.2b3_1.heavy 710.338 / 544.296 N/A N/A - - - - - - - - - 0.0 - - - - - - - GCET2 germinal center expressed transcript 2 131 17 B20140407_SF105_01 B20140407_SF105_01 TB150160.[MT7]-RQDSQNENER.2b7_1.heavy 710.338 / 1002.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - GCET2 germinal center expressed transcript 2 133 17 B20140407_SF105_01 B20140407_SF105_01 TB150160.[MT7]-RQDSQNENER.2b9_1.heavy 710.338 / 1245.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - GCET2 germinal center expressed transcript 2 135 17 B20140407_SF105_01 B20140407_SF105_01 TB150160.[MT7]-RQDSQNENER.2y7_1.heavy 710.338 / 876.381 N/A N/A - - - - - - - - - 0.0 - - - - - - - GCET2 germinal center expressed transcript 2 137 18 B20140407_SF105_01 B20140407_SF105_01 TB150268.[MT7]-QYLPNSHPPTVVR.3y6_1.heavy 551.306 / 668.409 311830.0 25.346099853515625 50 20 10 10 10 4.904334883592963 15.927222617920297 0.0 3 0.9950496585829414 17.53337299468562 311830.0 40.80912028771904 0.0 - - - - - - - 1353.0 623 2 CSN3 casein kappa 139 18 B20140407_SF105_01 B20140407_SF105_01 TB150268.[MT7]-QYLPNSHPPTVVR.3b5_1.heavy 551.306 / 760.411 29065.0 25.346099853515625 50 20 10 10 10 4.904334883592963 15.927222617920297 0.0 3 0.9950496585829414 17.53337299468562 29065.0 17.44790635172413 0.0 - - - - - - - 724.0 58 13 CSN3 casein kappa 141 18 B20140407_SF105_01 B20140407_SF105_01 TB150268.[MT7]-QYLPNSHPPTVVR.3b3_1.heavy 551.306 / 549.315 165564.0 25.346099853515625 50 20 10 10 10 4.904334883592963 15.927222617920297 0.0 3 0.9950496585829414 17.53337299468562 165564.0 32.51795272333635 0.0 - - - - - - - 941.0 331 1 CSN3 casein kappa 143 18 B20140407_SF105_01 B20140407_SF105_01 TB150268.[MT7]-QYLPNSHPPTVVR.3y5_1.heavy 551.306 / 571.356 128615.0 25.346099853515625 50 20 10 10 10 4.904334883592963 15.927222617920297 0.0 3 0.9950496585829414 17.53337299468562 128615.0 28.930165257343305 0.0 - - - - - - - 1294.0 257 2 CSN3 casein kappa 145 19 B20140407_SF105_01 B20140407_SF105_01 TB150061.[MT7]-EMLEILSK[MT7].2y4_1.heavy 625.867 / 604.415 12633.0 34.02299880981445 42 18 8 10 6 7.770846801821907 12.868610403766366 0.0 5 0.9863535724083804 10.552558324808237 12633.0 5.24800327632329 1.0 - - - - - - - 770.0 29 3 IGSF22 immunoglobulin superfamily, member 22 147 19 B20140407_SF105_01 B20140407_SF105_01 TB150061.[MT7]-EMLEILSK[MT7].2b3_1.heavy 625.867 / 518.276 12016.0 34.02299880981445 42 18 8 10 6 7.770846801821907 12.868610403766366 0.0 5 0.9863535724083804 10.552558324808237 12016.0 8.020940469088313 0.0 - - - - - - - 770.0 24 2 IGSF22 immunoglobulin superfamily, member 22 149 19 B20140407_SF105_01 B20140407_SF105_01 TB150061.[MT7]-EMLEILSK[MT7].2y5_1.heavy 625.867 / 733.458 7087.0 34.02299880981445 42 18 8 10 6 7.770846801821907 12.868610403766366 0.0 5 0.9863535724083804 10.552558324808237 7087.0 6.188172061434786 0.0 - - - - - - - 816.2 14 10 IGSF22 immunoglobulin superfamily, member 22 151 19 B20140407_SF105_01 B20140407_SF105_01 TB150061.[MT7]-EMLEILSK[MT7].2b4_1.heavy 625.867 / 647.319 19411.0 34.02299880981445 42 18 8 10 6 7.770846801821907 12.868610403766366 0.0 5 0.9863535724083804 10.552558324808237 19411.0 16.002866997677927 1.0 - - - - - - - 308.0 52 1 IGSF22 immunoglobulin superfamily, member 22 153 20 B20140407_SF105_01 B20140407_SF105_01 TB150266.[MT7]-VYPQADAVIVHHR.3b6_1.heavy 550.306 / 818.417 21132.0 25.22279930114746 43 15 10 10 8 2.5761424407415983 38.81772933767313 0.0 4 0.9574917785872639 5.964517913593587 21132.0 43.40544315103661 2.0 - - - - - - - 713.5714285714286 49 7 FUT6 fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 155 20 B20140407_SF105_01 B20140407_SF105_01 TB150266.[MT7]-VYPQADAVIVHHR.3b4_1.heavy 550.306 / 632.352 17765.0 25.22279930114746 43 15 10 10 8 2.5761424407415983 38.81772933767313 0.0 4 0.9574917785872639 5.964517913593587 17765.0 24.293140029901387 1.0 - - - - - - - 406.0 42 2 FUT6 fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 157 20 B20140407_SF105_01 B20140407_SF105_01 TB150266.[MT7]-VYPQADAVIVHHR.3y4_1.heavy 550.306 / 548.305 57940.0 25.22279930114746 43 15 10 10 8 2.5761424407415983 38.81772933767313 0.0 4 0.9574917785872639 5.964517913593587 57940.0 52.276768816493586 0.0 - - - - - - - 774.3333333333334 115 3 FUT6 fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 159 20 B20140407_SF105_01 B20140407_SF105_01 TB150266.[MT7]-VYPQADAVIVHHR.3y5_1.heavy 550.306 / 661.389 65023.0 25.22279930114746 43 15 10 10 8 2.5761424407415983 38.81772933767313 0.0 4 0.9574917785872639 5.964517913593587 65023.0 65.76484325508301 0.0 - - - - - - - 1664.4444444444443 130 9 FUT6 fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 161 21 B20140407_SF105_01 B20140407_SF105_01 TB499321.[MT7]-QDPGTELLHC[CAM]ENEDLIC[CAM]FK[MT7].4b8_1.heavy 652.317 / 998.528 9104.0 33.265499114990234 50 20 10 10 10 29.313098676748936 3.411444184142828 0.0 3 0.999638074019243 64.86932671704702 9104.0 11.523850282874673 0.0 - - - - - - - 725.0 18 9 HINT3 histidine triad nucleotide binding protein 3 163 21 B20140407_SF105_01 B20140407_SF105_01 TB499321.[MT7]-QDPGTELLHC[CAM]ENEDLIC[CAM]FK[MT7].4b7_1.heavy 652.317 / 885.443 10925.0 33.265499114990234 50 20 10 10 10 29.313098676748936 3.411444184142828 0.0 3 0.999638074019243 64.86932671704702 10925.0 14.196734560107856 0.0 - - - - - - - 1105.4285714285713 21 7 HINT3 histidine triad nucleotide binding protein 3 165 21 B20140407_SF105_01 B20140407_SF105_01 TB499321.[MT7]-QDPGTELLHC[CAM]ENEDLIC[CAM]FK[MT7].4y3_1.heavy 652.317 / 598.314 N/A 33.265499114990234 50 20 10 10 10 29.313098676748936 3.411444184142828 0.0 3 0.999638074019243 64.86932671704702 118959.0 50.887289462864125 0.0 - - - - - - - 1897.0 237 2 HINT3 histidine triad nucleotide binding protein 3 167 21 B20140407_SF105_01 B20140407_SF105_01 TB499321.[MT7]-QDPGTELLHC[CAM]ENEDLIC[CAM]FK[MT7].4b6_1.heavy 652.317 / 772.359 11835.0 33.265499114990234 50 20 10 10 10 29.313098676748936 3.411444184142828 0.0 3 0.999638074019243 64.86932671704702 11835.0 9.572363764864281 0.0 - - - - - - - 1192.2857142857142 23 7 HINT3 histidine triad nucleotide binding protein 3 169 22 B20140407_SF105_01 B20140407_SF105_01 TB149915.[MT7]-GLVDDIK[MT7].2y4_1.heavy 524.318 / 634.353 44181.0 27.824899673461914 48 20 10 10 8 11.423360447653192 8.753991477222794 0.0 4 0.9973150230721585 23.81194497288119 44181.0 26.018731342772092 1.0 - - - - - - - 412.0 186 1 ACTRT2 actin-related protein T2 171 22 B20140407_SF105_01 B20140407_SF105_01 TB149915.[MT7]-GLVDDIK[MT7].2b4_1.heavy 524.318 / 529.31 62293.0 27.824899673461914 48 20 10 10 8 11.423360447653192 8.753991477222794 0.0 4 0.9973150230721585 23.81194497288119 62293.0 32.20860893640568 1.0 - - - - - - - 1666.4285714285713 153 7 ACTRT2 actin-related protein T2 173 22 B20140407_SF105_01 B20140407_SF105_01 TB149915.[MT7]-GLVDDIK[MT7].2y3_1.heavy 524.318 / 519.326 61058.0 27.824899673461914 48 20 10 10 8 11.423360447653192 8.753991477222794 0.0 4 0.9973150230721585 23.81194497288119 61058.0 16.80707508235205 1.0 - - - - - - - 1509.0 122 1 ACTRT2 actin-related protein T2 175 22 B20140407_SF105_01 B20140407_SF105_01 TB149915.[MT7]-GLVDDIK[MT7].2b5_1.heavy 524.318 / 644.337 130622.0 27.824899673461914 48 20 10 10 8 11.423360447653192 8.753991477222794 0.0 4 0.9973150230721585 23.81194497288119 130622.0 24.37116390338949 1.0 - - - - - - - 1509.0 262 1 ACTRT2 actin-related protein T2 177 23 B20140407_SF105_01 B20140407_SF105_01 TB149916.[MT7]-SNLTSLK[MT7].2y4_1.heavy 525.823 / 592.379 28060.0 25.01027488708496 46 20 10 6 10 6.818626085284769 14.665711061031683 0.03929901123046875 3 0.9953470367275988 18.085437424788196 28060.0 14.8619184546517 1.0 - - - - - - - 898.0 56 1 CEP68 centrosomal protein 68kDa 179 23 B20140407_SF105_01 B20140407_SF105_01 TB149916.[MT7]-SNLTSLK[MT7].2y5_1.heavy 525.823 / 705.463 7408.0 25.01027488708496 46 20 10 6 10 6.818626085284769 14.665711061031683 0.03929901123046875 3 0.9953470367275988 18.085437424788196 7408.0 10.58975155911753 1.0 - - - - - - - 673.2857142857143 14 7 CEP68 centrosomal protein 68kDa 181 23 B20140407_SF105_01 B20140407_SF105_01 TB149916.[MT7]-SNLTSLK[MT7].2y6_1.heavy 525.823 / 819.506 11000.0 25.01027488708496 46 20 10 6 10 6.818626085284769 14.665711061031683 0.03929901123046875 3 0.9953470367275988 18.085437424788196 11000.0 12.420315532500968 0.0 - - - - - - - 404.0 22 5 CEP68 centrosomal protein 68kDa 183 23 B20140407_SF105_01 B20140407_SF105_01 TB149916.[MT7]-SNLTSLK[MT7].2b5_1.heavy 525.823 / 647.348 4826.0 25.01027488708496 46 20 10 6 10 6.818626085284769 14.665711061031683 0.03929901123046875 3 0.9953470367275988 18.085437424788196 4826.0 3.1820376634545413 15.0 - - - - - - - 1739.5 28 2 CEP68 centrosomal protein 68kDa 185 24 B20140407_SF105_01 B20140407_SF105_01 TB499043.[MT7]-LLISHLSGIR.3b4_1.heavy 418.267 / 571.394 172376.0 31.6427001953125 50 20 10 10 10 13.921251527129916 7.183262209228724 0.0 3 0.9925966845338043 14.334446978862898 172376.0 79.04097599768652 0.0 - - - - - - - 253.33333333333334 344 3 LACTB lactamase, beta 187 24 B20140407_SF105_01 B20140407_SF105_01 TB499043.[MT7]-LLISHLSGIR.3b3_1.heavy 418.267 / 484.362 97893.0 31.6427001953125 50 20 10 10 10 13.921251527129916 7.183262209228724 0.0 3 0.9925966845338043 14.334446978862898 97893.0 47.616691337719296 0.0 - - - - - - - 304.0 195 2 LACTB lactamase, beta 189 24 B20140407_SF105_01 B20140407_SF105_01 TB499043.[MT7]-LLISHLSGIR.3y4_1.heavy 418.267 / 432.257 544166.0 31.6427001953125 50 20 10 10 10 13.921251527129916 7.183262209228724 0.0 3 0.9925966845338043 14.334446978862898 544166.0 61.03323556172927 0.0 - - - - - - - 456.0 1088 1 LACTB lactamase, beta 191 24 B20140407_SF105_01 B20140407_SF105_01 TB499043.[MT7]-LLISHLSGIR.3y5_1.heavy 418.267 / 545.341 385490.0 31.6427001953125 50 20 10 10 10 13.921251527129916 7.183262209228724 0.0 3 0.9925966845338043 14.334446978862898 385490.0 95.28088687628161 0.0 - - - - - - - 456.0 770 1 LACTB lactamase, beta 193 25 B20140407_SF105_01 B20140407_SF105_01 TB149917.[MT7]-ILIFEK[MT7].2y4_1.heavy 525.844 / 680.41 185932.0 34.14929962158203 48 18 10 10 10 5.603253015705533 17.84677574253864 0.0 3 0.9890520536867716 11.784170654202876 185932.0 179.34252322647149 0.0 - - - - - - - 384.25 371 4 GCET2 germinal center expressed transcript 2 195 25 B20140407_SF105_01 B20140407_SF105_01 TB149917.[MT7]-ILIFEK[MT7].2y5_1.heavy 525.844 / 793.494 279129.0 34.14929962158203 48 18 10 10 10 5.603253015705533 17.84677574253864 0.0 3 0.9890520536867716 11.784170654202876 279129.0 286.8423968540062 0.0 - - - - - - - 384.5 558 4 GCET2 germinal center expressed transcript 2 197 25 B20140407_SF105_01 B20140407_SF105_01 TB149917.[MT7]-ILIFEK[MT7].2b4_1.heavy 525.844 / 631.43 28297.0 34.14929962158203 48 18 10 10 10 5.603253015705533 17.84677574253864 0.0 3 0.9890520536867716 11.784170654202876 28297.0 9.585827262805763 0.0 - - - - - - - 692.0 56 2 GCET2 germinal center expressed transcript 2 199 25 B20140407_SF105_01 B20140407_SF105_01 TB149917.[MT7]-ILIFEK[MT7].2y3_1.heavy 525.844 / 567.326 329264.0 34.14929962158203 48 18 10 10 10 5.603253015705533 17.84677574253864 0.0 3 0.9890520536867716 11.784170654202876 329264.0 156.02518954861716 0.0 - - - - - - - 730.5 658 4 GCET2 germinal center expressed transcript 2 201 26 B20140407_SF105_01 B20140407_SF105_01 TB149910.[MT7]-VFEQGYR.2b3_1.heavy 521.776 / 520.289 12812.0 25.601699829101562 50 20 10 10 10 16.987870969246256 5.886552834138753 0.0 3 0.9994639608357493 53.302147561028136 12812.0 9.499336958451853 1.0 - - - - - - - 1223.0 25 10 GSG1L GSG1-like 203 26 B20140407_SF105_01 B20140407_SF105_01 TB149910.[MT7]-VFEQGYR.2y5_1.heavy 521.776 / 652.305 12696.0 25.601699829101562 50 20 10 10 10 16.987870969246256 5.886552834138753 0.0 3 0.9994639608357493 53.302147561028136 12696.0 7.189163368820021 0.0 - - - - - - - 748.8571428571429 25 7 GSG1L GSG1-like 205 26 B20140407_SF105_01 B20140407_SF105_01 TB149910.[MT7]-VFEQGYR.2y6_1.heavy 521.776 / 799.373 61615.0 25.601699829101562 50 20 10 10 10 16.987870969246256 5.886552834138753 0.0 3 0.9994639608357493 53.302147561028136 61615.0 33.33000490779158 0.0 - - - - - - - 233.0 123 1 GSG1L GSG1-like 207 26 B20140407_SF105_01 B20140407_SF105_01 TB149910.[MT7]-VFEQGYR.2b5_1.heavy 521.776 / 705.369 8270.0 25.601699829101562 50 20 10 10 10 16.987870969246256 5.886552834138753 0.0 3 0.9994639608357493 53.302147561028136 8270.0 13.69615998314858 1.0 - - - - - - - 766.6666666666666 40 12 GSG1L GSG1-like 209 27 B20140407_SF105_01 B20140407_SF105_01 TB150076.[MT7]-YLVDEDPER.2y5_1.heavy 640.318 / 645.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 211 27 B20140407_SF105_01 B20140407_SF105_01 TB150076.[MT7]-YLVDEDPER.2b4_1.heavy 640.318 / 635.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 213 27 B20140407_SF105_01 B20140407_SF105_01 TB150076.[MT7]-YLVDEDPER.2b6_1.heavy 640.318 / 879.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 215 27 B20140407_SF105_01 B20140407_SF105_01 TB150076.[MT7]-YLVDEDPER.2y7_1.heavy 640.318 / 859.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 217 28 B20140407_SF105_01 B20140407_SF105_01 TB499088.[MT7]-LDIDFGAEGNR.2y9_1.heavy 675.842 / 978.464 29626.0 31.77910041809082 44 14 10 10 10 1.6572954160967102 40.09037954566081 0.0 3 0.9495733373968512 5.472555120619332 29626.0 34.93220525356164 0.0 - - - - - - - 752.0 59 8 PRND prion protein 2 (dublet) 219 28 B20140407_SF105_01 B20140407_SF105_01 TB499088.[MT7]-LDIDFGAEGNR.2b4_1.heavy 675.842 / 601.331 68426.0 31.77910041809082 44 14 10 10 10 1.6572954160967102 40.09037954566081 0.0 3 0.9495733373968512 5.472555120619332 68426.0 58.33310276845849 0.0 - - - - - - - 301.0 136 1 PRND prion protein 2 (dublet) 221 28 B20140407_SF105_01 B20140407_SF105_01 TB499088.[MT7]-LDIDFGAEGNR.2y10_1.heavy 675.842 / 1093.49 34439.0 31.77910041809082 44 14 10 10 10 1.6572954160967102 40.09037954566081 0.0 3 0.9495733373968512 5.472555120619332 34439.0 80.97092497162409 0.0 - - - - - - - 281.875 68 8 PRND prion protein 2 (dublet) 223 28 B20140407_SF105_01 B20140407_SF105_01 TB499088.[MT7]-LDIDFGAEGNR.2y7_1.heavy 675.842 / 750.353 67674.0 31.77910041809082 44 14 10 10 10 1.6572954160967102 40.09037954566081 0.0 3 0.9495733373968512 5.472555120619332 67674.0 53.18669920116288 0.0 - - - - - - - 802.0 135 3 PRND prion protein 2 (dublet) 225 29 B20140407_SF105_01 B20140407_SF105_01 TB149912.[MT7]-ALLLQAK[MT7].2y4_1.heavy 522.855 / 603.395 30357.0 29.18239974975586 48 18 10 10 10 4.903691823520113 20.39279865026572 0.0 3 0.9814999510668264 9.059497502212684 30357.0 17.14947273921666 0.0 - - - - - - - 1313.6666666666667 60 3 TTC39C tetratricopeptide repeat domain 39C 227 29 B20140407_SF105_01 B20140407_SF105_01 TB149912.[MT7]-ALLLQAK[MT7].2y5_1.heavy 522.855 / 716.479 22622.0 29.18239974975586 48 18 10 10 10 4.903691823520113 20.39279865026572 0.0 3 0.9814999510668264 9.059497502212684 22622.0 20.1521671136937 0.0 - - - - - - - 438.0 45 2 TTC39C tetratricopeptide repeat domain 39C 229 29 B20140407_SF105_01 B20140407_SF105_01 TB149912.[MT7]-ALLLQAK[MT7].2b4_1.heavy 522.855 / 555.399 17660.0 29.18239974975586 48 18 10 10 10 4.903691823520113 20.39279865026572 0.0 3 0.9814999510668264 9.059497502212684 17660.0 15.44866225258503 0.0 - - - - - - - 657.0 35 2 TTC39C tetratricopeptide repeat domain 39C 231 29 B20140407_SF105_01 B20140407_SF105_01 TB149912.[MT7]-ALLLQAK[MT7].2y6_1.heavy 522.855 / 829.563 16638.0 29.18239974975586 48 18 10 10 10 4.903691823520113 20.39279865026572 0.0 3 0.9814999510668264 9.059497502212684 16638.0 21.347591345538344 2.0 - - - - - - - 771.7142857142857 44 7 TTC39C tetratricopeptide repeat domain 39C 233 30 B20140407_SF105_01 B20140407_SF105_01 TB499086.[MT7]-LLLLGAGESGK[MT7].3b4_1.heavy 449.281 / 597.446 175279.0 33.6068000793457 48 18 10 10 10 7.716304401760048 12.959571680089567 0.0 3 0.9877272210553598 11.128733548775593 175279.0 235.4910423185915 0.0 - - - - - - - 404.25 350 8 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 235 30 B20140407_SF105_01 B20140407_SF105_01 TB499086.[MT7]-LLLLGAGESGK[MT7].3b5_1.heavy 449.281 / 654.467 450431.0 33.6068000793457 48 18 10 10 10 7.716304401760048 12.959571680089567 0.0 3 0.9877272210553598 11.128733548775593 450431.0 861.3286495381874 0.0 - - - - - - - 154.0 900 2 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 237 30 B20140407_SF105_01 B20140407_SF105_01 TB499086.[MT7]-LLLLGAGESGK[MT7].3b3_1.heavy 449.281 / 484.362 618100.0 33.6068000793457 48 18 10 10 10 7.716304401760048 12.959571680089567 0.0 3 0.9877272210553598 11.128733548775593 618100.0 334.2269217937183 0.0 - - - - - - - 846.0 1236 2 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 239 30 B20140407_SF105_01 B20140407_SF105_01 TB499086.[MT7]-LLLLGAGESGK[MT7].3b8_2.heavy 449.281 / 456.288 159582.0 33.6068000793457 48 18 10 10 10 7.716304401760048 12.959571680089567 0.0 3 0.9877272210553598 11.128733548775593 159582.0 170.25938340012587 0.0 - - - - - - - 462.0 319 1 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 241 31 B20140407_SF105_01 B20140407_SF105_01 TB360654.[MT7]-FK[MT7]PNQTR.2y6_1.heavy 589.848 / 887.518 8778.0 19.874024391174316 38 18 10 6 4 5.971800777596009 16.745367724784636 0.035900115966796875 9 0.9881362064332491 11.319318422523137 8778.0 47.01895953757226 0.0 - - - - - - - 195.58333333333334 17 24 NUDT4 nudix (nucleoside diphosphate linked moiety X)-type motif 4 243 31 B20140407_SF105_01 B20140407_SF105_01 TB360654.[MT7]-FK[MT7]PNQTR.2y4_1.heavy 589.848 / 518.268 1521.0 19.874024391174316 38 18 10 6 4 5.971800777596009 16.745367724784636 0.035900115966796875 9 0.9881362064332491 11.319318422523137 1521.0 3.0452446498929016 13.0 - - - - - - - 720.7142857142857 4 14 NUDT4 nudix (nucleoside diphosphate linked moiety X)-type motif 4 245 31 B20140407_SF105_01 B20140407_SF105_01 TB360654.[MT7]-FK[MT7]PNQTR.2y5_1.heavy 589.848 / 615.321 20389.0 19.874024391174316 38 18 10 6 4 5.971800777596009 16.745367724784636 0.035900115966796875 9 0.9881362064332491 11.319318422523137 20389.0 44.43187907785994 0.0 - - - - - - - 226.0909090909091 40 22 NUDT4 nudix (nucleoside diphosphate linked moiety X)-type motif 4 247 31 B20140407_SF105_01 B20140407_SF105_01 TB360654.[MT7]-FK[MT7]PNQTR.2b4_1.heavy 589.848 / 775.471 829.0 19.874024391174316 38 18 10 6 4 5.971800777596009 16.745367724784636 0.035900115966796875 9 0.9881362064332491 11.319318422523137 829.0 1.1771676300578033 8.0 - - - - - - - 247.31578947368422 2 19 NUDT4 nudix (nucleoside diphosphate linked moiety X)-type motif 4 249 32 B20140407_SF105_01 B20140407_SF105_01 TB499046.[MT7]-DIVQFVPFR.2y8_1.heavy 632.862 / 1005.59 19661.0 36.102500915527344 48 18 10 10 10 18.05794386603794 5.53772903171289 0.0 3 0.9899328578709441 12.289784096298769 19661.0 49.862739923264364 1.0 - - - - - - - 670.7142857142857 39 7 CPNE4;CPNE8;CPNE9;CPNE2;CPNE7;CPNE5;CPNE3;CPNE6 copine IV;copine VIII;copine family member IX;copine II;copine VII;copine V;copine III;copine VI (neuronal) 251 32 B20140407_SF105_01 B20140407_SF105_01 TB499046.[MT7]-DIVQFVPFR.2b4_1.heavy 632.862 / 600.347 31986.0 36.102500915527344 48 18 10 10 10 18.05794386603794 5.53772903171289 0.0 3 0.9899328578709441 12.289784096298769 31986.0 32.47424837926179 0.0 - - - - - - - 293.5 63 2 CPNE4;CPNE8;CPNE9;CPNE2;CPNE7;CPNE5;CPNE3;CPNE6 copine IV;copine VIII;copine family member IX;copine II;copine VII;copine V;copine III;copine VI (neuronal) 253 32 B20140407_SF105_01 B20140407_SF105_01 TB499046.[MT7]-DIVQFVPFR.2y6_1.heavy 632.862 / 793.435 50913.0 36.102500915527344 48 18 10 10 10 18.05794386603794 5.53772903171289 0.0 3 0.9899328578709441 12.289784096298769 50913.0 83.9316032443393 0.0 - - - - - - - 770.25 101 8 CPNE4;CPNE8;CPNE9;CPNE2;CPNE7;CPNE5;CPNE3;CPNE6 copine IV;copine VIII;copine family member IX;copine II;copine VII;copine V;copine III;copine VI (neuronal) 255 32 B20140407_SF105_01 B20140407_SF105_01 TB499046.[MT7]-DIVQFVPFR.2y7_1.heavy 632.862 / 892.504 41523.0 36.102500915527344 48 18 10 10 10 18.05794386603794 5.53772903171289 0.0 3 0.9899328578709441 12.289784096298769 41523.0 51.45603663899979 0.0 - - - - - - - 268.8333333333333 83 6 CPNE4;CPNE8;CPNE9;CPNE2;CPNE7;CPNE5;CPNE3;CPNE6 copine IV;copine VIII;copine family member IX;copine II;copine VII;copine V;copine III;copine VI (neuronal) 257 33 B20140407_SF105_01 B20140407_SF105_01 TB499085.[MT7]-SSAQEAPELNR.2y5_1.heavy 673.345 / 628.341 44736.0 22.002399444580078 47 17 10 10 10 35.898322756056544 2.785645465375638 0.0 3 0.9738986025914631 7.6222167767107285 44736.0 27.68570677812569 0.0 - - - - - - - 1226.888888888889 89 9 GSG1L GSG1-like 259 33 B20140407_SF105_01 B20140407_SF105_01 TB499085.[MT7]-SSAQEAPELNR.2y6_1.heavy 673.345 / 699.378 44817.0 22.002399444580078 47 17 10 10 10 35.898322756056544 2.785645465375638 0.0 3 0.9738986025914631 7.6222167767107285 44817.0 195.42222429316064 0.0 - - - - - - - 220.28571428571428 89 14 GSG1L GSG1-like 261 33 B20140407_SF105_01 B20140407_SF105_01 TB499085.[MT7]-SSAQEAPELNR.2y10_1.heavy 673.345 / 1114.55 22733.0 22.002399444580078 47 17 10 10 10 35.898322756056544 2.785645465375638 0.0 3 0.9738986025914631 7.6222167767107285 22733.0 334.64577109896777 0.0 - - - - - - - 146.06666666666666 45 15 GSG1L GSG1-like 263 33 B20140407_SF105_01 B20140407_SF105_01 TB499085.[MT7]-SSAQEAPELNR.2b5_1.heavy 673.345 / 647.312 36454.0 22.002399444580078 47 17 10 10 10 35.898322756056544 2.785645465375638 0.0 3 0.9738986025914631 7.6222167767107285 36454.0 57.778323378278586 0.0 - - - - - - - 836.3 72 10 GSG1L GSG1-like 265 34 B20140407_SF105_01 B20140407_SF105_01 TB499082.[MT7]-LQLTDFVSK[MT7].3b6_1.heavy 446.934 / 862.479 43375.0 33.6068000793457 50 20 10 10 10 13.315467793944281 7.510062849273596 0.0 3 0.9968509625427188 21.98666823215867 43375.0 310.0047187086233 0.0 - - - - - - - 215.4 86 5 C14orf148 chromosome 14 open reading frame 148 267 34 B20140407_SF105_01 B20140407_SF105_01 TB499082.[MT7]-LQLTDFVSK[MT7].3b5_1.heavy 446.934 / 715.411 411291.0 33.6068000793457 50 20 10 10 10 13.315467793944281 7.510062849273596 0.0 3 0.9968509625427188 21.98666823215867 411291.0 200.18896241913706 0.0 - - - - - - - 769.0 822 2 C14orf148 chromosome 14 open reading frame 148 269 34 B20140407_SF105_01 B20140407_SF105_01 TB499082.[MT7]-LQLTDFVSK[MT7].3y4_1.heavy 446.934 / 624.384 46912.0 33.6068000793457 50 20 10 10 10 13.315467793944281 7.510062849273596 0.0 3 0.9968509625427188 21.98666823215867 46912.0 34.13272147093044 0.0 - - - - - - - 246.4 93 5 C14orf148 chromosome 14 open reading frame 148 271 34 B20140407_SF105_01 B20140407_SF105_01 TB499082.[MT7]-LQLTDFVSK[MT7].3b3_1.heavy 446.934 / 499.336 161809.0 33.6068000793457 50 20 10 10 10 13.315467793944281 7.510062849273596 0.0 3 0.9968509625427188 21.98666823215867 161809.0 162.042815967384 0.0 - - - - - - - 461.0 323 2 C14orf148 chromosome 14 open reading frame 148 273 35 B20140407_SF105_01 B20140407_SF105_01 TB499081.[MT7]-LQLTDFVSK[MT7].2y4_1.heavy 669.897 / 624.384 67557.0 33.6068000793457 39 9 10 10 10 0.624378446304432 88.93173989280125 0.0 3 0.8103775276239246 2.788065219515888 67557.0 40.78115509672358 0.0 - - - - - - - 1231.0 135 2 C14orf148 chromosome 14 open reading frame 148 275 35 B20140407_SF105_01 B20140407_SF105_01 TB499081.[MT7]-LQLTDFVSK[MT7].2y5_1.heavy 669.897 / 739.411 40934.0 33.6068000793457 39 9 10 10 10 0.624378446304432 88.93173989280125 0.0 3 0.8103775276239246 2.788065219515888 40934.0 27.65490614405028 0.0 - - - - - - - 359.3333333333333 81 3 C14orf148 chromosome 14 open reading frame 148 277 35 B20140407_SF105_01 B20140407_SF105_01 TB499081.[MT7]-LQLTDFVSK[MT7].2y6_1.heavy 669.897 / 840.458 61401.0 33.6068000793457 39 9 10 10 10 0.624378446304432 88.93173989280125 0.0 3 0.8103775276239246 2.788065219515888 61401.0 86.1838374754127 0.0 - - - - - - - 308.0 122 3 C14orf148 chromosome 14 open reading frame 148 279 35 B20140407_SF105_01 B20140407_SF105_01 TB499081.[MT7]-LQLTDFVSK[MT7].2b5_1.heavy 669.897 / 715.411 52322.0 33.6068000793457 39 9 10 10 10 0.624378446304432 88.93173989280125 0.0 3 0.8103775276239246 2.788065219515888 52322.0 21.756979119111342 0.0 - - - - - - - 462.0 104 1 C14orf148 chromosome 14 open reading frame 148 281 36 B20140407_SF105_01 B20140407_SF105_01 TB499080.[MT7]-EANAPGPVPGER.2y8_1.heavy 669.35 / 808.431 195641.0 22.10932493209839 39 13 10 6 10 1.940249703877721 51.53975789824536 0.03949928283691406 3 0.9204920986686641 4.347472570172507 195641.0 108.08056863211516 0.0 - - - - - - - 247.0 391 5 SUMF1 sulfatase modifying factor 1 283 36 B20140407_SF105_01 B20140407_SF105_01 TB499080.[MT7]-EANAPGPVPGER.2y9_1.heavy 669.35 / 879.468 25937.0 22.10932493209839 39 13 10 6 10 1.940249703877721 51.53975789824536 0.03949928283691406 3 0.9204920986686641 4.347472570172507 25937.0 66.29101950285565 0.0 - - - - - - - 267.5 51 4 SUMF1 sulfatase modifying factor 1 285 36 B20140407_SF105_01 B20140407_SF105_01 TB499080.[MT7]-EANAPGPVPGER.2b4_1.heavy 669.35 / 530.269 193418.0 22.10932493209839 39 13 10 6 10 1.940249703877721 51.53975789824536 0.03949928283691406 3 0.9204920986686641 4.347472570172507 193418.0 108.10590967261447 0.0 - - - - - - - 246.66666666666666 386 3 SUMF1 sulfatase modifying factor 1 287 36 B20140407_SF105_01 B20140407_SF105_01 TB499080.[MT7]-EANAPGPVPGER.2y11_1.heavy 669.35 / 1064.55 37547.0 22.10932493209839 39 13 10 6 10 1.940249703877721 51.53975789824536 0.03949928283691406 3 0.9204920986686641 4.347472570172507 37547.0 120.19941018312535 0.0 - - - - - - - 276.1764705882353 75 17 SUMF1 sulfatase modifying factor 1 289 37 B20140407_SF105_01 B20140407_SF105_01 TB149919.[MT7]-GVPGK[MT7]PGR.3y6_2.heavy 352.557 / 378.236 869459.0 19.31702470779419 35 12 10 3 10 3.5049652914896483 28.530953000535682 0.07269859313964844 3 0.8800976655699028 3.5278529109618266 869459.0 341.6789333629886 0.0 - - - - - - - 1216.0 1738 2 COL16A1;COL22A1;CHAC2 collagen, type XVI, alpha 1;collagen, type XXII, alpha 1;ChaC, cation transport regulator homolog 2 (E. coli) 291 37 B20140407_SF105_01 B20140407_SF105_01 TB149919.[MT7]-GVPGK[MT7]PGR.3y6_1.heavy 352.557 / 755.464 64.0 19.31702470779419 35 12 10 3 10 3.5049652914896483 28.530953000535682 0.07269859313964844 3 0.8800976655699028 3.5278529109618266 64.0 0.0 19.0 - - - - - - - 0.0 0 0 COL16A1;COL22A1;CHAC2 collagen, type XVI, alpha 1;collagen, type XXII, alpha 1;ChaC, cation transport regulator homolog 2 (E. coli) 293 37 B20140407_SF105_01 B20140407_SF105_01 TB149919.[MT7]-GVPGK[MT7]PGR.3b5_2.heavy 352.557 / 364.239 361756.0 19.31702470779419 35 12 10 3 10 3.5049652914896483 28.530953000535682 0.07269859313964844 3 0.8800976655699028 3.5278529109618266 361756.0 265.3349954915285 0.0 - - - - - - - 1244.4444444444443 723 9 COL16A1;COL22A1;CHAC2 collagen, type XVI, alpha 1;collagen, type XXII, alpha 1;ChaC, cation transport regulator homolog 2 (E. coli) 295 37 B20140407_SF105_01 B20140407_SF105_01 TB149919.[MT7]-GVPGK[MT7]PGR.3y5_1.heavy 352.557 / 658.412 75499.0 19.31702470779419 35 12 10 3 10 3.5049652914896483 28.530953000535682 0.07269859313964844 3 0.8800976655699028 3.5278529109618266 75499.0 287.0534895833333 0.0 - - - - - - - 233.14285714285714 150 14 COL16A1;COL22A1;CHAC2 collagen, type XVI, alpha 1;collagen, type XXII, alpha 1;ChaC, cation transport regulator homolog 2 (E. coli) 297 38 B20140407_SF105_01 B20140407_SF105_01 TB361128.[MT7]-GIIC[CAM]LVSIYGTHHNPTVWPDSK[MT7].4y5_1.heavy 696.37 / 776.406 8652.0 35.1067008972168 42 12 10 10 10 1.3820087923649718 46.69170854492422 0.0 3 0.8909592249363841 3.702885121646441 8652.0 10.473954100066479 0.0 - - - - - - - 335.25 17 4 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 299 38 B20140407_SF105_01 B20140407_SF105_01 TB361128.[MT7]-GIIC[CAM]LVSIYGTHHNPTVWPDSK[MT7].4y4_1.heavy 696.37 / 590.327 41021.0 35.1067008972168 42 12 10 10 10 1.3820087923649718 46.69170854492422 0.0 3 0.8909592249363841 3.702885121646441 41021.0 31.372639145636093 0.0 - - - - - - - 149.0 82 1 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 301 38 B20140407_SF105_01 B20140407_SF105_01 TB361128.[MT7]-GIIC[CAM]LVSIYGTHHNPTVWPDSK[MT7].4b4_1.heavy 696.37 / 588.33 15066.0 35.1067008972168 42 12 10 10 10 1.3820087923649718 46.69170854492422 0.0 3 0.8909592249363841 3.702885121646441 15066.0 7.916207338310233 1.0 - - - - - - - 895.0 30 1 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 303 38 B20140407_SF105_01 B20140407_SF105_01 TB361128.[MT7]-GIIC[CAM]LVSIYGTHHNPTVWPDSK[MT7].4b5_1.heavy 696.37 / 701.414 10292.0 35.1067008972168 42 12 10 10 10 1.3820087923649718 46.69170854492422 0.0 3 0.8909592249363841 3.702885121646441 10292.0 8.917825782937484 0.0 - - - - - - - 1342.25 20 8 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 305 39 B20140407_SF105_01 B20140407_SF105_01 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 2458720.0 28.214000701904297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2458720.0 424.4000800946463 0.0 - - - - - - - 3293.0 4917 2 307 39 B20140407_SF105_01 B20140407_SF105_01 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 759344.0 28.214000701904297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 759344.0 206.27076407215608 0.0 - - - - - - - 274.0 1518 1 309 39 B20140407_SF105_01 B20140407_SF105_01 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 562108.0 28.214000701904297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 562108.0 152.443970723422 0.0 - - - - - - - 1235.0 1124 1 311 40 B20140407_SF105_01 B20140407_SF105_01 TB499331.[MT7]-LEC[CAM]QINSALTSFHTALELAVDQR.4y9_1.heavy 690.858 / 1014.56 2470.0 42.83284950256348 40 15 10 5 10 2.886808247746447 34.6403333432568 0.041698455810546875 3 0.9501010557772728 5.501663661524044 2470.0 39.22073170731707 0.0 - - - - - - - 205.85714285714286 4 14 TTC39C tetratricopeptide repeat domain 39C 313 40 B20140407_SF105_01 B20140407_SF105_01 TB499331.[MT7]-LEC[CAM]QINSALTSFHTALELAVDQR.4y10_1.heavy 690.858 / 1115.61 2552.0 42.83284950256348 40 15 10 5 10 2.886808247746447 34.6403333432568 0.041698455810546875 3 0.9501010557772728 5.501663661524044 2552.0 11.149514563106797 0.0 - - - - - - - 175.53333333333333 5 15 TTC39C tetratricopeptide repeat domain 39C 315 40 B20140407_SF105_01 B20140407_SF105_01 TB499331.[MT7]-LEC[CAM]QINSALTSFHTALELAVDQR.4b4_1.heavy 690.858 / 675.325 14489.0 42.83284950256348 40 15 10 5 10 2.886808247746447 34.6403333432568 0.041698455810546875 3 0.9501010557772728 5.501663661524044 14489.0 63.365591524773514 0.0 - - - - - - - 705.5714285714286 28 7 TTC39C tetratricopeptide repeat domain 39C 317 40 B20140407_SF105_01 B20140407_SF105_01 TB499331.[MT7]-LEC[CAM]QINSALTSFHTALELAVDQR.4b3_1.heavy 690.858 / 547.267 4116.0 42.83284950256348 40 15 10 5 10 2.886808247746447 34.6403333432568 0.041698455810546875 3 0.9501010557772728 5.501663661524044 4116.0 15.797287234042553 0.0 - - - - - - - 329.375 8 16 TTC39C tetratricopeptide repeat domain 39C 319 41 B20140407_SF105_01 B20140407_SF105_01 TB150275.[MT7]-FK[MT7]TEQENEAK[MT7].3b6_2.heavy 552.637 / 526.287 37491.0 20.610300064086914 40 10 10 10 10 0.7111184181516677 74.6902535262279 0.0 3 0.8261390723862899 2.9158043638522435 37491.0 27.692324712907872 0.0 - - - - - - - 690.3333333333334 74 3 LACTB lactamase, beta 321 41 B20140407_SF105_01 B20140407_SF105_01 TB150275.[MT7]-FK[MT7]TEQENEAK[MT7].3b4_1.heavy 552.637 / 794.465 5570.0 20.610300064086914 40 10 10 10 10 0.7111184181516677 74.6902535262279 0.0 3 0.8261390723862899 2.9158043638522435 5570.0 29.488235294117644 0.0 - - - - - - - 232.7826086956522 11 23 LACTB lactamase, beta 323 41 B20140407_SF105_01 B20140407_SF105_01 TB150275.[MT7]-FK[MT7]TEQENEAK[MT7].3y4_1.heavy 552.637 / 605.338 27351.0 20.610300064086914 40 10 10 10 10 0.7111184181516677 74.6902535262279 0.0 3 0.8261390723862899 2.9158043638522435 27351.0 57.83809792726269 0.0 - - - - - - - 759.5454545454545 54 11 LACTB lactamase, beta 325 41 B20140407_SF105_01 B20140407_SF105_01 TB150275.[MT7]-FK[MT7]TEQENEAK[MT7].3y5_1.heavy 552.637 / 734.38 12140.0 20.610300064086914 40 10 10 10 10 0.7111184181516677 74.6902535262279 0.0 3 0.8261390723862899 2.9158043638522435 12140.0 59.24964667556611 0.0 - - - - - - - 587.1111111111111 24 9 LACTB lactamase, beta 327 42 B20140407_SF105_01 B20140407_SF105_01 TB499308.[MT7]-QYK[MT7]PVVYSNTIQSLAAIVR.4y5_1.heavy 610.356 / 529.346 105883.0 36.247100830078125 47 17 10 10 10 2.8934159441828395 27.566190379463627 0.0 3 0.9796898704406825 8.645064191766222 105883.0 61.59417315071443 0.0 - - - - - - - 784.0 211 3 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 329 42 B20140407_SF105_01 B20140407_SF105_01 TB499308.[MT7]-QYK[MT7]PVVYSNTIQSLAAIVR.4y8_1.heavy 610.356 / 857.52 94854.0 36.247100830078125 47 17 10 10 10 2.8934159441828395 27.566190379463627 0.0 3 0.9796898704406825 8.645064191766222 94854.0 63.1352717959106 0.0 - - - - - - - 264.6 189 5 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 331 42 B20140407_SF105_01 B20140407_SF105_01 TB499308.[MT7]-QYK[MT7]PVVYSNTIQSLAAIVR.4y7_1.heavy 610.356 / 729.462 70001.0 36.247100830078125 47 17 10 10 10 2.8934159441828395 27.566190379463627 0.0 3 0.9796898704406825 8.645064191766222 70001.0 36.19319739160903 0.0 - - - - - - - 882.0 140 1 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 333 42 B20140407_SF105_01 B20140407_SF105_01 TB499308.[MT7]-QYK[MT7]PVVYSNTIQSLAAIVR.4b6_2.heavy 610.356 / 502.313 66912.0 36.247100830078125 47 17 10 10 10 2.8934159441828395 27.566190379463627 0.0 3 0.9796898704406825 8.645064191766222 66912.0 55.96739065674026 0.0 - - - - - - - 441.0 133 1 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 335 43 B20140407_SF105_01 B20140407_SF105_01 TB499078.[MT7]-TELVAWAVSNWGPNSAR.3y6_1.heavy 668.014 / 601.305 186936.0 38.049400329589844 48 18 10 10 10 2.663276528944678 29.9247688450381 0.0 3 0.9805174481454076 8.827379954436012 186936.0 191.74685294117646 0.0 - - - - - - - 922.0 373 1 FUT6 fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 337 43 B20140407_SF105_01 B20140407_SF105_01 TB499078.[MT7]-TELVAWAVSNWGPNSAR.3b4_1.heavy 668.014 / 587.352 127522.0 38.049400329589844 48 18 10 10 10 2.663276528944678 29.9247688450381 0.0 3 0.9805174481454076 8.827379954436012 127522.0 50.156039346560675 0.0 - - - - - - - 1317.5 255 2 FUT6 fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 339 43 B20140407_SF105_01 B20140407_SF105_01 TB499078.[MT7]-TELVAWAVSNWGPNSAR.3b5_1.heavy 668.014 / 658.389 218685.0 38.049400329589844 48 18 10 10 10 2.663276528944678 29.9247688450381 0.0 3 0.9805174481454076 8.827379954436012 218685.0 94.50451770020531 0.0 - - - - - - - 395.0 437 1 FUT6 fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 341 43 B20140407_SF105_01 B20140407_SF105_01 TB499078.[MT7]-TELVAWAVSNWGPNSAR.3y9_1.heavy 668.014 / 988.459 77725.0 38.049400329589844 48 18 10 10 10 2.663276528944678 29.9247688450381 0.0 3 0.9805174481454076 8.827379954436012 77725.0 213.70687855787477 0.0 - - - - - - - 263.2 155 5 FUT6 fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 343 44 B20140407_SF105_01 B20140407_SF105_01 TB499307.[MT7]-LAEQFVLLNLVY[MT7]ETTDK[MT7].4b4_1.heavy 607.848 / 586.332 57536.0 39.80162525177002 43 17 10 6 10 3.202568243843716 25.383462571378708 0.037899017333984375 3 0.9785544283629408 8.412292122668946 57536.0 125.33651142125346 0.0 - - - - - - - 706.7 115 10 AGR2 anterior gradient homolog 2 (Xenopus laevis) 345 44 B20140407_SF105_01 B20140407_SF105_01 TB499307.[MT7]-LAEQFVLLNLVY[MT7]ETTDK[MT7].4b5_1.heavy 607.848 / 733.4 82716.0 39.80162525177002 43 17 10 6 10 3.202568243843716 25.383462571378708 0.037899017333984375 3 0.9785544283629408 8.412292122668946 82716.0 224.64862309404796 0.0 - - - - - - - 342.0 165 9 AGR2 anterior gradient homolog 2 (Xenopus laevis) 347 44 B20140407_SF105_01 B20140407_SF105_01 TB499307.[MT7]-LAEQFVLLNLVY[MT7]ETTDK[MT7].4y6_1.heavy 607.848 / 1044.55 10254.0 39.80162525177002 43 17 10 6 10 3.202568243843716 25.383462571378708 0.037899017333984375 3 0.9785544283629408 8.412292122668946 10254.0 80.41294736842104 0.0 - - - - - - - 161.5 20 12 AGR2 anterior gradient homolog 2 (Xenopus laevis) 349 44 B20140407_SF105_01 B20140407_SF105_01 TB499307.[MT7]-LAEQFVLLNLVY[MT7]ETTDK[MT7].4b6_1.heavy 607.848 / 832.469 46713.0 39.80162525177002 43 17 10 6 10 3.202568243843716 25.383462571378708 0.037899017333984375 3 0.9785544283629408 8.412292122668946 46713.0 106.8082650834403 0.0 - - - - - - - 700.2857142857143 93 7 AGR2 anterior gradient homolog 2 (Xenopus laevis) 351 45 B20140407_SF105_01 B20140407_SF105_01 TB499305.[MT7]-LIDTFSLIEHLQGLSQAVPR.4y8_1.heavy 596.088 / 827.473 7921.0 41.767799377441406 38 13 10 5 10 2.5678984184504556 38.94235039886932 0.04180145263671875 3 0.9076894366845565 4.030304098706867 7921.0 84.34225219277562 0.0 - - - - - - - 212.3846153846154 15 13 CATSPER2 cation channel, sperm associated 2 353 45 B20140407_SF105_01 B20140407_SF105_01 TB499305.[MT7]-LIDTFSLIEHLQGLSQAVPR.4y9_1.heavy 596.088 / 955.532 7737.0 41.767799377441406 38 13 10 5 10 2.5678984184504556 38.94235039886932 0.04180145263671875 3 0.9076894366845565 4.030304098706867 7737.0 118.99842391304347 0.0 - - - - - - - 156.5 15 10 CATSPER2 cation channel, sperm associated 2 355 45 B20140407_SF105_01 B20140407_SF105_01 TB499305.[MT7]-LIDTFSLIEHLQGLSQAVPR.4b4_1.heavy 596.088 / 587.352 22934.0 41.767799377441406 38 13 10 5 10 2.5678984184504556 38.94235039886932 0.04180145263671875 3 0.9076894366845565 4.030304098706867 22934.0 24.375565714285713 0.0 - - - - - - - 368.3333333333333 45 3 CATSPER2 cation channel, sperm associated 2 357 45 B20140407_SF105_01 B20140407_SF105_01 TB499305.[MT7]-LIDTFSLIEHLQGLSQAVPR.4b6_1.heavy 596.088 / 821.453 7921.0 41.767799377441406 38 13 10 5 10 2.5678984184504556 38.94235039886932 0.04180145263671875 3 0.9076894366845565 4.030304098706867 7921.0 90.66895117540686 0.0 - - - - - - - 209.0909090909091 15 11 CATSPER2 cation channel, sperm associated 2 359 46 B20140407_SF105_01 B20140407_SF105_01 TB150049.[MT7]-TEQENEAK[MT7].3y3_1.heavy 412.882 / 491.295 10714.0 17.2007999420166 48 18 10 10 10 4.7277142611384155 21.151870539637983 0.0 3 0.9853648482030232 10.189025833931817 10714.0 10.734097627134187 0.0 - - - - - - - 296.5 21 4 LACTB lactamase, beta 361 46 B20140407_SF105_01 B20140407_SF105_01 TB150049.[MT7]-TEQENEAK[MT7].3b4_1.heavy 412.882 / 632.301 11228.0 17.2007999420166 48 18 10 10 10 4.7277142611384155 21.151870539637983 0.0 3 0.9853648482030232 10.189025833931817 11228.0 26.951336416140606 0.0 - - - - - - - 271.14285714285717 22 14 LACTB lactamase, beta 363 46 B20140407_SF105_01 B20140407_SF105_01 TB150049.[MT7]-TEQENEAK[MT7].3b5_1.heavy 412.882 / 746.344 5060.0 17.2007999420166 48 18 10 10 10 4.7277142611384155 21.151870539637983 0.0 3 0.9853648482030232 10.189025833931817 5060.0 13.197862771816565 0.0 - - - - - - - 138.57142857142858 10 14 LACTB lactamase, beta 365 46 B20140407_SF105_01 B20140407_SF105_01 TB150049.[MT7]-TEQENEAK[MT7].3b3_1.heavy 412.882 / 503.258 21506.0 17.2007999420166 48 18 10 10 10 4.7277142611384155 21.151870539637983 0.0 3 0.9853648482030232 10.189025833931817 21506.0 29.057962427745665 0.0 - - - - - - - 794.0833333333334 43 12 LACTB lactamase, beta 367 47 B20140407_SF105_01 B20140407_SF105_01 TB499304.[MT7]-LIDTFSLIEHLQGLSQAVPR.3b6_1.heavy 794.448 / 821.453 20623.0 41.788700103759766 47 17 10 10 10 2.459490905100972 32.41192000444322 0.0 3 0.9758509086427428 7.925635447635952 20623.0 65.87094834324554 0.0 - - - - - - - 660.1 41 10 CATSPER2 cation channel, sperm associated 2 369 47 B20140407_SF105_01 B20140407_SF105_01 TB499304.[MT7]-LIDTFSLIEHLQGLSQAVPR.3y8_1.heavy 794.448 / 827.473 48395.0 41.788700103759766 47 17 10 10 10 2.459490905100972 32.41192000444322 0.0 3 0.9758509086427428 7.925635447635952 48395.0 108.52212121212122 0.0 - - - - - - - 286.5 96 8 CATSPER2 cation channel, sperm associated 2 371 47 B20140407_SF105_01 B20140407_SF105_01 TB499304.[MT7]-LIDTFSLIEHLQGLSQAVPR.3y10_1.heavy 794.448 / 1068.62 34188.0 41.788700103759766 47 17 10 10 10 2.459490905100972 32.41192000444322 0.0 3 0.9758509086427428 7.925635447635952 34188.0 100.64691588785047 0.0 - - - - - - - 220.1 68 10 CATSPER2 cation channel, sperm associated 2 373 47 B20140407_SF105_01 B20140407_SF105_01 TB499304.[MT7]-LIDTFSLIEHLQGLSQAVPR.3y9_1.heavy 794.448 / 955.532 56370.0 41.788700103759766 47 17 10 10 10 2.459490905100972 32.41192000444322 0.0 3 0.9758509086427428 7.925635447635952 56370.0 171.1691245581202 0.0 - - - - - - - 240.5 112 8 CATSPER2 cation channel, sperm associated 2 375 48 B20140407_SF105_01 B20140407_SF105_01 TB499033.[MT7]-FENSIESLR.2y4_1.heavy 619.828 / 504.278 22350.0 29.80430030822754 42 18 8 10 6 3.3537583367204364 23.431821807079686 0.0 5 0.9881832195711433 11.34185769046143 22350.0 9.37091500040951 1.0 - - - - - - - 1726.6666666666667 93 3 LACTB lactamase, beta 377 48 B20140407_SF105_01 B20140407_SF105_01 TB499033.[MT7]-FENSIESLR.2b3_1.heavy 619.828 / 535.263 23535.0 29.80430030822754 42 18 8 10 6 3.3537583367204364 23.431821807079686 0.0 5 0.9881832195711433 11.34185769046143 23535.0 14.8384431442151 1.0 - - - - - - - 740.0 133 1 LACTB lactamase, beta 379 48 B20140407_SF105_01 B20140407_SF105_01 TB499033.[MT7]-FENSIESLR.2y6_1.heavy 619.828 / 704.394 28271.0 29.80430030822754 42 18 8 10 6 3.3537583367204364 23.431821807079686 0.0 5 0.9881832195711433 11.34185769046143 28271.0 20.648097484060653 1.0 - - - - - - - 740.0 72 3 LACTB lactamase, beta 381 48 B20140407_SF105_01 B20140407_SF105_01 TB499033.[MT7]-FENSIESLR.2y7_1.heavy 619.828 / 818.437 50326.0 29.80430030822754 42 18 8 10 6 3.3537583367204364 23.431821807079686 0.0 5 0.9881832195711433 11.34185769046143 50326.0 70.86753992628992 0.0 - - - - - - - 1202.5 100 8 LACTB lactamase, beta 383 49 B20140407_SF105_01 B20140407_SF105_01 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 1398850.0 18.637100219726562 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1398850.0 1143.026388527804 0.0 - - - - - - - 1727.2 2797 5 385 49 B20140407_SF105_01 B20140407_SF105_01 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 2730070.0 18.637100219726562 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2730070.0 2780.020374522821 0.0 - - - - - - - 1226.0 5460 1 387 49 B20140407_SF105_01 B20140407_SF105_01 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 992519.0 18.637100219726562 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 992519.0 1392.8345520494556 0.0 - - - - - - - 1259.142857142857 1985 7 389 50 B20140407_SF105_01 B20140407_SF105_01 TB150047.[MT7]-K[MT7]VEVEAIR.3y7_1.heavy 411.259 / 815.462 2949.0 23.797500610351562 43 13 10 10 10 4.11258087016474 24.31563126830239 0.0 3 0.9159579883819486 4.226925450792065 2949.0 40.24432193567082 0.0 - - - - - - - 175.63636363636363 5 11 IGSF22 immunoglobulin superfamily, member 22 391 50 B20140407_SF105_01 B20140407_SF105_01 TB150047.[MT7]-K[MT7]VEVEAIR.3y6_1.heavy 411.259 / 716.394 37731.0 23.797500610351562 43 13 10 10 10 4.11258087016474 24.31563126830239 0.0 3 0.9159579883819486 4.226925450792065 37731.0 115.63539572231262 0.0 - - - - - - - 623.0 75 8 IGSF22 immunoglobulin superfamily, member 22 393 50 B20140407_SF105_01 B20140407_SF105_01 TB150047.[MT7]-K[MT7]VEVEAIR.3y4_1.heavy 411.259 / 488.283 113906.0 23.797500610351562 43 13 10 10 10 4.11258087016474 24.31563126830239 0.0 3 0.9159579883819486 4.226925450792065 113906.0 33.51471926114629 0.0 - - - - - - - 2271.3333333333335 227 3 IGSF22 immunoglobulin superfamily, member 22 395 50 B20140407_SF105_01 B20140407_SF105_01 TB150047.[MT7]-K[MT7]VEVEAIR.3y5_1.heavy 411.259 / 587.351 89294.0 23.797500610351562 43 13 10 10 10 4.11258087016474 24.31563126830239 0.0 3 0.9159579883819486 4.226925450792065 89294.0 77.9689377953075 0.0 - - - - - - - 915.0 178 1 IGSF22 immunoglobulin superfamily, member 22 397 51 B20140407_SF105_01 B20140407_SF105_01 TB360629.[MT7]-DAFDSFER.2y4_1.heavy 565.765 / 538.262 38838.0 29.42060089111328 44 14 10 10 10 1.94073105464619 41.04857663814026 0.0 3 0.949522682379158 5.469784995413218 38838.0 17.63309459165077 0.0 - - - - - - - 1849.0 77 1 TTC39C tetratricopeptide repeat domain 39C 399 51 B20140407_SF105_01 B20140407_SF105_01 TB360629.[MT7]-DAFDSFER.2b4_1.heavy 565.765 / 593.269 34855.0 29.42060089111328 44 14 10 10 10 1.94073105464619 41.04857663814026 0.0 3 0.949522682379158 5.469784995413218 34855.0 22.654927168156853 0.0 - - - - - - - 1280.0 69 1 TTC39C tetratricopeptide repeat domain 39C 401 51 B20140407_SF105_01 B20140407_SF105_01 TB360629.[MT7]-DAFDSFER.2b5_1.heavy 565.765 / 680.301 7113.0 29.42060089111328 44 14 10 10 10 1.94073105464619 41.04857663814026 0.0 3 0.949522682379158 5.469784995413218 7113.0 2.413532344043369 3.0 - - - - - - - 640.0 16 2 TTC39C tetratricopeptide repeat domain 39C 403 51 B20140407_SF105_01 B20140407_SF105_01 TB360629.[MT7]-DAFDSFER.2y7_1.heavy 565.765 / 871.394 22904.0 29.42060089111328 44 14 10 10 10 1.94073105464619 41.04857663814026 0.0 3 0.949522682379158 5.469784995413218 22904.0 33.864718487305986 0.0 - - - - - - - 285.0 45 2 TTC39C tetratricopeptide repeat domain 39C 405 52 B20140407_SF105_01 B20140407_SF105_01 TB499070.[MT7]-WWTC[CAM]FVK[MT7].2y4_1.heavy 657.849 / 697.382 20653.0 36.68159866333008 48 18 10 10 10 6.159046115432773 16.2362804443742 0.0 3 0.9876066211334332 11.07434254316337 20653.0 17.974425404611857 0.0 - - - - - - - 644.1428571428571 41 7 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 407 52 B20140407_SF105_01 B20140407_SF105_01 TB499070.[MT7]-WWTC[CAM]FVK[MT7].2y5_1.heavy 657.849 / 798.43 40143.0 36.68159866333008 48 18 10 10 10 6.159046115432773 16.2362804443742 0.0 3 0.9876066211334332 11.07434254316337 40143.0 43.24658488117889 0.0 - - - - - - - 327.0 80 4 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 409 52 B20140407_SF105_01 B20140407_SF105_01 TB499070.[MT7]-WWTC[CAM]FVK[MT7].2y3_1.heavy 657.849 / 537.352 16435.0 36.68159866333008 48 18 10 10 10 6.159046115432773 16.2362804443742 0.0 3 0.9876066211334332 11.07434254316337 16435.0 17.2650301120382 0.0 - - - - - - - 291.0 32 3 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 411 52 B20140407_SF105_01 B20140407_SF105_01 TB499070.[MT7]-WWTC[CAM]FVK[MT7].2y6_1.heavy 657.849 / 984.509 36361.0 36.68159866333008 48 18 10 10 10 6.159046115432773 16.2362804443742 0.0 3 0.9876066211334332 11.07434254316337 36361.0 56.827191471801925 0.0 - - - - - - - 254.25 72 8 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 413 53 B20140407_SF105_01 B20140407_SF105_01 TB360627.[MT7]-LQHYFK[MT7].3y3_1.heavy 375.222 / 601.347 70969.0 25.91160011291504 42 12 10 10 10 0.8678441881783163 71.44034559310711 0.0 3 0.8871681726297834 3.6389479191026117 70969.0 88.33375531914893 0.0 - - - - - - - 755.1428571428571 141 7 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 415 53 B20140407_SF105_01 B20140407_SF105_01 TB360627.[MT7]-LQHYFK[MT7].3b3_2.heavy 375.222 / 262.159 77197.0 25.91160011291504 42 12 10 10 10 0.8678441881783163 71.44034559310711 0.0 3 0.8871681726297834 3.6389479191026117 77197.0 32.90672007003877 0.0 - - - - - - - 881.0 154 2 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 417 53 B20140407_SF105_01 B20140407_SF105_01 TB360627.[MT7]-LQHYFK[MT7].3b3_1.heavy 375.222 / 523.311 96349.0 25.91160011291504 42 12 10 10 10 0.8678441881783163 71.44034559310711 0.0 3 0.8871681726297834 3.6389479191026117 96349.0 199.3001150448053 0.0 - - - - - - - 285.2857142857143 192 7 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 419 53 B20140407_SF105_01 B20140407_SF105_01 TB360627.[MT7]-LQHYFK[MT7].3y3_2.heavy 375.222 / 301.177 35602.0 25.91160011291504 42 12 10 10 10 0.8678441881783163 71.44034559310711 0.0 3 0.8871681726297834 3.6389479191026117 35602.0 3.7652257298441465 1.0 - - - - - - - 1057.0 121 1 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 421 54 B20140407_SF105_01 B20140407_SF105_01 TB499072.[MT7]-AAAPGGLASSC[CAM]GR.2y12_1.heavy 659.836 / 1103.53 30985.0 22.158100128173828 50 20 10 10 10 7.023839295342418 14.23722778884065 0.0 3 0.9915805486274608 13.44049586933851 30985.0 71.09331593425286 0.0 - - - - - - - 233.63636363636363 61 11 LACTB lactamase, beta 423 54 B20140407_SF105_01 B20140407_SF105_01 TB499072.[MT7]-AAAPGGLASSC[CAM]GR.2y9_1.heavy 659.836 / 864.399 15575.0 22.158100128173828 50 20 10 10 10 7.023839295342418 14.23722778884065 0.0 3 0.9915805486274608 13.44049586933851 15575.0 75.72820305518914 0.0 - - - - - - - 270.36842105263156 31 19 LACTB lactamase, beta 425 54 B20140407_SF105_01 B20140407_SF105_01 TB499072.[MT7]-AAAPGGLASSC[CAM]GR.2y10_1.heavy 659.836 / 961.452 224100.0 22.158100128173828 50 20 10 10 10 7.023839295342418 14.23722778884065 0.0 3 0.9915805486274608 13.44049586933851 224100.0 325.07452488244513 0.0 - - - - - - - 314.8 448 5 LACTB lactamase, beta 427 54 B20140407_SF105_01 B20140407_SF105_01 TB499072.[MT7]-AAAPGGLASSC[CAM]GR.2y11_1.heavy 659.836 / 1032.49 25434.0 22.158100128173828 50 20 10 10 10 7.023839295342418 14.23722778884065 0.0 3 0.9915805486274608 13.44049586933851 25434.0 126.72589313776845 0.0 - - - - - - - 179.75 50 12 LACTB lactamase, beta 429 55 B20140407_SF105_01 B20140407_SF105_01 TB360522.[MT7]-LWLEDR.2b3_1.heavy 488.273 / 557.357 17828.0 31.96470069885254 40 20 4 10 6 5.481832469771544 18.242075173115882 0.0 6 0.9943306351805582 16.382861991700224 17828.0 10.421623528721941 1.0 - - - - - - - 749.0 35 3 GP9 glycoprotein IX (platelet) 431 55 B20140407_SF105_01 B20140407_SF105_01 TB360522.[MT7]-LWLEDR.2y4_1.heavy 488.273 / 532.273 24270.0 31.96470069885254 40 20 4 10 6 5.481832469771544 18.242075173115882 0.0 6 0.9943306351805582 16.382861991700224 24270.0 8.8892889741036 0.0 - - - - - - - 1348.5 48 2 GP9 glycoprotein IX (platelet) 433 55 B20140407_SF105_01 B20140407_SF105_01 TB360522.[MT7]-LWLEDR.2y5_1.heavy 488.273 / 718.352 133487.0 31.96470069885254 40 20 4 10 6 5.481832469771544 18.242075173115882 0.0 6 0.9943306351805582 16.382861991700224 133487.0 148.24715883266384 2.0 - - - - - - - 3745.5 468 2 GP9 glycoprotein IX (platelet) 435 55 B20140407_SF105_01 B20140407_SF105_01 TB360522.[MT7]-LWLEDR.2b5_1.heavy 488.273 / 801.426 19177.0 31.96470069885254 40 20 4 10 6 5.481832469771544 18.242075173115882 0.0 6 0.9943306351805582 16.382861991700224 19177.0 14.360719633511344 1.0 - - - - - - - 724.0 120 6 GP9 glycoprotein IX (platelet) 437 56 B20140407_SF105_01 B20140407_SF105_01 TB150185.[MT7]-DYDSTC[CAM]VFC[CAM]R.2b3_1.heavy 733.812 / 538.227 87459.0 27.58099937438965 44 14 10 10 10 2.215427414017267 45.13801687533898 0.0 3 0.9493339660574581 5.4595013237019945 87459.0 33.13553199223494 0.0 - - - - - - - 308.25 174 4 HINT3 histidine triad nucleotide binding protein 3 439 56 B20140407_SF105_01 B20140407_SF105_01 TB150185.[MT7]-DYDSTC[CAM]VFC[CAM]R.2y8_1.heavy 733.812 / 1044.42 14531.0 27.58099937438965 44 14 10 10 10 2.215427414017267 45.13801687533898 0.0 3 0.9493339660574581 5.4595013237019945 14531.0 20.34782696924907 0.0 - - - - - - - 234.85714285714286 29 7 HINT3 histidine triad nucleotide binding protein 3 441 56 B20140407_SF105_01 B20140407_SF105_01 TB150185.[MT7]-DYDSTC[CAM]VFC[CAM]R.2y9_1.heavy 733.812 / 1207.49 22893.0 27.58099937438965 44 14 10 10 10 2.215427414017267 45.13801687533898 0.0 3 0.9493339660574581 5.4595013237019945 22893.0 44.40419538356101 0.0 - - - - - - - 287.7 45 10 HINT3 histidine triad nucleotide binding protein 3 443 56 B20140407_SF105_01 B20140407_SF105_01 TB150185.[MT7]-DYDSTC[CAM]VFC[CAM]R.2y7_1.heavy 733.812 / 929.397 56204.0 27.58099937438965 44 14 10 10 10 2.215427414017267 45.13801687533898 0.0 3 0.9493339660574581 5.4595013237019945 56204.0 35.945572113930524 0.0 - - - - - - - 239.75 112 4 HINT3 histidine triad nucleotide binding protein 3 445 57 B20140407_SF105_01 B20140407_SF105_01 TB360623.[MT7]-ELSDEDIR.2y4_1.heavy 560.784 / 532.273 14798.0 24.4618501663208 44 18 10 6 10 5.111009374921828 19.565606842881106 0.037799835205078125 3 0.984485678392609 9.895389394681366 14798.0 3.8695415301943585 0.0 - - - - - - - 2293.0 29 1 CYP4F8;CYP4F22;CYP4F11 cytochrome P450, family 4, subfamily F, polypeptide 8;cytochrome P450, family 4, subfamily F, polypeptide 22;cytochrome P450, family 4, subfamily F, polypeptide 11 447 57 B20140407_SF105_01 B20140407_SF105_01 TB360623.[MT7]-ELSDEDIR.2b4_1.heavy 560.784 / 589.295 18758.0 24.4618501663208 44 18 10 6 10 5.111009374921828 19.565606842881106 0.037799835205078125 3 0.984485678392609 9.895389394681366 18758.0 6.727938452258252 0.0 - - - - - - - 1797.75 37 4 CYP4F8;CYP4F22;CYP4F11 cytochrome P450, family 4, subfamily F, polypeptide 8;cytochrome P450, family 4, subfamily F, polypeptide 22;cytochrome P450, family 4, subfamily F, polypeptide 11 449 57 B20140407_SF105_01 B20140407_SF105_01 TB360623.[MT7]-ELSDEDIR.2b6_1.heavy 560.784 / 833.365 61379.0 24.4618501663208 44 18 10 6 10 5.111009374921828 19.565606842881106 0.037799835205078125 3 0.984485678392609 9.895389394681366 61379.0 19.51586383037958 0.0 - - - - - - - 3752.0 122 1 CYP4F8;CYP4F22;CYP4F11 cytochrome P450, family 4, subfamily F, polypeptide 8;cytochrome P450, family 4, subfamily F, polypeptide 22;cytochrome P450, family 4, subfamily F, polypeptide 11 451 57 B20140407_SF105_01 B20140407_SF105_01 TB360623.[MT7]-ELSDEDIR.2y7_1.heavy 560.784 / 847.416 10629.0 24.4618501663208 44 18 10 6 10 5.111009374921828 19.565606842881106 0.037799835205078125 3 0.984485678392609 9.895389394681366 10629.0 3.987457368494862 1.0 - - - - - - - 886.0 21 2 CYP4F8;CYP4F22;CYP4F11 cytochrome P450, family 4, subfamily F, polypeptide 8;cytochrome P450, family 4, subfamily F, polypeptide 22;cytochrome P450, family 4, subfamily F, polypeptide 11 453 58 B20140407_SF105_01 B20140407_SF105_01 TB499300.[MT7]-LLTPAFHFDILK[MT7]PYMK[MT7].4y4_1.heavy 592.347 / 682.371 23631.0 37.10110092163086 31 13 2 10 6 2.418846841693298 41.34201400283602 0.0 6 0.9232584185491879 4.4261864419813275 23631.0 28.148142180094784 0.0 - - - - - - - 351.5 47 6 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 455 58 B20140407_SF105_01 B20140407_SF105_01 TB499300.[MT7]-LLTPAFHFDILK[MT7]PYMK[MT7].4b5_1.heavy 592.347 / 640.415 19692.0 37.10110092163086 31 13 2 10 6 2.418846841693298 41.34201400283602 0.0 6 0.9232584185491879 4.4261864419813275 19692.0 18.47089690689726 1.0 - - - - - - - 328.0 115 6 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 457 58 B20140407_SF105_01 B20140407_SF105_01 TB499300.[MT7]-LLTPAFHFDILK[MT7]PYMK[MT7].4y3_1.heavy 592.347 / 585.319 2391.0 37.10110092163086 31 13 2 10 6 2.418846841693298 41.34201400283602 0.0 6 0.9232584185491879 4.4261864419813275 2391.0 1.953773459168283 14.0 - - - - - - - 879.25 12 12 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 459 58 B20140407_SF105_01 B20140407_SF105_01 TB499300.[MT7]-LLTPAFHFDILK[MT7]PYMK[MT7].4b6_1.heavy 592.347 / 787.483 6611.0 37.10110092163086 31 13 2 10 6 2.418846841693298 41.34201400283602 0.0 6 0.9232584185491879 4.4261864419813275 6611.0 12.071290756909193 2.0 - - - - - - - 844.1111111111111 80 9 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 461 59 B20140407_SF105_01 B20140407_SF105_01 TB150041.[MT7]-SLTMVALAK[MT7].2y4_1.heavy 611.378 / 546.373 29927.0 31.260499954223633 50 20 10 10 10 4.0760844861840235 19.469431965889136 0.0 3 0.9908099781294815 12.863849117604339 29927.0 14.795669592844044 0.0 - - - - - - - 1738.125 59 8 LACTB lactamase, beta 463 59 B20140407_SF105_01 B20140407_SF105_01 TB150041.[MT7]-SLTMVALAK[MT7].2y5_1.heavy 611.378 / 645.442 17684.0 31.260499954223633 50 20 10 10 10 4.0760844861840235 19.469431965889136 0.0 3 0.9908099781294815 12.863849117604339 17684.0 10.90917030622434 0.0 - - - - - - - 806.3333333333334 35 3 LACTB lactamase, beta 465 59 B20140407_SF105_01 B20140407_SF105_01 TB150041.[MT7]-SLTMVALAK[MT7].2b4_1.heavy 611.378 / 577.314 16928.0 31.260499954223633 50 20 10 10 10 4.0760844861840235 19.469431965889136 0.0 3 0.9908099781294815 12.863849117604339 16928.0 9.611725190839694 0.0 - - - - - - - 831.5 33 2 LACTB lactamase, beta 467 59 B20140407_SF105_01 B20140407_SF105_01 TB150041.[MT7]-SLTMVALAK[MT7].2y6_1.heavy 611.378 / 776.482 12999.0 31.260499954223633 50 20 10 10 10 4.0760844861840235 19.469431965889136 0.0 3 0.9908099781294815 12.863849117604339 12999.0 18.060217147700126 0.0 - - - - - - - 1295.2857142857142 25 7 LACTB lactamase, beta 469 60 B20140407_SF105_01 B20140407_SF105_01 TB150247.[MT7]-AMDTLGIEYGDK[MT7].3b6_1.heavy 534.276 / 733.367 109925.0 30.16515064239502 42 17 10 5 10 2.0365224776039046 38.74714769613054 0.04730033874511719 3 0.9724944859319764 7.424239454301287 109925.0 88.18852113614477 0.0 - - - - - - - 1373.0 219 6 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 471 60 B20140407_SF105_01 B20140407_SF105_01 TB150247.[MT7]-AMDTLGIEYGDK[MT7].3b4_1.heavy 534.276 / 563.262 42383.0 30.16515064239502 42 17 10 5 10 2.0365224776039046 38.74714769613054 0.04730033874511719 3 0.9724944859319764 7.424239454301287 42383.0 24.233146298499435 0.0 - - - - - - - 899.0 84 1 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 473 60 B20140407_SF105_01 B20140407_SF105_01 TB150247.[MT7]-AMDTLGIEYGDK[MT7].3y4_1.heavy 534.276 / 626.327 82069.0 30.16515064239502 42 17 10 5 10 2.0365224776039046 38.74714769613054 0.04730033874511719 3 0.9724944859319764 7.424239454301287 82069.0 35.92162754987811 0.0 - - - - - - - 1198.0 164 1 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 475 60 B20140407_SF105_01 B20140407_SF105_01 TB150247.[MT7]-AMDTLGIEYGDK[MT7].3y5_1.heavy 534.276 / 755.369 27706.0 30.16515064239502 42 17 10 5 10 2.0365224776039046 38.74714769613054 0.04730033874511719 3 0.9724944859319764 7.424239454301287 27706.0 19.229724263082208 0.0 - - - - - - - 374.5 55 2 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 477 61 B20140407_SF105_01 B20140407_SF105_01 TB150040.[MT7]-RQQNTQEMPWNVR.3y7_1.heavy 610.977 / 931.445 19072.0 27.7012996673584 37 7 10 10 10 0.6327505460431214 80.58091461767816 0.0 3 0.7323784384053389 2.330250528539137 19072.0 28.646283417882117 0.0 - - - - - - - 668.875 38 8 GCET2 germinal center expressed transcript 2 479 61 B20140407_SF105_01 B20140407_SF105_01 TB150040.[MT7]-RQQNTQEMPWNVR.3y6_1.heavy 610.977 / 802.403 24423.0 27.7012996673584 37 7 10 10 10 0.6327505460431214 80.58091461767816 0.0 3 0.7323784384053389 2.330250528539137 24423.0 16.88516261995369 0.0 - - - - - - - 274.3333333333333 48 3 GCET2 germinal center expressed transcript 2 481 61 B20140407_SF105_01 B20140407_SF105_01 TB150040.[MT7]-RQQNTQEMPWNVR.3y4_1.heavy 610.977 / 574.31 22639.0 27.7012996673584 37 7 10 10 10 0.6327505460431214 80.58091461767816 0.0 3 0.7323784384053389 2.330250528539137 22639.0 2.961353676033868 2.0 - - - - - - - 1697.875 49 8 GCET2 germinal center expressed transcript 2 483 61 B20140407_SF105_01 B20140407_SF105_01 TB150040.[MT7]-RQQNTQEMPWNVR.3b7_2.heavy 610.977 / 515.263 94536.0 27.7012996673584 37 7 10 10 10 0.6327505460431214 80.58091461767816 0.0 3 0.7323784384053389 2.330250528539137 94536.0 47.8761135619039 0.0 - - - - - - - 412.0 189 1 GCET2 germinal center expressed transcript 2 485 62 B20140407_SF105_01 B20140407_SF105_01 TB360535.[MT7]-YLSYFR.2b3_1.heavy 496.77 / 508.289 16450.0 32.503700256347656 50 20 10 10 10 4.0667729135369655 24.589521501712696 0.0 3 0.991542794211439 13.410419651299117 16450.0 11.162115524072306 0.0 - - - - - - - 336.75 32 4 FUT3;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 487 62 B20140407_SF105_01 B20140407_SF105_01 TB360535.[MT7]-YLSYFR.2y4_1.heavy 496.77 / 572.283 49950.0 32.503700256347656 50 20 10 10 10 4.0667729135369655 24.589521501712696 0.0 3 0.991542794211439 13.410419651299117 49950.0 39.169374708655056 0.0 - - - - - - - 299.0 99 1 FUT3;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 489 62 B20140407_SF105_01 B20140407_SF105_01 TB360535.[MT7]-YLSYFR.2y5_1.heavy 496.77 / 685.367 107526.0 32.503700256347656 50 20 10 10 10 4.0667729135369655 24.589521501712696 0.0 3 0.991542794211439 13.410419651299117 107526.0 109.6752960218448 0.0 - - - - - - - 299.5 215 4 FUT3;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 491 62 B20140407_SF105_01 B20140407_SF105_01 TB360535.[MT7]-YLSYFR.2b4_1.heavy 496.77 / 671.352 16450.0 32.503700256347656 50 20 10 10 10 4.0667729135369655 24.589521501712696 0.0 3 0.991542794211439 13.410419651299117 16450.0 13.795058139534882 0.0 - - - - - - - 299.0 32 1 FUT3;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 493 63 B20140407_SF105_01 B20140407_SF105_01 TB499314.[MT7]-GWGDQLIWTQTYEEALYK[MT7].3b6_1.heavy 830.425 / 801.401 107966.0 38.4656982421875 43 13 10 10 10 1.3248959128334483 50.318418240186155 0.0 3 0.9241209835244055 4.451602202371503 107966.0 53.23042060844655 0.0 - - - - - - - 551.6666666666666 215 3 AGR2 anterior gradient homolog 2 (Xenopus laevis) 495 63 B20140407_SF105_01 B20140407_SF105_01 TB499314.[MT7]-GWGDQLIWTQTYEEALYK[MT7].3b4_1.heavy 830.425 / 560.258 49400.0 38.4656982421875 43 13 10 10 10 1.3248959128334483 50.318418240186155 0.0 3 0.9241209835244055 4.451602202371503 49400.0 72.88129645615884 0.0 - - - - - - - 318.5 98 2 AGR2 anterior gradient homolog 2 (Xenopus laevis) 497 63 B20140407_SF105_01 B20140407_SF105_01 TB499314.[MT7]-GWGDQLIWTQTYEEALYK[MT7].3b5_1.heavy 830.425 / 688.317 83012.0 38.4656982421875 43 13 10 10 10 1.3248959128334483 50.318418240186155 0.0 3 0.9241209835244055 4.451602202371503 83012.0 71.5637689469095 0.0 - - - - - - - 127.0 166 1 AGR2 anterior gradient homolog 2 (Xenopus laevis) 499 63 B20140407_SF105_01 B20140407_SF105_01 TB499314.[MT7]-GWGDQLIWTQTYEEALYK[MT7].3b7_1.heavy 830.425 / 914.485 112550.0 38.4656982421875 43 13 10 10 10 1.3248959128334483 50.318418240186155 0.0 3 0.9241209835244055 4.451602202371503 112550.0 93.61625662668271 0.0 - - - - - - - 127.0 225 1 AGR2 anterior gradient homolog 2 (Xenopus laevis) 501 64 B20140407_SF105_01 B20140407_SF105_01 TB360539.[MT7]-DLFGEK[MT7].2b3_1.heavy 498.784 / 520.289 54331.0 27.952199935913086 45 15 10 10 10 2.22945112728442 44.85408932099125 0.0 3 0.9547186823882864 5.777637362698497 54331.0 25.051388293074126 0.0 - - - - - - - 1303.5 108 2 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 503 64 B20140407_SF105_01 B20140407_SF105_01 TB360539.[MT7]-DLFGEK[MT7].2y4_1.heavy 498.784 / 624.347 99881.0 27.952199935913086 45 15 10 10 10 2.22945112728442 44.85408932099125 0.0 3 0.9547186823882864 5.777637362698497 99881.0 12.437932551772914 0.0 - - - - - - - 1235.0 199 1 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 505 64 B20140407_SF105_01 B20140407_SF105_01 TB360539.[MT7]-DLFGEK[MT7].2y5_1.heavy 498.784 / 737.431 82593.0 27.952199935913086 45 15 10 10 10 2.22945112728442 44.85408932099125 0.0 3 0.9547186823882864 5.777637362698497 82593.0 41.97058695783455 0.0 - - - - - - - 720.25 165 4 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 507 64 B20140407_SF105_01 B20140407_SF105_01 TB360539.[MT7]-DLFGEK[MT7].2b4_1.heavy 498.784 / 577.31 12073.0 27.952199935913086 45 15 10 10 10 2.22945112728442 44.85408932099125 0.0 3 0.9547186823882864 5.777637362698497 12073.0 2.909848852979601 0.0 - - - - - - - 960.0 24 1 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 509 65 B20140407_SF105_01 B20140407_SF105_01 TB499317.[MT7]-VFEQGYREEPTFIDPEAIK[MT7].4y4_1.heavy 639.836 / 604.379 127184.0 32.923500061035156 45 15 10 10 10 1.627521286137487 48.809855223418616 0.0 3 0.957438337078463 5.960745169613603 127184.0 53.95356749754137 0.0 - - - - - - - 2690.5 254 2 GSG1L GSG1-like 511 65 B20140407_SF105_01 B20140407_SF105_01 TB499317.[MT7]-VFEQGYREEPTFIDPEAIK[MT7].4y5_1.heavy 639.836 / 701.431 283661.0 32.923500061035156 45 15 10 10 10 1.627521286137487 48.809855223418616 0.0 3 0.957438337078463 5.960745169613603 283661.0 151.69505735404954 0.0 - - - - - - - 897.0 567 1 GSG1L GSG1-like 513 65 B20140407_SF105_01 B20140407_SF105_01 TB499317.[MT7]-VFEQGYREEPTFIDPEAIK[MT7].4b11_2.heavy 639.836 / 740.863 234790.0 32.923500061035156 45 15 10 10 10 1.627521286137487 48.809855223418616 0.0 3 0.957438337078463 5.960745169613603 234790.0 324.1446301300458 0.0 - - - - - - - 747.3333333333334 469 3 GSG1L GSG1-like 515 65 B20140407_SF105_01 B20140407_SF105_01 TB499317.[MT7]-VFEQGYREEPTFIDPEAIK[MT7].4b9_2.heavy 639.836 / 641.813 123896.0 32.923500061035156 45 15 10 10 10 1.627521286137487 48.809855223418616 0.0 3 0.957438337078463 5.960745169613603 123896.0 98.37111876432951 0.0 - - - - - - - 1195.7142857142858 247 7 GSG1L GSG1-like 517 66 B20140407_SF105_01 B20140407_SF105_01 TB499316.[MT7]-GEILLQC[CAM]LLENTPVLEDVLGR.3b6_1.heavy 842.464 / 798.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEP68 centrosomal protein 68kDa 519 66 B20140407_SF105_01 B20140407_SF105_01 TB499316.[MT7]-GEILLQC[CAM]LLENTPVLEDVLGR.3b4_1.heavy 842.464 / 557.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEP68 centrosomal protein 68kDa 521 66 B20140407_SF105_01 B20140407_SF105_01 TB499316.[MT7]-GEILLQC[CAM]LLENTPVLEDVLGR.3b5_1.heavy 842.464 / 670.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEP68 centrosomal protein 68kDa 523 66 B20140407_SF105_01 B20140407_SF105_01 TB499316.[MT7]-GEILLQC[CAM]LLENTPVLEDVLGR.3y9_1.heavy 842.464 / 997.568 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEP68 centrosomal protein 68kDa 525 67 B20140407_SF105_01 B20140407_SF105_01 TB360639.[MT7]-WSALYDVR.2b4_1.heavy 577.31 / 602.342 144788.0 32.35309982299805 42 12 10 10 10 1.5025843222813793 52.4273872666666 0.0 3 0.8898503827159445 3.6838453301760086 144788.0 102.42772862431207 0.0 - - - - - - - 822.5 289 2 UBE2C ubiquitin-conjugating enzyme E2C 527 67 B20140407_SF105_01 B20140407_SF105_01 TB360639.[MT7]-WSALYDVR.2b6_1.heavy 577.31 / 880.432 423295.0 32.35309982299805 42 12 10 10 10 1.5025843222813793 52.4273872666666 0.0 3 0.8898503827159445 3.6838453301760086 423295.0 423.0587168258496 0.0 - - - - - - - 399.0 846 3 UBE2C ubiquitin-conjugating enzyme E2C 529 67 B20140407_SF105_01 B20140407_SF105_01 TB360639.[MT7]-WSALYDVR.2y6_1.heavy 577.31 / 736.399 40983.0 32.35309982299805 42 12 10 10 10 1.5025843222813793 52.4273872666666 0.0 3 0.8898503827159445 3.6838453301760086 40983.0 38.4045384426514 0.0 - - - - - - - 747.6 81 5 UBE2C ubiquitin-conjugating enzyme E2C 531 67 B20140407_SF105_01 B20140407_SF105_01 TB360639.[MT7]-WSALYDVR.2y7_1.heavy 577.31 / 823.431 207160.0 32.35309982299805 42 12 10 10 10 1.5025843222813793 52.4273872666666 0.0 3 0.8898503827159445 3.6838453301760086 207160.0 311.2923857714762 0.0 - - - - - - - 299.3333333333333 414 3 UBE2C ubiquitin-conjugating enzyme E2C 533 68 B20140407_SF105_01 B20140407_SF105_01 TB360635.[MT7]-NYQQAQSR.2b3_1.heavy 569.79 / 550.274 6975.0 17.717199325561523 50 20 10 10 10 332.2289200797228 0.30099727614321975 0.0 3 0.9996861891417712 69.66538292386144 6975.0 15.41365122723898 0.0 - - - - - - - 614.75 13 8 GRB7 growth factor receptor-bound protein 7 535 68 B20140407_SF105_01 B20140407_SF105_01 TB360635.[MT7]-NYQQAQSR.2y5_1.heavy 569.79 / 589.305 10136.0 17.717199325561523 50 20 10 10 10 332.2289200797228 0.30099727614321975 0.0 3 0.9996861891417712 69.66538292386144 10136.0 62.579737111404754 0.0 - - - - - - - 150.52941176470588 20 17 GRB7 growth factor receptor-bound protein 7 537 68 B20140407_SF105_01 B20140407_SF105_01 TB360635.[MT7]-NYQQAQSR.2y6_1.heavy 569.79 / 717.364 10789.0 17.717199325561523 50 20 10 10 10 332.2289200797228 0.30099727614321975 0.0 3 0.9996861891417712 69.66538292386144 10789.0 49.52296689348799 0.0 - - - - - - - 211.3684210526316 21 19 GRB7 growth factor receptor-bound protein 7 539 68 B20140407_SF105_01 B20140407_SF105_01 TB360635.[MT7]-NYQQAQSR.2y7_1.heavy 569.79 / 880.427 21928.0 17.717199325561523 50 20 10 10 10 332.2289200797228 0.30099727614321975 0.0 3 0.9996861891417712 69.66538292386144 21928.0 177.28500719838755 0.0 - - - - - - - 153.35294117647058 43 17 GRB7 growth factor receptor-bound protein 7 541 69 B20140407_SF105_01 B20140407_SF105_01 TB360802.[MT7]-RPETLGELQK[MT7].2y5_1.heavy 729.93 / 718.422 2591.0 24.697750091552734 42 16 10 6 10 1.4511568658094434 44.62975188314505 0.037700653076171875 3 0.9668163636363104 6.756037513111198 2591.0 6.597453703703704 1.0 - - - - - - - 755.8888888888889 5 9 C14orf148 chromosome 14 open reading frame 148 543 69 B20140407_SF105_01 B20140407_SF105_01 TB360802.[MT7]-RPETLGELQK[MT7].2y9_1.heavy 729.93 / 1158.65 8419.0 24.697750091552734 42 16 10 6 10 1.4511568658094434 44.62975188314505 0.037700653076171875 3 0.9668163636363104 6.756037513111198 8419.0 127.06453703703704 0.0 - - - - - - - 127.63636363636364 16 11 C14orf148 chromosome 14 open reading frame 148 545 69 B20140407_SF105_01 B20140407_SF105_01 TB360802.[MT7]-RPETLGELQK[MT7].2y3_1.heavy 729.93 / 532.357 4641.0 24.697750091552734 42 16 10 6 10 1.4511568658094434 44.62975188314505 0.037700653076171875 3 0.9668163636363104 6.756037513111198 4641.0 13.321388888888889 0.0 - - - - - - - 621.0 9 8 C14orf148 chromosome 14 open reading frame 148 547 69 B20140407_SF105_01 B20140407_SF105_01 TB360802.[MT7]-RPETLGELQK[MT7].2b7_1.heavy 729.93 / 927.502 3994.0 24.697750091552734 42 16 10 6 10 1.4511568658094434 44.62975188314505 0.037700653076171875 3 0.9668163636363104 6.756037513111198 3994.0 6.471759259259259 0.0 - - - - - - - 243.0 7 16 C14orf148 chromosome 14 open reading frame 148 549 70 B20140407_SF105_01 B20140407_SF105_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 2451730.0 20.463599522908527 23 -3 10 6 10 null 0.0 0.03389930725097656 3 0.0 0.0 2451730.0 3779.136043099255 0.0 - - - - - - - 1792.3333333333333 4903 3 551 70 B20140407_SF105_01 B20140407_SF105_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 1568810.0 20.463599522908527 23 -3 10 6 10 null 0.0 0.03389930725097656 3 0.0 0.0 1568810.0 1186.142806462728 0.0 - - - - - - - 1839.2857142857142 3137 7 553 70 B20140407_SF105_01 B20140407_SF105_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 1427680.0 20.463599522908527 23 -3 10 6 10 null 0.0 0.03389930725097656 3 0.0 0.0 1427680.0 3238.7720413800052 0.0 - - - - - - - 2223.4285714285716 2855 7 555 71 B20140407_SF105_01 B20140407_SF105_01 TB150193.[MT7]-RSQPLLIPTTGR.3b6_1.heavy 494.967 / 839.522 44446.0 27.19260025024414 47 17 10 10 10 5.29891751256195 18.871778955406203 0.0 3 0.9755227018924605 7.872102964483629 44446.0 66.74398717375237 0.0 - - - - - - - 324.875 88 8 GRB7 growth factor receptor-bound protein 7 557 71 B20140407_SF105_01 B20140407_SF105_01 TB150193.[MT7]-RSQPLLIPTTGR.3b5_1.heavy 494.967 / 726.438 33779.0 27.19260025024414 47 17 10 10 10 5.29891751256195 18.871778955406203 0.0 3 0.9755227018924605 7.872102964483629 33779.0 45.07465174243875 0.0 - - - - - - - 752.125 67 8 GRB7 growth factor receptor-bound protein 7 559 71 B20140407_SF105_01 B20140407_SF105_01 TB150193.[MT7]-RSQPLLIPTTGR.3b3_1.heavy 494.967 / 516.301 25437.0 27.19260025024414 47 17 10 10 10 5.29891751256195 18.871778955406203 0.0 3 0.9755227018924605 7.872102964483629 25437.0 18.08315872848331 2.0 - - - - - - - 684.0 50 2 GRB7 growth factor receptor-bound protein 7 561 71 B20140407_SF105_01 B20140407_SF105_01 TB150193.[MT7]-RSQPLLIPTTGR.3y5_1.heavy 494.967 / 531.289 268867.0 27.19260025024414 47 17 10 10 10 5.29891751256195 18.871778955406203 0.0 3 0.9755227018924605 7.872102964483629 268867.0 97.55592680274009 0.0 - - - - - - - 1641.0 537 1 GRB7 growth factor receptor-bound protein 7 563 72 B20140407_SF105_01 B20140407_SF105_01 TB150194.[MT7]-QMWVTAADFK[MT7].3y3_1.heavy 495.599 / 553.31 64368.0 33.5619010925293 46 16 10 10 10 2.5257149074885628 31.453912351470358 0.0 3 0.9619859410618342 6.309642939943023 64368.0 89.1677922077922 0.0 - - - - - - - 752.8888888888889 128 9 ACTRT2 actin-related protein T2 565 72 B20140407_SF105_01 B20140407_SF105_01 TB150194.[MT7]-QMWVTAADFK[MT7].3b4_1.heavy 495.599 / 689.356 30490.0 33.5619010925293 46 16 10 10 10 2.5257149074885628 31.453912351470358 0.0 3 0.9619859410618342 6.309642939943023 30490.0 62.365909090909085 0.0 - - - - - - - 352.0 60 7 ACTRT2 actin-related protein T2 567 72 B20140407_SF105_01 B20140407_SF105_01 TB150194.[MT7]-QMWVTAADFK[MT7].3y4_1.heavy 495.599 / 624.347 50663.0 33.5619010925293 46 16 10 10 10 2.5257149074885628 31.453912351470358 0.0 3 0.9619859410618342 6.309642939943023 50663.0 83.23207142857143 0.0 - - - - - - - 374.0 101 7 ACTRT2 actin-related protein T2 569 72 B20140407_SF105_01 B20140407_SF105_01 TB150194.[MT7]-QMWVTAADFK[MT7].3b3_1.heavy 495.599 / 590.288 60210.0 33.5619010925293 46 16 10 10 10 2.5257149074885628 31.453912351470358 0.0 3 0.9619859410618342 6.309642939943023 60210.0 62.160920897284534 0.0 - - - - - - - 770.0 120 7 ACTRT2 actin-related protein T2 571 73 B20140407_SF105_01 B20140407_SF105_01 TB150191.[MT7]-FQAPSAEANQK[MT7].2y4_1.heavy 739.896 / 604.354 9943.0 23.59149932861328 45 15 10 10 10 1.8763876362740668 41.39258657684331 0.0 3 0.9538408205408082 5.722007906932646 9943.0 25.82280602359043 0.0 - - - - - - - 773.5714285714286 19 7 ACTRT2 actin-related protein T2 573 73 B20140407_SF105_01 B20140407_SF105_01 TB150191.[MT7]-FQAPSAEANQK[MT7].2y8_1.heavy 739.896 / 988.518 58378.0 23.59149932861328 45 15 10 10 10 1.8763876362740668 41.39258657684331 0.0 3 0.9538408205408082 5.722007906932646 58378.0 288.75755461871574 0.0 - - - - - - - 322.0 116 11 ACTRT2 actin-related protein T2 575 73 B20140407_SF105_01 B20140407_SF105_01 TB150191.[MT7]-FQAPSAEANQK[MT7].2y9_1.heavy 739.896 / 1059.56 16933.0 23.59149932861328 45 15 10 10 10 1.8763876362740668 41.39258657684331 0.0 3 0.9538408205408082 5.722007906932646 16933.0 124.59077918781725 0.0 - - - - - - - 211.92307692307693 33 13 ACTRT2 actin-related protein T2 577 73 B20140407_SF105_01 B20140407_SF105_01 TB150191.[MT7]-FQAPSAEANQK[MT7].2y3_1.heavy 739.896 / 533.316 4627.0 23.59149932861328 45 15 10 10 10 1.8763876362740668 41.39258657684331 0.0 3 0.9538408205408082 5.722007906932646 4627.0 10.87696898308249 1.0 - - - - - - - 246.0 11 14 ACTRT2 actin-related protein T2 579 74 B20140407_SF105_01 B20140407_SF105_01 TB150050.[MT7]-NPTAFK[MT7]K[MT7].3y6_2.heavy 413.259 / 490.313 368054.0 21.81450080871582 43 13 10 10 10 2.6510746375669854 37.72055248198318 0.0 3 0.906813579405713 4.011015888233152 368054.0 206.91761335784315 0.0 - - - - - - - 725.0 736 1 UBE2C ubiquitin-conjugating enzyme E2C 581 74 B20140407_SF105_01 B20140407_SF105_01 TB150050.[MT7]-NPTAFK[MT7]K[MT7].3y3_1.heavy 413.259 / 710.48 23613.0 21.81450080871582 43 13 10 10 10 2.6510746375669854 37.72055248198318 0.0 3 0.906813579405713 4.011015888233152 23613.0 155.7674980750475 0.0 - - - - - - - 229.53846153846155 47 13 UBE2C ubiquitin-conjugating enzyme E2C 583 74 B20140407_SF105_01 B20140407_SF105_01 TB150050.[MT7]-NPTAFK[MT7]K[MT7].3y4_1.heavy 413.259 / 781.517 34976.0 21.81450080871582 43 13 10 10 10 2.6510746375669854 37.72055248198318 0.0 3 0.906813579405713 4.011015888233152 34976.0 288.39311129263444 0.0 - - - - - - - 197.22222222222223 69 18 UBE2C ubiquitin-conjugating enzyme E2C 585 74 B20140407_SF105_01 B20140407_SF105_01 TB150050.[MT7]-NPTAFK[MT7]K[MT7].3y5_1.heavy 413.259 / 882.565 N/A 21.81450080871582 43 13 10 10 10 2.6510746375669854 37.72055248198318 0.0 3 0.906813579405713 4.011015888233152 81.0 0.96 34.0 - - - - - - - 0.0 0 0 UBE2C ubiquitin-conjugating enzyme E2C 587 75 B20140407_SF105_01 B20140407_SF105_01 TB499029.[MT7]-YFELLEK[MT7].2y4_1.heavy 615.355 / 646.426 17274.0 34.73400115966797 48 18 10 10 10 6.273977621136724 15.938851879723781 0.0 3 0.9845088551418232 9.902808252591974 17274.0 6.215361209831247 0.0 - - - - - - - 459.0 34 1 CATSPER2 cation channel, sperm associated 2 589 75 B20140407_SF105_01 B20140407_SF105_01 TB499029.[MT7]-YFELLEK[MT7].2b3_1.heavy 615.355 / 584.284 17121.0 34.73400115966797 48 18 10 10 10 6.273977621136724 15.938851879723781 0.0 3 0.9845088551418232 9.902808252591974 17121.0 9.822711400971734 1.0 - - - - - - - 459.0 34 1 CATSPER2 cation channel, sperm associated 2 591 75 B20140407_SF105_01 B20140407_SF105_01 TB499029.[MT7]-YFELLEK[MT7].2y3_1.heavy 615.355 / 533.341 18344.0 34.73400115966797 48 18 10 10 10 6.273977621136724 15.938851879723781 0.0 3 0.9845088551418232 9.902808252591974 18344.0 6.428179873807809 1.0 - - - - - - - 1725.2857142857142 36 7 CATSPER2 cation channel, sperm associated 2 593 75 B20140407_SF105_01 B20140407_SF105_01 TB499029.[MT7]-YFELLEK[MT7].2y6_1.heavy 615.355 / 922.537 22471.0 34.73400115966797 48 18 10 10 10 6.273977621136724 15.938851879723781 0.0 3 0.9845088551418232 9.902808252591974 22471.0 24.215837762353786 0.0 - - - - - - - 747.0 44 9 CATSPER2 cation channel, sperm associated 2 595 76 B20140407_SF105_01 B20140407_SF105_01 TB360684.[MT7]-TEQENEAK[MT7].2y4_1.heavy 618.819 / 605.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - LACTB lactamase, beta 597 76 B20140407_SF105_01 B20140407_SF105_01 TB360684.[MT7]-TEQENEAK[MT7].2y5_1.heavy 618.819 / 734.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - LACTB lactamase, beta 599 76 B20140407_SF105_01 B20140407_SF105_01 TB360684.[MT7]-TEQENEAK[MT7].2b4_1.heavy 618.819 / 632.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - LACTB lactamase, beta 601 76 B20140407_SF105_01 B20140407_SF105_01 TB360684.[MT7]-TEQENEAK[MT7].2y7_1.heavy 618.819 / 991.481 N/A N/A - - - - - - - - - 0.0 - - - - - - - LACTB lactamase, beta 603 77 B20140407_SF105_01 B20140407_SF105_01 TB498928.[MT7]-GAEPSGGAAR.2y9_1.heavy 508.766 / 815.401 15571.0 17.006399154663086 50 20 10 10 10 2.943105042895364 33.977720313245136 0.0 3 0.9915383191715748 13.406868053496959 15571.0 139.53011123766134 0.0 - - - - - - - 159.72727272727272 31 11 UBE2C ubiquitin-conjugating enzyme E2C 605 77 B20140407_SF105_01 B20140407_SF105_01 TB498928.[MT7]-GAEPSGGAAR.2y6_1.heavy 508.766 / 518.268 3673.0 17.006399154663086 50 20 10 10 10 2.943105042895364 33.977720313245136 0.0 3 0.9915383191715748 13.406868053496959 3673.0 92.77138579387186 0.0 - - - - - - - 169.6875 7 16 UBE2C ubiquitin-conjugating enzyme E2C 607 77 B20140407_SF105_01 B20140407_SF105_01 TB498928.[MT7]-GAEPSGGAAR.2b7_1.heavy 508.766 / 700.338 4831.0 17.006399154663086 50 20 10 10 10 2.943105042895364 33.977720313245136 0.0 3 0.9915383191715748 13.406868053496959 4831.0 37.39603564547206 0.0 - - - - - - - 147.3125 9 16 UBE2C ubiquitin-conjugating enzyme E2C 609 77 B20140407_SF105_01 B20140407_SF105_01 TB498928.[MT7]-GAEPSGGAAR.2y7_1.heavy 508.766 / 615.321 96420.0 17.006399154663086 50 20 10 10 10 2.943105042895364 33.977720313245136 0.0 3 0.9915383191715748 13.406868053496959 96420.0 768.6759167024474 0.0 - - - - - - - 139.875 192 8 UBE2C ubiquitin-conjugating enzyme E2C 611 78 B20140407_SF105_01 B20140407_SF105_01 TB498927.[MT7]-ANVFFK[MT7].2y4_1.heavy 507.305 / 684.42 36149.0 29.948999404907227 40 20 0 10 10 10.098538140280432 9.902423361766205 0.0 3 0.998453510606211 31.378552936029276 36149.0 26.677063571401725 0.0 - - - - - - - 446.0 72 3 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 613 78 B20140407_SF105_01 B20140407_SF105_01 TB498927.[MT7]-ANVFFK[MT7].2y5_1.heavy 507.305 / 798.463 N/A 29.948999404907227 40 20 0 10 10 10.098538140280432 9.902423361766205 0.0 3 0.998453510606211 31.378552936029276 0.0 0.0 30.0 - - - - - - - 396.6666666666667 1305 3 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 615 78 B20140407_SF105_01 B20140407_SF105_01 TB498927.[MT7]-ANVFFK[MT7].2b4_1.heavy 507.305 / 576.326 41802.0 29.948999404907227 40 20 0 10 10 10.098538140280432 9.902423361766205 0.0 3 0.998453510606211 31.378552936029276 41802.0 30.307437089371206 0.0 - - - - - - - 1253.857142857143 83 7 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 617 78 B20140407_SF105_01 B20140407_SF105_01 TB498927.[MT7]-ANVFFK[MT7].2y3_1.heavy 507.305 / 585.352 146234.0 29.948999404907227 40 20 0 10 10 10.098538140280432 9.902423361766205 0.0 3 0.998453510606211 31.378552936029276 146234.0 66.04068283245988 0.0 - - - - - - - 1822.25 292 4 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 619 79 B20140407_SF105_01 B20140407_SF105_01 TB360601.[MT7]-TEETLSK[MT7].2y4_1.heavy 548.31 / 592.379 8300.0 21.356300354003906 40 16 8 10 6 1.9513171463147827 35.23944027655805 0.0 5 0.9666129622708326 6.7353108429359985 8300.0 13.365539452495975 1.0 - - - - - - - 704.75 17 12 CATSPER2 cation channel, sperm associated 2 621 79 B20140407_SF105_01 B20140407_SF105_01 TB360601.[MT7]-TEETLSK[MT7].2y5_1.heavy 548.31 / 721.421 5585.0 21.356300354003906 40 16 8 10 6 1.9513171463147827 35.23944027655805 0.0 5 0.9666129622708326 6.7353108429359985 5585.0 8.123545470819908 1.0 - - - - - - - 775.8888888888889 23 9 CATSPER2 cation channel, sperm associated 2 623 79 B20140407_SF105_01 B20140407_SF105_01 TB360601.[MT7]-TEETLSK[MT7].2b4_1.heavy 548.31 / 605.29 5042.0 21.356300354003906 40 16 8 10 6 1.9513171463147827 35.23944027655805 0.0 5 0.9666129622708326 6.7353108429359985 5042.0 11.988024104215285 0.0 - - - - - - - 722.1538461538462 10 13 CATSPER2 cation channel, sperm associated 2 625 79 B20140407_SF105_01 B20140407_SF105_01 TB360601.[MT7]-TEETLSK[MT7].2y6_1.heavy 548.31 / 850.464 8688.0 21.356300354003906 40 16 8 10 6 1.9513171463147827 35.23944027655805 0.0 5 0.9666129622708326 6.7353108429359985 8688.0 46.645526789422675 0.0 - - - - - - - 226.33333333333334 17 24 CATSPER2 cation channel, sperm associated 2 627 80 B20140407_SF105_01 B20140407_SF105_01 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 2017690.0 33.307498931884766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2017690.0 175.768122777293 0.0 - - - - - - - 188.75 4035 4 629 80 B20140407_SF105_01 B20140407_SF105_01 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 956370.0 33.307498931884766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 956370.0 183.15017218044386 0.0 - - - - - - - 237.28571428571428 1912 7 631 80 B20140407_SF105_01 B20140407_SF105_01 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1384930.0 33.307498931884766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1384930.0 131.9939936288121 0.0 - - - - - - - 453.0 2769 1 633 81 B20140407_SF105_01 B20140407_SF105_01 TB499011.[MT7]-IWLYLQGR.2b3_1.heavy 596.852 / 557.357 41442.0 36.102500915527344 48 18 10 10 10 4.807469009786496 20.80096612093212 0.0 3 0.9850695776594798 10.087521842839415 41442.0 40.164510886164315 0.0 - - - - - - - 1342.0 82 7 C14orf148 chromosome 14 open reading frame 148 635 81 B20140407_SF105_01 B20140407_SF105_01 TB499011.[MT7]-IWLYLQGR.2y5_1.heavy 596.852 / 636.346 69765.0 36.102500915527344 48 18 10 10 10 4.807469009786496 20.80096612093212 0.0 3 0.9850695776594798 10.087521842839415 69765.0 68.94631270133456 0.0 - - - - - - - 447.0 139 3 C14orf148 chromosome 14 open reading frame 148 637 81 B20140407_SF105_01 B20140407_SF105_01 TB499011.[MT7]-IWLYLQGR.2y6_1.heavy 596.852 / 749.43 56796.0 36.102500915527344 48 18 10 10 10 4.807469009786496 20.80096612093212 0.0 3 0.9850695776594798 10.087521842839415 56796.0 73.87547032096252 0.0 - - - - - - - 730.1 113 10 C14orf148 chromosome 14 open reading frame 148 639 81 B20140407_SF105_01 B20140407_SF105_01 TB499011.[MT7]-IWLYLQGR.2y7_1.heavy 596.852 / 935.51 137742.0 36.102500915527344 48 18 10 10 10 4.807469009786496 20.80096612093212 0.0 3 0.9850695776594798 10.087521842839415 137742.0 262.48227717985765 0.0 - - - - - - - 659.8571428571429 275 7 C14orf148 chromosome 14 open reading frame 148 641 82 B20140407_SF105_01 B20140407_SF105_01 TB360785.[MT7]-GHGLTALPALPAR.3b6_1.heavy 473.285 / 681.38 132011.0 28.98870086669922 50 20 10 10 10 6.476496918867852 15.440445854096211 0.0 3 0.9922423321924702 14.002823698856568 132011.0 88.37286549460119 0.0 - - - - - - - 728.75 264 4 GP9 glycoprotein IX (platelet) 643 82 B20140407_SF105_01 B20140407_SF105_01 TB360785.[MT7]-GHGLTALPALPAR.3y6_1.heavy 473.285 / 624.383 605433.0 28.98870086669922 50 20 10 10 10 6.476496918867852 15.440445854096211 0.0 3 0.9922423321924702 14.002823698856568 605433.0 234.1616786459748 0.0 - - - - - - - 729.0 1210 1 GP9 glycoprotein IX (platelet) 645 82 B20140407_SF105_01 B20140407_SF105_01 TB360785.[MT7]-GHGLTALPALPAR.3b4_1.heavy 473.285 / 509.295 92525.0 28.98870086669922 50 20 10 10 10 6.476496918867852 15.440445854096211 0.0 3 0.9922423321924702 14.002823698856568 92525.0 23.04309137277304 0.0 - - - - - - - 437.0 185 1 GP9 glycoprotein IX (platelet) 647 82 B20140407_SF105_01 B20140407_SF105_01 TB360785.[MT7]-GHGLTALPALPAR.3y5_1.heavy 473.285 / 527.33 155470.0 28.98870086669922 50 20 10 10 10 6.476496918867852 15.440445854096211 0.0 3 0.9922423321924702 14.002823698856568 155470.0 70.51616882980952 1.0 - - - - - - - 874.0 310 1 GP9 glycoprotein IX (platelet) 649 83 B20140407_SF105_01 B20140407_SF105_01 TB150025.[MT7]-VYSEDGAC[CAM]R.2y8_1.heavy 600.775 / 957.373 89380.0 20.85140037536621 43 17 10 6 10 1.323558902527792 45.503960061205504 0.03639984130859375 3 0.9760959711872124 7.966322534867963 89380.0 63.49210894775628 0.0 - - - - - - - 764.8571428571429 178 7 GRB7 growth factor receptor-bound protein 7 651 83 B20140407_SF105_01 B20140407_SF105_01 TB150025.[MT7]-VYSEDGAC[CAM]R.2y5_1.heavy 600.775 / 578.235 14836.0 20.85140037536621 43 17 10 6 10 1.323558902527792 45.503960061205504 0.03639984130859375 3 0.9760959711872124 7.966322534867963 14836.0 3.188578446423089 0.0 - - - - - - - 1676.6666666666667 49 6 GRB7 growth factor receptor-bound protein 7 653 83 B20140407_SF105_01 B20140407_SF105_01 TB150025.[MT7]-VYSEDGAC[CAM]R.2b5_1.heavy 600.775 / 738.343 32495.0 20.85140037536621 43 17 10 6 10 1.323558902527792 45.503960061205504 0.03639984130859375 3 0.9760959711872124 7.966322534867963 32495.0 116.69475138121547 0.0 - - - - - - - 624.25 64 8 GRB7 growth factor receptor-bound protein 7 655 83 B20140407_SF105_01 B20140407_SF105_01 TB150025.[MT7]-VYSEDGAC[CAM]R.2y7_1.heavy 600.775 / 794.31 28660.0 20.85140037536621 43 17 10 6 10 1.323558902527792 45.503960061205504 0.03639984130859375 3 0.9760959711872124 7.966322534867963 28660.0 124.87484566517861 0.0 - - - - - - - 661.7142857142857 57 7 GRB7 growth factor receptor-bound protein 7 657 84 B20140407_SF105_01 B20140407_SF105_01 TB150024.[MT7]-FTPFTLGK[MT7].2y4_1.heavy 599.857 / 562.368 25664.0 33.432899475097656 46 16 10 10 10 1.9537717907622572 38.79657436473489 0.0 3 0.9699723506472778 7.104097813612508 25664.0 20.15652179964945 0.0 - - - - - - - 1267.5 51 4 EFNA1 ephrin-A1 659 84 B20140407_SF105_01 B20140407_SF105_01 TB150024.[MT7]-FTPFTLGK[MT7].2y5_1.heavy 599.857 / 709.437 15214.0 33.432899475097656 46 16 10 10 10 1.9537717907622572 38.79657436473489 0.0 3 0.9699723506472778 7.104097813612508 15214.0 7.3387197818397825 0.0 - - - - - - - 461.0 30 1 EFNA1 ephrin-A1 661 84 B20140407_SF105_01 B20140407_SF105_01 TB150024.[MT7]-FTPFTLGK[MT7].2y6_1.heavy 599.857 / 806.489 160129.0 33.432899475097656 46 16 10 10 10 1.9537717907622572 38.79657436473489 0.0 3 0.9699723506472778 7.104097813612508 160129.0 146.75857928223544 0.0 - - - - - - - 384.0 320 2 EFNA1 ephrin-A1 663 84 B20140407_SF105_01 B20140407_SF105_01 TB150024.[MT7]-FTPFTLGK[MT7].2y7_1.heavy 599.857 / 907.537 43490.0 33.432899475097656 46 16 10 10 10 1.9537717907622572 38.79657436473489 0.0 3 0.9699723506472778 7.104097813612508 43490.0 147.3104045101886 0.0 - - - - - - - 263.42857142857144 86 7 EFNA1 ephrin-A1 665 85 B20140407_SF105_01 B20140407_SF105_01 TB360784.[MT7]-SSPHSLFPEK[MT7].3y3_1.heavy 472.929 / 517.31 237248.0 26.380399703979492 45 20 10 5 10 7.896193482286972 12.664329999552777 0.04380035400390625 3 0.9974316377161234 24.34676321165993 237248.0 53.34956318446442 0.0 - - - - - - - 1837.0 474 1 GRB7 growth factor receptor-bound protein 7 667 85 B20140407_SF105_01 B20140407_SF105_01 TB360784.[MT7]-SSPHSLFPEK[MT7].3b4_1.heavy 472.929 / 553.285 20087.0 26.380399703979492 45 20 10 5 10 7.896193482286972 12.664329999552777 0.04380035400390625 3 0.9974316377161234 24.34676321165993 20087.0 28.390701470139916 0.0 - - - - - - - 490.0 40 2 GRB7 growth factor receptor-bound protein 7 669 85 B20140407_SF105_01 B20140407_SF105_01 TB360784.[MT7]-SSPHSLFPEK[MT7].3b5_1.heavy 472.929 / 640.317 12248.0 26.380399703979492 45 20 10 5 10 7.896193482286972 12.664329999552777 0.04380035400390625 3 0.9974316377161234 24.34676321165993 12248.0 12.901966894993702 0.0 - - - - - - - 490.0 24 1 GRB7 growth factor receptor-bound protein 7 671 85 B20140407_SF105_01 B20140407_SF105_01 TB360784.[MT7]-SSPHSLFPEK[MT7].3y4_1.heavy 472.929 / 664.379 51443.0 26.380399703979492 45 20 10 5 10 7.896193482286972 12.664329999552777 0.04380035400390625 3 0.9974316377161234 24.34676321165993 51443.0 60.439140382507865 0.0 - - - - - - - 490.0 102 1 GRB7 growth factor receptor-bound protein 7 673 86 B20140407_SF105_01 B20140407_SF105_01 TB150023.[MT7]-YLQELDK[MT7].2y4_1.heavy 598.842 / 648.369 31693.0 29.229400634765625 48 18 10 10 10 4.802877064216644 16.64527439891041 0.0 3 0.9890447856360276 11.780253838055035 31693.0 19.559500718743745 0.0 - - - - - - - 872.0 63 1 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 675 86 B20140407_SF105_01 B20140407_SF105_01 TB150023.[MT7]-YLQELDK[MT7].2y5_1.heavy 598.842 / 776.427 30966.0 29.229400634765625 48 18 10 10 10 4.802877064216644 16.64527439891041 0.0 3 0.9890447856360276 11.780253838055035 30966.0 21.30163388309593 0.0 - - - - - - - 436.0 61 1 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 677 86 B20140407_SF105_01 B20140407_SF105_01 TB150023.[MT7]-YLQELDK[MT7].2y3_1.heavy 598.842 / 519.326 33001.0 29.229400634765625 48 18 10 10 10 4.802877064216644 16.64527439891041 0.0 3 0.9890447856360276 11.780253838055035 33001.0 19.05569467532946 0.0 - - - - - - - 727.0 66 1 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 679 86 B20140407_SF105_01 B20140407_SF105_01 TB150023.[MT7]-YLQELDK[MT7].2y6_1.heavy 598.842 / 889.511 42451.0 29.229400634765625 48 18 10 10 10 4.802877064216644 16.64527439891041 0.0 3 0.9890447856360276 11.780253838055035 42451.0 47.17831480386225 0.0 - - - - - - - 747.7142857142857 84 7 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 681 87 B20140407_SF105_01 B20140407_SF105_01 TB361075.[MT7]-FYLAFENSLHPDYITEK[MT7].4b4_1.heavy 594.56 / 639.362 55480.0 35.90700149536133 47 17 10 10 10 2.8090290597309666 30.461938034272904 0.0 3 0.9739880050136789 7.6353616369173425 55480.0 33.50667529128035 0.0 - - - - - - - 862.0 110 1 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 683 87 B20140407_SF105_01 B20140407_SF105_01 TB361075.[MT7]-FYLAFENSLHPDYITEK[MT7].4y7_1.heavy 594.56 / 1009.53 18398.0 35.90700149536133 47 17 10 10 10 2.8090290597309666 30.461938034272904 0.0 3 0.9739880050136789 7.6353616369173425 18398.0 27.65340947010008 0.0 - - - - - - - 311.3333333333333 36 6 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 685 87 B20140407_SF105_01 B20140407_SF105_01 TB361075.[MT7]-FYLAFENSLHPDYITEK[MT7].4y3_1.heavy 594.56 / 521.305 73303.0 35.90700149536133 47 17 10 10 10 2.8090290597309666 30.461938034272904 0.0 3 0.9739880050136789 7.6353616369173425 73303.0 20.905782617897437 0.0 - - - - - - - 719.0 146 1 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 687 87 B20140407_SF105_01 B20140407_SF105_01 TB361075.[MT7]-FYLAFENSLHPDYITEK[MT7].4b3_1.heavy 594.56 / 568.325 41538.0 35.90700149536133 47 17 10 10 10 2.8090290597309666 30.461938034272904 0.0 3 0.9739880050136789 7.6353616369173425 41538.0 12.654661894083148 0.0 - - - - - - - 1773.0 83 3 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 689 88 B20140407_SF105_01 B20140407_SF105_01 TB360404.[MT7]-GTEPLR.2y4_1.heavy 408.738 / 514.298 4850.0 20.32784938812256 36 18 4 6 8 6.677523882506525 14.975610983882136 0.034198760986328125 4 0.9891853438098288 11.856700160939495 4850.0 3.2003401360544217 5.0 - - - - - - - 1747.3333333333333 14 9 IGSF22 immunoglobulin superfamily, member 22 691 88 B20140407_SF105_01 B20140407_SF105_01 TB360404.[MT7]-GTEPLR.2b3_1.heavy 408.738 / 432.221 53641.0 20.32784938812256 36 18 4 6 8 6.677523882506525 14.975610983882136 0.034198760986328125 4 0.9891853438098288 11.856700160939495 53641.0 43.172702259091494 1.0 - - - - - - - 1800.375 183 8 IGSF22 immunoglobulin superfamily, member 22 693 88 B20140407_SF105_01 B20140407_SF105_01 TB360404.[MT7]-GTEPLR.2y5_1.heavy 408.738 / 615.346 18738.0 20.32784938812256 36 18 4 6 8 6.677523882506525 14.975610983882136 0.034198760986328125 4 0.9891853438098288 11.856700160939495 18738.0 34.77800313194585 0.0 - - - - - - - 818.7142857142857 37 7 IGSF22 immunoglobulin superfamily, member 22 695 88 B20140407_SF105_01 B20140407_SF105_01 TB360404.[MT7]-GTEPLR.2b4_1.heavy 408.738 / 529.274 22118.0 20.32784938812256 36 18 4 6 8 6.677523882506525 14.975610983882136 0.034198760986328125 4 0.9891853438098288 11.856700160939495 22118.0 16.862631562900177 0.0 - - - - - - - 1698.111111111111 44 9 IGSF22 immunoglobulin superfamily, member 22 697 89 B20140407_SF105_01 B20140407_SF105_01 TB361152.[MT7]-TILLSIQSLLGEPNIDSPLNTHAAELWK[MT7].4b4_1.heavy 841.221 / 585.409 62214.0 43.99552631378174 44 18 10 6 10 4.2188262180791165 23.703275468296304 0.033298492431640625 3 0.9872146152633956 10.90289079521868 62214.0 42.02577500510308 0.0 - - - - - - - 386.0 124 3 UBE2C ubiquitin-conjugating enzyme E2C 699 89 B20140407_SF105_01 B20140407_SF105_01 TB361152.[MT7]-TILLSIQSLLGEPNIDSPLNTHAAELWK[MT7].4b5_1.heavy 841.221 / 672.441 53996.0 43.99552631378174 44 18 10 6 10 4.2188262180791165 23.703275468296304 0.033298492431640625 3 0.9872146152633956 10.90289079521868 53996.0 35.38708043685507 0.0 - - - - - - - 298.3333333333333 107 3 UBE2C ubiquitin-conjugating enzyme E2C 701 89 B20140407_SF105_01 B20140407_SF105_01 TB361152.[MT7]-TILLSIQSLLGEPNIDSPLNTHAAELWK[MT7].4y3_1.heavy 841.221 / 590.378 16805.0 43.99552631378174 44 18 10 6 10 4.2188262180791165 23.703275468296304 0.033298492431640625 3 0.9872146152633956 10.90289079521868 16805.0 31.37642405063291 0.0 - - - - - - - 742.3636363636364 33 11 UBE2C ubiquitin-conjugating enzyme E2C 703 89 B20140407_SF105_01 B20140407_SF105_01 TB361152.[MT7]-TILLSIQSLLGEPNIDSPLNTHAAELWK[MT7].4y6_1.heavy 841.221 / 861.495 18016.0 43.99552631378174 44 18 10 6 10 4.2188262180791165 23.703275468296304 0.033298492431640625 3 0.9872146152633956 10.90289079521868 18016.0 29.84437411866797 0.0 - - - - - - - 732.3 36 10 UBE2C ubiquitin-conjugating enzyme E2C 705 90 B20140407_SF105_01 B20140407_SF105_01 TB150543.[MT7]-SPLTIC[CAM]FPEYTGPNTYEDAAAYIQAQFESK[MT7].4y4_1.heavy 925.7 / 654.358 18933.0 40.81420135498047 38 20 0 10 8 12.58331269610163 7.947032901040476 0.0 4 0.9932474964347209 15.010158365849142 18933.0 106.19111560004245 0.0 - - - - - - - 238.0909090909091 37 11 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 707 90 B20140407_SF105_01 B20140407_SF105_01 TB150543.[MT7]-SPLTIC[CAM]FPEYTGPNTYEDAAAYIQAQFESK[MT7].4b7_1.heavy 925.7 / 963.509 14079.0 40.81420135498047 38 20 0 10 8 12.58331269610163 7.947032901040476 0.0 4 0.9932474964347209 15.010158365849142 14079.0 19.642616337946663 0.0 - - - - - - - 237.11111111111111 28 9 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 709 90 B20140407_SF105_01 B20140407_SF105_01 TB150543.[MT7]-SPLTIC[CAM]FPEYTGPNTYEDAAAYIQAQFESK[MT7].4y6_1.heavy 925.7 / 853.454 16506.0 40.81420135498047 38 20 0 10 8 12.58331269610163 7.947032901040476 0.0 4 0.9932474964347209 15.010158365849142 16506.0 22.038177946979253 1.0 - - - - - - - 801.25 484 8 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 711 90 B20140407_SF105_01 B20140407_SF105_01 TB150543.[MT7]-SPLTIC[CAM]FPEYTGPNTYEDAAAYIQAQFESK[MT7].4b6_1.heavy 925.7 / 816.441 14661.0 40.81420135498047 38 20 0 10 8 12.58331269610163 7.947032901040476 0.0 4 0.9932474964347209 15.010158365849142 14661.0 26.546845856845856 0.0 - - - - - - - 720.4166666666666 29 12 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 713 91 B20140407_SF105_01 B20140407_SF105_01 TB150131.[MT7]-IQAVIDSGVC[CAM]R.2y5_1.heavy 681.37 / 578.271 53064.0 29.42060089111328 48 18 10 10 10 3.1589507414830997 25.642513689912423 0.0 3 0.985160343039237 10.118401461555889 53064.0 46.1610065754718 0.0 - - - - - - - 1293.125 106 8 KPNA6;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 5 (importin alpha 6) 715 91 B20140407_SF105_01 B20140407_SF105_01 TB150131.[MT7]-IQAVIDSGVC[CAM]R.2y9_1.heavy 681.37 / 976.488 28528.0 29.42060089111328 48 18 10 10 10 3.1589507414830997 25.642513689912423 0.0 3 0.985160343039237 10.118401461555889 28528.0 133.0804390176979 0.0 - - - - - - - 328.44444444444446 57 9 KPNA6;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 5 (importin alpha 6) 717 91 B20140407_SF105_01 B20140407_SF105_01 TB150131.[MT7]-IQAVIDSGVC[CAM]R.2y10_1.heavy 681.37 / 1104.55 29858.0 29.42060089111328 48 18 10 10 10 3.1589507414830997 25.642513689912423 0.0 3 0.985160343039237 10.118401461555889 29858.0 41.558065172825636 0.0 - - - - - - - 369.5 59 6 KPNA6;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 5 (importin alpha 6) 719 91 B20140407_SF105_01 B20140407_SF105_01 TB150131.[MT7]-IQAVIDSGVC[CAM]R.2y7_1.heavy 681.37 / 806.383 30893.0 29.42060089111328 48 18 10 10 10 3.1589507414830997 25.642513689912423 0.0 3 0.985160343039237 10.118401461555889 30893.0 10.282722484220704 1.0 - - - - - - - 295.6666666666667 73 6 KPNA6;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 5 (importin alpha 6) 721 92 B20140407_SF105_01 B20140407_SF105_01 TB361166.[MT7]-NDPLFFK[MT7]PGSQFLYSTFGYTLLAAIVERASGC[CAM]K[MT7].4y4_1.heavy 1033.3 / 595.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - LACTB lactamase, beta 723 92 B20140407_SF105_01 B20140407_SF105_01 TB361166.[MT7]-NDPLFFK[MT7]PGSQFLYSTFGYTLLAAIVERASGC[CAM]K[MT7].4y8_1.heavy 1033.3 / 1050.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - LACTB lactamase, beta 725 92 B20140407_SF105_01 B20140407_SF105_01 TB361166.[MT7]-NDPLFFK[MT7]PGSQFLYSTFGYTLLAAIVERASGC[CAM]K[MT7].4b11_2.heavy 1033.3 / 760.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - LACTB lactamase, beta 727 92 B20140407_SF105_01 B20140407_SF105_01 TB361166.[MT7]-NDPLFFK[MT7]PGSQFLYSTFGYTLLAAIVERASGC[CAM]K[MT7].4b7_1.heavy 1033.3 / 1150.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - LACTB lactamase, beta 729 93 B20140407_SF105_01 B20140407_SF105_01 TB360692.[MT7]-YPEYQEK[MT7].2y4_1.heavy 622.824 / 711.379 6658.0 23.510499954223633 45 17 10 10 8 3.8861868020886043 25.732164996869344 0.0 4 0.9756879943446026 7.898927843778118 6658.0 11.402820378405762 1.0 - - - - - - - 741.0 16 8 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 731 93 B20140407_SF105_01 B20140407_SF105_01 TB360692.[MT7]-YPEYQEK[MT7].2y5_1.heavy 622.824 / 840.422 2645.0 23.510499954223633 45 17 10 10 8 3.8861868020886043 25.732164996869344 0.0 4 0.9756879943446026 7.898927843778118 2645.0 4.647844932542116 2.0 - - - - - - - 689.0 5 9 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 733 93 B20140407_SF105_01 B20140407_SF105_01 TB360692.[MT7]-YPEYQEK[MT7].2y3_1.heavy 622.824 / 548.316 3466.0 23.510499954223633 45 17 10 10 8 3.8861868020886043 25.732164996869344 0.0 4 0.9756879943446026 7.898927843778118 3466.0 1.654334864821386 6.0 - - - - - - - 741.125 7 8 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 735 93 B20140407_SF105_01 B20140407_SF105_01 TB360692.[MT7]-YPEYQEK[MT7].2y6_1.heavy 622.824 / 937.475 43323.0 23.510499954223633 45 17 10 10 8 3.8861868020886043 25.732164996869344 0.0 4 0.9756879943446026 7.898927843778118 43323.0 145.11726118544817 0.0 - - - - - - - 342.0 86 8 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 737 94 B20140407_SF105_01 B20140407_SF105_01 TB498919.[MT7]-SFSWALAFC[CAM]K[MT7].3b6_1.heavy 502.267 / 836.442 21104.0 36.965301513671875 45 15 10 10 10 3.1535281017512538 25.23164542303782 0.0 3 0.9569379749522867 5.925762301307435 21104.0 16.256271823178952 0.0 - - - - - - - 326.0 42 7 FUT5;FUT6 fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 739 94 B20140407_SF105_01 B20140407_SF105_01 TB498919.[MT7]-SFSWALAFC[CAM]K[MT7].3y3_1.heavy 502.267 / 598.314 150149.0 36.965301513671875 45 15 10 10 10 3.1535281017512538 25.23164542303782 0.0 3 0.9569379749522867 5.925762301307435 150149.0 126.70868545096383 0.0 - - - - - - - 237.66666666666666 300 3 FUT5;FUT6 fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 741 94 B20140407_SF105_01 B20140407_SF105_01 TB498919.[MT7]-SFSWALAFC[CAM]K[MT7].3b5_1.heavy 502.267 / 723.358 114786.0 36.965301513671875 45 15 10 10 10 3.1535281017512538 25.23164542303782 0.0 3 0.9569379749522867 5.925762301307435 114786.0 285.07314750997324 0.0 - - - - - - - 370.8 229 5 FUT5;FUT6 fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 743 94 B20140407_SF105_01 B20140407_SF105_01 TB498919.[MT7]-SFSWALAFC[CAM]K[MT7].3y4_1.heavy 502.267 / 669.351 96107.0 36.965301513671875 45 15 10 10 10 3.1535281017512538 25.23164542303782 0.0 3 0.9569379749522867 5.925762301307435 96107.0 84.9192286115007 0.0 - - - - - - - 356.6666666666667 192 6 FUT5;FUT6 fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 745 95 B20140407_SF105_01 B20140407_SF105_01 TB150136.[MT7]-ENVAFEQEK[MT7].2y8_1.heavy 691.364 / 1108.58 14605.0 24.45240020751953 50 20 10 10 10 5.478159085932914 14.622694276843376 0.0 3 0.9920222920109916 13.808107384495859 14605.0 72.57142857142857 0.0 - - - - - - - 259.5 29 12 LACTB lactamase, beta 747 95 B20140407_SF105_01 B20140407_SF105_01 TB150136.[MT7]-ENVAFEQEK[MT7].2y5_1.heavy 691.364 / 824.427 23303.0 24.45240020751953 50 20 10 10 10 5.478159085932914 14.622694276843376 0.0 3 0.9920222920109916 13.808107384495859 23303.0 55.54532588454376 0.0 - - - - - - - 657.625 46 8 LACTB lactamase, beta 749 95 B20140407_SF105_01 B20140407_SF105_01 TB150136.[MT7]-ENVAFEQEK[MT7].2b4_1.heavy 691.364 / 558.3 29746.0 24.45240020751953 50 20 10 10 10 5.478159085932914 14.622694276843376 0.0 3 0.9920222920109916 13.808107384495859 29746.0 44.1072934478139 0.0 - - - - - - - 671.0 59 12 LACTB lactamase, beta 751 95 B20140407_SF105_01 B20140407_SF105_01 TB150136.[MT7]-ENVAFEQEK[MT7].2y6_1.heavy 691.364 / 895.464 44566.0 24.45240020751953 50 20 10 10 10 5.478159085932914 14.622694276843376 0.0 3 0.9920222920109916 13.808107384495859 44566.0 120.3751593277583 0.0 - - - - - - - 222.92307692307693 89 13 LACTB lactamase, beta 753 96 B20140407_SF105_01 B20140407_SF105_01 TB150036.[MT7]-LIWTFLK[MT7].2y4_1.heavy 604.886 / 652.415 13831.0 39.886199951171875 50 20 10 10 10 21.51601644489517 4.647700481922885 0.0 3 0.9995443411687067 57.81306329213964 13831.0 43.570751121076235 0.0 - - - - - - - 717.0 27 7 EPHX4 epoxide hydrolase 4 755 96 B20140407_SF105_01 B20140407_SF105_01 TB150036.[MT7]-LIWTFLK[MT7].2y5_1.heavy 604.886 / 838.494 15058.0 39.886199951171875 50 20 10 10 10 21.51601644489517 4.647700481922885 0.0 3 0.9995443411687067 57.81306329213964 15058.0 64.08796064520448 0.0 - - - - - - - 304.3636363636364 30 11 EPHX4 epoxide hydrolase 4 757 96 B20140407_SF105_01 B20140407_SF105_01 TB150036.[MT7]-LIWTFLK[MT7].2y3_1.heavy 604.886 / 551.367 N/A 39.886199951171875 50 20 10 10 10 21.51601644489517 4.647700481922885 0.0 3 0.9995443411687067 57.81306329213964 8700.0 7.1618777739942745 0.0 - - - - - - - 1242.7142857142858 17 7 EPHX4 epoxide hydrolase 4 759 96 B20140407_SF105_01 B20140407_SF105_01 TB150036.[MT7]-LIWTFLK[MT7].2y6_1.heavy 604.886 / 951.578 7808.0 39.886199951171875 50 20 10 10 10 21.51601644489517 4.647700481922885 0.0 3 0.9995443411687067 57.81306329213964 7808.0 99.13496476617551 0.0 - - - - - - - 230.1875 15 16 EPHX4 epoxide hydrolase 4 761 97 B20140407_SF105_01 B20140407_SF105_01 TB150035.[MT7]-LQYNLEER.2b4_1.heavy 604.823 / 663.358 14241.0 27.448100090026855 46 20 10 6 10 6.100716207343792 16.39151807776669 0.039600372314453125 3 0.993897889842114 15.790695461100626 14241.0 11.787455470406154 0.0 - - - - - - - 411.0 28 1 CATSPER2 cation channel, sperm associated 2 763 97 B20140407_SF105_01 B20140407_SF105_01 TB150035.[MT7]-LQYNLEER.2y6_1.heavy 604.823 / 823.394 25744.0 27.448100090026855 46 20 10 6 10 6.100716207343792 16.39151807776669 0.039600372314453125 3 0.993897889842114 15.790695461100626 25744.0 46.67795478255925 0.0 - - - - - - - 685.0 51 9 CATSPER2 cation channel, sperm associated 2 765 97 B20140407_SF105_01 B20140407_SF105_01 TB150035.[MT7]-LQYNLEER.2b5_1.heavy 604.823 / 776.442 8079.0 27.448100090026855 46 20 10 6 10 6.100716207343792 16.39151807776669 0.039600372314453125 3 0.993897889842114 15.790695461100626 8079.0 14.152992700729929 1.0 - - - - - - - 685.0 16 9 CATSPER2 cation channel, sperm associated 2 767 97 B20140407_SF105_01 B20140407_SF105_01 TB150035.[MT7]-LQYNLEER.2y7_1.heavy 604.823 / 951.453 40396.0 27.448100090026855 46 20 10 6 10 6.100716207343792 16.39151807776669 0.039600372314453125 3 0.993897889842114 15.790695461100626 40396.0 55.908360790271196 0.0 - - - - - - - 365.3333333333333 80 9 CATSPER2 cation channel, sperm associated 2 769 98 B20140407_SF105_01 B20140407_SF105_01 TB150032.[MT7]-SGLYYSTK[MT7].2y4_1.heavy 603.834 / 642.358 11498.0 24.75429916381836 34 18 0 10 6 3.1971681576535746 25.92336134436035 0.0 6 0.9808537988980336 8.90483121979887 11498.0 12.892227295788938 0.0 - - - - - - - 829.2857142857143 22 7 GRB7 growth factor receptor-bound protein 7 771 98 B20140407_SF105_01 B20140407_SF105_01 TB150032.[MT7]-SGLYYSTK[MT7].2y5_1.heavy 603.834 / 805.421 9418.0 24.75429916381836 34 18 0 10 6 3.1971681576535746 25.92336134436035 0.0 6 0.9808537988980336 8.90483121979887 9418.0 12.0217625031267 1.0 - - - - - - - 671.125 86 8 GRB7 growth factor receptor-bound protein 7 773 98 B20140407_SF105_01 B20140407_SF105_01 TB150032.[MT7]-SGLYYSTK[MT7].2b4_1.heavy 603.834 / 565.31 10294.0 24.75429916381836 34 18 0 10 6 3.1971681576535746 25.92336134436035 0.0 6 0.9808537988980336 8.90483121979887 10294.0 7.525835517255848 2.0 - - - - - - - 438.0 62 1 GRB7 growth factor receptor-bound protein 7 775 98 B20140407_SF105_01 B20140407_SF105_01 TB150032.[MT7]-SGLYYSTK[MT7].2b5_1.heavy 603.834 / 728.374 4380.0 24.75429916381836 34 18 0 10 6 3.1971681576535746 25.92336134436035 0.0 6 0.9808537988980336 8.90483121979887 4380.0 13.52676399026764 4.0 - - - - - - - 799.7 11 10 GRB7 growth factor receptor-bound protein 7 777 99 B20140407_SF105_01 B20140407_SF105_01 TB150031.[MT7]-ELEQLASK[MT7].2y4_1.heavy 603.353 / 562.368 57140.0 27.035200119018555 48 18 10 10 10 4.818125176654174 20.754960972068908 0.0 3 0.9838160508474055 9.687967089543143 57140.0 14.367923773464817 0.0 - - - - - - - 1385.6666666666667 114 3 ACTRT2 actin-related protein T2 779 99 B20140407_SF105_01 B20140407_SF105_01 TB150031.[MT7]-ELEQLASK[MT7].2b3_1.heavy 603.353 / 516.279 63445.0 27.035200119018555 48 18 10 10 10 4.818125176654174 20.754960972068908 0.0 3 0.9838160508474055 9.687967089543143 63445.0 43.26243398570985 0.0 - - - - - - - 671.0 126 1 ACTRT2 actin-related protein T2 781 99 B20140407_SF105_01 B20140407_SF105_01 TB150031.[MT7]-ELEQLASK[MT7].2b4_1.heavy 603.353 / 644.337 61433.0 27.035200119018555 48 18 10 10 10 4.818125176654174 20.754960972068908 0.0 3 0.9838160508474055 9.687967089543143 61433.0 61.51812255589389 0.0 - - - - - - - 771.5 122 8 ACTRT2 actin-related protein T2 783 99 B20140407_SF105_01 B20140407_SF105_01 TB150031.[MT7]-ELEQLASK[MT7].2y7_1.heavy 603.353 / 932.553 51775.0 27.035200119018555 48 18 10 10 10 4.818125176654174 20.754960972068908 0.0 3 0.9838160508474055 9.687967089543143 51775.0 26.694663388853847 0.0 - - - - - - - 335.0 103 2 ACTRT2 actin-related protein T2 785 100 B20140407_SF105_01 B20140407_SF105_01 TB499009.[MT7]-YYLDSLDR.2y5_1.heavy 594.805 / 605.289 51121.0 30.695899963378906 47 17 10 10 10 3.7046739793603263 26.99292854300412 0.0 3 0.9763071742487205 8.001892607938489 51121.0 52.68257191154767 0.0 - - - - - - - 771.0 102 7 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 787 100 B20140407_SF105_01 B20140407_SF105_01 TB499009.[MT7]-YYLDSLDR.2b4_1.heavy 594.805 / 699.347 103740.0 30.695899963378906 47 17 10 10 10 3.7046739793603263 26.99292854300412 0.0 3 0.9763071742487205 8.001892607938489 103740.0 47.87711675176263 0.0 - - - - - - - 792.4285714285714 207 7 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 789 100 B20140407_SF105_01 B20140407_SF105_01 TB499009.[MT7]-YYLDSLDR.2y6_1.heavy 594.805 / 718.373 61465.0 30.695899963378906 47 17 10 10 10 3.7046739793603263 26.99292854300412 0.0 3 0.9763071742487205 8.001892607938489 61465.0 40.048813058470905 0.0 - - - - - - - 1292.75 122 8 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 791 100 B20140407_SF105_01 B20140407_SF105_01 TB499009.[MT7]-YYLDSLDR.2y7_1.heavy 594.805 / 881.436 135522.0 30.695899963378906 47 17 10 10 10 3.7046739793603263 26.99292854300412 0.0 3 0.9763071742487205 8.001892607938489 135522.0 223.47836520734916 0.0 - - - - - - - 375.0 271 4 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 793 101 B20140407_SF105_01 B20140407_SF105_01 TB360925.[MT7]-SQNTPDSSASNLGFR.2b3_1.heavy 862.92 / 474.243 12642.0 26.446199417114258 40 10 10 10 10 0.4847497786876247 96.48998247206694 0.0 3 0.8223919338698055 2.883918583160685 12642.0 24.27134394628547 0.0 - - - - - - - 699.0 25 8 SUMF1 sulfatase modifying factor 1 795 101 B20140407_SF105_01 B20140407_SF105_01 TB360925.[MT7]-SQNTPDSSASNLGFR.2b4_1.heavy 862.92 / 575.291 32455.0 26.446199417114258 40 10 10 10 10 0.4847497786876247 96.48998247206694 0.0 3 0.8223919338698055 2.883918583160685 32455.0 144.89713838047933 0.0 - - - - - - - 270.1111111111111 64 9 SUMF1 sulfatase modifying factor 1 797 101 B20140407_SF105_01 B20140407_SF105_01 TB360925.[MT7]-SQNTPDSSASNLGFR.2y9_1.heavy 862.92 / 938.469 14708.0 26.446199417114258 40 10 10 10 10 0.4847497786876247 96.48998247206694 0.0 3 0.8223919338698055 2.883918583160685 14708.0 40.55292181069959 0.0 - - - - - - - 746.5714285714286 29 7 SUMF1 sulfatase modifying factor 1 799 101 B20140407_SF105_01 B20140407_SF105_01 TB360925.[MT7]-SQNTPDSSASNLGFR.2y11_1.heavy 862.92 / 1150.55 30875.0 26.446199417114258 40 10 10 10 10 0.4847497786876247 96.48998247206694 0.0 3 0.8223919338698055 2.883918583160685 30875.0 47.5382311717807 1.0 - - - - - - - 258.5 62 8 SUMF1 sulfatase modifying factor 1 801 102 B20140407_SF105_01 B20140407_SF105_01 TB360410.[MT7]-GPPSGK[MT7].2y4_1.heavy 415.752 / 532.321 16662.0 17.82819938659668 38 8 10 10 10 0.6019506459959575 89.34238506214899 0.0 3 0.7969952583721048 2.6913641376193005 16662.0 25.673909284786586 0.0 - - - - - - - 336.4 33 5 SUMF1 sulfatase modifying factor 1 803 102 B20140407_SF105_01 B20140407_SF105_01 TB360410.[MT7]-GPPSGK[MT7].2y5_2.heavy 415.752 / 315.191 21547.0 17.82819938659668 38 8 10 10 10 0.6019506459959575 89.34238506214899 0.0 3 0.7969952583721048 2.6913641376193005 21547.0 26.59406403024835 0.0 - - - - - - - 845.1428571428571 43 7 SUMF1 sulfatase modifying factor 1 805 102 B20140407_SF105_01 B20140407_SF105_01 TB360410.[MT7]-GPPSGK[MT7].2y5_1.heavy 415.752 / 629.374 27517.0 17.82819938659668 38 8 10 10 10 0.6019506459959575 89.34238506214899 0.0 3 0.7969952583721048 2.6913641376193005 27517.0 72.15911173306193 0.0 - - - - - - - 260.4 55 5 SUMF1 sulfatase modifying factor 1 807 102 B20140407_SF105_01 B20140407_SF105_01 TB360410.[MT7]-GPPSGK[MT7].2y3_1.heavy 415.752 / 435.268 5536.0 17.82819938659668 38 8 10 10 10 0.6019506459959575 89.34238506214899 0.0 3 0.7969952583721048 2.6913641376193005 5536.0 3.1624570024570025 1.0 - - - - - - - 278.25 11 8 SUMF1 sulfatase modifying factor 1 809 103 B20140407_SF105_01 B20140407_SF105_01 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1187090.0 31.339500427246094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1187090.0 170.9828011035704 0.0 - - - - - - - 3496.0 2374 1 811 103 B20140407_SF105_01 B20140407_SF105_01 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 323015.0 31.339500427246094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 323015.0 97.47508246677084 0.0 - - - - - - - 1064.0 646 1 813 103 B20140407_SF105_01 B20140407_SF105_01 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 440973.0 31.339500427246094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 440973.0 127.89288545542686 0.0 - - - - - - - 2660.0 881 2 815 104 B20140407_SF105_01 B20140407_SF105_01 TB361080.[MT7]-ILFGEIVLSGGTTLFHGLDDR.3y6_1.heavy 802.105 / 712.337 134335.0 42.770198822021484 47 17 10 10 10 3.9829182464813186 25.10721883090227 0.0 3 0.9707030811370458 7.192590969334118 134335.0 149.2490385973291 0.0 - - - - - - - 201.0 268 1 ACTRT2 actin-related protein T2 817 104 B20140407_SF105_01 B20140407_SF105_01 TB361080.[MT7]-ILFGEIVLSGGTTLFHGLDDR.3b6_1.heavy 802.105 / 817.494 262632.0 42.770198822021484 47 17 10 10 10 3.9829182464813186 25.10721883090227 0.0 3 0.9707030811370458 7.192590969334118 262632.0 155.02414864976714 0.0 - - - - - - - 738.0 525 3 ACTRT2 actin-related protein T2 819 104 B20140407_SF105_01 B20140407_SF105_01 TB361080.[MT7]-ILFGEIVLSGGTTLFHGLDDR.3b5_1.heavy 802.105 / 704.41 278870.0 42.770198822021484 47 17 10 10 10 3.9829182464813186 25.10721883090227 0.0 3 0.9707030811370458 7.192590969334118 278870.0 92.25582316328399 0.0 - - - - - - - 827.3333333333334 557 3 ACTRT2 actin-related protein T2 821 104 B20140407_SF105_01 B20140407_SF105_01 TB361080.[MT7]-ILFGEIVLSGGTTLFHGLDDR.3b7_1.heavy 802.105 / 916.562 138965.0 42.770198822021484 47 17 10 10 10 3.9829182464813186 25.10721883090227 0.0 3 0.9707030811370458 7.192590969334118 138965.0 158.7501798983857 0.0 - - - - - - - 201.0 277 1 ACTRT2 actin-related protein T2 823 105 B20140407_SF105_01 B20140407_SF105_01 TB361162.[MT7]-AVGNIVTGDDIQTQVILNC[CAM]SALPC[CAM]LLHLLSSPK[MT7].4b11_1.heavy 959.523 / 1199.64 4690.0 42.8120002746582 44 14 10 10 10 1.5974608051782264 42.692442205671995 0.0 3 0.9424371717819734 5.119006712044991 4690.0 25.825410045662103 0.0 - - - - - - - 250.3125 9 16 KPNA6;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 5 (importin alpha 6) 825 105 B20140407_SF105_01 B20140407_SF105_01 TB361162.[MT7]-AVGNIVTGDDIQTQVILNC[CAM]SALPC[CAM]LLHLLSSPK[MT7].4b10_1.heavy 959.523 / 1086.55 5252.0 42.8120002746582 44 14 10 10 10 1.5974608051782264 42.692442205671995 0.0 3 0.9424371717819734 5.119006712044991 5252.0 9.696924983164982 1.0 - - - - - - - 205.57142857142858 11 14 KPNA6;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 5 (importin alpha 6) 827 105 B20140407_SF105_01 B20140407_SF105_01 TB361162.[MT7]-AVGNIVTGDDIQTQVILNC[CAM]SALPC[CAM]LLHLLSSPK[MT7].4b5_1.heavy 959.523 / 599.363 12756.0 42.8120002746582 44 14 10 10 10 1.5974608051782264 42.692442205671995 0.0 3 0.9424371717819734 5.119006712044991 12756.0 33.93956973357016 0.0 - - - - - - - 750.2857142857143 25 7 KPNA6;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 5 (importin alpha 6) 829 105 B20140407_SF105_01 B20140407_SF105_01 TB361162.[MT7]-AVGNIVTGDDIQTQVILNC[CAM]SALPC[CAM]LLHLLSSPK[MT7].4b6_1.heavy 959.523 / 698.432 13381.0 42.8120002746582 44 14 10 10 10 1.5974608051782264 42.692442205671995 0.0 3 0.9424371717819734 5.119006712044991 13381.0 34.1424297033668 0.0 - - - - - - - 625.2 26 10 KPNA6;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 5 (importin alpha 6) 831 106 B20140407_SF105_01 B20140407_SF105_01 TB498908.[MT7]-QDGEAPAR.2b4_1.heavy 494.252 / 574.259 11386.0 16.96980094909668 48 18 10 10 10 3.9942319521876426 25.036102358860244 0.0 3 0.9810885578250131 8.960107740460115 11386.0 94.35202596678482 0.0 - - - - - - - 254.5 22 16 SUMF1 sulfatase modifying factor 1 833 106 B20140407_SF105_01 B20140407_SF105_01 TB498908.[MT7]-QDGEAPAR.2y6_1.heavy 494.252 / 600.31 20874.0 16.96980094909668 48 18 10 10 10 3.9942319521876426 25.036102358860244 0.0 3 0.9810885578250131 8.960107740460115 20874.0 35.88642328926193 0.0 - - - - - - - 649.4285714285714 41 7 SUMF1 sulfatase modifying factor 1 835 106 B20140407_SF105_01 B20140407_SF105_01 TB498908.[MT7]-QDGEAPAR.2b5_1.heavy 494.252 / 645.296 11386.0 16.96980094909668 48 18 10 10 10 3.9942319521876426 25.036102358860244 0.0 3 0.9810885578250131 8.960107740460115 11386.0 71.10244725738397 0.0 - - - - - - - 199.94444444444446 22 18 SUMF1 sulfatase modifying factor 1 837 106 B20140407_SF105_01 B20140407_SF105_01 TB498908.[MT7]-QDGEAPAR.2y7_1.heavy 494.252 / 715.337 18225.0 16.96980094909668 48 18 10 10 10 3.9942319521876426 25.036102358860244 0.0 3 0.9810885578250131 8.960107740460115 18225.0 32.2603448275862 0.0 - - - - - - - 300.5 36 10 SUMF1 sulfatase modifying factor 1 839 107 B20140407_SF105_01 B20140407_SF105_01 TB499202.[MT7]-GISAFPESDNLFK[MT7].3y6_1.heavy 571.641 / 867.469 91070.0 34.190399169921875 50 20 10 10 10 10.264842788947194 9.74199040901789 0.0 3 0.9964314586893933 20.65321999180156 91070.0 97.09845502372083 0.0 - - - - - - - 462.0 182 3 UBE2C ubiquitin-conjugating enzyme E2C 841 107 B20140407_SF105_01 B20140407_SF105_01 TB499202.[MT7]-GISAFPESDNLFK[MT7].3y3_1.heavy 571.641 / 551.367 120810.0 34.190399169921875 50 20 10 10 10 10.264842788947194 9.74199040901789 0.0 3 0.9964314586893933 20.65321999180156 120810.0 62.50089126492418 0.0 - - - - - - - 770.0 241 1 UBE2C ubiquitin-conjugating enzyme E2C 843 107 B20140407_SF105_01 B20140407_SF105_01 TB499202.[MT7]-GISAFPESDNLFK[MT7].3b5_1.heavy 571.641 / 620.352 573869.0 34.190399169921875 50 20 10 10 10 10.264842788947194 9.74199040901789 0.0 3 0.9964314586893933 20.65321999180156 573869.0 127.51203232378464 0.0 - - - - - - - 3852.0 1147 1 UBE2C ubiquitin-conjugating enzyme E2C 845 107 B20140407_SF105_01 B20140407_SF105_01 TB499202.[MT7]-GISAFPESDNLFK[MT7].3y4_1.heavy 571.641 / 665.41 88450.0 34.190399169921875 50 20 10 10 10 10.264842788947194 9.74199040901789 0.0 3 0.9964314586893933 20.65321999180156 88450.0 75.45675683999173 0.0 - - - - - - - 821.6666666666666 176 3 UBE2C ubiquitin-conjugating enzyme E2C 847 108 B20140407_SF105_01 B20140407_SF105_01 TB498907.[MT7]-HILVSDR.2y4_1.heavy 492.291 / 476.246 12844.0 22.158100128173828 50 20 10 10 10 7.477902457677955 13.372733940561735 0.0 3 0.9958573710511486 19.167890121818083 12844.0 3.397535029604213 1.0 - - - - - - - 592.0 25 1 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 849 108 B20140407_SF105_01 B20140407_SF105_01 TB498907.[MT7]-HILVSDR.2b3_1.heavy 492.291 / 508.336 8788.0 22.158100128173828 50 20 10 10 10 7.477902457677955 13.372733940561735 0.0 3 0.9958573710511486 19.167890121818083 8788.0 5.387336160916128 0.0 - - - - - - - 776.0909090909091 17 11 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 851 108 B20140407_SF105_01 B20140407_SF105_01 TB498907.[MT7]-HILVSDR.2y5_1.heavy 492.291 / 589.33 26196.0 22.158100128173828 50 20 10 10 10 7.477902457677955 13.372733940561735 0.0 3 0.9958573710511486 19.167890121818083 26196.0 28.18434267636374 0.0 - - - - - - - 1193.875 52 8 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 853 108 B20140407_SF105_01 B20140407_SF105_01 TB498907.[MT7]-HILVSDR.2y6_1.heavy 492.291 / 702.414 44195.0 22.158100128173828 50 20 10 10 10 7.477902457677955 13.372733940561735 0.0 3 0.9958573710511486 19.167890121818083 44195.0 69.91568705725477 0.0 - - - - - - - 676.1538461538462 88 13 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 855 109 B20140407_SF105_01 B20140407_SF105_01 TB150143.[MT7]-EEEGIQLRK[MT7].3b4_1.heavy 463.936 / 589.259 42769.0 23.877199172973633 44 14 10 10 10 1.9673205639751485 42.11226142145578 0.0 3 0.94681615496452 5.3275639152603755 42769.0 50.61091027308193 0.0 - - - - - - - 410.0 85 1 KPNA6;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 5 (importin alpha 6) 857 109 B20140407_SF105_01 B20140407_SF105_01 TB150143.[MT7]-EEEGIQLRK[MT7].3b5_1.heavy 463.936 / 702.343 9641.0 23.877199172973633 44 14 10 10 10 1.9673205639751485 42.11226142145578 0.0 3 0.94681615496452 5.3275639152603755 9641.0 17.828706767140797 0.0 - - - - - - - 743.625 19 8 KPNA6;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 5 (importin alpha 6) 859 109 B20140407_SF105_01 B20140407_SF105_01 TB150143.[MT7]-EEEGIQLRK[MT7].3b3_1.heavy 463.936 / 532.237 13538.0 23.877199172973633 44 14 10 10 10 1.9673205639751485 42.11226142145578 0.0 3 0.94681615496452 5.3275639152603755 13538.0 8.44387057395881 0.0 - - - - - - - 1699.5714285714287 27 7 KPNA6;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 5 (importin alpha 6) 861 109 B20140407_SF105_01 B20140407_SF105_01 TB150143.[MT7]-EEEGIQLRK[MT7].3y8_2.heavy 463.936 / 558.828 51179.0 23.877199172973633 44 14 10 10 10 1.9673205639751485 42.11226142145578 0.0 3 0.94681615496452 5.3275639152603755 51179.0 39.52952512633962 0.0 - - - - - - - 1807.75 102 8 KPNA6;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 5 (importin alpha 6) 863 110 B20140407_SF105_01 B20140407_SF105_01 TB360660.[MT7]-TQLWFHGR.3y3_1.heavy 396.885 / 369.199 235244.0 28.083499908447266 48 18 10 10 10 3.3935529724541675 23.56055623306979 0.0 3 0.9844075802222696 9.870512026707555 235244.0 72.69233794555522 0.0 - - - - - - - 1601.3333333333333 470 3 GRB7 growth factor receptor-bound protein 7 865 110 B20140407_SF105_01 B20140407_SF105_01 TB360660.[MT7]-TQLWFHGR.3b3_1.heavy 396.885 / 487.3 177463.0 28.083499908447266 48 18 10 10 10 3.3935529724541675 23.56055623306979 0.0 3 0.9844075802222696 9.870512026707555 177463.0 72.58553367827648 0.0 - - - - - - - 412.0 354 1 GRB7 growth factor receptor-bound protein 7 867 110 B20140407_SF105_01 B20140407_SF105_01 TB360660.[MT7]-TQLWFHGR.3y4_1.heavy 396.885 / 516.268 180619.0 28.083499908447266 48 18 10 10 10 3.3935529724541675 23.56055623306979 0.0 3 0.9844075802222696 9.870512026707555 180619.0 42.39756894853866 0.0 - - - - - - - 1715.5 361 2 GRB7 growth factor receptor-bound protein 7 869 110 B20140407_SF105_01 B20140407_SF105_01 TB360660.[MT7]-TQLWFHGR.3y5_1.heavy 396.885 / 702.347 28136.0 28.083499908447266 48 18 10 10 10 3.3935529724541675 23.56055623306979 0.0 3 0.9844075802222696 9.870512026707555 28136.0 114.6266693865243 0.0 - - - - - - - 199.27272727272728 56 11 GRB7 growth factor receptor-bound protein 7 871 111 B20140407_SF105_01 B20140407_SF105_01 TB498904.[MT7]-LREEER.2b3_1.heavy 488.271 / 543.337 8737.0 18.747499465942383 43 13 10 10 10 3.8230390860743033 26.157200527783576 0.0 3 0.9203287472150755 4.3429525278774905 8737.0 6.338747063016824 0.0 - - - - - - - 746.0 17 8 GRB7 growth factor receptor-bound protein 7 873 111 B20140407_SF105_01 B20140407_SF105_01 TB498904.[MT7]-LREEER.2y4_1.heavy 488.271 / 562.247 4553.0 18.747499465942383 43 13 10 10 10 3.8230390860743033 26.157200527783576 0.0 3 0.9203287472150755 4.3429525278774905 4553.0 5.834688008130081 1.0 - - - - - - - 782.1428571428571 9 14 GRB7 growth factor receptor-bound protein 7 875 111 B20140407_SF105_01 B20140407_SF105_01 TB498904.[MT7]-LREEER.2b4_1.heavy 488.271 / 672.38 34087.0 18.747499465942383 43 13 10 10 10 3.8230390860743033 26.157200527783576 0.0 3 0.9203287472150755 4.3429525278774905 34087.0 80.56011816838995 0.0 - - - - - - - 713.7 68 10 GRB7 growth factor receptor-bound protein 7 877 111 B20140407_SF105_01 B20140407_SF105_01 TB498904.[MT7]-LREEER.2b5_1.heavy 488.271 / 801.422 16613.0 18.747499465942383 43 13 10 10 10 3.8230390860743033 26.157200527783576 0.0 3 0.9203287472150755 4.3429525278774905 16613.0 43.89613821138211 0.0 - - - - - - - 315.0 33 17 GRB7 growth factor receptor-bound protein 7 879 112 B20140407_SF105_01 B20140407_SF105_01 TB499201.[MT7]-GISAFPESDNLFK[MT7].2y8_1.heavy 856.958 / 1093.56 96081.0 34.190399169921875 40 10 10 10 10 1.0215314464024576 64.16451445909793 0.0 3 0.8215235951615016 2.8766716423497534 96081.0 91.44754154935973 0.0 - - - - - - - 410.6666666666667 192 3 UBE2C ubiquitin-conjugating enzyme E2C 881 112 B20140407_SF105_01 B20140407_SF105_01 TB499201.[MT7]-GISAFPESDNLFK[MT7].2y9_1.heavy 856.958 / 1240.63 14012.0 34.190399169921875 40 10 10 10 10 1.0215314464024576 64.16451445909793 0.0 3 0.8215235951615016 2.8766716423497534 14012.0 36.12184415584416 0.0 - - - - - - - 364.0 28 11 UBE2C ubiquitin-conjugating enzyme E2C 883 112 B20140407_SF105_01 B20140407_SF105_01 TB499201.[MT7]-GISAFPESDNLFK[MT7].2y6_1.heavy 856.958 / 867.469 7391.0 34.190399169921875 40 10 10 10 10 1.0215314464024576 64.16451445909793 0.0 3 0.8215235951615016 2.8766716423497534 7391.0 10.014645021645022 0.0 - - - - - - - 712.25 14 8 UBE2C ubiquitin-conjugating enzyme E2C 885 112 B20140407_SF105_01 B20140407_SF105_01 TB499201.[MT7]-GISAFPESDNLFK[MT7].2b5_1.heavy 856.958 / 620.352 132881.0 34.190399169921875 40 10 10 10 10 1.0215314464024576 64.16451445909793 0.0 3 0.8215235951615016 2.8766716423497534 132881.0 96.47640431989419 0.0 - - - - - - - 616.0 265 1 UBE2C ubiquitin-conjugating enzyme E2C 887 113 B20140407_SF105_01 B20140407_SF105_01 TB150141.[MT7]-VLAGVLDSVDVR.3y6_1.heavy 462.941 / 690.342 232054.0 35.8577995300293 50 20 10 10 10 8.952160988482206 11.170487229693409 0.0 3 0.9959041160534791 19.277033493883796 232054.0 289.54294098090344 0.0 - - - - - - - 248.33333333333334 464 3 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 889 113 B20140407_SF105_01 B20140407_SF105_01 TB150141.[MT7]-VLAGVLDSVDVR.3b4_1.heavy 462.941 / 485.32 410637.0 35.8577995300293 50 20 10 10 10 8.952160988482206 11.170487229693409 0.0 3 0.9959041160534791 19.277033493883796 410637.0 219.59586580442294 0.0 - - - - - - - 447.0 821 1 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 891 113 B20140407_SF105_01 B20140407_SF105_01 TB150141.[MT7]-VLAGVLDSVDVR.3b5_1.heavy 462.941 / 584.389 241735.0 35.8577995300293 50 20 10 10 10 8.952160988482206 11.170487229693409 0.0 3 0.9959041160534791 19.277033493883796 241735.0 153.44436639366228 0.0 - - - - - - - 298.0 483 1 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 893 113 B20140407_SF105_01 B20140407_SF105_01 TB150141.[MT7]-VLAGVLDSVDVR.3y5_1.heavy 462.941 / 575.315 157284.0 35.8577995300293 50 20 10 10 10 8.952160988482206 11.170487229693409 0.0 3 0.9959041160534791 19.277033493883796 157284.0 302.1769115126484 0.0 - - - - - - - 372.5 314 2 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 895 114 B20140407_SF105_01 B20140407_SF105_01 TB150282.[MT7]-TTGIVETHFTFK[MT7].3b6_1.heavy 556.978 / 745.421 146474.0 30.0935001373291 46 16 10 10 10 1.8164120699344783 39.9817343837819 0.0 3 0.96378707208179 6.465634808317112 146474.0 81.34453936586263 0.0 - - - - - - - 674.0 292 2 GNAI1;GNAI2;GNAI3;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 897 114 B20140407_SF105_01 B20140407_SF105_01 TB150282.[MT7]-TTGIVETHFTFK[MT7].3y3_1.heavy 556.978 / 539.331 369631.0 30.0935001373291 46 16 10 10 10 1.8164120699344783 39.9817343837819 0.0 3 0.96378707208179 6.465634808317112 369631.0 42.593983007754574 0.0 - - - - - - - 8836.0 739 1 GNAI1;GNAI2;GNAI3;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 899 114 B20140407_SF105_01 B20140407_SF105_01 TB150282.[MT7]-TTGIVETHFTFK[MT7].3b4_1.heavy 556.978 / 517.31 205484.0 30.0935001373291 46 16 10 10 10 1.8164120699344783 39.9817343837819 0.0 3 0.96378707208179 6.465634808317112 205484.0 89.38370353017584 0.0 - - - - - - - 1348.0 410 1 GNAI1;GNAI2;GNAI3;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 901 114 B20140407_SF105_01 B20140407_SF105_01 TB150282.[MT7]-TTGIVETHFTFK[MT7].3y4_1.heavy 556.978 / 686.399 297891.0 30.0935001373291 46 16 10 10 10 1.8164120699344783 39.9817343837819 0.0 3 0.96378707208179 6.465634808317112 297891.0 79.14239108103209 0.0 - - - - - - - 2196.6666666666665 595 3 GNAI1;GNAI2;GNAI3;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 903 115 B20140407_SF105_01 B20140407_SF105_01 TB360667.[MT7]-FTPFTLGK[MT7].3y3_1.heavy 400.241 / 461.32 218351.0 33.432899475097656 50 20 10 10 10 14.579818106996225 6.858796129425944 0.0 3 0.9989723031361325 38.49396557095061 218351.0 211.61979015684156 0.0 - - - - - - - 308.0 436 4 EFNA1 ephrin-A1 905 115 B20140407_SF105_01 B20140407_SF105_01 TB360667.[MT7]-FTPFTLGK[MT7].3b4_1.heavy 400.241 / 637.347 139147.0 33.432899475097656 50 20 10 10 10 14.579818106996225 6.858796129425944 0.0 3 0.9989723031361325 38.49396557095061 139147.0 942.9350854691031 0.0 - - - - - - - 308.0 278 7 EFNA1 ephrin-A1 907 115 B20140407_SF105_01 B20140407_SF105_01 TB360667.[MT7]-FTPFTLGK[MT7].3b5_1.heavy 400.241 / 738.394 14793.0 33.432899475097656 50 20 10 10 10 14.579818106996225 6.858796129425944 0.0 3 0.9989723031361325 38.49396557095061 14793.0 54.80134090909091 0.0 - - - - - - - 338.8 29 5 EFNA1 ephrin-A1 909 115 B20140407_SF105_01 B20140407_SF105_01 TB360667.[MT7]-FTPFTLGK[MT7].3y4_1.heavy 400.241 / 562.368 99237.0 33.432899475097656 50 20 10 10 10 14.579818106996225 6.858796129425944 0.0 3 0.9989723031361325 38.49396557095061 99237.0 246.26322727874538 0.0 - - - - - - - 264.0 198 7 EFNA1 ephrin-A1 911 116 B20140407_SF105_01 B20140407_SF105_01 TB499207.[MT7]-EALSVALEEAQAWR.3y6_1.heavy 572.973 / 760.374 74721.0 37.055999755859375 50 20 10 10 10 16.547506199674206 6.0432066798058575 0.0 3 0.9929900098129777 14.73159049922269 74721.0 52.40711564122222 0.0 - - - - - - - 749.4285714285714 149 7 GRB7 growth factor receptor-bound protein 7 913 116 B20140407_SF105_01 B20140407_SF105_01 TB499207.[MT7]-EALSVALEEAQAWR.3b6_1.heavy 572.973 / 715.411 122786.0 37.055999755859375 50 20 10 10 10 16.547506199674206 6.0432066798058575 0.0 3 0.9929900098129777 14.73159049922269 122786.0 69.05431528345103 0.0 - - - - - - - 709.0 245 1 GRB7 growth factor receptor-bound protein 7 915 116 B20140407_SF105_01 B20140407_SF105_01 TB499207.[MT7]-EALSVALEEAQAWR.3b4_1.heavy 572.973 / 545.305 62244.0 37.055999755859375 50 20 10 10 10 16.547506199674206 6.0432066798058575 0.0 3 0.9929900098129777 14.73159049922269 62244.0 23.511033584781867 0.0 - - - - - - - 1701.0 124 1 GRB7 growth factor receptor-bound protein 7 917 116 B20140407_SF105_01 B20140407_SF105_01 TB499207.[MT7]-EALSVALEEAQAWR.3y5_1.heavy 572.973 / 631.331 73445.0 37.055999755859375 50 20 10 10 10 16.547506199674206 6.0432066798058575 0.0 3 0.9929900098129777 14.73159049922269 73445.0 114.68132389292352 0.0 - - - - - - - 815.375 146 8 GRB7 growth factor receptor-bound protein 7 919 117 B20140407_SF105_01 B20140407_SF105_01 TB150521.[MT7]-EAVTITWNAPTQDGGAPVLGYIVER.3b6_1.heavy 934.491 / 759.437 12267.0 37.37919998168945 45 15 10 10 10 3.498699042085001 28.58205258501068 0.0 3 0.9541012557268096 5.738345316667586 12267.0 11.669135732758134 0.0 - - - - - - - 712.5714285714286 24 7 IGSF22 immunoglobulin superfamily, member 22 921 117 B20140407_SF105_01 B20140407_SF105_01 TB150521.[MT7]-EAVTITWNAPTQDGGAPVLGYIVER.3b4_1.heavy 934.491 / 545.305 10649.0 37.37919998168945 45 15 10 10 10 3.498699042085001 28.58205258501068 0.0 3 0.9541012557268096 5.738345316667586 10649.0 16.242890103654442 0.0 - - - - - - - 1213.0 21 7 IGSF22 immunoglobulin superfamily, member 22 923 117 B20140407_SF105_01 B20140407_SF105_01 TB150521.[MT7]-EAVTITWNAPTQDGGAPVLGYIVER.3y12_1.heavy 934.491 / 1230.68 6605.0 37.37919998168945 45 15 10 10 10 3.498699042085001 28.58205258501068 0.0 3 0.9541012557268096 5.738345316667586 6605.0 22.55708384613971 0.0 - - - - - - - 269.6363636363636 13 11 IGSF22 immunoglobulin superfamily, member 22 925 117 B20140407_SF105_01 B20140407_SF105_01 TB150521.[MT7]-EAVTITWNAPTQDGGAPVLGYIVER.3y9_1.heavy 934.491 / 1045.6 22512.0 37.37919998168945 45 15 10 10 10 3.498699042085001 28.58205258501068 0.0 3 0.9541012557268096 5.738345316667586 22512.0 22.274176936007112 0.0 - - - - - - - 724.625 45 8 IGSF22 immunoglobulin superfamily, member 22 927 118 B20140407_SF105_01 B20140407_SF105_01 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 921876.0 23.356700897216797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 921876.0 333.86807715888483 0.0 - - - - - - - 1327.0 1843 9 929 118 B20140407_SF105_01 B20140407_SF105_01 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 1509270.0 23.356700897216797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1509270.0 806.0212485766456 0.0 - - - - - - - 196.7058823529412 3018 17 931 118 B20140407_SF105_01 B20140407_SF105_01 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 4721500.0 23.356700897216797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 4721500.0 1144.3139326376013 0.0 - - - - - - - 780.25 9443 8 933 119 B20140407_SF105_01 B20140407_SF105_01 TB150018.[MT7]-RFFC[CAM]FLR.3y6_1.heavy 397.219 / 889.439 N/A 33.181400299072266 50 20 10 10 10 5.556940648045029 17.995513418913465 0.0 3 0.9960242328885816 19.566263980278205 0.0 0.0 8.0 - - - - - - - 0.0 0 0 GRB7 growth factor receptor-bound protein 7 935 119 B20140407_SF105_01 B20140407_SF105_01 TB150018.[MT7]-RFFC[CAM]FLR.3y3_1.heavy 397.219 / 435.271 107451.0 33.181400299072266 50 20 10 10 10 5.556940648045029 17.995513418913465 0.0 3 0.9960242328885816 19.566263980278205 107451.0 229.41607843137254 0.0 - - - - - - - 191.25 214 8 GRB7 growth factor receptor-bound protein 7 937 119 B20140407_SF105_01 B20140407_SF105_01 TB150018.[MT7]-RFFC[CAM]FLR.3b4_1.heavy 397.219 / 755.378 10561.0 33.181400299072266 50 20 10 10 10 5.556940648045029 17.995513418913465 0.0 3 0.9960242328885816 19.566263980278205 10561.0 133.91071895424835 0.0 - - - - - - - 153.0 21 3 GRB7 growth factor receptor-bound protein 7 939 119 B20140407_SF105_01 B20140407_SF105_01 TB150018.[MT7]-RFFC[CAM]FLR.3y5_1.heavy 397.219 / 742.37 15766.0 33.181400299072266 50 20 10 10 10 5.556940648045029 17.995513418913465 0.0 3 0.9960242328885816 19.566263980278205 15766.0 123.65490196078431 0.0 - - - - - - - 255.0 31 6 GRB7 growth factor receptor-bound protein 7 941 120 B20140407_SF105_01 B20140407_SF105_01 TB150538.[MT7]-RATSLPSIPNPFPELC[CAM]SPPSQSPILGGPSSAR.4y8_1.heavy 866.205 / 744.4 19032.0 36.321401596069336 39 14 10 5 10 3.5100298361756783 28.489786317302105 0.048999786376953125 3 0.9402846694851039 5.024978667988272 19032.0 25.579359484721685 0.0 - - - - - - - 216.0 38 2 GRB7 growth factor receptor-bound protein 7 943 120 B20140407_SF105_01 B20140407_SF105_01 TB150538.[MT7]-RATSLPSIPNPFPELC[CAM]SPPSQSPILGGPSSAR.4y10_1.heavy 866.205 / 954.537 16581.0 36.321401596069336 39 14 10 5 10 3.5100298361756783 28.489786317302105 0.048999786376953125 3 0.9402846694851039 5.024978667988272 16581.0 31.11243144633362 0.0 - - - - - - - 360.5 33 6 GRB7 growth factor receptor-bound protein 7 945 120 B20140407_SF105_01 B20140407_SF105_01 TB150538.[MT7]-RATSLPSIPNPFPELC[CAM]SPPSQSPILGGPSSAR.4b10_1.heavy 866.205 / 1181.68 5335.0 36.321401596069336 39 14 10 5 10 3.5100298361756783 28.489786317302105 0.048999786376953125 3 0.9402846694851039 5.024978667988272 5335.0 1.6546857178875471 0.0 - - - - - - - 350.2857142857143 10 7 GRB7 growth factor receptor-bound protein 7 947 120 B20140407_SF105_01 B20140407_SF105_01 TB150538.[MT7]-RATSLPSIPNPFPELC[CAM]SPPSQSPILGGPSSAR.4y7_1.heavy 866.205 / 631.316 35180.0 36.321401596069336 39 14 10 5 10 3.5100298361756783 28.489786317302105 0.048999786376953125 3 0.9402846694851039 5.024978667988272 35180.0 38.27575579422705 0.0 - - - - - - - 433.0 70 1 GRB7 growth factor receptor-bound protein 7 949 121 B20140407_SF105_01 B20140407_SF105_01 TB150539.[MT7]-SDSDIFTPYGWLEPWSGQPAHPPLNLSAK[MT7].4y8_1.heavy 875.445 / 983.601 23226.0 39.24209976196289 47 17 10 10 10 3.751770234110456 26.654084274888966 0.0 3 0.9773783522470602 8.189891164974707 23226.0 48.81843725681535 0.0 - - - - - - - 300.0 46 7 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 951 121 B20140407_SF105_01 B20140407_SF105_01 TB150539.[MT7]-SDSDIFTPYGWLEPWSGQPAHPPLNLSAK[MT7].4b4_1.heavy 875.445 / 549.227 28362.0 39.24209976196289 47 17 10 10 10 3.751770234110456 26.654084274888966 0.0 3 0.9773783522470602 8.189891164974707 28362.0 29.835054780771042 0.0 - - - - - - - 1116.857142857143 56 7 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 953 121 B20140407_SF105_01 B20140407_SF105_01 TB150539.[MT7]-SDSDIFTPYGWLEPWSGQPAHPPLNLSAK[MT7].4b5_1.heavy 875.445 / 662.311 20425.0 39.24209976196289 47 17 10 10 10 3.751770234110456 26.654084274888966 0.0 3 0.9773783522470602 8.189891164974707 20425.0 26.122197331374707 0.0 - - - - - - - 1196.25 40 8 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 955 121 B20140407_SF105_01 B20140407_SF105_01 TB150539.[MT7]-SDSDIFTPYGWLEPWSGQPAHPPLNLSAK[MT7].4b6_1.heavy 875.445 / 809.38 14473.0 39.24209976196289 47 17 10 10 10 3.751770234110456 26.654084274888966 0.0 3 0.9773783522470602 8.189891164974707 14473.0 16.65222526034702 0.0 - - - - - - - 785.3636363636364 28 11 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 957 122 B20140407_SF105_01 B20140407_SF105_01 TB150534.[MT7]-GVIAALQDPTILQATC[CAM]PYSPAGGIILNIK[MT7].4b8_1.heavy 821.465 / 912.527 27133.0 40.11880111694336 44 14 10 10 10 1.9028898885909673 44.86315756064476 0.0 3 0.9496818788671678 5.478504867244729 27133.0 24.5988433474831 0.0 - - - - - - - 712.5 54 10 C14orf148 chromosome 14 open reading frame 148 959 122 B20140407_SF105_01 B20140407_SF105_01 TB150534.[MT7]-GVIAALQDPTILQATC[CAM]PYSPAGGIILNIK[MT7].4b5_1.heavy 821.465 / 556.357 37609.0 40.11880111694336 44 14 10 10 10 1.9028898885909673 44.86315756064476 0.0 3 0.9496818788671678 5.478504867244729 37609.0 9.935281937075246 1.0 - - - - - - - 419.0 75 1 C14orf148 chromosome 14 open reading frame 148 961 122 B20140407_SF105_01 B20140407_SF105_01 TB150534.[MT7]-GVIAALQDPTILQATC[CAM]PYSPAGGIILNIK[MT7].4y3_1.heavy 821.465 / 518.342 30381.0 40.11880111694336 44 14 10 10 10 1.9028898885909673 44.86315756064476 0.0 3 0.9496818788671678 5.478504867244729 30381.0 46.21274574880668 0.0 - - - - - - - 1162.7 60 10 C14orf148 chromosome 14 open reading frame 148 963 122 B20140407_SF105_01 B20140407_SF105_01 TB150534.[MT7]-GVIAALQDPTILQATC[CAM]PYSPAGGIILNIK[MT7].4b6_1.heavy 821.465 / 669.442 18752.0 40.11880111694336 44 14 10 10 10 1.9028898885909673 44.86315756064476 0.0 3 0.9496818788671678 5.478504867244729 18752.0 17.424317531021316 0.0 - - - - - - - 759.5 37 8 C14orf148 chromosome 14 open reading frame 148 965 123 B20140407_SF105_01 B20140407_SF105_01 TB149896.[MT7]-SSLQLYR.2y5_1.heavy 505.791 / 692.409 9856.0 26.87179946899414 40 14 8 10 8 2.390547623279181 41.83141930585227 0.0 4 0.9326231857500277 4.727570266780497 9856.0 3.8992147943044153 1.0 - - - - - - - 1258.0 19 7 CEP68 centrosomal protein 68kDa 967 123 B20140407_SF105_01 B20140407_SF105_01 TB149896.[MT7]-SSLQLYR.2b4_1.heavy 505.791 / 560.316 22472.0 26.87179946899414 40 14 8 10 8 2.390547623279181 41.83141930585227 0.0 4 0.9326231857500277 4.727570266780497 22472.0 10.147174023338406 0.0 - - - - - - - 1708.3333333333333 44 3 CEP68 centrosomal protein 68kDa 969 123 B20140407_SF105_01 B20140407_SF105_01 TB149896.[MT7]-SSLQLYR.2y6_1.heavy 505.791 / 779.441 N/A 26.87179946899414 40 14 8 10 8 2.390547623279181 41.83141930585227 0.0 4 0.9326231857500277 4.727570266780497 33773.0 7.033069836666957 1.0 - - - - - - - 713.4285714285714 88 7 CEP68 centrosomal protein 68kDa 971 123 B20140407_SF105_01 B20140407_SF105_01 TB149896.[MT7]-SSLQLYR.2b5_1.heavy 505.791 / 673.4 21158.0 26.87179946899414 40 14 8 10 8 2.390547623279181 41.83141930585227 0.0 4 0.9326231857500277 4.727570266780497 21158.0 7.372374265051474 1.0 - - - - - - - 657.0 51 1 CEP68 centrosomal protein 68kDa 973 124 B20140407_SF105_01 B20140407_SF105_01 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 892207.0 29.468900680541992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 892207.0 784.4046657220057 0.0 - - - - - - - 1356.5 1784 2 975 124 B20140407_SF105_01 B20140407_SF105_01 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 884176.0 29.468900680541992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 884176.0 419.19857055284297 0.0 - - - - - - - 2285.0 1768 2 977 124 B20140407_SF105_01 B20140407_SF105_01 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1651460.0 29.468900680541992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1651460.0 349.43763952891004 0.0 - - - - - - - 3903.6666666666665 3302 3 979 125 B20140407_SF105_01 B20140407_SF105_01 TB150533.[MT7]-HLFEWELGVK[MT7]PSDQPLLATEPSLNPR.4y9_1.heavy 816.193 / 984.511 43466.0 35.061100006103516 41 13 10 10 8 1.4840390251729363 53.68312674455049 0.0 4 0.9191233103749233 4.31001982152266 43466.0 12.845865439954288 2.0 - - - - - - - 373.5 96 2 ACTRT2 actin-related protein T2 981 125 B20140407_SF105_01 B20140407_SF105_01 TB150533.[MT7]-HLFEWELGVK[MT7]PSDQPLLATEPSLNPR.4b4_1.heavy 816.193 / 671.363 26139.0 35.061100006103516 41 13 10 10 8 1.4840390251729363 53.68312674455049 0.0 4 0.9191233103749233 4.31001982152266 26139.0 18.083782780707114 0.0 - - - - - - - 768.0 52 7 ACTRT2 actin-related protein T2 983 125 B20140407_SF105_01 B20140407_SF105_01 TB150533.[MT7]-HLFEWELGVK[MT7]PSDQPLLATEPSLNPR.4y6_1.heavy 816.193 / 683.383 212699.0 35.061100006103516 41 13 10 10 8 1.4840390251729363 53.68312674455049 0.0 4 0.9191233103749233 4.31001982152266 212699.0 112.13420083682009 0.0 - - - - - - - 784.0 425 4 ACTRT2 actin-related protein T2 985 125 B20140407_SF105_01 B20140407_SF105_01 TB150533.[MT7]-HLFEWELGVK[MT7]PSDQPLLATEPSLNPR.4b6_1.heavy 816.193 / 986.485 21360.0 35.061100006103516 41 13 10 10 8 1.4840390251729363 53.68312674455049 0.0 4 0.9191233103749233 4.31001982152266 21360.0 39.88915662650602 0.0 - - - - - - - 298.6666666666667 42 6 ACTRT2 actin-related protein T2 987 126 B20140407_SF105_01 B20140407_SF105_01 TB499218.[MT7]-RSQPLLIPTTGRK[MT7].4y5_1.heavy 439.527 / 706.433 82005.0 25.080249786376953 45 20 10 5 10 10.072623335651265 9.92790027659009 0.04010009765625 3 0.993804873685367 15.67158139565078 82005.0 109.69756729610285 0.0 - - - - - - - 775.7 164 10 GRB7 growth factor receptor-bound protein 7 989 126 B20140407_SF105_01 B20140407_SF105_01 TB499218.[MT7]-RSQPLLIPTTGRK[MT7].4b5_1.heavy 439.527 / 726.438 114474.0 25.080249786376953 45 20 10 5 10 10.072623335651265 9.92790027659009 0.04010009765625 3 0.993804873685367 15.67158139565078 114474.0 111.66071323212489 0.0 - - - - - - - 288.2 228 5 GRB7 growth factor receptor-bound protein 7 991 126 B20140407_SF105_01 B20140407_SF105_01 TB499218.[MT7]-RSQPLLIPTTGRK[MT7].4y6_1.heavy 439.527 / 803.486 210220.0 25.080249786376953 45 20 10 5 10 10.072623335651265 9.92790027659009 0.04010009765625 3 0.993804873685367 15.67158139565078 210220.0 408.68234005459186 0.0 - - - - - - - 194.0 420 8 GRB7 growth factor receptor-bound protein 7 993 126 B20140407_SF105_01 B20140407_SF105_01 TB499218.[MT7]-RSQPLLIPTTGRK[MT7].4b3_1.heavy 439.527 / 516.301 228837.0 25.080249786376953 45 20 10 5 10 10.072623335651265 9.92790027659009 0.04010009765625 3 0.993804873685367 15.67158139565078 228837.0 109.76892966563486 0.0 - - - - - - - 1810.0 457 3 GRB7 growth factor receptor-bound protein 7 995 127 B20140407_SF105_01 B20140407_SF105_01 TB150317.[MT7]-FVNSTGYLTEAEK[MT7].3b6_1.heavy 582.977 / 750.39 217585.0 29.65959930419922 45 15 10 10 10 5.037815428762702 19.849873703007063 0.0 3 0.9554960112496357 5.828260343813611 217585.0 57.436301113294704 0.0 - - - - - - - 820.5 435 2 SUMF1 sulfatase modifying factor 1 997 127 B20140407_SF105_01 B20140407_SF105_01 TB150317.[MT7]-FVNSTGYLTEAEK[MT7].3y4_1.heavy 582.977 / 620.337 165985.0 29.65959930419922 45 15 10 10 10 5.037815428762702 19.849873703007063 0.0 3 0.9554960112496357 5.828260343813611 165985.0 22.52964985326834 0.0 - - - - - - - 1193.0 331 2 SUMF1 sulfatase modifying factor 1 999 127 B20140407_SF105_01 B20140407_SF105_01 TB150317.[MT7]-FVNSTGYLTEAEK[MT7].3b3_1.heavy 582.977 / 505.289 73373.0 29.65959930419922 45 15 10 10 10 5.037815428762702 19.849873703007063 0.0 3 0.9554960112496357 5.828260343813611 73373.0 12.926305194796472 0.0 - - - - - - - 1342.0 146 1 SUMF1 sulfatase modifying factor 1 1001 127 B20140407_SF105_01 B20140407_SF105_01 TB150317.[MT7]-FVNSTGYLTEAEK[MT7].3y5_1.heavy 582.977 / 721.385 215050.0 29.65959930419922 45 15 10 10 10 5.037815428762702 19.849873703007063 0.0 3 0.9554960112496357 5.828260343813611 215050.0 37.442812317052486 0.0 - - - - - - - 1193.0 430 2 SUMF1 sulfatase modifying factor 1 1003 128 B20140407_SF105_01 B20140407_SF105_01 TB150314.[MT7]-IIHEDGFSGEDVK[MT7].3b6_1.heavy 578.636 / 809.427 20849.0 26.618099212646484 47 17 10 10 10 10.779638797547134 9.276748681296688 0.0 3 0.9751706317745412 7.815860720951561 20849.0 20.830700079608626 0.0 - - - - - - - 743.2222222222222 41 9 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1005 128 B20140407_SF105_01 B20140407_SF105_01 TB150314.[MT7]-IIHEDGFSGEDVK[MT7].3y3_1.heavy 578.636 / 505.31 68840.0 26.618099212646484 47 17 10 10 10 10.779638797547134 9.276748681296688 0.0 3 0.9751706317745412 7.815860720951561 68840.0 18.318648265497433 0.0 - - - - - - - 1049.0 137 1 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1007 128 B20140407_SF105_01 B20140407_SF105_01 TB150314.[MT7]-IIHEDGFSGEDVK[MT7].3y6_1.heavy 578.636 / 778.406 81034.0 26.618099212646484 47 17 10 10 10 10.779638797547134 9.276748681296688 0.0 3 0.9751706317745412 7.815860720951561 81034.0 38.61687823774713 0.0 - - - - - - - 787.0 162 4 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1009 128 B20140407_SF105_01 B20140407_SF105_01 TB150314.[MT7]-IIHEDGFSGEDVK[MT7].3y5_1.heavy 578.636 / 691.374 72905.0 26.618099212646484 47 17 10 10 10 10.779638797547134 9.276748681296688 0.0 3 0.9751706317745412 7.815860720951561 72905.0 31.36177821053357 0.0 - - - - - - - 787.0 145 3 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1011 129 B20140407_SF105_01 B20140407_SF105_01 TB150319.[MT7]-LLGIFEQNQDRK[MT7].3y10_2.heavy 583.668 / 689.863 212193.0 33.17070007324219 35 10 10 5 10 2.6640850892119614 37.53633861205991 0.0428009033203125 3 0.8431812995643082 3.0748036007943593 212193.0 72.2541635833784 0.0 - - - - - - - 458.0 424 1 NUDT4 nudix (nucleoside diphosphate linked moiety X)-type motif 4 1013 129 B20140407_SF105_01 B20140407_SF105_01 TB150319.[MT7]-LLGIFEQNQDRK[MT7].3b4_1.heavy 583.668 / 541.383 83198.0 33.17070007324219 35 10 10 5 10 2.6640850892119614 37.53633861205991 0.0428009033203125 3 0.8431812995643082 3.0748036007943593 83198.0 33.69069057194465 0.0 - - - - - - - 1832.0 166 1 NUDT4 nudix (nucleoside diphosphate linked moiety X)-type motif 4 1015 129 B20140407_SF105_01 B20140407_SF105_01 TB150319.[MT7]-LLGIFEQNQDRK[MT7].3y11_2.heavy 583.668 / 746.405 258143.0 33.17070007324219 35 10 10 5 10 2.6640850892119614 37.53633861205991 0.0428009033203125 3 0.8431812995643082 3.0748036007943593 258143.0 52.25024543970882 0.0 - - - - - - - 1323.0 516 3 NUDT4 nudix (nucleoside diphosphate linked moiety X)-type motif 4 1017 129 B20140407_SF105_01 B20140407_SF105_01 TB150319.[MT7]-LLGIFEQNQDRK[MT7].3y8_1.heavy 583.668 / 1208.61 153.0 33.17070007324219 35 10 10 5 10 2.6640850892119614 37.53633861205991 0.0428009033203125 3 0.8431812995643082 3.0748036007943593 153.0 0.700327868852459 25.0 - - - - - - - 0.0 0 0 NUDT4 nudix (nucleoside diphosphate linked moiety X)-type motif 4 1019 130 B20140407_SF105_01 B20140407_SF105_01 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 922003.0 25.82379913330078 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 922003.0 522.6401086275044 0.0 - - - - - - - 1276.0 1844 2 1021 130 B20140407_SF105_01 B20140407_SF105_01 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 1136720.0 25.82379913330078 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1136720.0 740.6332631439732 0.0 - - - - - - - 1218.0 2273 2 1023 130 B20140407_SF105_01 B20140407_SF105_01 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 1433950.0 25.82379913330078 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1433950.0 1209.211674116112 0.0 - - - - - - - 580.0 2867 1 1025 131 B20140407_SF105_01 B20140407_SF105_01 TB499128.[MT7]-RPETLGELQK[MT7].3y3_1.heavy 486.955 / 532.357 294751.0 24.71660041809082 41 11 10 10 10 0.8259961899459933 72.90436593928182 0.0 3 0.8626259047828342 3.290849594893062 294751.0 245.3790817703525 0.0 - - - - - - - 746.0 589 1 C14orf148 chromosome 14 open reading frame 148 1027 131 B20140407_SF105_01 B20140407_SF105_01 TB499128.[MT7]-RPETLGELQK[MT7].3b6_1.heavy 486.955 / 798.459 116004.0 24.71660041809082 41 11 10 10 10 0.8259961899459933 72.90436593928182 0.0 3 0.8626259047828342 3.290849594893062 116004.0 133.2090769242734 0.0 - - - - - - - 426.0 232 1 C14orf148 chromosome 14 open reading frame 148 1029 131 B20140407_SF105_01 B20140407_SF105_01 TB499128.[MT7]-RPETLGELQK[MT7].3y5_1.heavy 486.955 / 718.422 175977.0 24.71660041809082 41 11 10 10 10 0.8259961899459933 72.90436593928182 0.0 3 0.8626259047828342 3.290849594893062 175977.0 358.7131879989004 0.0 - - - - - - - 319.75 351 4 C14orf148 chromosome 14 open reading frame 148 1031 131 B20140407_SF105_01 B20140407_SF105_01 TB499128.[MT7]-RPETLGELQK[MT7].3b7_1.heavy 486.955 / 927.502 124739.0 24.71660041809082 41 11 10 10 10 0.8259961899459933 72.90436593928182 0.0 3 0.8626259047828342 3.290849594893062 124739.0 281.6755153100163 0.0 - - - - - - - 271.27272727272725 249 11 C14orf148 chromosome 14 open reading frame 148 1033 132 B20140407_SF105_01 B20140407_SF105_01 TB149882.[MT7]-FVSNLK[MT7].2y4_1.heavy 498.31 / 605.374 60223.0 27.075700759887695 46 18 10 10 8 7.826577301359579 12.776977234049511 0.0 4 0.9899214114287263 12.282791484776824 60223.0 31.217798719799756 0.0 - - - - - - - 135.0 120 1 IGSF22 immunoglobulin superfamily, member 22 1035 132 B20140407_SF105_01 B20140407_SF105_01 TB149882.[MT7]-FVSNLK[MT7].2y5_1.heavy 498.31 / 704.442 64949.0 27.075700759887695 46 18 10 10 8 7.826577301359579 12.776977234049511 0.0 4 0.9899214114287263 12.282791484776824 64949.0 42.40591375254491 0.0 - - - - - - - 1299.375 129 8 IGSF22 immunoglobulin superfamily, member 22 1037 132 B20140407_SF105_01 B20140407_SF105_01 TB149882.[MT7]-FVSNLK[MT7].2b4_1.heavy 498.31 / 592.321 10397.0 27.075700759887695 46 18 10 10 8 7.826577301359579 12.776977234049511 0.0 4 0.9899214114287263 12.282791484776824 10397.0 4.558492367624101 2.0 - - - - - - - 810.0 44 1 IGSF22 immunoglobulin superfamily, member 22 1039 132 B20140407_SF105_01 B20140407_SF105_01 TB149882.[MT7]-FVSNLK[MT7].2y3_1.heavy 498.31 / 518.342 19309.0 27.075700759887695 46 18 10 10 8 7.826577301359579 12.776977234049511 0.0 4 0.9899214114287263 12.282791484776824 19309.0 10.485316408389242 1.0 - - - - - - - 945.0 41 1 IGSF22 immunoglobulin superfamily, member 22 1041 133 B20140407_SF105_01 B20140407_SF105_01 TB150415.[MT7]-HLSIGSLNSATPEEFK[MT7].3b6_1.heavy 673.365 / 739.422 13949.0 30.11750030517578 43 18 10 5 10 5.5304082221707205 18.081847846079864 0.048000335693359375 3 0.9884490909942077 11.471900168640097 13949.0 15.095917777777778 0.0 - - - - - - - 300.0 27 2 C14orf148 chromosome 14 open reading frame 148 1043 133 B20140407_SF105_01 B20140407_SF105_01 TB150415.[MT7]-HLSIGSLNSATPEEFK[MT7].3y3_1.heavy 673.365 / 567.326 28797.0 30.11750030517578 43 18 10 5 10 5.5304082221707205 18.081847846079864 0.048000335693359375 3 0.9884490909942077 11.471900168640097 28797.0 21.971044444444445 0.0 - - - - - - - 900.0 57 1 C14orf148 chromosome 14 open reading frame 148 1045 133 B20140407_SF105_01 B20140407_SF105_01 TB150415.[MT7]-HLSIGSLNSATPEEFK[MT7].3y4_1.heavy 673.365 / 696.369 17548.0 30.11750030517578 43 18 10 5 10 5.5304082221707205 18.081847846079864 0.048000335693359375 3 0.9884490909942077 11.471900168640097 17548.0 20.769032888888887 0.0 - - - - - - - 150.0 35 1 C14orf148 chromosome 14 open reading frame 148 1047 133 B20140407_SF105_01 B20140407_SF105_01 TB150415.[MT7]-HLSIGSLNSATPEEFK[MT7].3y5_1.heavy 673.365 / 793.421 89241.0 30.11750030517578 43 18 10 5 10 5.5304082221707205 18.081847846079864 0.048000335693359375 3 0.9884490909942077 11.471900168640097 89241.0 89.69864615384614 0.0 - - - - - - - 750.0 178 4 C14orf148 chromosome 14 open reading frame 148 1049 134 B20140407_SF105_01 B20140407_SF105_01 TB149996.[MT7]-C[CAM]DTDIQK[MT7].2y5_1.heavy 584.3 / 748.432 12783.0 20.610300064086914 50 20 10 10 10 12.790440962449736 7.818338733870136 0.0 3 0.999164070570307 42.68224989761918 12783.0 31.354389906568684 0.0 - - - - - - - 724.5714285714286 25 7 ACTRT2 actin-related protein T2 1051 134 B20140407_SF105_01 B20140407_SF105_01 TB149996.[MT7]-C[CAM]DTDIQK[MT7].2b4_1.heavy 584.3 / 636.242 30350.0 20.610300064086914 50 20 10 10 10 12.790440962449736 7.818338733870136 0.0 3 0.999164070570307 42.68224989761918 30350.0 135.75716526610645 0.0 - - - - - - - 671.3 60 10 ACTRT2 actin-related protein T2 1053 134 B20140407_SF105_01 B20140407_SF105_01 TB149996.[MT7]-C[CAM]DTDIQK[MT7].2y3_1.heavy 584.3 / 532.357 N/A 20.610300064086914 50 20 10 10 10 12.790440962449736 7.818338733870136 0.0 3 0.999164070570307 42.68224989761918 25922.0 7.024932249322492 1.0 - - - - - - - 1754.4285714285713 66 7 ACTRT2 actin-related protein T2 1055 134 B20140407_SF105_01 B20140407_SF105_01 TB149996.[MT7]-C[CAM]DTDIQK[MT7].2y6_1.heavy 584.3 / 863.459 10283.0 20.610300064086914 50 20 10 10 10 12.790440962449736 7.818338733870136 0.0 3 0.999164070570307 42.68224989761918 10283.0 42.06718526663002 0.0 - - - - - - - 220.5909090909091 20 22 ACTRT2 actin-related protein T2 1057 135 B20140407_SF105_01 B20140407_SF105_01 TB149881.[MT7]-VFAENK[MT7].2y4_1.heavy 498.292 / 605.338 68330.0 23.63319969177246 50 20 10 10 10 6.556853251695635 15.251218253838378 0.0 3 0.9933203902509385 15.091930101262555 68330.0 68.29284738310453 0.0 - - - - - - - 1271.75 136 12 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1059 135 B20140407_SF105_01 B20140407_SF105_01 TB149881.[MT7]-VFAENK[MT7].2y5_1.heavy 498.292 / 752.406 174372.0 23.63319969177246 50 20 10 10 10 6.556853251695635 15.251218253838378 0.0 3 0.9933203902509385 15.091930101262555 174372.0 93.44353631800298 0.0 - - - - - - - 756.0 348 9 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1061 135 B20140407_SF105_01 B20140407_SF105_01 TB149881.[MT7]-VFAENK[MT7].2b4_1.heavy 498.292 / 591.326 30714.0 23.63319969177246 50 20 10 10 10 6.556853251695635 15.251218253838378 0.0 3 0.9933203902509385 15.091930101262555 30714.0 15.185971358171962 0.0 - - - - - - - 1263.4444444444443 61 9 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1063 135 B20140407_SF105_01 B20140407_SF105_01 TB149881.[MT7]-VFAENK[MT7].2y3_1.heavy 498.292 / 534.3 38685.0 23.63319969177246 50 20 10 10 10 6.556853251695635 15.251218253838378 0.0 3 0.9933203902509385 15.091930101262555 38685.0 16.826315265218444 0.0 - - - - - - - 1749.6666666666667 77 9 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1065 136 B20140407_SF105_01 B20140407_SF105_01 TB498827.[MT7]-VSVTTR.2y4_1.heavy 403.746 / 476.283 39611.0 21.146299362182617 48 20 10 10 8 6.323709489233203 15.81350316143725 0.0 4 0.9963775409269682 20.49884717732859 39611.0 25.56741384096075 1.0 - - - - - - - 996.0 91 1 LACTB lactamase, beta 1067 136 B20140407_SF105_01 B20140407_SF105_01 TB498827.[MT7]-VSVTTR.2b3_1.heavy 403.746 / 430.278 51947.0 21.146299362182617 48 20 10 10 8 6.323709489233203 15.81350316143725 0.0 4 0.9963775409269682 20.49884717732859 51947.0 25.690574780523626 0.0 - - - - - - - 1269.857142857143 103 7 LACTB lactamase, beta 1069 136 B20140407_SF105_01 B20140407_SF105_01 TB498827.[MT7]-VSVTTR.2y5_1.heavy 403.746 / 563.315 514746.0 21.146299362182617 48 20 10 10 8 6.323709489233203 15.81350316143725 0.0 4 0.9963775409269682 20.49884717732859 514746.0 262.2210823291215 0.0 - - - - - - - 383.0 1029 2 LACTB lactamase, beta 1071 136 B20140407_SF105_01 B20140407_SF105_01 TB498827.[MT7]-VSVTTR.2b4_1.heavy 403.746 / 531.326 34325.0 21.146299362182617 48 20 10 10 8 6.323709489233203 15.81350316143725 0.0 4 0.9963775409269682 20.49884717732859 34325.0 23.03945345731753 1.0 - - - - - - - 1277.111111111111 68 9 LACTB lactamase, beta 1073 137 B20140407_SF105_01 B20140407_SF105_01 TB360779.[MT7]-HLSPDGQYVPR.3y7_1.heavy 471.585 / 834.41 15575.0 23.797500610351562 46 16 10 10 10 1.288516808635553 48.04661909884268 0.0 3 0.9673223381093656 6.808431755846149 15575.0 130.7615239488272 0.0 - - - - - - - 760.4285714285714 31 7 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1075 137 B20140407_SF105_01 B20140407_SF105_01 TB360779.[MT7]-HLSPDGQYVPR.3y6_1.heavy 471.585 / 719.383 34402.0 23.797500610351562 46 16 10 10 10 1.288516808635553 48.04661909884268 0.0 3 0.9673223381093656 6.808431755846149 34402.0 37.921360666015794 0.0 - - - - - - - 295.8 68 5 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1077 137 B20140407_SF105_01 B20140407_SF105_01 TB360779.[MT7]-HLSPDGQYVPR.3b3_1.heavy 471.585 / 482.284 99066.0 23.797500610351562 46 16 10 10 10 1.288516808635553 48.04661909884268 0.0 3 0.9673223381093656 6.808431755846149 99066.0 47.46170623380154 0.0 - - - - - - - 862.5 198 4 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1079 137 B20140407_SF105_01 B20140407_SF105_01 TB360779.[MT7]-HLSPDGQYVPR.3y4_1.heavy 471.585 / 534.304 197146.0 23.797500610351562 46 16 10 10 10 1.288516808635553 48.04661909884268 0.0 3 0.9673223381093656 6.808431755846149 197146.0 57.65425595502723 0.0 - - - - - - - 2253.0 394 7 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1081 138 B20140407_SF105_01 B20140407_SF105_01 TB499126.[MT7]-NAVWALSNLC[CAM]R.2y8_1.heavy 724.383 / 1019.51 65233.0 35.061100006103516 47 17 10 10 10 6.009328848316374 16.640793427042503 0.0 3 0.9786250386770077 8.426225276161587 65233.0 89.9637878833951 0.0 - - - - - - - 303.2 130 5 KPNA6;KPNA1;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 1 (importin alpha 5);karyopherin alpha 5 (importin alpha 6) 1083 138 B20140407_SF105_01 B20140407_SF105_01 TB499126.[MT7]-NAVWALSNLC[CAM]R.2y9_1.heavy 724.383 / 1118.58 11985.0 35.061100006103516 47 17 10 10 10 6.009328848316374 16.640793427042503 0.0 3 0.9786250386770077 8.426225276161587 11985.0 23.838544732104054 0.0 - - - - - - - 260.0 23 7 KPNA6;KPNA1;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 1 (importin alpha 5);karyopherin alpha 5 (importin alpha 6) 1085 138 B20140407_SF105_01 B20140407_SF105_01 TB499126.[MT7]-NAVWALSNLC[CAM]R.2y10_1.heavy 724.383 / 1189.61 8951.0 35.061100006103516 47 17 10 10 10 6.009328848316374 16.640793427042503 0.0 3 0.9786250386770077 8.426225276161587 8951.0 13.214622886799685 0.0 - - - - - - - 248.1818181818182 17 11 KPNA6;KPNA1;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 1 (importin alpha 5);karyopherin alpha 5 (importin alpha 6) 1087 138 B20140407_SF105_01 B20140407_SF105_01 TB499126.[MT7]-NAVWALSNLC[CAM]R.2y7_1.heavy 724.383 / 833.43 41567.0 35.061100006103516 47 17 10 10 10 6.009328848316374 16.640793427042503 0.0 3 0.9786250386770077 8.426225276161587 41567.0 36.94885432596659 0.0 - - - - - - - 455.0 83 1 KPNA6;KPNA1;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 1 (importin alpha 5);karyopherin alpha 5 (importin alpha 6) 1089 139 B20140407_SF105_01 B20140407_SF105_01 TB360776.[MT7]-FGDSFVFEGMLSEQVK[MT7].3b6_1.heavy 703.359 / 797.395 37008.0 38.37160110473633 42 12 10 10 10 0.8814509276927112 72.3801044563748 0.0 3 0.8841060761150782 3.589596375065069 37008.0 54.11057369156701 0.0 - - - - - - - 371.8333333333333 74 6 SUMF1 sulfatase modifying factor 1 1091 139 B20140407_SF105_01 B20140407_SF105_01 TB360776.[MT7]-FGDSFVFEGMLSEQVK[MT7].3b4_1.heavy 703.359 / 551.258 7049.0 38.37160110473633 42 12 10 10 10 0.8814509276927112 72.3801044563748 0.0 3 0.8841060761150782 3.589596375065069 7049.0 2.8961335285340963 0.0 - - - - - - - 671.0 14 7 SUMF1 sulfatase modifying factor 1 1093 139 B20140407_SF105_01 B20140407_SF105_01 TB360776.[MT7]-FGDSFVFEGMLSEQVK[MT7].3b5_1.heavy 703.359 / 698.327 22205.0 38.37160110473633 42 12 10 10 10 0.8814509276927112 72.3801044563748 0.0 3 0.8841060761150782 3.589596375065069 22205.0 17.535045008183303 0.0 - - - - - - - 323.0 44 4 SUMF1 sulfatase modifying factor 1 1095 139 B20140407_SF105_01 B20140407_SF105_01 TB360776.[MT7]-FGDSFVFEGMLSEQVK[MT7].3y5_1.heavy 703.359 / 734.417 41472.0 38.37160110473633 42 12 10 10 10 0.8814509276927112 72.3801044563748 0.0 3 0.8841060761150782 3.589596375065069 41472.0 39.85169752957405 0.0 - - - - - - - 293.5 82 2 SUMF1 sulfatase modifying factor 1 1097 140 B20140407_SF105_01 B20140407_SF105_01 TB361047.[MT7]-LSLEFPSGYPYNAPTVK[MT7].3y6_1.heavy 724.392 / 773.464 34606.0 34.94375038146973 40 15 10 5 10 1.7691830659607577 37.96173139598875 0.046901702880859375 3 0.951482838058642 5.580112442531957 34606.0 36.07087808897635 0.0 - - - - - - - 298.0 69 4 UBE2C ubiquitin-conjugating enzyme E2C 1099 140 B20140407_SF105_01 B20140407_SF105_01 TB361047.[MT7]-LSLEFPSGYPYNAPTVK[MT7].3b4_1.heavy 724.392 / 587.352 99941.0 34.94375038146973 40 15 10 5 10 1.7691830659607577 37.96173139598875 0.046901702880859375 3 0.951482838058642 5.580112442531957 99941.0 36.37379464173279 0.0 - - - - - - - 895.0 199 1 UBE2C ubiquitin-conjugating enzyme E2C 1101 140 B20140407_SF105_01 B20140407_SF105_01 TB361047.[MT7]-LSLEFPSGYPYNAPTVK[MT7].3b5_1.heavy 724.392 / 734.42 106952.0 34.94375038146973 40 15 10 5 10 1.7691830659607577 37.96173139598875 0.046901702880859375 3 0.951482838058642 5.580112442531957 106952.0 103.03817068163085 0.0 - - - - - - - 447.0 213 2 UBE2C ubiquitin-conjugating enzyme E2C 1103 140 B20140407_SF105_01 B20140407_SF105_01 TB361047.[MT7]-LSLEFPSGYPYNAPTVK[MT7].3y4_1.heavy 724.392 / 588.384 166618.0 34.94375038146973 40 15 10 5 10 1.7691830659607577 37.96173139598875 0.046901702880859375 3 0.951482838058642 5.580112442531957 166618.0 57.14179341452005 0.0 - - - - - - - 1790.0 333 2 UBE2C ubiquitin-conjugating enzyme E2C 1105 141 B20140407_SF105_01 B20140407_SF105_01 TB149745.[MT7]-IEQISHAQR.3y3_1.heavy 409.23 / 374.215 N/A N/A - - - - - - - - - 0.0 - - - - - - - CATSPER2 cation channel, sperm associated 2 1107 141 B20140407_SF105_01 B20140407_SF105_01 TB149745.[MT7]-IEQISHAQR.3b4_1.heavy 409.23 / 628.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - CATSPER2 cation channel, sperm associated 2 1109 141 B20140407_SF105_01 B20140407_SF105_01 TB149745.[MT7]-IEQISHAQR.3y5_1.heavy 409.23 / 598.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - CATSPER2 cation channel, sperm associated 2 1111 142 B20140407_SF105_01 B20140407_SF105_01 TB499221.[MT7]-LIGQQGLVDGLFLVR.3y7_1.heavy 591.357 / 819.472 329769.0 40.04029846191406 48 18 10 10 10 3.178370937052202 25.147565361096767 0.0 3 0.9863589672196614 10.554649571839805 329769.0 183.4916006769498 0.0 - - - - - - - 255.0 659 3 GRB7 growth factor receptor-bound protein 7 1113 142 B20140407_SF105_01 B20140407_SF105_01 TB499221.[MT7]-LIGQQGLVDGLFLVR.3b6_1.heavy 591.357 / 741.438 316744.0 40.04029846191406 48 18 10 10 10 3.178370937052202 25.147565361096767 0.0 3 0.9863589672196614 10.554649571839805 316744.0 138.79598885691513 0.0 - - - - - - - 246.25 633 4 GRB7 growth factor receptor-bound protein 7 1115 142 B20140407_SF105_01 B20140407_SF105_01 TB499221.[MT7]-LIGQQGLVDGLFLVR.3y6_1.heavy 591.357 / 704.445 222947.0 40.04029846191406 48 18 10 10 10 3.178370937052202 25.147565361096767 0.0 3 0.9863589672196614 10.554649571839805 222947.0 223.34348134845428 0.0 - - - - - - - 383.0 445 2 GRB7 growth factor receptor-bound protein 7 1117 142 B20140407_SF105_01 B20140407_SF105_01 TB499221.[MT7]-LIGQQGLVDGLFLVR.3y8_1.heavy 591.357 / 918.541 176431.0 40.04029846191406 48 18 10 10 10 3.178370937052202 25.147565361096767 0.0 3 0.9863589672196614 10.554649571839805 176431.0 119.22163768180461 0.0 - - - - - - - 191.25 352 4 GRB7 growth factor receptor-bound protein 7 1119 143 B20140407_SF105_01 B20140407_SF105_01 TB360960.[MT7]-NALEAWAVPVVLGPSR.3y6_1.heavy 608.348 / 628.378 200969.0 38.18769836425781 46 16 10 10 10 5.610809451946492 17.822740347260975 0.0 3 0.9685097907093838 6.936306738127666 200969.0 207.10578386560073 0.0 - - - - - - - 351.0 401 2 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1121 143 B20140407_SF105_01 B20140407_SF105_01 TB360960.[MT7]-NALEAWAVPVVLGPSR.3b4_1.heavy 608.348 / 572.316 149907.0 38.18769836425781 46 16 10 10 10 5.610809451946492 17.822740347260975 0.0 3 0.9685097907093838 6.936306738127666 149907.0 119.4231558377198 0.0 - - - - - - - 820.0 299 2 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1123 143 B20140407_SF105_01 B20140407_SF105_01 TB360960.[MT7]-NALEAWAVPVVLGPSR.3b5_1.heavy 608.348 / 643.353 305435.0 38.18769836425781 46 16 10 10 10 5.610809451946492 17.822740347260975 0.0 3 0.9685097907093838 6.936306738127666 305435.0 181.96485701729898 0.0 - - - - - - - 820.0 610 1 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1125 143 B20140407_SF105_01 B20140407_SF105_01 TB360960.[MT7]-NALEAWAVPVVLGPSR.3y8_1.heavy 608.348 / 824.499 538806.0 38.18769836425781 46 16 10 10 10 5.610809451946492 17.822740347260975 0.0 3 0.9685097907093838 6.936306738127666 538806.0 516.979063032808 0.0 - - - - - - - 234.0 1077 2 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1127 144 B20140407_SF105_01 B20140407_SF105_01 TB360962.[MT7]-IGAADYQPTEQDILR.2y8_1.heavy 917.477 / 971.516 52792.0 30.519399642944336 46 16 10 10 10 1.433290972277586 45.389334787190265 0.0 3 0.9616190935899729 6.279221834352644 52792.0 114.34725677113781 0.0 - - - - - - - 302.6923076923077 105 13 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1129 144 B20140407_SF105_01 B20140407_SF105_01 TB360962.[MT7]-IGAADYQPTEQDILR.2b6_1.heavy 917.477 / 735.379 21480.0 30.519399642944336 46 16 10 10 10 1.433290972277586 45.389334787190265 0.0 3 0.9616190935899729 6.279221834352644 21480.0 44.6079365079365 0.0 - - - - - - - 302.625 42 8 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1131 144 B20140407_SF105_01 B20140407_SF105_01 TB360962.[MT7]-IGAADYQPTEQDILR.2b7_1.heavy 917.477 / 863.438 60052.0 30.519399642944336 46 16 10 10 10 1.433290972277586 45.389334787190265 0.0 3 0.9616190935899729 6.279221834352644 60052.0 112.60066679009233 0.0 - - - - - - - 737.375 120 8 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1133 144 B20140407_SF105_01 B20140407_SF105_01 TB360962.[MT7]-IGAADYQPTEQDILR.2b5_1.heavy 917.477 / 572.316 88037.0 30.519399642944336 46 16 10 10 10 1.433290972277586 45.389334787190265 0.0 3 0.9616190935899729 6.279221834352644 88037.0 110.64278484952406 0.0 - - - - - - - 333.0 176 5 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1135 145 B20140407_SF105_01 B20140407_SF105_01 TB499239.[MT7]-FFIDTSIILFLNK[MT7].3b6_1.heavy 620.369 / 855.437 30532.0 44.30189895629883 39 9 10 10 10 2.323334309535405 43.04158880174111 0.0 3 0.81942473733226 2.8593690105111476 30532.0 106.65666038715078 0.0 - - - - - - - 227.1875 61 16 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1137 145 B20140407_SF105_01 B20140407_SF105_01 TB499239.[MT7]-FFIDTSIILFLNK[MT7].3y3_1.heavy 620.369 / 518.342 72270.0 44.30189895629883 39 9 10 10 10 2.323334309535405 43.04158880174111 0.0 3 0.81942473733226 2.8593690105111476 72270.0 143.94823252838313 0.0 - - - - - - - 744.1428571428571 144 7 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1139 145 B20140407_SF105_01 B20140407_SF105_01 TB499239.[MT7]-FFIDTSIILFLNK[MT7].3b4_1.heavy 620.369 / 667.357 19809.0 44.30189895629883 39 9 10 10 10 2.323334309535405 43.04158880174111 0.0 3 0.81942473733226 2.8593690105111476 19809.0 59.77916822342611 0.0 - - - - - - - 631.7142857142857 39 7 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1141 145 B20140407_SF105_01 B20140407_SF105_01 TB499239.[MT7]-FFIDTSIILFLNK[MT7].3y4_1.heavy 620.369 / 665.41 80388.0 44.30189895629883 39 9 10 10 10 2.323334309535405 43.04158880174111 0.0 3 0.81942473733226 2.8593690105111476 80388.0 181.68712042241236 0.0 - - - - - - - 254.4 160 10 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1143 146 B20140407_SF105_01 B20140407_SF105_01 TB149874.[MT7]-LWEAGK[MT7].2b3_1.heavy 496.294 / 573.315 63125.0 27.66119956970215 48 18 10 10 10 3.2893847599020347 30.400821825105744 0.0 3 0.9846593069736769 9.951375492292618 63125.0 32.6574455366769 0.0 - - - - - - - 823.0 126 2 LACTB lactamase, beta 1145 146 B20140407_SF105_01 B20140407_SF105_01 TB149874.[MT7]-LWEAGK[MT7].2y4_1.heavy 496.294 / 548.316 96745.0 27.66119956970215 48 18 10 10 10 3.2893847599020347 30.400821825105744 0.0 3 0.9846593069736769 9.951375492292618 96745.0 29.813335378407 0.0 - - - - - - - 869.3333333333334 193 3 LACTB lactamase, beta 1147 146 B20140407_SF105_01 B20140407_SF105_01 TB149874.[MT7]-LWEAGK[MT7].2y5_1.heavy 496.294 / 734.395 224230.0 27.66119956970215 48 18 10 10 10 3.2893847599020347 30.400821825105744 0.0 3 0.9846593069736769 9.951375492292618 224230.0 175.77008173838226 0.0 - - - - - - - 549.0 448 1 LACTB lactamase, beta 1149 146 B20140407_SF105_01 B20140407_SF105_01 TB149874.[MT7]-LWEAGK[MT7].2b4_1.heavy 496.294 / 644.352 21956.0 27.66119956970215 48 18 10 10 10 3.2893847599020347 30.400821825105744 0.0 3 0.9846593069736769 9.951375492292618 21956.0 13.48215045482986 0.0 - - - - - - - 823.25 43 4 LACTB lactamase, beta 1151 147 B20140407_SF105_01 B20140407_SF105_01 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 357128.0 32.923500061035156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 357128.0 76.19794547549435 0.0 - - - - - - - 1643.0 714 1 1153 147 B20140407_SF105_01 B20140407_SF105_01 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 854259.0 32.923500061035156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 854259.0 72.39232492195391 0.0 - - - - - - - 2763.5 1708 2 1155 147 B20140407_SF105_01 B20140407_SF105_01 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 778557.0 32.923500061035156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 778557.0 81.79302603155159 0.0 - - - - - - - 2689.0 1557 1 1157 148 B20140407_SF105_01 B20140407_SF105_01 TB149873.[MT7]-AGLDEAK[MT7].2y4_1.heavy 496.287 / 606.321 8685.0 21.254499435424805 47 17 10 10 10 7.316543648595832 13.6676557679242 0.0 3 0.9718945453164477 7.344201932807045 8685.0 13.429759299781182 1.0 - - - - - - - 1600.0 17 8 TTC39C tetratricopeptide repeat domain 39C 1159 148 B20140407_SF105_01 B20140407_SF105_01 TB149873.[MT7]-AGLDEAK[MT7].2y5_1.heavy 496.287 / 719.406 3962.0 21.254499435424805 47 17 10 10 10 7.316543648595832 13.6676557679242 0.0 3 0.9718945453164477 7.344201932807045 3962.0 4.274075342465753 0.0 - - - - - - - 1295.0 7 8 TTC39C tetratricopeptide repeat domain 39C 1161 148 B20140407_SF105_01 B20140407_SF105_01 TB149873.[MT7]-AGLDEAK[MT7].2b4_1.heavy 496.287 / 501.279 18208.0 21.254499435424805 47 17 10 10 10 7.316543648595832 13.6676557679242 0.0 3 0.9718945453164477 7.344201932807045 18208.0 26.10917681866435 0.0 - - - - - - - 1198.2727272727273 36 11 TTC39C tetratricopeptide repeat domain 39C 1163 148 B20140407_SF105_01 B20140407_SF105_01 TB149873.[MT7]-AGLDEAK[MT7].2y6_1.heavy 496.287 / 776.427 15237.0 21.254499435424805 47 17 10 10 10 7.316543648595832 13.6676557679242 0.0 3 0.9718945453164477 7.344201932807045 15237.0 9.485904271343426 1.0 - - - - - - - 738.8 30 10 TTC39C tetratricopeptide repeat domain 39C 1165 149 B20140407_SF105_01 B20140407_SF105_01 TB360968.[MT7]-DQVELVENMVTVGK[MT7].2y4_1.heavy 925.003 / 548.352 16746.0 34.107398986816406 46 16 10 10 10 2.559671363880918 39.06751523304233 0.0 3 0.9654098424661459 6.616468130831199 16746.0 32.19128568170002 0.0 - - - - - - - 291.5833333333333 33 12 HINT3 histidine triad nucleotide binding protein 3 1167 149 B20140407_SF105_01 B20140407_SF105_01 TB360968.[MT7]-DQVELVENMVTVGK[MT7].2y8_1.heavy 925.003 / 1021.55 15071.0 34.107398986816406 46 16 10 10 10 2.559671363880918 39.06751523304233 0.0 3 0.9654098424661459 6.616468130831199 15071.0 93.20223684210526 0.0 - - - - - - - 260.57142857142856 30 7 HINT3 histidine triad nucleotide binding protein 3 1169 149 B20140407_SF105_01 B20140407_SF105_01 TB360968.[MT7]-DQVELVENMVTVGK[MT7].2y9_1.heavy 925.003 / 1120.62 8982.0 34.107398986816406 46 16 10 10 10 2.559671363880918 39.06751523304233 0.0 3 0.9654098424661459 6.616468130831199 8982.0 24.722502022876306 0.0 - - - - - - - 304.3 17 10 HINT3 histidine triad nucleotide binding protein 3 1171 149 B20140407_SF105_01 B20140407_SF105_01 TB360968.[MT7]-DQVELVENMVTVGK[MT7].2b4_1.heavy 925.003 / 616.306 21009.0 34.107398986816406 46 16 10 10 10 2.559671363880918 39.06751523304233 0.0 3 0.9654098424661459 6.616468130831199 21009.0 40.88711662526258 0.0 - - - - - - - 212.8 42 10 HINT3 histidine triad nucleotide binding protein 3 1173 150 B20140407_SF105_01 B20140407_SF105_01 TB150403.[MT7]-EALSVALEEAQAWRK[MT7].4y8_2.heavy 498.031 / 581.31 301418.0 34.38970184326172 40 10 10 10 10 0.713071885150034 80.51563585626755 0.0 3 0.8338882548214549 2.9850971301800633 301418.0 191.46450873761063 0.0 - - - - - - - 800.75 602 4 GRB7 growth factor receptor-bound protein 7 1175 150 B20140407_SF105_01 B20140407_SF105_01 TB150403.[MT7]-EALSVALEEAQAWRK[MT7].4b4_1.heavy 498.031 / 545.305 112727.0 34.38970184326172 40 10 10 10 10 0.713071885150034 80.51563585626755 0.0 3 0.8338882548214549 2.9850971301800633 112727.0 67.88981419364127 0.0 - - - - - - - 305.0 225 1 GRB7 growth factor receptor-bound protein 7 1177 150 B20140407_SF105_01 B20140407_SF105_01 TB150403.[MT7]-EALSVALEEAQAWRK[MT7].4y7_2.heavy 498.031 / 516.789 192200.0 34.38970184326172 40 10 10 10 10 0.713071885150034 80.51563585626755 0.0 3 0.8338882548214549 2.9850971301800633 192200.0 109.27411882993019 0.0 - - - - - - - 305.0 384 2 GRB7 growth factor receptor-bound protein 7 1179 150 B20140407_SF105_01 B20140407_SF105_01 TB150403.[MT7]-EALSVALEEAQAWRK[MT7].4b6_1.heavy 498.031 / 715.411 96405.0 34.38970184326172 40 10 10 10 10 0.713071885150034 80.51563585626755 0.0 3 0.8338882548214549 2.9850971301800633 96405.0 74.90844197804749 0.0 - - - - - - - 343.25 192 4 GRB7 growth factor receptor-bound protein 7 1181 151 B20140407_SF105_01 B20140407_SF105_01 TB150402.[MT7]-EALSVALEEAQAWRK[MT7].3y6_1.heavy 663.705 / 903.528 18165.0 34.38970184326172 45 15 10 10 10 1.8662432468789893 42.27857637179549 0.0 3 0.9592180373727935 6.090335245279861 18165.0 38.08342614478586 0.0 - - - - - - - 305.375 36 8 GRB7 growth factor receptor-bound protein 7 1183 151 B20140407_SF105_01 B20140407_SF105_01 TB150402.[MT7]-EALSVALEEAQAWRK[MT7].3b6_1.heavy 663.705 / 715.411 51747.0 34.38970184326172 45 15 10 10 10 1.8662432468789893 42.27857637179549 0.0 3 0.9592180373727935 6.090335245279861 51747.0 33.182994645588984 0.0 - - - - - - - 763.25 103 4 GRB7 growth factor receptor-bound protein 7 1185 151 B20140407_SF105_01 B20140407_SF105_01 TB150402.[MT7]-EALSVALEEAQAWRK[MT7].3b4_1.heavy 663.705 / 545.305 38619.0 34.38970184326172 45 15 10 10 10 1.8662432468789893 42.27857637179549 0.0 3 0.9592180373727935 6.090335245279861 38619.0 39.63085152838428 0.0 - - - - - - - 305.0 77 3 GRB7 growth factor receptor-bound protein 7 1187 151 B20140407_SF105_01 B20140407_SF105_01 TB150402.[MT7]-EALSVALEEAQAWRK[MT7].3y8_1.heavy 663.705 / 1161.61 17402.0 34.38970184326172 45 15 10 10 10 1.8662432468789893 42.27857637179549 0.0 3 0.9592180373727935 6.090335245279861 17402.0 121.56513704702336 0.0 - - - - - - - 305.3636363636364 34 11 GRB7 growth factor receptor-bound protein 7 1189 152 B20140407_SF105_01 B20140407_SF105_01 TB150404.[MT7]-C[CAM]TVDGLLEDTEYEFR.3b6_1.heavy 664.311 / 790.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - IGSF22 immunoglobulin superfamily, member 22 1191 152 B20140407_SF105_01 B20140407_SF105_01 TB150404.[MT7]-C[CAM]TVDGLLEDTEYEFR.3b4_1.heavy 664.311 / 620.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - IGSF22 immunoglobulin superfamily, member 22 1193 152 B20140407_SF105_01 B20140407_SF105_01 TB150404.[MT7]-C[CAM]TVDGLLEDTEYEFR.3b5_1.heavy 664.311 / 677.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - IGSF22 immunoglobulin superfamily, member 22 1195 152 B20140407_SF105_01 B20140407_SF105_01 TB150404.[MT7]-C[CAM]TVDGLLEDTEYEFR.3y4_1.heavy 664.311 / 614.293 N/A N/A - - - - - - - - - 0.0 - - - - - - - IGSF22 immunoglobulin superfamily, member 22 1197 153 B20140407_SF105_01 B20140407_SF105_01 TB498951.[MT7]-GVPGK[MT7]PGR.2y5_1.heavy 528.332 / 658.412 5316.0 19.326124668121338 46 20 10 6 10 4.846016876234321 14.409925108718662 0.03629875183105469 3 0.9993401325417003 48.04078881278563 5316.0 17.49056749311295 0.0 - - - - - - - 264.3076923076923 10 13 COL16A1;COL22A1;CHAC2 collagen, type XVI, alpha 1;collagen, type XXII, alpha 1;ChaC, cation transport regulator homolog 2 (E. coli) 1199 153 B20140407_SF105_01 B20140407_SF105_01 TB498951.[MT7]-GVPGK[MT7]PGR.2y6_1.heavy 528.332 / 755.464 66900.0 19.326124668121338 46 20 10 6 10 4.846016876234321 14.409925108718662 0.03629875183105469 3 0.9993401325417003 48.04078881278563 66900.0 91.73284759456482 0.0 - - - - - - - 815.0 133 7 COL16A1;COL22A1;CHAC2 collagen, type XVI, alpha 1;collagen, type XXII, alpha 1;ChaC, cation transport regulator homolog 2 (E. coli) 1201 153 B20140407_SF105_01 B20140407_SF105_01 TB498951.[MT7]-GVPGK[MT7]PGR.2b5_1.heavy 528.332 / 727.471 2269.0 19.326124668121338 46 20 10 6 10 4.846016876234321 14.409925108718662 0.03629875183105469 3 0.9993401325417003 48.04078881278563 2269.0 4.083033419023136 4.0 - - - - - - - 707.1818181818181 5 11 COL16A1;COL22A1;CHAC2 collagen, type XVI, alpha 1;collagen, type XXII, alpha 1;ChaC, cation transport regulator homolog 2 (E. coli) 1203 153 B20140407_SF105_01 B20140407_SF105_01 TB498951.[MT7]-GVPGK[MT7]PGR.2y7_1.heavy 528.332 / 854.533 4214.0 19.326124668121338 46 20 10 6 10 4.846016876234321 14.409925108718662 0.03629875183105469 3 0.9993401325417003 48.04078881278563 4214.0 25.18594545888215 0.0 - - - - - - - 183.55555555555554 8 18 COL16A1;COL22A1;CHAC2 collagen, type XVI, alpha 1;collagen, type XXII, alpha 1;ChaC, cation transport regulator homolog 2 (E. coli) 1205 154 B20140407_SF105_01 B20140407_SF105_01 TB499136.[MT7]-FQAPSAEANQK[MT7].3b6_1.heavy 493.6 / 746.395 76222.0 23.59149932861328 48 18 10 10 10 4.355923776867597 22.957242854215266 0.0 3 0.9860437360798887 10.434493949879277 76222.0 177.90591320875916 0.0 - - - - - - - 352.5 152 4 ACTRT2 actin-related protein T2 1207 154 B20140407_SF105_01 B20140407_SF105_01 TB499136.[MT7]-FQAPSAEANQK[MT7].3y3_1.heavy 493.6 / 533.316 191918.0 23.59149932861328 48 18 10 10 10 4.355923776867597 22.957242854215266 0.0 3 0.9860437360798887 10.434493949879277 191918.0 96.97507010584246 0.0 - - - - - - - 1316.0 383 1 ACTRT2 actin-related protein T2 1209 154 B20140407_SF105_01 B20140407_SF105_01 TB499136.[MT7]-FQAPSAEANQK[MT7].3b5_1.heavy 493.6 / 675.358 96335.0 23.59149932861328 48 18 10 10 10 4.355923776867597 22.957242854215266 0.0 3 0.9860437360798887 10.434493949879277 96335.0 134.98141300007015 0.0 - - - - - - - 313.3333333333333 192 3 ACTRT2 actin-related protein T2 1211 154 B20140407_SF105_01 B20140407_SF105_01 TB499136.[MT7]-FQAPSAEANQK[MT7].3y4_1.heavy 493.6 / 604.354 116542.0 23.59149932861328 48 18 10 10 10 4.355923776867597 22.957242854215266 0.0 3 0.9860437360798887 10.434493949879277 116542.0 34.82521499491862 1.0 - - - - - - - 846.0 242 2 ACTRT2 actin-related protein T2 1213 155 B20140407_SF105_01 B20140407_SF105_01 TB360768.[MT7]-ILK[MT7]PLEDK[MT7].3y3_1.heavy 463.301 / 535.284 41608.0 27.381099700927734 45 15 10 10 10 1.5420694045794165 49.165841765831 0.0 3 0.9550431679867039 5.798609982379501 41608.0 22.625553961620312 0.0 - - - - - - - 952.0 83 3 IGSF22 immunoglobulin superfamily, member 22 1215 155 B20140407_SF105_01 B20140407_SF105_01 TB360768.[MT7]-ILK[MT7]PLEDK[MT7].3y7_2.heavy 463.301 / 565.855 78321.0 27.381099700927734 45 15 10 10 10 1.5420694045794165 49.165841765831 0.0 3 0.9550431679867039 5.798609982379501 78321.0 71.98621323529412 0.0 - - - - - - - 816.0 156 5 IGSF22 immunoglobulin superfamily, member 22 1217 155 B20140407_SF105_01 B20140407_SF105_01 TB360768.[MT7]-ILK[MT7]PLEDK[MT7].3y4_1.heavy 463.301 / 648.369 19444.0 27.381099700927734 45 15 10 10 10 1.5420694045794165 49.165841765831 0.0 3 0.9550431679867039 5.798609982379501 19444.0 27.307382352941175 0.0 - - - - - - - 1243.4285714285713 38 7 IGSF22 immunoglobulin superfamily, member 22 1219 155 B20140407_SF105_01 B20140407_SF105_01 TB360768.[MT7]-ILK[MT7]PLEDK[MT7].3y5_1.heavy 463.301 / 745.421 157459.0 27.381099700927734 45 15 10 10 10 1.5420694045794165 49.165841765831 0.0 3 0.9550431679867039 5.798609982379501 157459.0 154.1303630514706 0.0 - - - - - - - 731.0 314 8 IGSF22 immunoglobulin superfamily, member 22 1221 156 B20140407_SF105_01 B20140407_SF105_01 TB150103.[MT7]-LLHLLGLEK[MT7].3y3_1.heavy 441.958 / 533.341 13703.0 36.00529861450195 46 16 10 10 10 3.357245999374337 22.518711267077073 0.0 3 0.9695370558377423 7.0529000995064655 13703.0 17.84729573922411 0.0 - - - - - - - 276.7142857142857 27 7 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1223 156 B20140407_SF105_01 B20140407_SF105_01 TB150103.[MT7]-LLHLLGLEK[MT7].3y4_1.heavy 441.958 / 590.363 71344.0 36.00529861450195 46 16 10 10 10 3.357245999374337 22.518711267077073 0.0 3 0.9695370558377423 7.0529000995064655 71344.0 61.29074702233349 0.0 - - - - - - - 745.0 142 7 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1225 156 B20140407_SF105_01 B20140407_SF105_01 TB150103.[MT7]-LLHLLGLEK[MT7].3b3_1.heavy 441.958 / 508.336 49151.0 36.00529861450195 46 16 10 10 10 3.357245999374337 22.518711267077073 0.0 3 0.9695370558377423 7.0529000995064655 49151.0 93.07116490891659 0.0 - - - - - - - 238.4 98 5 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1227 156 B20140407_SF105_01 B20140407_SF105_01 TB150103.[MT7]-LLHLLGLEK[MT7].3y5_1.heavy 441.958 / 703.447 16831.0 36.00529861450195 46 16 10 10 10 3.357245999374337 22.518711267077073 0.0 3 0.9695370558377423 7.0529000995064655 16831.0 129.62129194630873 0.0 - - - - - - - 223.5 33 6 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1229 157 B20140407_SF105_01 B20140407_SF105_01 TB150104.[MT7]-DPWDLPVGQR.2y5_1.heavy 663.85 / 556.32 15993.0 32.3031005859375 48 18 10 10 10 4.967654021402384 20.13022637429361 0.0 3 0.9826268143826995 9.349575027675582 15993.0 5.978720843180717 2.0 - - - - - - - 1495.0 33 2 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1231 157 B20140407_SF105_01 B20140407_SF105_01 TB150104.[MT7]-DPWDLPVGQR.2y9_1.heavy 663.85 / 1067.56 41254.0 32.3031005859375 48 18 10 10 10 4.967654021402384 20.13022637429361 0.0 3 0.9826268143826995 9.349575027675582 41254.0 92.73161597050998 0.0 - - - - - - - 336.0 82 8 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1233 157 B20140407_SF105_01 B20140407_SF105_01 TB150104.[MT7]-DPWDLPVGQR.2y6_1.heavy 663.85 / 669.404 38862.0 32.3031005859375 48 18 10 10 10 4.967654021402384 20.13022637429361 0.0 3 0.9826268143826995 9.349575027675582 38862.0 22.915100937404134 0.0 - - - - - - - 784.75 77 4 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1235 157 B20140407_SF105_01 B20140407_SF105_01 TB150104.[MT7]-DPWDLPVGQR.2y7_1.heavy 663.85 / 784.431 11360.0 32.3031005859375 48 18 10 10 10 4.967654021402384 20.13022637429361 0.0 3 0.9826268143826995 9.349575027675582 11360.0 10.048595193395581 1.0 - - - - - - - 448.0 22 1 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1237 158 B20140407_SF105_01 B20140407_SF105_01 TB499236.[MT7]-DQVELVENMVTVGK[MT7].3b6_1.heavy 617.004 / 828.458 83365.0 34.107398986816406 41 11 10 10 10 0.7838638554397042 73.06608883161343 0.0 3 0.8528950296052761 3.177423411966727 83365.0 15.522627371757356 0.0 - - - - - - - 925.0 166 1 HINT3 histidine triad nucleotide binding protein 3 1239 158 B20140407_SF105_01 B20140407_SF105_01 TB499236.[MT7]-DQVELVENMVTVGK[MT7].3b4_1.heavy 617.004 / 616.306 153632.0 34.107398986816406 41 11 10 10 10 0.7838638554397042 73.06608883161343 0.0 3 0.8528950296052761 3.177423411966727 153632.0 9.99635955371092 0.0 - - - - - - - 8937.0 307 1 HINT3 histidine triad nucleotide binding protein 3 1241 158 B20140407_SF105_01 B20140407_SF105_01 TB499236.[MT7]-DQVELVENMVTVGK[MT7].3b5_1.heavy 617.004 / 729.39 164264.0 34.107398986816406 41 11 10 10 10 0.7838638554397042 73.06608883161343 0.0 3 0.8528950296052761 3.177423411966727 164264.0 94.79790863914778 0.0 - - - - - - - 718.8333333333334 328 6 HINT3 histidine triad nucleotide binding protein 3 1243 158 B20140407_SF105_01 B20140407_SF105_01 TB499236.[MT7]-DQVELVENMVTVGK[MT7].3y4_1.heavy 617.004 / 548.352 308342.0 34.107398986816406 41 11 10 10 10 0.7838638554397042 73.06608883161343 0.0 3 0.8528950296052761 3.177423411966727 308342.0 204.5082527322404 0.0 - - - - - - - 873.3333333333334 616 3 HINT3 histidine triad nucleotide binding protein 3 1245 159 B20140407_SF105_01 B20140407_SF105_01 TB360865.[MT7]-QEALQLHSPFER.3b4_1.heavy 533.618 / 586.332 99308.0 29.852500915527344 45 15 10 10 10 3.388371230733732 23.513575113195053 0.0 3 0.9597179160989223 6.128266739953382 99308.0 69.99898751993159 0.0 - - - - - - - 1191.0 198 1 ACTRT2 actin-related protein T2 1247 159 B20140407_SF105_01 B20140407_SF105_01 TB360865.[MT7]-QEALQLHSPFER.3b5_1.heavy 533.618 / 714.39 146356.0 29.852500915527344 45 15 10 10 10 3.388371230733732 23.513575113195053 0.0 3 0.9597179160989223 6.128266739953382 146356.0 87.46685233836934 0.0 - - - - - - - 298.0 292 1 ACTRT2 actin-related protein T2 1249 159 B20140407_SF105_01 B20140407_SF105_01 TB360865.[MT7]-QEALQLHSPFER.3y4_1.heavy 533.618 / 548.283 188044.0 29.852500915527344 45 15 10 10 10 3.388371230733732 23.513575113195053 0.0 3 0.9597179160989223 6.128266739953382 188044.0 82.84258375193791 0.0 - - - - - - - 2282.6666666666665 376 3 ACTRT2 actin-related protein T2 1251 159 B20140407_SF105_01 B20140407_SF105_01 TB360865.[MT7]-QEALQLHSPFER.3y5_1.heavy 533.618 / 635.315 210526.0 29.852500915527344 45 15 10 10 10 3.388371230733732 23.513575113195053 0.0 3 0.9597179160989223 6.128266739953382 210526.0 158.47830733060044 0.0 - - - - - - - 1340.0 421 2 ACTRT2 actin-related protein T2 1253 160 B20140407_SF105_01 B20140407_SF105_01 TB499235.[MT7]-ATIRPWSTFVDQQR.3y6_1.heavy 616.999 / 792.4 30715.0 31.50749969482422 47 17 10 10 10 2.072960552370818 33.96054527880197 0.0 3 0.9717920839666834 7.330788152259165 30715.0 36.99273578154492 0.0 - - - - - - - 456.0 61 3 RABAC1 Rab acceptor 1 (prenylated) 1255 160 B20140407_SF105_01 B20140407_SF105_01 TB499235.[MT7]-ATIRPWSTFVDQQR.3y4_1.heavy 616.999 / 546.263 44705.0 31.50749969482422 47 17 10 10 10 2.072960552370818 33.96054527880197 0.0 3 0.9717920839666834 7.330788152259165 44705.0 13.186116265401193 0.0 - - - - - - - 1977.0 89 2 RABAC1 Rab acceptor 1 (prenylated) 1257 160 B20140407_SF105_01 B20140407_SF105_01 TB499235.[MT7]-ATIRPWSTFVDQQR.3y8_1.heavy 616.999 / 980.48 31020.0 31.50749969482422 47 17 10 10 10 2.072960552370818 33.96054527880197 0.0 3 0.9717920839666834 7.330788152259165 31020.0 51.392236038664066 0.0 - - - - - - - 278.6666666666667 62 6 RABAC1 Rab acceptor 1 (prenylated) 1259 160 B20140407_SF105_01 B20140407_SF105_01 TB499235.[MT7]-ATIRPWSTFVDQQR.3y5_1.heavy 616.999 / 645.331 40143.0 31.50749969482422 47 17 10 10 10 2.072960552370818 33.96054527880197 0.0 3 0.9717920839666834 7.330788152259165 40143.0 42.05572187533237 0.0 - - - - - - - 912.0 80 1 RABAC1 Rab acceptor 1 (prenylated) 1261 161 B20140407_SF105_01 B20140407_SF105_01 TB150202.[MT7]-SFSWALAFC[CAM]K[MT7].2y4_1.heavy 752.897 / 669.351 19678.0 36.965301513671875 47 17 10 10 10 4.30895247208009 23.207496635888006 0.0 3 0.973951048177743 7.629919671676064 19678.0 17.44827060853825 2.0 - - - - - - - 190.33333333333334 39 3 FUT5;FUT6 fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1263 161 B20140407_SF105_01 B20140407_SF105_01 TB150202.[MT7]-SFSWALAFC[CAM]K[MT7].2y5_1.heavy 752.897 / 782.435 14687.0 36.965301513671875 47 17 10 10 10 4.30895247208009 23.207496635888006 0.0 3 0.973951048177743 7.629919671676064 14687.0 33.74782842449743 0.0 - - - - - - - 784.25 29 8 FUT5;FUT6 fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1265 161 B20140407_SF105_01 B20140407_SF105_01 TB150202.[MT7]-SFSWALAFC[CAM]K[MT7].2y3_1.heavy 752.897 / 598.314 18252.0 36.965301513671875 47 17 10 10 10 4.30895247208009 23.207496635888006 0.0 3 0.973951048177743 7.629919671676064 18252.0 19.97411906662459 0.0 - - - - - - - 399.4 36 5 FUT5;FUT6 fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1267 161 B20140407_SF105_01 B20140407_SF105_01 TB150202.[MT7]-SFSWALAFC[CAM]K[MT7].2y6_1.heavy 752.897 / 853.472 13689.0 36.965301513671875 47 17 10 10 10 4.30895247208009 23.207496635888006 0.0 3 0.973951048177743 7.629919671676064 13689.0 13.600137167558234 1.0 - - - - - - - 753.7142857142857 32 7 FUT5;FUT6 fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1269 162 B20140407_SF105_01 B20140407_SF105_01 TB499233.[MT7]-RLPTEAEWEYSC[CAM]R.3y6_1.heavy 614.297 / 900.367 101711.0 27.952199935913086 44 14 10 10 10 3.6561758635635275 27.350981936228315 0.0 3 0.9414664239438895 5.075961662651705 101711.0 141.4461439119163 0.0 - - - - - - - 740.1428571428571 203 7 SUMF1 sulfatase modifying factor 1 1271 162 B20140407_SF105_01 B20140407_SF105_01 TB499233.[MT7]-RLPTEAEWEYSC[CAM]R.3b5_1.heavy 614.297 / 741.438 52355.0 27.952199935913086 44 14 10 10 10 3.6561758635635275 27.350981936228315 0.0 3 0.9414664239438895 5.075961662651705 52355.0 44.759898125509366 0.0 - - - - - - - 1687.125 104 8 SUMF1 sulfatase modifying factor 1 1273 162 B20140407_SF105_01 B20140407_SF105_01 TB499233.[MT7]-RLPTEAEWEYSC[CAM]R.3y4_1.heavy 614.297 / 585.245 201649.0 27.952199935913086 44 14 10 10 10 3.6561758635635275 27.350981936228315 0.0 3 0.9414664239438895 5.075961662651705 201649.0 40.77550484091914 0.0 - - - - - - - 1636.0 403 1 SUMF1 sulfatase modifying factor 1 1275 162 B20140407_SF105_01 B20140407_SF105_01 TB499233.[MT7]-RLPTEAEWEYSC[CAM]R.3b7_1.heavy 614.297 / 941.517 83986.0 27.952199935913086 44 14 10 10 10 3.6561758635635275 27.350981936228315 0.0 3 0.9414664239438895 5.075961662651705 83986.0 82.27020429544265 0.0 - - - - - - - 249.83333333333334 167 6 SUMF1 sulfatase modifying factor 1 1277 163 B20140407_SF105_01 B20140407_SF105_01 TB149737.[MT7]-ADITGR.2b3_1.heavy 388.723 / 444.258 60227.0 19.990699768066406 47 17 10 10 10 5.0227896717369775 19.9092549231547 0.0 3 0.9751248100494385 7.808628648087316 60227.0 9.179259800458437 0.0 - - - - - - - 1677.0 120 2 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1279 163 B20140407_SF105_01 B20140407_SF105_01 TB149737.[MT7]-ADITGR.2y4_1.heavy 388.723 / 446.272 187992.0 19.990699768066406 47 17 10 10 10 5.0227896717369775 19.9092549231547 0.0 3 0.9751248100494385 7.808628648087316 187992.0 45.9966501307714 1.0 - - - - - - - 2012.0 375 1 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1281 163 B20140407_SF105_01 B20140407_SF105_01 TB149737.[MT7]-ADITGR.2y5_1.heavy 388.723 / 561.299 186316.0 19.990699768066406 47 17 10 10 10 5.0227896717369775 19.9092549231547 0.0 3 0.9751248100494385 7.808628648087316 186316.0 90.11845654820574 0.0 - - - - - - - 301.5 372 2 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1283 163 B20140407_SF105_01 B20140407_SF105_01 TB149737.[MT7]-ADITGR.2b5_1.heavy 388.723 / 602.327 41582.0 19.990699768066406 47 17 10 10 10 5.0227896717369775 19.9092549231547 0.0 3 0.9751248100494385 7.808628648087316 41582.0 26.75332471666943 0.0 - - - - - - - 939.0 83 1 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1285 164 B20140407_SF105_01 B20140407_SF105_01 TB361039.[MT7]-FFIDTSIILFLNK[MT7]K[MT7].4b4_1.heavy 533.578 / 667.357 18001.0 41.10240173339844 38 8 10 10 10 0.6895045905978002 84.62744198630946 0.0 3 0.7967332215927518 2.6895653137640614 18001.0 24.49523860547761 0.0 - - - - - - - 723.6666666666666 36 9 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1287 164 B20140407_SF105_01 B20140407_SF105_01 TB361039.[MT7]-FFIDTSIILFLNK[MT7]K[MT7].4y6_2.heavy 533.578 / 525.849 75777.0 41.10240173339844 38 8 10 10 10 0.6895045905978002 84.62744198630946 0.0 3 0.7967332215927518 2.6895653137640614 75777.0 92.3534882221295 0.0 - - - - - - - 300.0 151 2 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1289 164 B20140407_SF105_01 B20140407_SF105_01 TB361039.[MT7]-FFIDTSIILFLNK[MT7]K[MT7].4y7_2.heavy 533.578 / 582.391 44832.0 41.10240173339844 38 8 10 10 10 0.6895045905978002 84.62744198630946 0.0 3 0.7967332215927518 2.6895653137640614 44832.0 71.39583195691203 0.0 - - - - - - - 734.5714285714286 89 7 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1291 164 B20140407_SF105_01 B20140407_SF105_01 TB361039.[MT7]-FFIDTSIILFLNK[MT7]K[MT7].4b3_1.heavy 533.578 / 552.33 11829.0 41.10240173339844 38 8 10 10 10 0.6895045905978002 84.62744198630946 0.0 3 0.7967332215927518 2.6895653137640614 11829.0 16.564078886058176 0.0 - - - - - - - 771.3333333333334 23 9 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1293 165 B20140407_SF105_01 B20140407_SF105_01 TB360760.[MT7]-FLYC[CAM]YVPK[MT7].2b3_1.heavy 689.378 / 568.325 11093.0 33.432899475097656 47 17 10 10 10 6.603307553973647 15.14392585573625 0.0 3 0.9783585875440555 8.374004957021327 11093.0 6.322272540250645 0.0 - - - - - - - 770.0 22 3 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1295 165 B20140407_SF105_01 B20140407_SF105_01 TB360760.[MT7]-FLYC[CAM]YVPK[MT7].2y5_1.heavy 689.378 / 810.43 9244.0 33.432899475097656 47 17 10 10 10 6.603307553973647 15.14392585573625 0.0 3 0.9783585875440555 8.374004957021327 9244.0 10.319544100653847 0.0 - - - - - - - 1277.0 18 7 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1297 165 B20140407_SF105_01 B20140407_SF105_01 TB360760.[MT7]-FLYC[CAM]YVPK[MT7].2b4_1.heavy 689.378 / 728.356 6625.0 33.432899475097656 47 17 10 10 10 6.603307553973647 15.14392585573625 0.0 3 0.9783585875440555 8.374004957021327 6625.0 6.11171335145238 2.0 - - - - - - - 770.0 13 4 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1299 165 B20140407_SF105_01 B20140407_SF105_01 TB360760.[MT7]-FLYC[CAM]YVPK[MT7].2b5_1.heavy 689.378 / 891.419 6779.0 33.432899475097656 47 17 10 10 10 6.603307553973647 15.14392585573625 0.0 3 0.9783585875440555 8.374004957021327 6779.0 7.742401038286826 0.0 - - - - - - - 410.6666666666667 13 3 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1301 166 B20140407_SF105_01 B20140407_SF105_01 TB499248.[MT7]-DEVGAPGIVVGVSVDGK[MT7].3b4_1.heavy 629.354 / 545.269 25957.0 31.10650062561035 47 17 10 10 10 4.582239695145841 21.82338914001688 0.0 3 0.9708326994883514 7.208633759232996 25957.0 8.396715377478728 0.0 - - - - - - - 455.0 51 1 LACTB lactamase, beta 1303 166 B20140407_SF105_01 B20140407_SF105_01 TB499248.[MT7]-DEVGAPGIVVGVSVDGK[MT7].3b5_1.heavy 629.354 / 616.306 124017.0 31.10650062561035 47 17 10 10 10 4.582239695145841 21.82338914001688 0.0 3 0.9708326994883514 7.208633759232996 124017.0 35.473809488900294 0.0 - - - - - - - 1745.5 248 2 LACTB lactamase, beta 1305 166 B20140407_SF105_01 B20140407_SF105_01 TB499248.[MT7]-DEVGAPGIVVGVSVDGK[MT7].3b8_1.heavy 629.354 / 883.464 65120.0 31.10650062561035 47 17 10 10 10 4.582239695145841 21.82338914001688 0.0 3 0.9708326994883514 7.208633759232996 65120.0 31.529711129869185 0.0 - - - - - - - 1799.857142857143 130 7 LACTB lactamase, beta 1307 166 B20140407_SF105_01 B20140407_SF105_01 TB499248.[MT7]-DEVGAPGIVVGVSVDGK[MT7].3b7_1.heavy 629.354 / 770.38 72406.0 31.10650062561035 47 17 10 10 10 4.582239695145841 21.82338914001688 0.0 3 0.9708326994883514 7.208633759232996 72406.0 25.81135121447086 0.0 - - - - - - - 911.0 144 1 LACTB lactamase, beta 1309 167 B20140407_SF105_01 B20140407_SF105_01 TB360492.[MT7]-RTSQSAR.2y5_1.heavy 475.268 / 548.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEP68 centrosomal protein 68kDa 1311 167 B20140407_SF105_01 B20140407_SF105_01 TB360492.[MT7]-RTSQSAR.2b6_1.heavy 475.268 / 775.418 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEP68 centrosomal protein 68kDa 1313 167 B20140407_SF105_01 B20140407_SF105_01 TB360492.[MT7]-RTSQSAR.2y6_1.heavy 475.268 / 649.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEP68 centrosomal protein 68kDa 1315 167 B20140407_SF105_01 B20140407_SF105_01 TB360492.[MT7]-RTSQSAR.2b5_1.heavy 475.268 / 704.381 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEP68 centrosomal protein 68kDa 1317 168 B20140407_SF105_01 B20140407_SF105_01 TB149764.[MT7]-VDVYGR.2b3_1.heavy 426.738 / 458.273 75562.0 23.49090003967285 43 17 10 6 10 3.7165506944029048 20.635785192082274 0.0391998291015625 3 0.9751405609602626 7.811112372376921 75562.0 46.67901313169327 0.0 - - - - - - - 953.0 151 1 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1319 168 B20140407_SF105_01 B20140407_SF105_01 TB149764.[MT7]-VDVYGR.2y4_1.heavy 426.738 / 494.272 179900.0 23.49090003967285 43 17 10 6 10 3.7165506944029048 20.635785192082274 0.0391998291015625 3 0.9751405609602626 7.811112372376921 179900.0 77.42598744576863 1.0 - - - - - - - 1238.4 359 5 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1321 168 B20140407_SF105_01 B20140407_SF105_01 TB149764.[MT7]-VDVYGR.2y5_1.heavy 426.738 / 609.299 265563.0 23.49090003967285 43 17 10 6 10 3.7165506944029048 20.635785192082274 0.0391998291015625 3 0.9751405609602626 7.811112372376921 265563.0 63.44619960546916 1.0 - - - - - - - 476.0 531 1 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1323 168 B20140407_SF105_01 B20140407_SF105_01 TB149764.[MT7]-VDVYGR.2b4_1.heavy 426.738 / 621.336 31349.0 23.49090003967285 43 17 10 6 10 3.7165506944029048 20.635785192082274 0.0391998291015625 3 0.9751405609602626 7.811112372376921 31349.0 35.89337750289958 1.0 - - - - - - - 419.0 62 5 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1325 169 B20140407_SF105_01 B20140407_SF105_01 TB150432.[MT7]-VHTDFTPSPYDTDSLK[MT7].3y6_1.heavy 704.356 / 822.432 19549.0 28.192150115966797 43 18 10 5 10 3.1017825502440055 27.568371407952487 0.043701171875 3 0.9820928148992867 9.208703450097627 19549.0 32.63181390958157 0.0 - - - - - - - 614.1428571428571 39 7 SASH1;SAMSN1 SAM and SH3 domain containing 1;SAM domain, SH3 domain and nuclear localization signals 1 1327 169 B20140407_SF105_01 B20140407_SF105_01 TB150432.[MT7]-VHTDFTPSPYDTDSLK[MT7].3b4_1.heavy 704.356 / 597.311 23708.0 28.192150115966797 43 18 10 5 10 3.1017825502440055 27.568371407952487 0.043701171875 3 0.9820928148992867 9.208703450097627 23708.0 18.873014974506447 0.0 - - - - - - - 1643.857142857143 47 7 SASH1;SAMSN1 SAM and SH3 domain containing 1;SAM domain, SH3 domain and nuclear localization signals 1 1329 169 B20140407_SF105_01 B20140407_SF105_01 TB150432.[MT7]-VHTDFTPSPYDTDSLK[MT7].3y8_1.heavy 704.356 / 1082.55 13726.0 28.192150115966797 43 18 10 5 10 3.1017825502440055 27.568371407952487 0.043701171875 3 0.9820928148992867 9.208703450097627 13726.0 43.55365384615385 0.0 - - - - - - - 658.75 27 8 SASH1;SAMSN1 SAM and SH3 domain containing 1;SAM domain, SH3 domain and nuclear localization signals 1 1331 169 B20140407_SF105_01 B20140407_SF105_01 TB150432.[MT7]-VHTDFTPSPYDTDSLK[MT7].3y5_1.heavy 704.356 / 707.406 21351.0 28.192150115966797 43 18 10 5 10 3.1017825502440055 27.568371407952487 0.043701171875 3 0.9820928148992867 9.208703450097627 21351.0 40.38713827838828 0.0 - - - - - - - 814.75 42 8 SASH1;SAMSN1 SAM and SH3 domain containing 1;SAM domain, SH3 domain and nuclear localization signals 1 1333 170 B20140407_SF105_01 B20140407_SF105_01 TB149975.[MT7]-NLGELC[CAM]QR.2y4_1.heavy 567.296 / 576.292 32720.0 25.18199920654297 50 20 10 10 10 13.635342948195369 7.33388227783702 0.0 3 0.998840683890117 36.24261022059782 32720.0 33.00955699740774 0.0 - - - - - - - 300.6666666666667 65 3 RABAC1 Rab acceptor 1 (prenylated) 1335 170 B20140407_SF105_01 B20140407_SF105_01 TB149975.[MT7]-NLGELC[CAM]QR.2b4_1.heavy 567.296 / 558.3 N/A 25.18199920654297 50 20 10 10 10 13.635342948195369 7.33388227783702 0.0 3 0.998840683890117 36.24261022059782 59460.0 7.019542548111933 3.0 - - - - - - - 6995.0 135 1 RABAC1 Rab acceptor 1 (prenylated) 1337 170 B20140407_SF105_01 B20140407_SF105_01 TB149975.[MT7]-NLGELC[CAM]QR.2y6_1.heavy 567.296 / 762.356 67471.0 25.18199920654297 50 20 10 10 10 13.635342948195369 7.33388227783702 0.0 3 0.998840683890117 36.24261022059782 67471.0 74.26612851090024 0.0 - - - - - - - 394.5 134 2 RABAC1 Rab acceptor 1 (prenylated) 1339 170 B20140407_SF105_01 B20140407_SF105_01 TB149975.[MT7]-NLGELC[CAM]QR.2y7_1.heavy 567.296 / 875.44 61830.0 25.18199920654297 50 20 10 10 10 13.635342948195369 7.33388227783702 0.0 3 0.998840683890117 36.24261022059782 61830.0 95.17390393028775 0.0 - - - - - - - 1128.0 123 7 RABAC1 Rab acceptor 1 (prenylated) 1341 171 B20140407_SF105_01 B20140407_SF105_01 TB499107.[MT7]-GLITGWDDVER.2y4_1.heavy 702.866 / 518.257 66985.0 33.13859939575195 50 20 10 10 10 5.033474373640483 15.68044727908195 0.0 3 0.9927002458406219 14.435894897591822 66985.0 30.044141932785863 0.0 - - - - - - - 1802.0 133 1 ACTRT2 actin-related protein T2 1343 171 B20140407_SF105_01 B20140407_SF105_01 TB499107.[MT7]-GLITGWDDVER.2y8_1.heavy 702.866 / 977.432 127962.0 33.13859939575195 50 20 10 10 10 5.033474373640483 15.68044727908195 0.0 3 0.9927002458406219 14.435894897591822 127962.0 41.50081276013735 0.0 - - - - - - - 1652.0 255 2 ACTRT2 actin-related protein T2 1345 171 B20140407_SF105_01 B20140407_SF105_01 TB499107.[MT7]-GLITGWDDVER.2y9_1.heavy 702.866 / 1090.52 47009.0 33.13859939575195 50 20 10 10 10 5.033474373640483 15.68044727908195 0.0 3 0.9927002458406219 14.435894897591822 47009.0 30.374061643023147 0.0 - - - - - - - 300.0 94 1 ACTRT2 actin-related protein T2 1347 171 B20140407_SF105_01 B20140407_SF105_01 TB499107.[MT7]-GLITGWDDVER.2y7_1.heavy 702.866 / 876.385 85007.0 33.13859939575195 50 20 10 10 10 5.033474373640483 15.68044727908195 0.0 3 0.9927002458406219 14.435894897591822 85007.0 36.24102908028744 0.0 - - - - - - - 901.0 170 1 ACTRT2 actin-related protein T2 1349 172 B20140407_SF105_01 B20140407_SF105_01 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 592584.0 34.82640075683594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 592584.0 162.02806801253246 0.0 - - - - - - - 305.0 1185 1 1351 172 B20140407_SF105_01 B20140407_SF105_01 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 1105550.0 34.82640075683594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1105550.0 168.57749659845993 0.0 - - - - - - - 763.0 2211 1 1353 172 B20140407_SF105_01 B20140407_SF105_01 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 1152040.0 34.82640075683594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1152040.0 56.61290845298163 1.0 - - - - - - - 1373.0 2688 1 1355 173 B20140407_SF105_01 B20140407_SF105_01 TB498944.[MT7]-IVGEEVVR.2y4_1.heavy 522.812 / 502.298 47452.0 26.490100860595703 50 20 10 10 10 5.3636082166871395 18.644165636274888 0.0 3 0.9947804614304434 17.07486315565074 47452.0 20.592051097066097 0.0 - - - - - - - 1785.0 94 3 IGSF22 immunoglobulin superfamily, member 22 1357 173 B20140407_SF105_01 B20140407_SF105_01 TB498944.[MT7]-IVGEEVVR.2y6_1.heavy 522.812 / 688.362 176231.0 26.490100860595703 50 20 10 10 10 5.3636082166871395 18.644165636274888 0.0 3 0.9947804614304434 17.07486315565074 176231.0 153.81838232904238 0.0 - - - - - - - 498.0 352 1 IGSF22 immunoglobulin superfamily, member 22 1359 173 B20140407_SF105_01 B20140407_SF105_01 TB498944.[MT7]-IVGEEVVR.2b5_1.heavy 522.812 / 672.369 72734.0 26.490100860595703 50 20 10 10 10 5.3636082166871395 18.644165636274888 0.0 3 0.9947804614304434 17.07486315565074 72734.0 39.66356834049142 0.0 - - - - - - - 374.0 145 1 IGSF22 immunoglobulin superfamily, member 22 1361 173 B20140407_SF105_01 B20140407_SF105_01 TB498944.[MT7]-IVGEEVVR.2y7_1.heavy 522.812 / 787.431 357817.0 26.490100860595703 50 20 10 10 10 5.3636082166871395 18.644165636274888 0.0 3 0.9947804614304434 17.07486315565074 357817.0 307.2708362389925 0.0 - - - - - - - 809.5 715 4 IGSF22 immunoglobulin superfamily, member 22 1363 174 B20140407_SF105_01 B20140407_SF105_01 TB360757.[MT7]-VYNPYRFDPDNPQQR.3y7_1.heavy 685.005 / 854.411 134473.0 27.908899307250977 40 10 10 10 10 0.5309173425915271 84.57739664394883 0.0 3 0.8206343475751717 2.8693041881359918 134473.0 170.20166724771357 0.0 - - - - - - - 697.1 268 10 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1365 174 B20140407_SF105_01 B20140407_SF105_01 TB360757.[MT7]-VYNPYRFDPDNPQQR.3b3_1.heavy 685.005 / 521.284 38265.0 27.908899307250977 40 10 10 10 10 0.5309173425915271 84.57739664394883 0.0 3 0.8206343475751717 2.8693041881359918 38265.0 28.720473705795605 0.0 - - - - - - - 957.0 76 1 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1367 174 B20140407_SF105_01 B20140407_SF105_01 TB360757.[MT7]-VYNPYRFDPDNPQQR.3y5_1.heavy 685.005 / 642.332 81995.0 27.908899307250977 40 10 10 10 10 0.5309173425915271 84.57739664394883 0.0 3 0.8206343475751717 2.8693041881359918 81995.0 58.75737882499051 0.0 - - - - - - - 1367.0 163 5 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1369 174 B20140407_SF105_01 B20140407_SF105_01 TB360757.[MT7]-VYNPYRFDPDNPQQR.3b8_2.heavy 685.005 / 600.302 165494.0 27.908899307250977 40 10 10 10 10 0.5309173425915271 84.57739664394883 0.0 3 0.8206343475751717 2.8693041881359918 165494.0 74.30878343527822 0.0 - - - - - - - 957.0 330 1 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1371 175 B20140407_SF105_01 B20140407_SF105_01 TB499101.[MT7]-VLAGVLDSVDVR.2y5_1.heavy 693.907 / 575.315 92209.0 35.8577995300293 48 18 10 10 10 2.543219855119743 27.19061237884692 0.0 3 0.983624564687677 9.63100279305451 92209.0 53.271566885158705 0.0 - - - - - - - 373.0 184 2 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1373 175 B20140407_SF105_01 B20140407_SF105_01 TB499101.[MT7]-VLAGVLDSVDVR.2y9_1.heavy 693.907 / 959.516 95790.0 35.8577995300293 48 18 10 10 10 2.543219855119743 27.19061237884692 0.0 3 0.983624564687677 9.63100279305451 95790.0 66.2080317996071 0.0 - - - - - - - 398.0 191 3 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1375 175 B20140407_SF105_01 B20140407_SF105_01 TB499101.[MT7]-VLAGVLDSVDVR.2y10_1.heavy 693.907 / 1030.55 76841.0 35.8577995300293 48 18 10 10 10 2.543219855119743 27.19061237884692 0.0 3 0.983624564687677 9.63100279305451 76841.0 167.08520418782922 0.0 - - - - - - - 388.2 153 5 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1377 175 B20140407_SF105_01 B20140407_SF105_01 TB499101.[MT7]-VLAGVLDSVDVR.2y11_1.heavy 693.907 / 1143.64 85047.0 35.8577995300293 48 18 10 10 10 2.543219855119743 27.19061237884692 0.0 3 0.983624564687677 9.63100279305451 85047.0 251.9086786740558 0.0 - - - - - - - 298.3333333333333 170 6 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1379 176 B20140407_SF105_01 B20140407_SF105_01 TB360597.[MT7]-GILPC[CAM]LLR.2y5_1.heavy 543.335 / 658.37 121830.0 35.1067008972168 50 20 10 10 10 10.21465022707621 9.789860423700823 0.0 3 0.9966812806288574 21.416915491570496 121830.0 36.208308219409616 1.0 - - - - - - - 852.0 243 4 GRB7 growth factor receptor-bound protein 7 1381 176 B20140407_SF105_01 B20140407_SF105_01 TB360597.[MT7]-GILPC[CAM]LLR.2y6_1.heavy 543.335 / 771.455 40314.0 35.1067008972168 50 20 10 10 10 10.21465022707621 9.789860423700823 0.0 3 0.9966812806288574 21.416915491570496 40314.0 59.34642396714329 0.0 - - - - - - - 345.6666666666667 80 3 GRB7 growth factor receptor-bound protein 7 1383 176 B20140407_SF105_01 B20140407_SF105_01 TB360597.[MT7]-GILPC[CAM]LLR.2b5_1.heavy 543.335 / 685.382 12598.0 35.1067008972168 50 20 10 10 10 10.21465022707621 9.789860423700823 0.0 3 0.9966812806288574 21.416915491570496 12598.0 10.453679704514887 0.0 - - - - - - - 1249.142857142857 25 7 GRB7 growth factor receptor-bound protein 7 1385 176 B20140407_SF105_01 B20140407_SF105_01 TB360597.[MT7]-GILPC[CAM]LLR.2y7_1.heavy 543.335 / 884.539 24010.0 35.1067008972168 50 20 10 10 10 10.21465022707621 9.789860423700823 0.0 3 0.9966812806288574 21.416915491570496 24010.0 33.32673475992006 0.0 - - - - - - - 352.0 48 8 GRB7 growth factor receptor-bound protein 7 1387 177 B20140407_SF105_01 B20140407_SF105_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 747558.0 31.339500427246094 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 747558.0 461.0869306218582 0.0 - - - - - - - 456.0 1495 1 1389 177 B20140407_SF105_01 B20140407_SF105_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 118604.0 31.339500427246094 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 118604.0 120.31477884696456 1.0 - - - - - - - 1738.142857142857 350 7 1391 177 B20140407_SF105_01 B20140407_SF105_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 84695.0 31.339500427246094 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 84695.0 54.85364276551742 0.0 - - - - - - - 1064.0 169 1 1393 178 B20140407_SF105_01 B20140407_SF105_01 TB360750.[MT7]-LIGNMALLPIR.2b4_1.heavy 677.922 / 542.342 23715.0 37.82270050048828 50 20 10 10 10 6.324508010532403 15.811506576237525 0.0 3 0.9907120792150703 12.795769361103188 23715.0 30.540749630197105 0.0 - - - - - - - 872.5714285714286 47 7 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 1395 178 B20140407_SF105_01 B20140407_SF105_01 TB360750.[MT7]-LIGNMALLPIR.2y9_1.heavy 677.922 / 984.566 60005.0 37.82270050048828 50 20 10 10 10 6.324508010532403 15.811506576237525 0.0 3 0.9907120792150703 12.795769361103188 60005.0 169.55701423886734 0.0 - - - - - - - 299.4 120 10 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 1397 178 B20140407_SF105_01 B20140407_SF105_01 TB360750.[MT7]-LIGNMALLPIR.2y6_1.heavy 677.922 / 682.461 25032.0 37.82270050048828 50 20 10 10 10 6.324508010532403 15.811506576237525 0.0 3 0.9907120792150703 12.795769361103188 25032.0 30.087837607772457 0.0 - - - - - - - 772.9090909090909 50 11 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 1399 178 B20140407_SF105_01 B20140407_SF105_01 TB360750.[MT7]-LIGNMALLPIR.2y10_1.heavy 677.922 / 1097.65 54855.0 37.82270050048828 50 20 10 10 10 6.324508010532403 15.811506576237525 0.0 3 0.9907120792150703 12.795769361103188 54855.0 81.44322958235891 0.0 - - - - - - - 359.375 109 8 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 1401 179 B20140407_SF105_01 B20140407_SF105_01 TB360499.[MT7]-VEVEAIR.2y5_1.heavy 480.286 / 587.351 15016.0 26.048599243164062 34 18 0 10 6 2.810011102200946 35.587048009054065 0.0 5 0.9840289078687523 9.75248630771588 15016.0 4.363989846826674 1.0 - - - - - - - 1099.0 30 1 IGSF22 immunoglobulin superfamily, member 22 1403 179 B20140407_SF105_01 B20140407_SF105_01 TB360499.[MT7]-VEVEAIR.2b4_1.heavy 480.286 / 601.331 9767.0 26.048599243164062 34 18 0 10 6 2.810011102200946 35.587048009054065 0.0 5 0.9840289078687523 9.75248630771588 9767.0 6.580689806415771 2.0 - - - - - - - 1290.7142857142858 19 7 IGSF22 immunoglobulin superfamily, member 22 1405 179 B20140407_SF105_01 B20140407_SF105_01 TB360499.[MT7]-VEVEAIR.2y6_1.heavy 480.286 / 716.394 34794.0 26.048599243164062 34 18 0 10 6 2.810011102200946 35.587048009054065 0.0 5 0.9840289078687523 9.75248630771588 34794.0 29.06198530975523 1.0 - - - - - - - 366.0 256 1 IGSF22 immunoglobulin superfamily, member 22 1407 179 B20140407_SF105_01 B20140407_SF105_01 TB360499.[MT7]-VEVEAIR.2b5_1.heavy 480.286 / 672.369 13551.0 26.048599243164062 34 18 0 10 6 2.810011102200946 35.587048009054065 0.0 5 0.9840289078687523 9.75248630771588 13551.0 5.746330133579704 4.0 - - - - - - - 488.0 28 1 IGSF22 immunoglobulin superfamily, member 22 1409 180 B20140407_SF105_01 B20140407_SF105_01 TB499244.[MT7]-DTDIVDEAIYYFK[MT7].3y3_1.heavy 627.324 / 601.347 380548.0 39.811100006103516 43 13 10 10 10 1.5345364968316892 43.738660976030474 0.0 3 0.9297984503141775 4.630362524489643 380548.0 184.6959424436243 0.0 - - - - - - - 914.0 761 1 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 1411 180 B20140407_SF105_01 B20140407_SF105_01 TB499244.[MT7]-DTDIVDEAIYYFK[MT7].3b6_1.heavy 627.324 / 803.39 208319.0 39.811100006103516 43 13 10 10 10 1.5345364968316892 43.738660976030474 0.0 3 0.9297984503141775 4.630362524489643 208319.0 171.7121515804279 0.0 - - - - - - - 228.5 416 2 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 1413 180 B20140407_SF105_01 B20140407_SF105_01 TB499244.[MT7]-DTDIVDEAIYYFK[MT7].3b4_1.heavy 627.324 / 589.295 256173.0 39.811100006103516 43 13 10 10 10 1.5345364968316892 43.738660976030474 0.0 3 0.9297984503141775 4.630362524489643 256173.0 195.48703555855715 0.0 - - - - - - - 114.0 512 1 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 1415 180 B20140407_SF105_01 B20140407_SF105_01 TB499244.[MT7]-DTDIVDEAIYYFK[MT7].3y4_1.heavy 627.324 / 764.41 340917.0 39.811100006103516 43 13 10 10 10 1.5345364968316892 43.738660976030474 0.0 3 0.9297984503141775 4.630362524489643 340917.0 213.4650058895249 0.0 - - - - - - - 685.0 681 3 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 1417 181 B20140407_SF105_01 B20140407_SF105_01 TB361067.[MT7]-YILDFSLFAYPLPNVTK[MT7].3y7_1.heavy 763.764 / 912.563 75269.0 43.37900161743164 45 15 10 10 10 1.509593603460875 51.66012467671678 0.0 3 0.9546739011413767 5.774760649438447 75269.0 89.39553920247005 0.0 - - - - - - - 752.0 150 8 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1419 181 B20140407_SF105_01 B20140407_SF105_01 TB361067.[MT7]-YILDFSLFAYPLPNVTK[MT7].3b6_1.heavy 763.764 / 883.468 38379.0 43.37900161743164 45 15 10 10 10 1.509593603460875 51.66012467671678 0.0 3 0.9546739011413767 5.774760649438447 38379.0 106.9328802245789 0.0 - - - - - - - 706.6666666666666 76 9 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1421 181 B20140407_SF105_01 B20140407_SF105_01 TB361067.[MT7]-YILDFSLFAYPLPNVTK[MT7].3b3_1.heavy 763.764 / 534.341 14607.0 43.37900161743164 45 15 10 10 10 1.509593603460875 51.66012467671678 0.0 3 0.9546739011413767 5.774760649438447 14607.0 38.51318312559924 0.0 - - - - - - - 692.7272727272727 29 11 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1423 181 B20140407_SF105_01 B20140407_SF105_01 TB361067.[MT7]-YILDFSLFAYPLPNVTK[MT7].3y5_1.heavy 763.764 / 702.427 120637.0 43.37900161743164 45 15 10 10 10 1.509593603460875 51.66012467671678 0.0 3 0.9546739011413767 5.774760649438447 120637.0 134.71305543787162 0.0 - - - - - - - 1246.0 241 8 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1425 182 B20140407_SF105_01 B20140407_SF105_01 TB360481.[MT7]-LLYNLR.2b3_1.heavy 468.293 / 534.341 54668.0 31.42140007019043 50 20 10 10 10 58.870860906112405 1.698633219573272 0.0 3 0.9996005151481316 61.74442533308832 54668.0 60.57700567644277 1.0 - - - - - - - 402.6666666666667 120 3 C14orf148 chromosome 14 open reading frame 148 1427 182 B20140407_SF105_01 B20140407_SF105_01 TB360481.[MT7]-LLYNLR.2y4_1.heavy 468.293 / 565.309 152678.0 31.42140007019043 50 20 10 10 10 58.870860906112405 1.698633219573272 0.0 3 0.9996005151481316 61.74442533308832 152678.0 341.85234941658786 0.0 - - - - - - - 339.75 305 4 C14orf148 chromosome 14 open reading frame 148 1429 182 B20140407_SF105_01 B20140407_SF105_01 TB360481.[MT7]-LLYNLR.2y5_1.heavy 468.293 / 678.393 387057.0 31.42140007019043 50 20 10 10 10 58.870860906112405 1.698633219573272 0.0 3 0.9996005151481316 61.74442533308832 387057.0 307.0424400026871 0.0 - - - - - - - 604.0 774 2 C14orf148 chromosome 14 open reading frame 148 1431 182 B20140407_SF105_01 B20140407_SF105_01 TB360481.[MT7]-LLYNLR.2b4_1.heavy 468.293 / 648.384 113112.0 31.42140007019043 50 20 10 10 10 58.870860906112405 1.698633219573272 0.0 3 0.9996005151481316 61.74442533308832 113112.0 88.01761589403974 0.0 - - - - - - - 302.0 226 2 C14orf148 chromosome 14 open reading frame 148 1433 183 B20140407_SF105_01 B20140407_SF105_01 TB361053.[MT7]-ATSLPSIPNPFPELC[CAM]SPPSQSPILGGPSSAR.3y7_1.heavy 1102.57 / 631.316 10162.0 38.11874961853027 28 13 2 5 8 1.3376211758831469 53.21909534368068 0.046901702880859375 4 0.9242495416018012 4.455427167472249 10162.0 26.414287501480395 1.0 - - - - - - - 356.90909090909093 42 11 GRB7 growth factor receptor-bound protein 7 1435 183 B20140407_SF105_01 B20140407_SF105_01 TB361053.[MT7]-ATSLPSIPNPFPELC[CAM]SPPSQSPILGGPSSAR.3y11_1.heavy 1102.57 / 1041.57 4157.0 38.11874961853027 28 13 2 5 8 1.3376211758831469 53.21909534368068 0.046901702880859375 4 0.9242495416018012 4.455427167472249 4157.0 7.379104654202531 1.0 - - - - - - - 259.5833333333333 8 12 GRB7 growth factor receptor-bound protein 7 1437 183 B20140407_SF105_01 B20140407_SF105_01 TB361053.[MT7]-ATSLPSIPNPFPELC[CAM]SPPSQSPILGGPSSAR.3y10_1.heavy 1102.57 / 954.537 7044.0 38.11874961853027 28 13 2 5 8 1.3376211758831469 53.21909534368068 0.046901702880859375 4 0.9242495416018012 4.455427167472249 7044.0 21.416799837943685 0.0 - - - - - - - 282.1111111111111 14 9 GRB7 growth factor receptor-bound protein 7 1439 183 B20140407_SF105_01 B20140407_SF105_01 TB361053.[MT7]-ATSLPSIPNPFPELC[CAM]SPPSQSPILGGPSSAR.3b3_1.heavy 1102.57 / 404.226 6582.0 38.11874961853027 28 13 2 5 8 1.3376211758831469 53.21909534368068 0.046901702880859375 4 0.9242495416018012 4.455427167472249 6582.0 14.607859071621448 0.0 - - - - - - - 332.0 13 8 GRB7 growth factor receptor-bound protein 7 1441 184 B20140407_SF105_01 B20140407_SF105_01 TB361050.[MT7]-TNIQQAVAAAPWWLPVK[MT7].2b4_1.heavy 1091.12 / 601.343 21001.0 38.944000244140625 41 11 10 10 10 0.6827520128181964 74.95918091428888 0.0 3 0.8578093213683525 3.2332634321862974 21001.0 82.24452734055784 0.0 - - - - - - - 261.8333333333333 42 12 SUMF1 sulfatase modifying factor 1 1443 184 B20140407_SF105_01 B20140407_SF105_01 TB361050.[MT7]-TNIQQAVAAAPWWLPVK[MT7].2b6_1.heavy 1091.12 / 800.438 27279.0 38.944000244140625 41 11 10 10 10 0.6827520128181964 74.95918091428888 0.0 3 0.8578093213683525 3.2332634321862974 27279.0 120.71843445625949 0.0 - - - - - - - 258.38461538461536 54 13 SUMF1 sulfatase modifying factor 1 1445 184 B20140407_SF105_01 B20140407_SF105_01 TB361050.[MT7]-TNIQQAVAAAPWWLPVK[MT7].2b7_1.heavy 1091.12 / 899.507 26305.0 38.944000244140625 41 11 10 10 10 0.6827520128181964 74.95918091428888 0.0 3 0.8578093213683525 3.2332634321862974 26305.0 61.087190065018554 0.0 - - - - - - - 240.66666666666666 52 9 SUMF1 sulfatase modifying factor 1 1447 184 B20140407_SF105_01 B20140407_SF105_01 TB361050.[MT7]-TNIQQAVAAAPWWLPVK[MT7].2b10_1.heavy 1091.12 / 1112.62 30310.0 38.944000244140625 41 11 10 10 10 0.6827520128181964 74.95918091428888 0.0 3 0.8578093213683525 3.2332634321862974 30310.0 72.02060095884198 0.0 - - - - - - - 180.33333333333334 60 6 SUMF1 sulfatase modifying factor 1 1449 185 B20140407_SF105_01 B20140407_SF105_01 TB150422.[MT7]-C[CAM]YLDINALQELYQK[MT7].3b6_1.heavy 687.031 / 923.441 11743.0 36.965301513671875 43 13 10 10 10 2.165319677327555 46.18255726721162 0.0 3 0.9255567668190551 4.4948791781726305 11743.0 29.703917871292433 0.0 - - - - - - - 771.5454545454545 23 11 TTC39C tetratricopeptide repeat domain 39C 1451 185 B20140407_SF105_01 B20140407_SF105_01 TB150422.[MT7]-C[CAM]YLDINALQELYQK[MT7].3y3_1.heavy 687.031 / 582.337 34237.0 36.965301513671875 43 13 10 10 10 2.165319677327555 46.18255726721162 0.0 3 0.9255567668190551 4.4948791781726305 34237.0 37.513247783770375 0.0 - - - - - - - 283.0 68 1 TTC39C tetratricopeptide repeat domain 39C 1453 185 B20140407_SF105_01 B20140407_SF105_01 TB150422.[MT7]-C[CAM]YLDINALQELYQK[MT7].3b4_1.heavy 687.031 / 696.314 35935.0 36.965301513671875 43 13 10 10 10 2.165319677327555 46.18255726721162 0.0 3 0.9255567668190551 4.4948791781726305 35935.0 51.25993736771826 0.0 - - - - - - - 282.75 71 4 TTC39C tetratricopeptide repeat domain 39C 1455 185 B20140407_SF105_01 B20140407_SF105_01 TB150422.[MT7]-C[CAM]YLDINALQELYQK[MT7].3b7_1.heavy 687.031 / 994.478 12591.0 36.965301513671875 43 13 10 10 10 2.165319677327555 46.18255726721162 0.0 3 0.9255567668190551 4.4948791781726305 12591.0 13.897473043007913 1.0 - - - - - - - 302.85714285714283 26 7 TTC39C tetratricopeptide repeat domain 39C 1457 186 B20140407_SF105_01 B20140407_SF105_01 TB149983.[MT7]-QDGEAPARR.3y7_2.heavy 381.871 / 378.709 15909.0 16.29520034790039 41 11 10 10 10 1.6443277490016721 52.94660657400402 0.0 3 0.8795418141700427 3.5195333100868886 15909.0 23.35949579682297 0.0 - - - - - - - 737.3333333333334 31 9 SUMF1 sulfatase modifying factor 1 1459 186 B20140407_SF105_01 B20140407_SF105_01 TB149983.[MT7]-QDGEAPARR.3b5_1.heavy 381.871 / 645.296 4112.0 16.29520034790039 41 11 10 10 10 1.6443277490016721 52.94660657400402 0.0 3 0.8795418141700427 3.5195333100868886 4112.0 8.968881492927611 0.0 - - - - - - - 164.8 8 15 SUMF1 sulfatase modifying factor 1 1461 186 B20140407_SF105_01 B20140407_SF105_01 TB149983.[MT7]-QDGEAPARR.3y4_1.heavy 381.871 / 499.31 5348.0 16.29520034790039 41 11 10 10 10 1.6443277490016721 52.94660657400402 0.0 3 0.8795418141700427 3.5195333100868886 5348.0 9.824634849195801 0.0 - - - - - - - 746.3333333333334 10 9 SUMF1 sulfatase modifying factor 1 1463 186 B20140407_SF105_01 B20140407_SF105_01 TB149983.[MT7]-QDGEAPARR.3b3_1.heavy 381.871 / 445.216 5133.0 16.29520034790039 41 11 10 10 10 1.6443277490016721 52.94660657400402 0.0 3 0.8795418141700427 3.5195333100868886 5133.0 12.245422792439047 1.0 - - - - - - - 683.7777777777778 10 9 SUMF1 sulfatase modifying factor 1 1465 187 B20140407_SF105_01 B20140407_SF105_01 TB150427.[MT7]-RLQQELMTLMMSGDK[MT7].3y6_1.heavy 690.365 / 812.376 4103.0 36.91960144042969 40 10 10 10 10 2.8034233375184856 35.67067401547612 0.0 3 0.8222375720539347 2.8826264820263354 4103.0 3.624878588862232 1.0 - - - - - - - 828.4285714285714 8 7 UBE2C ubiquitin-conjugating enzyme E2C 1467 187 B20140407_SF105_01 B20140407_SF105_01 TB150427.[MT7]-RLQQELMTLMMSGDK[MT7].3b5_1.heavy 690.365 / 799.454 1415.0 36.91960144042969 40 10 10 10 10 2.8034233375184856 35.67067401547612 0.0 3 0.8222375720539347 2.8826264820263354 1415.0 0.7000000000000001 14.0 - - - - - - - 282.8 3 5 UBE2C ubiquitin-conjugating enzyme E2C 1469 187 B20140407_SF105_01 B20140407_SF105_01 TB150427.[MT7]-RLQQELMTLMMSGDK[MT7].3y4_1.heavy 690.365 / 550.295 11601.0 36.91960144042969 40 10 10 10 10 2.8034233375184856 35.67067401547612 0.0 3 0.8222375720539347 2.8826264820263354 11601.0 11.709506572074812 0.0 - - - - - - - 235.33333333333334 23 3 UBE2C ubiquitin-conjugating enzyme E2C 1471 187 B20140407_SF105_01 B20140407_SF105_01 TB150427.[MT7]-RLQQELMTLMMSGDK[MT7].3y5_1.heavy 690.365 / 681.336 8347.0 36.91960144042969 40 10 10 10 10 2.8034233375184856 35.67067401547612 0.0 3 0.8222375720539347 2.8826264820263354 8347.0 3.2164213189215416 0.0 - - - - - - - 707.0 16 1 UBE2C ubiquitin-conjugating enzyme E2C 1473 188 B20140407_SF105_01 B20140407_SF105_01 TB149852.[MT7]-QLAHSK[MT7].2b3_1.heavy 486.297 / 457.289 9995.0 17.86520004272461 44 14 10 10 10 2.5615972969377765 31.06839604871845 0.0 3 0.9377794741954673 4.9217274351041995 9995.0 8.106901497456345 0.0 - - - - - - - 1271.2222222222222 19 9 SUMF1 sulfatase modifying factor 1 1475 188 B20140407_SF105_01 B20140407_SF105_01 TB149852.[MT7]-QLAHSK[MT7].2y4_1.heavy 486.297 / 586.343 9545.0 17.86520004272461 44 14 10 10 10 2.5615972969377765 31.06839604871845 0.0 3 0.9377794741954673 4.9217274351041995 9545.0 32.105909090909094 0.0 - - - - - - - 266.6666666666667 19 18 SUMF1 sulfatase modifying factor 1 1477 188 B20140407_SF105_01 B20140407_SF105_01 TB149852.[MT7]-QLAHSK[MT7].2y5_1.heavy 486.297 / 699.427 15742.0 17.86520004272461 44 14 10 10 10 2.5615972969377765 31.06839604871845 0.0 3 0.9377794741954673 4.9217274351041995 15742.0 33.054262531265636 0.0 - - - - - - - 270.8333333333333 31 12 SUMF1 sulfatase modifying factor 1 1479 188 B20140407_SF105_01 B20140407_SF105_01 TB149852.[MT7]-QLAHSK[MT7].2y3_1.heavy 486.297 / 515.306 11944.0 17.86520004272461 44 14 10 10 10 2.5615972969377765 31.06839604871845 0.0 3 0.9377794741954673 4.9217274351041995 11944.0 33.2436135770235 0.0 - - - - - - - 240.625 23 16 SUMF1 sulfatase modifying factor 1 1481 189 B20140407_SF105_01 B20140407_SF105_01 TB360946.[MT7]-DAEAEGLSGTTLLPK[MT7].3y3_1.heavy 597.331 / 501.352 242682.0 30.76020050048828 39 14 10 5 10 1.9655048014153493 40.524456965226335 0.042400360107421875 3 0.9339276632330535 4.774542834941495 242682.0 102.4921036176685 0.0 - - - - - - - 1825.0 485 1 RABAC1 Rab acceptor 1 (prenylated) 1483 189 B20140407_SF105_01 B20140407_SF105_01 TB360946.[MT7]-DAEAEGLSGTTLLPK[MT7].3b6_1.heavy 597.331 / 717.317 308675.0 30.76020050048828 39 14 10 5 10 1.9655048014153493 40.524456965226335 0.042400360107421875 3 0.9339276632330535 4.774542834941495 308675.0 123.27436696434 0.0 - - - - - - - 1064.0 617 1 RABAC1 Rab acceptor 1 (prenylated) 1485 189 B20140407_SF105_01 B20140407_SF105_01 TB360946.[MT7]-DAEAEGLSGTTLLPK[MT7].3b4_1.heavy 597.331 / 531.253 96708.0 30.76020050048828 39 14 10 5 10 1.9655048014153493 40.524456965226335 0.042400360107421875 3 0.9339276632330535 4.774542834941495 96708.0 66.96658576684578 0.0 - - - - - - - 760.0 193 1 RABAC1 Rab acceptor 1 (prenylated) 1487 189 B20140407_SF105_01 B20140407_SF105_01 TB360946.[MT7]-DAEAEGLSGTTLLPK[MT7].3b5_1.heavy 597.331 / 660.296 118452.0 30.76020050048828 39 14 10 5 10 1.9655048014153493 40.524456965226335 0.042400360107421875 3 0.9339276632330535 4.774542834941495 118452.0 64.89844715959518 0.0 - - - - - - - 1571.6666666666667 236 3 RABAC1 Rab acceptor 1 (prenylated) 1489 190 B20140407_SF105_01 B20140407_SF105_01 TB499119.[MT7]-WQC[CAM]NRPSAK[MT7].3y7_1.heavy 478.922 / 976.511 N/A 21.38990020751953 42 12 10 10 10 1.4710832505303184 41.02353591861 0.0 3 0.8916286996486992 3.7145208613074465 460.0 8.005194805194805 0.0 - - - - - - - 0.0 0 0 EFNA1 ephrin-A1 1491 190 B20140407_SF105_01 B20140407_SF105_01 TB499119.[MT7]-WQC[CAM]NRPSAK[MT7].3y8_2.heavy 478.922 / 552.789 89210.0 21.38990020751953 42 12 10 10 10 1.4710832505303184 41.02353591861 0.0 3 0.8916286996486992 3.7145208613074465 89210.0 38.009984101748806 0.0 - - - - - - - 843.8 178 5 EFNA1 ephrin-A1 1493 190 B20140407_SF105_01 B20140407_SF105_01 TB499119.[MT7]-WQC[CAM]NRPSAK[MT7].3b4_1.heavy 478.922 / 733.321 9665.0 21.38990020751953 42 12 10 10 10 1.4710832505303184 41.02353591861 0.0 3 0.8916286996486992 3.7145208613074465 9665.0 30.734231257617772 0.0 - - - - - - - 655.5454545454545 19 11 EFNA1 ephrin-A1 1495 190 B20140407_SF105_01 B20140407_SF105_01 TB499119.[MT7]-WQC[CAM]NRPSAK[MT7].3y4_1.heavy 478.922 / 546.337 83151.0 21.38990020751953 42 12 10 10 10 1.4710832505303184 41.02353591861 0.0 3 0.8916286996486992 3.7145208613074465 83151.0 27.691053324074872 0.0 - - - - - - - 920.0 166 2 EFNA1 ephrin-A1 1497 191 B20140407_SF105_01 B20140407_SF105_01 TB360949.[MT7]-EYEDLLDYTYPLRPGPQLPK[MT7].3b4_1.heavy 899.146 / 681.285 22980.0 35.47800064086914 47 17 10 10 10 3.3220500227656173 24.906942443735623 0.0 3 0.9702442056363596 7.1366397388984355 22980.0 55.984039289647704 0.0 - - - - - - - 727.4285714285714 45 7 CEP68 centrosomal protein 68kDa 1499 191 B20140407_SF105_01 B20140407_SF105_01 TB360949.[MT7]-EYEDLLDYTYPLRPGPQLPK[MT7].3b5_1.heavy 899.146 / 794.369 10763.0 35.47800064086914 47 17 10 10 10 3.3220500227656173 24.906942443735623 0.0 3 0.9702442056363596 7.1366397388984355 10763.0 30.412163814007574 0.0 - - - - - - - 672.75 21 8 CEP68 centrosomal protein 68kDa 1501 191 B20140407_SF105_01 B20140407_SF105_01 TB360949.[MT7]-EYEDLLDYTYPLRPGPQLPK[MT7].3b3_1.heavy 899.146 / 566.258 11636.0 35.47800064086914 47 17 10 10 10 3.3220500227656173 24.906942443735623 0.0 3 0.9702442056363596 7.1366397388984355 11636.0 45.28443298969072 0.0 - - - - - - - 203.4 23 5 CEP68 centrosomal protein 68kDa 1503 191 B20140407_SF105_01 B20140407_SF105_01 TB360949.[MT7]-EYEDLLDYTYPLRPGPQLPK[MT7].3y10_1.heavy 899.146 / 1246.78 3927.0 35.47800064086914 47 17 10 10 10 3.3220500227656173 24.906942443735623 0.0 3 0.9702442056363596 7.1366397388984355 3927.0 16.10384879725086 0.0 - - - - - - - 193.66666666666666 7 9 CEP68 centrosomal protein 68kDa 1505 192 B20140407_SF105_01 B20140407_SF105_01 TB149855.[MT7]-ELLDPSR.2b3_1.heavy 487.275 / 500.32 29628.0 26.138900756835938 46 16 10 10 10 3.9676924242997416 25.20356653342377 0.0 3 0.9631700539726024 6.4109120038076295 29628.0 24.224960016792885 0.0 - - - - - - - 729.0 59 1 CATSPER2 cation channel, sperm associated 2 1507 192 B20140407_SF105_01 B20140407_SF105_01 TB149855.[MT7]-ELLDPSR.2y5_1.heavy 487.275 / 587.315 17850.0 26.138900756835938 46 16 10 10 10 3.9676924242997416 25.20356653342377 0.0 3 0.9631700539726024 6.4109120038076295 17850.0 5.692435295119881 5.0 - - - - - - - 486.0 87 1 CATSPER2 cation channel, sperm associated 2 1509 192 B20140407_SF105_01 B20140407_SF105_01 TB149855.[MT7]-ELLDPSR.2b4_1.heavy 487.275 / 615.347 322022.0 26.138900756835938 46 16 10 10 10 3.9676924242997416 25.20356653342377 0.0 3 0.9631700539726024 6.4109120038076295 322022.0 150.41858566479232 0.0 - - - - - - - 1943.0 644 1 CATSPER2 cation channel, sperm associated 2 1511 192 B20140407_SF105_01 B20140407_SF105_01 TB149855.[MT7]-ELLDPSR.2y6_1.heavy 487.275 / 700.399 50028.0 26.138900756835938 46 16 10 10 10 3.9676924242997416 25.20356653342377 0.0 3 0.9631700539726024 6.4109120038076295 50028.0 17.37463705677393 1.0 - - - - - - - 1153.5 100 2 CATSPER2 cation channel, sperm associated 2 1513 193 B20140407_SF105_01 B20140407_SF105_01 TB499114.[MT7]-IMFVDPSLTVR.2b3_1.heavy 711.401 / 536.302 59000.0 35.8577995300293 42 12 10 10 10 1.780025808246892 56.17896074129835 0.0 3 0.898035491696718 3.8315689724204387 59000.0 66.35182486905357 0.0 - - - - - - - 446.0 118 2 AGR2;AGR3 anterior gradient homolog 2 (Xenopus laevis);anterior gradient homolog 3 (Xenopus laevis) 1515 193 B20140407_SF105_01 B20140407_SF105_01 TB499114.[MT7]-IMFVDPSLTVR.2y6_1.heavy 711.401 / 672.404 222478.0 35.8577995300293 42 12 10 10 10 1.780025808246892 56.17896074129835 0.0 3 0.898035491696718 3.8315689724204387 222478.0 168.0087947371731 0.0 - - - - - - - 892.0 444 1 AGR2;AGR3 anterior gradient homolog 2 (Xenopus laevis);anterior gradient homolog 3 (Xenopus laevis) 1517 193 B20140407_SF105_01 B20140407_SF105_01 TB499114.[MT7]-IMFVDPSLTVR.2y10_1.heavy 711.401 / 1164.61 48003.0 35.8577995300293 42 12 10 10 10 1.780025808246892 56.17896074129835 0.0 3 0.898035491696718 3.8315689724204387 48003.0 147.45316143497757 0.0 - - - - - - - 297.3333333333333 96 6 AGR2;AGR3 anterior gradient homolog 2 (Xenopus laevis);anterior gradient homolog 3 (Xenopus laevis) 1519 193 B20140407_SF105_01 B20140407_SF105_01 TB499114.[MT7]-IMFVDPSLTVR.2b5_1.heavy 711.401 / 750.398 138659.0 35.8577995300293 42 12 10 10 10 1.780025808246892 56.17896074129835 0.0 3 0.898035491696718 3.8315689724204387 138659.0 75.0884390011941 0.0 - - - - - - - 446.0 277 1 AGR2;AGR3 anterior gradient homolog 2 (Xenopus laevis);anterior gradient homolog 3 (Xenopus laevis) 1521 194 B20140407_SF105_01 B20140407_SF105_01 TB498838.[MT7]-GEAGPK[MT7].2y4_1.heavy 423.75 / 516.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - COL5A2;SFTPD collagen, type V, alpha 2;surfactant protein D 1523 194 B20140407_SF105_01 B20140407_SF105_01 TB498838.[MT7]-GEAGPK[MT7].2y5_1.heavy 423.75 / 645.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - COL5A2;SFTPD collagen, type V, alpha 2;surfactant protein D 1525 194 B20140407_SF105_01 B20140407_SF105_01 TB498838.[MT7]-GEAGPK[MT7].2b4_1.heavy 423.75 / 459.232 N/A N/A - - - - - - - - - 0.0 - - - - - - - COL5A2;SFTPD collagen, type V, alpha 2;surfactant protein D 1527 194 B20140407_SF105_01 B20140407_SF105_01 TB498838.[MT7]-GEAGPK[MT7].2y3_1.heavy 423.75 / 445.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - COL5A2;SFTPD collagen, type V, alpha 2;surfactant protein D 1529 195 B20140407_SF105_01 B20140407_SF105_01 TB498839.[MT7]-QETGLR.2y4_1.heavy 424.241 / 446.272 51416.0 19.409000396728516 46 16 10 10 10 2.2984468768162207 29.858957081222048 0.0 3 0.9669161070232968 6.7662710439935125 51416.0 33.19241997351371 0.0 - - - - - - - 1705.2857142857142 102 7 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 1531 195 B20140407_SF105_01 B20140407_SF105_01 TB498839.[MT7]-QETGLR.2y5_1.heavy 424.241 / 575.315 78691.0 19.409000396728516 46 16 10 10 10 2.2984468768162207 29.858957081222048 0.0 3 0.9669161070232968 6.7662710439935125 78691.0 40.2679953653217 0.0 - - - - - - - 1200.5714285714287 157 7 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 1533 195 B20140407_SF105_01 B20140407_SF105_01 TB498839.[MT7]-QETGLR.2b4_1.heavy 424.241 / 560.28 52283.0 19.409000396728516 46 16 10 10 10 2.2984468768162207 29.858957081222048 0.0 3 0.9669161070232968 6.7662710439935125 52283.0 34.4998800239952 0.0 - - - - - - - 311.3333333333333 104 3 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 1535 195 B20140407_SF105_01 B20140407_SF105_01 TB498839.[MT7]-QETGLR.2b5_1.heavy 424.241 / 673.364 35878.0 19.409000396728516 46 16 10 10 10 2.2984468768162207 29.858957081222048 0.0 3 0.9669161070232968 6.7662710439935125 35878.0 43.19658763500571 0.0 - - - - - - - 1213.6 71 10 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 1537 196 B20140407_SF105_01 B20140407_SF105_01 TB499112.[MT7]-RQDSQNENER.3y7_1.heavy 473.895 / 876.381 6358.0 15.197099685668945 44 14 10 10 10 9.792941941267957 10.211436011745857 0.0 3 0.94666596406695 5.319989389789442 6358.0 172.27259806820422 0.0 - - - - - - - 155.72727272727272 12 11 GCET2 germinal center expressed transcript 2 1539 196 B20140407_SF105_01 B20140407_SF105_01 TB499112.[MT7]-RQDSQNENER.3y4_1.heavy 473.895 / 547.247 6244.0 15.197099685668945 44 14 10 10 10 9.792941941267957 10.211436011745857 0.0 3 0.94666596406695 5.319989389789442 6244.0 25.560233918128652 0.0 - - - - - - - 144.25 12 12 GCET2 germinal center expressed transcript 2 1541 196 B20140407_SF105_01 B20140407_SF105_01 TB499112.[MT7]-RQDSQNENER.3b3_1.heavy 473.895 / 544.296 2608.0 15.197099685668945 44 14 10 10 10 9.792941941267957 10.211436011745857 0.0 3 0.94666596406695 5.319989389789442 2608.0 -0.5 1.0 - - - - - - - 137.95 5 20 GCET2 germinal center expressed transcript 2 1543 196 B20140407_SF105_01 B20140407_SF105_01 TB499112.[MT7]-RQDSQNENER.3y5_1.heavy 473.895 / 661.29 11460.0 15.197099685668945 44 14 10 10 10 9.792941941267957 10.211436011745857 0.0 3 0.94666596406695 5.319989389789442 11460.0 620.6188046387155 0.0 - - - - - - - 156.69230769230768 22 13 GCET2 germinal center expressed transcript 2 1545 197 B20140407_SF105_01 B20140407_SF105_01 TB499110.[MT7]-EAAWAITNATSGGTPEQIR.3b4_1.heavy 706.363 / 602.305 73081.0 30.82309913635254 50 20 10 10 10 8.032012483748327 12.45017985247611 0.0 3 0.9908933736389062 12.922706455555138 73081.0 20.49136991407407 0.0 - - - - - - - 606.0 146 1 KPNA6;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 5 (importin alpha 6) 1547 197 B20140407_SF105_01 B20140407_SF105_01 TB499110.[MT7]-EAAWAITNATSGGTPEQIR.3b5_1.heavy 706.363 / 673.343 227887.0 30.82309913635254 50 20 10 10 10 8.032012483748327 12.45017985247611 0.0 3 0.9908933736389062 12.922706455555138 227887.0 39.72174471839594 0.0 - - - - - - - 1668.0 455 1 KPNA6;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 5 (importin alpha 6) 1549 197 B20140407_SF105_01 B20140407_SF105_01 TB499110.[MT7]-EAAWAITNATSGGTPEQIR.3y5_1.heavy 706.363 / 642.357 111593.0 30.82309913635254 50 20 10 10 10 8.032012483748327 12.45017985247611 0.0 3 0.9908933736389062 12.922706455555138 111593.0 27.97402270883941 0.0 - - - - - - - 1667.75 223 4 KPNA6;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 5 (importin alpha 6) 1551 197 B20140407_SF105_01 B20140407_SF105_01 TB499110.[MT7]-EAAWAITNATSGGTPEQIR.3y9_1.heavy 706.363 / 944.48 83088.0 30.82309913635254 50 20 10 10 10 8.032012483748327 12.45017985247611 0.0 3 0.9908933736389062 12.922706455555138 83088.0 27.537072448904844 0.0 - - - - - - - 303.0 166 1 KPNA6;KPNA5 karyopherin alpha 6 (importin alpha 7);karyopherin alpha 5 (importin alpha 6) 1553 198 B20140407_SF105_01 B20140407_SF105_01 TB149988.[MT7]-RPTC[CAM]TESR.3y7_1.heavy 384.197 / 850.372 N/A 16.636199951171875 47 17 10 10 10 4.171972362884971 23.969478055422385 0.0 3 0.9757457379082415 7.908363374506773 30.0 1.4918032786885247 3.0 - - - - - - - 0.0 0 0 CEP68 centrosomal protein 68kDa 1555 198 B20140407_SF105_01 B20140407_SF105_01 TB149988.[MT7]-RPTC[CAM]TESR.3y3_1.heavy 384.197 / 391.194 11061.0 16.636199951171875 47 17 10 10 10 4.171972362884971 23.969478055422385 0.0 3 0.9757457379082415 7.908363374506773 11061.0 23.728264466769954 0.0 - - - - - - - 301.0 22 8 CEP68 centrosomal protein 68kDa 1557 198 B20140407_SF105_01 B20140407_SF105_01 TB149988.[MT7]-RPTC[CAM]TESR.3y5_1.heavy 384.197 / 652.272 6765.0 16.636199951171875 47 17 10 10 10 4.171972362884971 23.969478055422385 0.0 3 0.9757457379082415 7.908363374506773 6765.0 61.3519542709232 0.0 - - - - - - - 167.55555555555554 13 18 CEP68 centrosomal protein 68kDa 1559 198 B20140407_SF105_01 B20140407_SF105_01 TB149988.[MT7]-RPTC[CAM]TESR.3y4_1.heavy 384.197 / 492.241 18191.0 16.636199951171875 47 17 10 10 10 4.171972362884971 23.969478055422385 0.0 3 0.9757457379082415 7.908363374506773 18191.0 100.61454874243437 0.0 - - - - - - - 628.25 36 8 CEP68 centrosomal protein 68kDa 1561 199 B20140407_SF105_01 B20140407_SF105_01 TB149989.[MT7]-VAC[CAM]SNWK[MT7].2y4_1.heavy 576.807 / 678.369 11383.0 24.49020004272461 46 20 8 10 8 55.55337282391283 1.8000707232838833 0.0 4 0.9995005758680957 55.221669404364015 11383.0 19.97445491106317 0.0 - - - - - - - 767.1428571428571 22 7 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1563 199 B20140407_SF105_01 B20140407_SF105_01 TB149989.[MT7]-VAC[CAM]SNWK[MT7].2y5_1.heavy 576.807 / 838.4 9128.0 24.49020004272461 46 20 8 10 8 55.55337282391283 1.8000707232838833 0.0 4 0.9995005758680957 55.221669404364015 9128.0 16.334798313726196 0.0 - - - - - - - 632.3333333333334 18 9 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1565 199 B20140407_SF105_01 B20140407_SF105_01 TB149989.[MT7]-VAC[CAM]SNWK[MT7].2y3_1.heavy 576.807 / 591.337 6336.0 24.49020004272461 46 20 8 10 8 55.55337282391283 1.8000707232838833 0.0 4 0.9995005758680957 55.221669404364015 6336.0 7.306686302444334 0.0 - - - - - - - 835.1111111111111 12 9 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1567 199 B20140407_SF105_01 B20140407_SF105_01 TB149989.[MT7]-VAC[CAM]SNWK[MT7].2y6_1.heavy 576.807 / 909.437 26739.0 24.49020004272461 46 20 8 10 8 55.55337282391283 1.8000707232838833 0.0 4 0.9995005758680957 55.221669404364015 26739.0 75.87941844811102 2.0 - - - - - - - 740.9 72 10 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1569 200 B20140407_SF105_01 B20140407_SF105_01 TB498831.[MT7]-AQSYGR.2b3_1.heavy 413.22 / 431.237 3282.0 17.9773006439209 40 18 6 10 6 4.885169214397261 20.47011999201304 0.0 5 0.9842597818896882 9.823939703274066 3282.0 5.071452114696579 2.0 - - - - - - - 681.3571428571429 11 14 CEP68 centrosomal protein 68kDa 1571 200 B20140407_SF105_01 B20140407_SF105_01 TB498831.[MT7]-AQSYGR.2y4_1.heavy 413.22 / 482.236 5847.0 17.9773006439209 40 18 6 10 6 4.885169214397261 20.47011999201304 0.0 5 0.9842597818896882 9.823939703274066 5847.0 8.109355191385772 1.0 - - - - - - - 1219.6666666666667 11 9 CEP68 centrosomal protein 68kDa 1573 200 B20140407_SF105_01 B20140407_SF105_01 TB498831.[MT7]-AQSYGR.2y5_1.heavy 413.22 / 610.294 10668.0 17.9773006439209 40 18 6 10 6 4.885169214397261 20.47011999201304 0.0 5 0.9842597818896882 9.823939703274066 10668.0 7.559699845400494 1.0 - - - - - - - 718.0 32 10 CEP68 centrosomal protein 68kDa 1575 200 B20140407_SF105_01 B20140407_SF105_01 TB498831.[MT7]-AQSYGR.2b5_1.heavy 413.22 / 651.322 4359.0 17.9773006439209 40 18 6 10 6 4.885169214397261 20.47011999201304 0.0 5 0.9842597818896882 9.823939703274066 4359.0 6.688005169101432 1.0 - - - - - - - 659.4285714285714 16 7 CEP68 centrosomal protein 68kDa 1577 201 B20140407_SF105_01 B20140407_SF105_01 TB498937.[MT7]-LFDVGGQR.2b4_1.heavy 518.289 / 619.357 50177.0 29.900699615478516 50 20 10 10 10 4.434903779988852 22.54840351919684 0.0 3 0.9953772556530203 18.144499246304306 50177.0 29.049843058300723 0.0 - - - - - - - 744.5 100 2 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1579 201 B20140407_SF105_01 B20140407_SF105_01 TB498937.[MT7]-LFDVGGQR.2y6_1.heavy 518.289 / 631.316 97376.0 29.900699615478516 50 20 10 10 10 4.434903779988852 22.54840351919684 0.0 3 0.9953772556530203 18.144499246304306 97376.0 82.6290335311127 0.0 - - - - - - - 893.0 194 1 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1581 201 B20140407_SF105_01 B20140407_SF105_01 TB498937.[MT7]-LFDVGGQR.2b5_1.heavy 518.289 / 676.379 23376.0 29.900699615478516 50 20 10 10 10 4.434903779988852 22.54840351919684 0.0 3 0.9953772556530203 18.144499246304306 23376.0 18.695379104888843 0.0 - - - - - - - 298.0 46 3 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1583 201 B20140407_SF105_01 B20140407_SF105_01 TB498937.[MT7]-LFDVGGQR.2y7_1.heavy 518.289 / 778.384 298977.0 29.900699615478516 50 20 10 10 10 4.434903779988852 22.54840351919684 0.0 3 0.9953772556530203 18.144499246304306 298977.0 269.63621057983215 0.0 - - - - - - - 744.3333333333334 597 3 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1585 202 B20140407_SF105_01 B20140407_SF105_01 TB498938.[MT7]-AYLQQLR.2y4_1.heavy 518.307 / 544.32 114961.0 27.66119956970215 50 20 10 10 10 28.95338698765129 3.4538273550742202 0.0 3 0.9980505931804476 27.947344772730705 114961.0 79.62985173333334 0.0 - - - - - - - 408.0 229 1 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 1587 202 B20140407_SF105_01 B20140407_SF105_01 TB498938.[MT7]-AYLQQLR.2y5_1.heavy 518.307 / 657.404 145808.0 27.66119956970215 50 20 10 10 10 28.95338698765129 3.4538273550742202 0.0 3 0.9980505931804476 27.947344772730705 145808.0 82.41556341781686 0.0 - - - - - - - 1304.6 291 10 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 1589 202 B20140407_SF105_01 B20140407_SF105_01 TB498938.[MT7]-AYLQQLR.2b4_1.heavy 518.307 / 620.352 84115.0 27.66119956970215 50 20 10 10 10 28.95338698765129 3.4538273550742202 0.0 3 0.9980505931804476 27.947344772730705 84115.0 49.877953525562575 0.0 - - - - - - - 815.0 168 1 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 1591 202 B20140407_SF105_01 B20140407_SF105_01 TB498938.[MT7]-AYLQQLR.2y6_1.heavy 518.307 / 820.468 350863.0 27.66119956970215 50 20 10 10 10 28.95338698765129 3.4538273550742202 0.0 3 0.9980505931804476 27.947344772730705 350863.0 245.2684694628403 0.0 - - - - - - - 374.0 701 4 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 1593 203 B20140407_SF105_01 B20140407_SF105_01 TB149759.[MT7]-GGWILR.2b3_1.heavy 423.259 / 445.232 16719.0 30.865400314331055 42 12 10 10 10 1.3785961111660914 60.81949472110305 0.0 3 0.8964638641165182 3.8018595491920815 16719.0 35.41788157894737 0.0 - - - - - - - 380.0 33 4 TTC39C tetratricopeptide repeat domain 39C 1595 203 B20140407_SF105_01 B20140407_SF105_01 TB149759.[MT7]-GGWILR.2y5_1.heavy 423.259 / 644.388 7447.0 30.865400314331055 42 12 10 10 10 1.3785961111660914 60.81949472110305 0.0 3 0.8964638641165182 3.8018595491920815 7447.0 28.416184210526314 0.0 - - - - - - - 304.0 14 14 TTC39C tetratricopeptide repeat domain 39C 1597 203 B20140407_SF105_01 B20140407_SF105_01 TB149759.[MT7]-GGWILR.2b4_1.heavy 423.259 / 558.316 22038.0 30.865400314331055 42 12 10 10 10 1.3785961111660914 60.81949472110305 0.0 3 0.8964638641165182 3.8018595491920815 22038.0 11.035109649122807 0.0 - - - - - - - 760.0 44 9 TTC39C tetratricopeptide repeat domain 39C 1599 203 B20140407_SF105_01 B20140407_SF105_01 TB149759.[MT7]-GGWILR.2b5_1.heavy 423.259 / 671.4 9575.0 30.865400314331055 42 12 10 10 10 1.3785961111660914 60.81949472110305 0.0 3 0.8964638641165182 3.8018595491920815 9575.0 19.842927631578945 0.0 - - - - - - - 266.0 19 8 TTC39C tetratricopeptide repeat domain 39C 1601 204 B20140407_SF105_01 B20140407_SF105_01 TB360743.[MT7]-LLLLGAGESGK[MT7].2y8_1.heavy 673.418 / 862.475 103740.0 33.6068000793457 48 18 10 10 10 10.6639064860436 9.377426567916281 0.0 3 0.9858379779392631 10.358237387321738 103740.0 122.78568190243863 0.0 - - - - - - - 230.0 207 2 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 1603 204 B20140407_SF105_01 B20140407_SF105_01 TB360743.[MT7]-LLLLGAGESGK[MT7].2y5_1.heavy 673.418 / 621.332 74429.0 33.6068000793457 48 18 10 10 10 10.6639064860436 9.377426567916281 0.0 3 0.9858379779392631 10.358237387321738 74429.0 68.00429868174147 0.0 - - - - - - - 460.0 148 1 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 1605 204 B20140407_SF105_01 B20140407_SF105_01 TB360743.[MT7]-LLLLGAGESGK[MT7].2y9_1.heavy 673.418 / 975.559 45732.0 33.6068000793457 48 18 10 10 10 10.6639064860436 9.377426567916281 0.0 3 0.9858379779392631 10.358237387321738 45732.0 67.02326048609117 0.0 - - - - - - - 245.2 91 5 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 1607 204 B20140407_SF105_01 B20140407_SF105_01 TB360743.[MT7]-LLLLGAGESGK[MT7].2y7_1.heavy 673.418 / 749.391 229886.0 33.6068000793457 48 18 10 10 10 10.6639064860436 9.377426567916281 0.0 3 0.9858379779392631 10.358237387321738 229886.0 223.61399817179372 0.0 - - - - - - - 844.0 459 2 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 1609 205 B20140407_SF105_01 B20140407_SF105_01 TB149842.[MT7]-VEDAIK[MT7].2y4_1.heavy 481.792 / 590.363 53772.0 23.59149932861328 48 20 10 10 8 5.484957397396563 18.231682172675587 0.0 4 0.9934440709602818 15.233780546719178 53772.0 5.572210508614563 0.0 - - - - - - - 1262.0 107 2 NUDT4;NUDT10;NUDT11 nudix (nucleoside diphosphate linked moiety X)-type motif 4;nudix (nucleoside diphosphate linked moiety X)-type motif 10;nudix (nucleoside diphosphate linked moiety X)-type motif 11 1611 205 B20140407_SF105_01 B20140407_SF105_01 TB149842.[MT7]-VEDAIK[MT7].2b3_1.heavy 481.792 / 488.247 148309.0 23.59149932861328 48 20 10 10 8 5.484957397396563 18.231682172675587 0.0 4 0.9934440709602818 15.233780546719178 148309.0 97.76528082703545 0.0 - - - - - - - 1407.5 296 2 NUDT4;NUDT10;NUDT11 nudix (nucleoside diphosphate linked moiety X)-type motif 4;nudix (nucleoside diphosphate linked moiety X)-type motif 10;nudix (nucleoside diphosphate linked moiety X)-type motif 11 1613 205 B20140407_SF105_01 B20140407_SF105_01 TB149842.[MT7]-VEDAIK[MT7].2y5_1.heavy 481.792 / 719.406 143747.0 23.59149932861328 48 20 10 10 8 5.484957397396563 18.231682172675587 0.0 4 0.9934440709602818 15.233780546719178 143747.0 30.73382717404831 0.0 - - - - - - - 971.0 287 1 NUDT4;NUDT10;NUDT11 nudix (nucleoside diphosphate linked moiety X)-type motif 4;nudix (nucleoside diphosphate linked moiety X)-type motif 10;nudix (nucleoside diphosphate linked moiety X)-type motif 11 1615 205 B20140407_SF105_01 B20140407_SF105_01 TB149842.[MT7]-VEDAIK[MT7].2b4_1.heavy 481.792 / 559.284 58528.0 23.59149932861328 48 20 10 10 8 5.484957397396563 18.231682172675587 0.0 4 0.9934440709602818 15.233780546719178 58528.0 35.23650092506611 1.0 - - - - - - - 971.0 140 1 NUDT4;NUDT10;NUDT11 nudix (nucleoside diphosphate linked moiety X)-type motif 4;nudix (nucleoside diphosphate linked moiety X)-type motif 10;nudix (nucleoside diphosphate linked moiety X)-type motif 11 1617 206 B20140407_SF105_01 B20140407_SF105_01 TB360570.[MT7]-EYEGEK[MT7].2b3_1.heavy 521.768 / 566.258 13310.0 19.631799697875977 44 16 10 10 8 1.1872851090829128 52.49101914950381 0.0 4 0.9635833316216468 6.44741183791946 13310.0 20.68188751191611 0.0 - - - - - - - 674.5714285714286 26 7 LACTB lactamase, beta 1619 206 B20140407_SF105_01 B20140407_SF105_01 TB360570.[MT7]-EYEGEK[MT7].2y4_1.heavy 521.768 / 606.321 8982.0 19.631799697875977 44 16 10 10 8 1.1872851090829128 52.49101914950381 0.0 4 0.9635833316216468 6.44741183791946 8982.0 15.135573761981213 1.0 - - - - - - - 646.4285714285714 31 7 LACTB lactamase, beta 1621 206 B20140407_SF105_01 B20140407_SF105_01 TB360570.[MT7]-EYEGEK[MT7].2y5_1.heavy 521.768 / 769.385 26291.0 19.631799697875977 44 16 10 10 8 1.1872851090829128 52.49101914950381 0.0 4 0.9635833316216468 6.44741183791946 26291.0 56.03068896777076 0.0 - - - - - - - 786.75 52 8 LACTB lactamase, beta 1623 206 B20140407_SF105_01 B20140407_SF105_01 TB360570.[MT7]-EYEGEK[MT7].2b5_1.heavy 521.768 / 752.322 7409.0 19.631799697875977 44 16 10 10 8 1.1872851090829128 52.49101914950381 0.0 4 0.9635833316216468 6.44741183791946 7409.0 16.013330039674983 0.0 - - - - - - - 749.2857142857143 14 7 LACTB lactamase, beta 1625 207 B20140407_SF105_01 B20140407_SF105_01 TB150458.[MT7]-LAEQFVLLNLVYETTDK[MT7].2y9_1.heavy 1142.64 / 1226.64 7743.0 42.64030075073242 45 15 10 10 10 1.7946121006257678 37.64882382924932 0.0 3 0.9540672442560716 5.736203872153395 7743.0 104.93802631578949 0.0 - - - - - - - 177.25 15 12 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1627 207 B20140407_SF105_01 B20140407_SF105_01 TB150458.[MT7]-LAEQFVLLNLVYETTDK[MT7].2b4_1.heavy 1142.64 / 586.332 13816.0 42.64030075073242 45 15 10 10 10 1.7946121006257678 37.64882382924932 0.0 3 0.9540672442560716 5.736203872153395 13816.0 63.43464319778029 0.0 - - - - - - - 639.5714285714286 27 7 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1629 207 B20140407_SF105_01 B20140407_SF105_01 TB150458.[MT7]-LAEQFVLLNLVYETTDK[MT7].2b6_1.heavy 1142.64 / 832.469 20572.0 42.64030075073242 45 15 10 10 10 1.7946121006257678 37.64882382924932 0.0 3 0.9540672442560716 5.736203872153395 20572.0 85.80986928860614 0.0 - - - - - - - 233.0 41 15 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1631 207 B20140407_SF105_01 B20140407_SF105_01 TB150458.[MT7]-LAEQFVLLNLVYETTDK[MT7].2b5_1.heavy 1142.64 / 733.4 15258.0 42.64030075073242 45 15 10 10 10 1.7946121006257678 37.64882382924932 0.0 3 0.9540672442560716 5.736203872153395 15258.0 63.767673799884335 0.0 - - - - - - - 272.47058823529414 30 17 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1633 208 B20140407_SF105_01 B20140407_SF105_01 TB498862.[MT7]-Y[MT7]YLDSLDR.3y7_1.heavy 444.906 / 881.436 3781.0 27.66119956970215 44 16 10 10 8 7.413226597617358 13.489402850863945 0.0 4 0.963169914542823 6.410899793205732 3781.0 24.98260740740741 0.0 - - - - - - - 270.0 7 10 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1635 208 B20140407_SF105_01 B20140407_SF105_01 TB498862.[MT7]-Y[MT7]YLDSLDR.3y6_1.heavy 444.906 / 718.373 32812.0 27.66119956970215 44 16 10 10 8 7.413226597617358 13.489402850863945 0.0 4 0.963169914542823 6.410899793205732 32812.0 26.764727880562397 2.0 - - - - - - - 405.0 85 1 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1637 208 B20140407_SF105_01 B20140407_SF105_01 TB498862.[MT7]-Y[MT7]YLDSLDR.3y4_1.heavy 444.906 / 490.262 129224.0 27.66119956970215 44 16 10 10 8 7.413226597617358 13.489402850863945 0.0 4 0.963169914542823 6.410899793205732 129224.0 43.00417129547858 1.0 - - - - - - - 1350.0 258 2 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1639 208 B20140407_SF105_01 B20140407_SF105_01 TB498862.[MT7]-Y[MT7]YLDSLDR.3y5_1.heavy 444.906 / 605.289 119097.0 27.66119956970215 44 16 10 10 8 7.413226597617358 13.489402850863945 0.0 4 0.963169914542823 6.410899793205732 119097.0 37.03599744804958 2.0 - - - - - - - 1687.5 238 2 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1641 209 B20140407_SF105_01 B20140407_SF105_01 TB150451.[MT7]-FLPPDAFIHVDDFQSPK[MT7].4b7_1.heavy 566.052 / 932.5 9948.0 35.8577995300293 45 17 10 10 8 3.2824335368783393 24.259065907803965 0.0 4 0.9750479114144837 7.796536422455542 9948.0 24.81034888207922 0.0 - - - - - - - 313.22222222222223 19 9 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1643 209 B20140407_SF105_01 B20140407_SF105_01 TB150451.[MT7]-FLPPDAFIHVDDFQSPK[MT7].4b5_1.heavy 566.052 / 714.394 19005.0 35.8577995300293 45 17 10 10 8 3.2824335368783393 24.259065907803965 0.0 4 0.9750479114144837 7.796536422455542 19005.0 15.886129234587163 1.0 - - - - - - - 742.5 47 2 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1645 209 B20140407_SF105_01 B20140407_SF105_01 TB150451.[MT7]-FLPPDAFIHVDDFQSPK[MT7].4b6_1.heavy 566.052 / 785.431 13808.0 35.8577995300293 45 17 10 10 8 3.2824335368783393 24.259065907803965 0.0 4 0.9750479114144837 7.796536422455542 13808.0 21.95568116020946 0.0 - - - - - - - 197.66666666666666 27 3 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1647 209 B20140407_SF105_01 B20140407_SF105_01 TB150451.[MT7]-FLPPDAFIHVDDFQSPK[MT7].4b10_2.heavy 566.052 / 641.359 20935.0 35.8577995300293 45 17 10 10 8 3.2824335368783393 24.259065907803965 0.0 4 0.9750479114144837 7.796536422455542 20935.0 3.650722219957703 1.0 - - - - - - - 148.0 43 2 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1649 210 B20140407_SF105_01 B20140407_SF105_01 TB499267.[MT7]-HLSIGSLNSATPEEFK[MT7].4y4_1.heavy 505.275 / 696.369 20916.0 30.14150047302246 36 18 0 10 8 5.121764470011966 19.52452139990076 0.0 4 0.9893720165380171 11.960560813721166 20916.0 10.486995897283295 1.0 - - - - - - - 697.3333333333334 42 3 C14orf148 chromosome 14 open reading frame 148 1651 210 B20140407_SF105_01 B20140407_SF105_01 TB499267.[MT7]-HLSIGSLNSATPEEFK[MT7].4y5_1.heavy 505.275 / 793.421 35110.0 30.14150047302246 36 18 0 10 8 5.121764470011966 19.52452139990076 0.0 4 0.9893720165380171 11.960560813721166 35110.0 52.48232598652999 0.0 - - - - - - - 1216.7142857142858 70 7 C14orf148 chromosome 14 open reading frame 148 1653 210 B20140407_SF105_01 B20140407_SF105_01 TB499267.[MT7]-HLSIGSLNSATPEEFK[MT7].4y3_1.heavy 505.275 / 567.326 36454.0 30.14150047302246 36 18 0 10 8 5.121764470011966 19.52452139990076 0.0 4 0.9893720165380171 11.960560813721166 36454.0 5.149359023802589 1.0 - - - - - - - 1345.0 300 1 C14orf148 chromosome 14 open reading frame 148 1655 210 B20140407_SF105_01 B20140407_SF105_01 TB499267.[MT7]-HLSIGSLNSATPEEFK[MT7].4b6_1.heavy 505.275 / 739.422 16136.0 30.14150047302246 36 18 0 10 8 5.121764470011966 19.52452139990076 0.0 4 0.9893720165380171 11.960560813721166 16136.0 8.34210668971802 1.0 - - - - - - - 373.5 71 2 C14orf148 chromosome 14 open reading frame 148 1657 211 B20140407_SF105_01 B20140407_SF105_01 TB499269.[MT7]-QLAGTLLQLGPIPAESLR.3b6_1.heavy 674.401 / 728.442 496543.0 38.004398345947266 48 18 10 10 10 4.98648064114494 20.05422405029915 0.0 3 0.9867753541538681 10.719895800300291 496543.0 410.6170188982213 0.0 - - - - - - - 384.0 993 1 C14orf148 chromosome 14 open reading frame 148 1659 211 B20140407_SF105_01 B20140407_SF105_01 TB499269.[MT7]-QLAGTLLQLGPIPAESLR.3y6_1.heavy 674.401 / 672.367 542735.0 38.004398345947266 48 18 10 10 10 4.98648064114494 20.05422405029915 0.0 3 0.9867753541538681 10.719895800300291 542735.0 355.2275954861111 0.0 - - - - - - - 192.0 1085 2 C14orf148 chromosome 14 open reading frame 148 1661 211 B20140407_SF105_01 B20140407_SF105_01 TB499269.[MT7]-QLAGTLLQLGPIPAESLR.3y8_1.heavy 674.401 / 882.504 332693.0 38.004398345947266 48 18 10 10 10 4.98648064114494 20.05422405029915 0.0 3 0.9867753541538681 10.719895800300291 332693.0 101.45735104053186 0.0 - - - - - - - 256.0 665 1 C14orf148 chromosome 14 open reading frame 148 1663 211 B20140407_SF105_01 B20140407_SF105_01 TB499269.[MT7]-QLAGTLLQLGPIPAESLR.3y9_1.heavy 674.401 / 939.526 426523.0 38.004398345947266 48 18 10 10 10 4.98648064114494 20.05422405029915 0.0 3 0.9867753541538681 10.719895800300291 426523.0 341.7409512606534 0.0 - - - - - - - 768.0 853 1 C14orf148 chromosome 14 open reading frame 148 1665 212 B20140407_SF105_01 B20140407_SF105_01 TB499263.[MT7]-WVGTIHGAAGTVYEDLR.3y11_1.heavy 663.682 / 1151.57 170580.0 32.59920120239258 44 14 10 10 10 8.620658460205957 11.60004197609876 0.0 3 0.9421420229365997 5.1058050093205605 170580.0 373.7305265906636 0.0 - - - - - - - 299.125 341 8 UBE2C ubiquitin-conjugating enzyme E2C 1667 212 B20140407_SF105_01 B20140407_SF105_01 TB499263.[MT7]-WVGTIHGAAGTVYEDLR.3b4_1.heavy 663.682 / 588.326 240907.0 32.59920120239258 44 14 10 10 10 8.620658460205957 11.60004197609876 0.0 3 0.9421420229365997 5.1058050093205605 240907.0 116.0282320726719 0.0 - - - - - - - 1838.4285714285713 481 7 UBE2C ubiquitin-conjugating enzyme E2C 1669 212 B20140407_SF105_01 B20140407_SF105_01 TB499263.[MT7]-WVGTIHGAAGTVYEDLR.3y8_1.heavy 663.682 / 952.473 189583.0 32.59920120239258 44 14 10 10 10 8.620658460205957 11.60004197609876 0.0 3 0.9421420229365997 5.1058050093205605 189583.0 226.70217226837977 0.0 - - - - - - - 399.0 379 3 UBE2C ubiquitin-conjugating enzyme E2C 1671 212 B20140407_SF105_01 B20140407_SF105_01 TB499263.[MT7]-WVGTIHGAAGTVYEDLR.3y9_1.heavy 663.682 / 1023.51 174022.0 32.59920120239258 44 14 10 10 10 8.620658460205957 11.60004197609876 0.0 3 0.9421420229365997 5.1058050093205605 174022.0 512.1017442276394 0.0 - - - - - - - 299.2857142857143 348 7 UBE2C ubiquitin-conjugating enzyme E2C 1673 213 B20140407_SF105_01 B20140407_SF105_01 TB361006.[MT7]-VDTTVVFDC[CAM]IMELK[MT7].3y3_1.heavy 653.345 / 533.341 24351.0 40.17840003967285 43 17 10 6 10 2.5165867930356964 31.720794889877 0.039203643798828125 3 0.9709822752673873 7.227279874307037 24351.0 46.93327840222113 0.0 - - - - - - - 782.5 48 8 IGSF22 immunoglobulin superfamily, member 22 1675 213 B20140407_SF105_01 B20140407_SF105_01 TB361006.[MT7]-VDTTVVFDC[CAM]IMELK[MT7].3b6_1.heavy 653.345 / 759.437 26404.0 40.17840003967285 43 17 10 6 10 2.5165867930356964 31.720794889877 0.039203643798828125 3 0.9709822752673873 7.227279874307037 26404.0 21.542996089931574 0.0 - - - - - - - 796.2857142857143 52 7 IGSF22 immunoglobulin superfamily, member 22 1677 213 B20140407_SF105_01 B20140407_SF105_01 TB361006.[MT7]-VDTTVVFDC[CAM]IMELK[MT7].3b5_1.heavy 653.345 / 660.369 28458.0 40.17840003967285 43 17 10 6 10 2.5165867930356964 31.720794889877 0.039203643798828125 3 0.9709822752673873 7.227279874307037 28458.0 38.06420355573585 0.0 - - - - - - - 770.125 56 8 IGSF22 immunoglobulin superfamily, member 22 1679 213 B20140407_SF105_01 B20140407_SF105_01 TB361006.[MT7]-VDTTVVFDC[CAM]IMELK[MT7].3y4_1.heavy 653.345 / 664.382 48115.0 40.17840003967285 43 17 10 6 10 2.5165867930356964 31.720794889877 0.039203643798828125 3 0.9709822752673873 7.227279874307037 48115.0 86.40653650701141 0.0 - - - - - - - 739.0 96 9 IGSF22 immunoglobulin superfamily, member 22 1681 214 B20140407_SF105_01 B20140407_SF105_01 TB360739.[MT7]-AEAEASEDTK[MT7].2b8_1.heavy 669.835 / 947.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEP68 centrosomal protein 68kDa 1683 214 B20140407_SF105_01 B20140407_SF105_01 TB360739.[MT7]-AEAEASEDTK[MT7].2y5_1.heavy 669.835 / 723.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEP68 centrosomal protein 68kDa 1685 214 B20140407_SF105_01 B20140407_SF105_01 TB360739.[MT7]-AEAEASEDTK[MT7].2b4_1.heavy 669.835 / 545.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEP68 centrosomal protein 68kDa 1687 214 B20140407_SF105_01 B20140407_SF105_01 TB360739.[MT7]-AEAEASEDTK[MT7].2b5_1.heavy 669.835 / 616.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEP68 centrosomal protein 68kDa 1689 215 B20140407_SF105_01 B20140407_SF105_01 TB499261.[MT7]-LTQVSSLVSYLGSISTLVTLPTGDIK[MT7].3b9_1.heavy 994.24 / 1059.62 6247.0 46.31837463378906 42 14 10 8 10 2.0533541390704286 41.77281567847244 0.0121002197265625 3 0.9432307871730908 5.155011795133074 6247.0 16.385573770491803 0.0 - - - - - - - 159.1951219512195 12 41 CEP68 centrosomal protein 68kDa 1691 215 B20140407_SF105_01 B20140407_SF105_01 TB499261.[MT7]-LTQVSSLVSYLGSISTLVTLPTGDIK[MT7].3y6_1.heavy 994.24 / 774.448 74575.0 46.31837463378906 42 14 10 8 10 2.0533541390704286 41.77281567847244 0.0121002197265625 3 0.9432307871730908 5.155011795133074 74575.0 130.7903306478984 0.0 - - - - - - - 659.0 149 15 CEP68 centrosomal protein 68kDa 1693 215 B20140407_SF105_01 B20140407_SF105_01 TB499261.[MT7]-LTQVSSLVSYLGSISTLVTLPTGDIK[MT7].3b4_1.heavy 994.24 / 586.368 12189.0 46.31837463378906 42 14 10 8 10 2.0533541390704286 41.77281567847244 0.0121002197265625 3 0.9432307871730908 5.155011795133074 12189.0 24.776211118252427 1.0 - - - - - - - 261.2564102564103 24 39 CEP68 centrosomal protein 68kDa 1695 215 B20140407_SF105_01 B20140407_SF105_01 TB499261.[MT7]-LTQVSSLVSYLGSISTLVTLPTGDIK[MT7].3b8_1.heavy 994.24 / 972.585 18685.0 46.31837463378906 42 14 10 8 10 2.0533541390704286 41.77281567847244 0.0121002197265625 3 0.9432307871730908 5.155011795133074 18685.0 35.432767774699904 0.0 - - - - - - - 248.38888888888889 37 36 CEP68 centrosomal protein 68kDa 1697 216 B20140407_SF105_01 B20140407_SF105_01 TB360831.[MT7]-NDFEQGELYLR.2b4_1.heavy 764.382 / 650.29 11100.0 31.222000122070312 48 18 10 10 10 2.696836215635207 24.81588452946091 0.0 3 0.9823068513673728 9.26440181874075 11100.0 7.461803893652954 0.0 - - - - - - - 228.0 22 2 LACTB lactamase, beta 1699 216 B20140407_SF105_01 B20140407_SF105_01 TB360831.[MT7]-NDFEQGELYLR.2y9_1.heavy 764.382 / 1154.58 15054.0 31.222000122070312 48 18 10 10 10 2.696836215635207 24.81588452946091 0.0 3 0.9823068513673728 9.26440181874075 15054.0 40.93631578947368 0.0 - - - - - - - 319.2 30 10 LACTB lactamase, beta 1701 216 B20140407_SF105_01 B20140407_SF105_01 TB360831.[MT7]-NDFEQGELYLR.2y6_1.heavy 764.382 / 750.414 7907.0 31.222000122070312 48 18 10 10 10 2.696836215635207 24.81588452946091 0.0 3 0.9823068513673728 9.26440181874075 7907.0 5.173982459394292 1.0 - - - - - - - 456.0 15 1 LACTB lactamase, beta 1703 216 B20140407_SF105_01 B20140407_SF105_01 TB360831.[MT7]-NDFEQGELYLR.2y7_1.heavy 764.382 / 878.473 10036.0 31.222000122070312 48 18 10 10 10 2.696836215635207 24.81588452946091 0.0 3 0.9823068513673728 9.26440181874075 10036.0 25.750263157894736 0.0 - - - - - - - 342.0 20 8 LACTB lactamase, beta 1705 217 B20140407_SF105_01 B20140407_SF105_01 TB360571.[MT7]-RPEEVLR.2y4_1.heavy 521.81 / 516.314 18180.0 22.079700469970703 36 18 2 10 6 3.070556536453705 32.5673860138376 0.0 6 0.9862101704033589 10.497420224115954 18180.0 5.86533450022001 2.0 - - - - - - - 3920.0 96 1 ACTRT2 actin-related protein T2 1707 217 B20140407_SF105_01 B20140407_SF105_01 TB360571.[MT7]-RPEEVLR.2b4_1.heavy 521.81 / 656.348 23017.0 22.079700469970703 36 18 2 10 6 3.070556536453705 32.5673860138376 0.0 6 0.9862101704033589 10.497420224115954 23017.0 29.959152124243385 2.0 - - - - - - - 667.1111111111111 625 9 ACTRT2 actin-related protein T2 1709 217 B20140407_SF105_01 B20140407_SF105_01 TB360571.[MT7]-RPEEVLR.2y6_1.heavy 521.81 / 742.409 96070.0 22.079700469970703 36 18 2 10 6 3.070556536453705 32.5673860138376 0.0 6 0.9862101704033589 10.497420224115954 96070.0 210.14350044097046 0.0 - - - - - - - 689.4 192 15 ACTRT2 actin-related protein T2 1711 217 B20140407_SF105_01 B20140407_SF105_01 TB360571.[MT7]-RPEEVLR.2b5_1.heavy 521.81 / 755.417 13176.0 22.079700469970703 36 18 2 10 6 3.070556536453705 32.5673860138376 0.0 6 0.9862101704033589 10.497420224115954 13176.0 25.891602138319694 1.0 - - - - - - - 281.5 189 8 ACTRT2 actin-related protein T2 1713 218 B20140407_SF105_01 B20140407_SF105_01 TB149960.[MT7]-MVC[CAM]DVVSR.2b4_1.heavy 555.282 / 650.276 34563.0 25.691299438476562 50 20 10 10 10 6.104647755670382 16.380961523474255 0.0 3 0.9931919871450746 14.948770962227037 34563.0 22.805713301530826 0.0 - - - - - - - 828.6666666666666 69 6 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1715 218 B20140407_SF105_01 B20140407_SF105_01 TB149960.[MT7]-MVC[CAM]DVVSR.2y6_1.heavy 555.282 / 735.345 25922.0 25.691299438476562 50 20 10 10 10 6.104647755670382 16.380961523474255 0.0 3 0.9931919871450746 14.948770962227037 25922.0 30.451808353695924 0.0 - - - - - - - 845.8571428571429 51 7 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1717 218 B20140407_SF105_01 B20140407_SF105_01 TB149960.[MT7]-MVC[CAM]DVVSR.2b5_1.heavy 555.282 / 749.344 16571.0 25.691299438476562 50 20 10 10 10 6.104647755670382 16.380961523474255 0.0 3 0.9931919871450746 14.948770962227037 16571.0 17.05196513999524 0.0 - - - - - - - 845.5714285714286 33 7 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1719 218 B20140407_SF105_01 B20140407_SF105_01 TB149960.[MT7]-MVC[CAM]DVVSR.2y7_1.heavy 555.282 / 834.414 48885.0 25.691299438476562 50 20 10 10 10 6.104647755670382 16.380961523474255 0.0 3 0.9931919871450746 14.948770962227037 48885.0 42.20781466698238 0.0 - - - - - - - 325.5 97 8 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1721 219 B20140407_SF105_01 B20140407_SF105_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 753452.0 37.10110092163086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 753452.0 286.98619781191354 0.0 - - - - - - - 846.0 1506 1 1723 219 B20140407_SF105_01 B20140407_SF105_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 1501500.0 37.10110092163086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1501500.0 371.2259403125329 0.0 - - - - - - - 2257.0 3003 2 1725 219 B20140407_SF105_01 B20140407_SF105_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 1196750.0 37.10110092163086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1196750.0 350.3362842404373 0.0 - - - - - - - 1411.0 2393 1 1727 220 B20140407_SF105_01 B20140407_SF105_01 TB498850.[MT7]-QYPPVTLVSR.3y6_1.heavy 435.255 / 674.42 6265.0 29.11044979095459 43 18 10 5 10 4.310176223024077 23.200907532694494 0.04950141906738281 3 0.9863578143710889 10.55420257697229 6265.0 10.104717098145262 0.0 - - - - - - - 267.1666666666667 12 6 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1729 220 B20140407_SF105_01 B20140407_SF105_01 TB498850.[MT7]-QYPPVTLVSR.3b3_1.heavy 435.255 / 533.284 16611.0 29.11044979095459 43 18 10 5 10 4.310176223024077 23.200907532694494 0.04950141906738281 3 0.9863578143710889 10.55420257697229 16611.0 14.031894511149229 1.0 - - - - - - - 583.0 33 2 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1731 220 B20140407_SF105_01 B20140407_SF105_01 TB498850.[MT7]-QYPPVTLVSR.3y4_1.heavy 435.255 / 474.303 31327.0 29.11044979095459 43 18 10 5 10 4.310176223024077 23.200907532694494 0.04950141906738281 3 0.9863578143710889 10.55420257697229 31327.0 9.93224505626213 0.0 - - - - - - - 1165.5 62 2 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1733 220 B20140407_SF105_01 B20140407_SF105_01 TB498850.[MT7]-QYPPVTLVSR.3y5_1.heavy 435.255 / 575.351 55806.0 29.11044979095459 43 18 10 5 10 4.310176223024077 23.200907532694494 0.04950141906738281 3 0.9863578143710889 10.55420257697229 55806.0 56.97969091581744 0.0 - - - - - - - 1238.5 111 2 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1735 221 B20140407_SF105_01 B20140407_SF105_01 TB150349.[MT7]-NALEAWAVPVVLGPSR.2y8_1.heavy 912.018 / 824.499 124677.0 38.18769836425781 47 17 10 10 10 6.132399429854857 16.306830816199266 0.0 3 0.9766639965525707 8.063079369551831 124677.0 105.0499250232731 0.0 - - - - - - - 129.0 249 2 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1737 221 B20140407_SF105_01 B20140407_SF105_01 TB150349.[MT7]-NALEAWAVPVVLGPSR.2b4_1.heavy 912.018 / 572.316 110009.0 38.18769836425781 47 17 10 10 10 6.132399429854857 16.306830816199266 0.0 3 0.9766639965525707 8.063079369551831 110009.0 127.41453962894367 0.0 - - - - - - - 659.625 220 8 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1739 221 B20140407_SF105_01 B20140407_SF105_01 TB150349.[MT7]-NALEAWAVPVVLGPSR.2y10_1.heavy 912.018 / 994.604 66134.0 38.18769836425781 47 17 10 10 10 6.132399429854857 16.306830816199266 0.0 3 0.9766639965525707 8.063079369551831 66134.0 119.55645262230883 0.0 - - - - - - - 283.0 132 5 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1741 221 B20140407_SF105_01 B20140407_SF105_01 TB150349.[MT7]-NALEAWAVPVVLGPSR.2b5_1.heavy 912.018 / 643.353 124548.0 38.18769836425781 47 17 10 10 10 6.132399429854857 16.306830816199266 0.0 3 0.9766639965525707 8.063079369551831 124548.0 324.58527367777856 0.0 - - - - - - - 225.25 249 4 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1743 222 B20140407_SF105_01 B20140407_SF105_01 TB150444.[MT7]-TNIQQAVAAAPWWLPVK[MT7].3b6_1.heavy 727.752 / 800.438 334064.0 38.944000244140625 46 16 10 10 10 1.9881849641652714 39.511642953050156 0.0 3 0.9634731684732041 6.43762205403064 334064.0 392.1041391812257 0.0 - - - - - - - 321.0 668 3 SUMF1 sulfatase modifying factor 1 1745 222 B20140407_SF105_01 B20140407_SF105_01 TB150444.[MT7]-TNIQQAVAAAPWWLPVK[MT7].3b4_1.heavy 727.752 / 601.343 204384.0 38.944000244140625 46 16 10 10 10 1.9881849641652714 39.511642953050156 0.0 3 0.9634731684732041 6.43762205403064 204384.0 150.94066412752153 0.0 - - - - - - - 811.75 408 4 SUMF1 sulfatase modifying factor 1 1747 222 B20140407_SF105_01 B20140407_SF105_01 TB150444.[MT7]-TNIQQAVAAAPWWLPVK[MT7].3y4_1.heavy 727.752 / 600.42 246609.0 38.944000244140625 46 16 10 10 10 1.9881849641652714 39.511642953050156 0.0 3 0.9634731684732041 6.43762205403064 246609.0 233.29791237058615 0.0 - - - - - - - 481.0 493 1 SUMF1 sulfatase modifying factor 1 1749 222 B20140407_SF105_01 B20140407_SF105_01 TB150444.[MT7]-TNIQQAVAAAPWWLPVK[MT7].3b7_1.heavy 727.752 / 899.507 130642.0 38.944000244140625 46 16 10 10 10 1.9881849641652714 39.511642953050156 0.0 3 0.9634731684732041 6.43762205403064 130642.0 389.1001331114809 0.0 - - - - - - - 340.6666666666667 261 6 SUMF1 sulfatase modifying factor 1 1751 223 B20140407_SF105_01 B20140407_SF105_01 TB360824.[MT7]-SPLAYVPFSAGPR.2y8_1.heavy 753.415 / 830.452 7610.0 34.82640075683594 50 20 10 10 10 12.246060345415229 8.16589149321306 0.0 3 0.9914491318020905 13.336667109345527 7610.0 5.845269651955541 0.0 - - - - - - - 348.3333333333333 15 3 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1753 223 B20140407_SF105_01 B20140407_SF105_01 TB360824.[MT7]-SPLAYVPFSAGPR.2y9_1.heavy 753.415 / 993.515 8057.0 34.82640075683594 50 20 10 10 10 12.246060345415229 8.16589149321306 0.0 3 0.9914491318020905 13.336667109345527 8057.0 11.363251749823412 0.0 - - - - - - - 358.0 16 5 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1755 223 B20140407_SF105_01 B20140407_SF105_01 TB360824.[MT7]-SPLAYVPFSAGPR.2y10_1.heavy 753.415 / 1064.55 5521.0 34.82640075683594 50 20 10 10 10 12.246060345415229 8.16589149321306 0.0 3 0.9914491318020905 13.336667109345527 5521.0 11.64569417847568 1.0 - - - - - - - 298.2 11 5 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1757 223 B20140407_SF105_01 B20140407_SF105_01 TB360824.[MT7]-SPLAYVPFSAGPR.2y7_1.heavy 753.415 / 731.383 19695.0 34.82640075683594 50 20 10 10 10 12.246060345415229 8.16589149321306 0.0 3 0.9914491318020905 13.336667109345527 19695.0 15.531457522772234 1.0 - - - - - - - 597.0 39 1 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1759 224 B20140407_SF105_01 B20140407_SF105_01 TB499275.[MT7]-WVGTIHGAAGTVY[MT7]EDLR.4y11_2.heavy 534.039 / 648.339 129821.0 30.473899841308594 40 10 10 10 10 0.8876170601483189 65.06618372428876 0.0 3 0.8260325812539396 2.914884152298282 129821.0 67.07101653356867 0.0 - - - - - - - 2673.625 259 8 UBE2C ubiquitin-conjugating enzyme E2C 1761 224 B20140407_SF105_01 B20140407_SF105_01 TB499275.[MT7]-WVGTIHGAAGTVY[MT7]EDLR.4b4_1.heavy 534.039 / 588.326 69697.0 30.473899841308594 40 10 10 10 10 0.8876170601483189 65.06618372428876 0.0 3 0.8260325812539396 2.914884152298282 69697.0 43.22776718756397 0.0 - - - - - - - 2264.714285714286 139 7 UBE2C ubiquitin-conjugating enzyme E2C 1763 224 B20140407_SF105_01 B20140407_SF105_01 TB499275.[MT7]-WVGTIHGAAGTVY[MT7]EDLR.4b5_1.heavy 534.039 / 701.41 36942.0 30.473899841308594 40 10 10 10 10 0.8876170601483189 65.06618372428876 0.0 3 0.8260325812539396 2.914884152298282 36942.0 66.47575037559844 1.0 - - - - - - - 349.0 73 3 UBE2C ubiquitin-conjugating enzyme E2C 1765 224 B20140407_SF105_01 B20140407_SF105_01 TB499275.[MT7]-WVGTIHGAAGTVY[MT7]EDLR.4b9_2.heavy 534.039 / 519.286 26473.0 30.473899841308594 40 10 10 10 10 0.8876170601483189 65.06618372428876 0.0 3 0.8260325812539396 2.914884152298282 26473.0 5.56843157181373 5.0 - - - - - - - 2991.0 169 1 UBE2C ubiquitin-conjugating enzyme E2C 1767 225 B20140407_SF105_01 B20140407_SF105_01 TB499172.[MT7]-SSSIVEFFSLVTR.2y8_1.heavy 808.444 / 998.531 24733.0 42.24700164794922 41 11 10 10 10 0.8209040590867067 72.23030797900284 0.0 3 0.8717503680673998 3.4086282330168993 24733.0 40.050596590909095 0.0 - - - - - - - 653.7142857142857 49 7 IGSF22 immunoglobulin superfamily, member 22 1769 225 B20140407_SF105_01 B20140407_SF105_01 TB499172.[MT7]-SSSIVEFFSLVTR.2b4_1.heavy 808.444 / 519.289 40841.0 42.24700164794922 41 11 10 10 10 0.8209040590867067 72.23030797900284 0.0 3 0.8717503680673998 3.4086282330168993 40841.0 74.91936688311688 0.0 - - - - - - - 1232.0 81 7 IGSF22 immunoglobulin superfamily, member 22 1771 225 B20140407_SF105_01 B20140407_SF105_01 TB499172.[MT7]-SSSIVEFFSLVTR.2y9_1.heavy 808.444 / 1097.6 24909.0 42.24700164794922 41 11 10 10 10 0.8209040590867067 72.23030797900284 0.0 3 0.8717503680673998 3.4086282330168993 24909.0 80.82844696969697 0.0 - - - - - - - 308.0 49 10 IGSF22 immunoglobulin superfamily, member 22 1773 225 B20140407_SF105_01 B20140407_SF105_01 TB499172.[MT7]-SSSIVEFFSLVTR.2y7_1.heavy 808.444 / 869.488 17252.0 42.24700164794922 41 11 10 10 10 0.8209040590867067 72.23030797900284 0.0 3 0.8717503680673998 3.4086282330168993 17252.0 31.74069264069264 0.0 - - - - - - - 660.0 34 8 IGSF22 immunoglobulin superfamily, member 22 1775 226 B20140407_SF105_01 B20140407_SF105_01 TB499274.[MT7]-VNSYWFITADHLIEK[MT7].4y4_1.heavy 531.79 / 646.426 25380.0 36.91960144042969 41 11 10 10 10 2.1003102338754167 47.612013876389874 0.0 3 0.8772445784758233 3.4857469359627746 25380.0 15.380652515368674 0.0 - - - - - - - 334.6666666666667 50 3 HINT3 histidine triad nucleotide binding protein 3 1777 226 B20140407_SF105_01 B20140407_SF105_01 TB499274.[MT7]-VNSYWFITADHLIEK[MT7].4y9_2.heavy 531.79 / 592.344 43878.0 36.91960144042969 41 11 10 10 10 2.1003102338754167 47.612013876389874 0.0 3 0.8772445784758233 3.4857469359627746 43878.0 9.289948749051295 0.0 - - - - - - - 430.0 87 1 HINT3 histidine triad nucleotide binding protein 3 1779 226 B20140407_SF105_01 B20140407_SF105_01 TB499274.[MT7]-VNSYWFITADHLIEK[MT7].4b4_1.heavy 531.79 / 608.316 47175.0 36.91960144042969 41 11 10 10 10 2.1003102338754167 47.612013876389874 0.0 3 0.8772445784758233 3.4857469359627746 47175.0 65.7949790794979 0.0 - - - - - - - 757.8571428571429 94 7 HINT3 histidine triad nucleotide binding protein 3 1781 226 B20140407_SF105_01 B20140407_SF105_01 TB499274.[MT7]-VNSYWFITADHLIEK[MT7].4b3_1.heavy 531.79 / 445.253 47892.0 36.91960144042969 41 11 10 10 10 2.1003102338754167 47.612013876389874 0.0 3 0.8772445784758233 3.4857469359627746 47892.0 33.91939635312599 0.0 - - - - - - - 334.6666666666667 95 3 HINT3 histidine triad nucleotide binding protein 3 1783 227 B20140407_SF105_01 B20140407_SF105_01 TB498852.[MT7]-VIENPR.2b3_1.heavy 436.26 / 486.304 54791.0 21.596599578857422 50 20 10 10 10 8.85443949153977 11.293769650303432 0.0 3 0.9990946489816228 41.012958762791925 54791.0 47.87745554598196 0.0 - - - - - - - 1346.0 109 9 GRB7 growth factor receptor-bound protein 7 1785 227 B20140407_SF105_01 B20140407_SF105_01 TB498852.[MT7]-VIENPR.2y4_1.heavy 436.26 / 515.257 64578.0 21.596599578857422 50 20 10 10 10 8.85443949153977 11.293769650303432 0.0 3 0.9990946489816228 41.012958762791925 64578.0 43.79267619213901 0.0 - - - - - - - 1615.7142857142858 129 7 GRB7 growth factor receptor-bound protein 7 1787 227 B20140407_SF105_01 B20140407_SF105_01 TB498852.[MT7]-VIENPR.2y5_1.heavy 436.26 / 628.341 289757.0 21.596599578857422 50 20 10 10 10 8.85443949153977 11.293769650303432 0.0 3 0.9990946489816228 41.012958762791925 289757.0 306.09018590785905 0.0 - - - - - - - 788.8333333333334 579 6 GRB7 growth factor receptor-bound protein 7 1789 227 B20140407_SF105_01 B20140407_SF105_01 TB498852.[MT7]-VIENPR.2b4_1.heavy 436.26 / 600.347 61770.0 21.596599578857422 50 20 10 10 10 8.85443949153977 11.293769650303432 0.0 3 0.9990946489816228 41.012958762791925 61770.0 64.86345687028964 0.0 - - - - - - - 1233.375 123 8 GRB7 growth factor receptor-bound protein 7 1791 228 B20140407_SF105_01 B20140407_SF105_01 TB498998.[MT7]-EFGTSVVQR.2y8_1.heavy 583.818 / 893.484 136671.0 25.513599395751953 40 20 2 10 8 7.874092992901208 12.699875412971853 0.0 4 0.9963296263746204 20.364526060673537 136671.0 178.61555066079296 0.0 - - - - - - - 729.8571428571429 273 7 ACTRT2 actin-related protein T2 1793 228 B20140407_SF105_01 B20140407_SF105_01 TB498998.[MT7]-EFGTSVVQR.2y5_1.heavy 583.818 / 588.346 28151.0 25.513599395751953 40 20 2 10 8 7.874092992901208 12.699875412971853 0.0 4 0.9963296263746204 20.364526060673537 28151.0 17.838824127414433 0.0 - - - - - - - 1800.0 56 7 ACTRT2 actin-related protein T2 1795 228 B20140407_SF105_01 B20140407_SF105_01 TB498998.[MT7]-EFGTSVVQR.2b5_1.heavy 583.818 / 666.321 14530.0 25.513599395751953 40 20 2 10 8 7.874092992901208 12.699875412971853 0.0 4 0.9963296263746204 20.364526060673537 14530.0 18.7576051325642 0.0 - - - - - - - 1191.875 29 8 ACTRT2 actin-related protein T2 1797 228 B20140407_SF105_01 B20140407_SF105_01 TB498998.[MT7]-EFGTSVVQR.2y7_1.heavy 583.818 / 746.416 83773.0 25.513599395751953 40 20 2 10 8 7.874092992901208 12.699875412971853 0.0 4 0.9963296263746204 20.364526060673537 83773.0 74.74587770908987 1.0 - - - - - - - 908.0 740 2 ACTRT2 actin-related protein T2 1799 229 B20140407_SF105_01 B20140407_SF105_01 TB360727.[MT7]-YLQETYSK[MT7].2y4_1.heavy 660.358 / 642.358 N/A 26.138900756835938 50 20 10 10 10 14.200518283241378 7.041996496565492 0.0 3 0.9986719766500209 33.8619091154543 55541.0 5.064715708454079 2.0 - - - - - - - 5766.0 112 1 UBE2C ubiquitin-conjugating enzyme E2C 1801 229 B20140407_SF105_01 B20140407_SF105_01 TB360727.[MT7]-YLQETYSK[MT7].2y5_1.heavy 660.358 / 771.401 20828.0 26.138900756835938 50 20 10 10 10 14.200518283241378 7.041996496565492 0.0 3 0.9986719766500209 33.8619091154543 20828.0 36.96207372537683 0.0 - - - - - - - 764.7 41 10 UBE2C ubiquitin-conjugating enzyme E2C 1803 229 B20140407_SF105_01 B20140407_SF105_01 TB360727.[MT7]-YLQETYSK[MT7].2y3_1.heavy 660.358 / 541.31 14944.0 26.138900756835938 50 20 10 10 10 14.200518283241378 7.041996496565492 0.0 3 0.9986719766500209 33.8619091154543 14944.0 18.67788328611898 0.0 - - - - - - - 794.0 29 8 UBE2C ubiquitin-conjugating enzyme E2C 1805 229 B20140407_SF105_01 B20140407_SF105_01 TB360727.[MT7]-YLQETYSK[MT7].2y7_1.heavy 660.358 / 1012.54 23417.0 26.138900756835938 50 20 10 10 10 14.200518283241378 7.041996496565492 0.0 3 0.9986719766500209 33.8619091154543 23417.0 55.06790878548226 0.0 - - - - - - - 282.4 46 10 UBE2C ubiquitin-conjugating enzyme E2C 1807 230 B20140407_SF105_01 B20140407_SF105_01 TB149838.[MT7]-LPQTLSR.2b3_1.heavy 479.794 / 483.305 18942.0 25.934149742126465 43 20 10 5 8 7.702689788199911 12.98247790702858 0.04509925842285156 4 0.9991823649324653 43.157176052144386 18942.0 8.946418931371891 0.0 - - - - - - - 1715.125 37 8 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1809 230 B20140407_SF105_01 B20140407_SF105_01 TB149838.[MT7]-LPQTLSR.2y5_1.heavy 479.794 / 604.341 44442.0 25.934149742126465 43 20 10 5 8 7.702689788199911 12.98247790702858 0.04509925842285156 4 0.9991823649324653 43.157176052144386 44442.0 37.718558406259596 1.0 - - - - - - - 364.0 137 1 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1811 230 B20140407_SF105_01 B20140407_SF105_01 TB149838.[MT7]-LPQTLSR.2b4_1.heavy 479.794 / 584.352 13964.0 25.934149742126465 43 20 10 5 8 7.702689788199911 12.98247790702858 0.04509925842285156 4 0.9991823649324653 43.157176052144386 13964.0 2.1410752671853412 3.0 - - - - - - - 2203.0 38 7 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1813 230 B20140407_SF105_01 B20140407_SF105_01 TB149838.[MT7]-LPQTLSR.2y6_1.heavy 479.794 / 701.394 1041120.0 25.934149742126465 43 20 10 5 8 7.702689788199911 12.98247790702858 0.04509925842285156 4 0.9991823649324653 43.157176052144386 1041120.0 474.0125081934551 0.0 - - - - - - - 1882.0 2082 2 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1815 231 B20140407_SF105_01 B20140407_SF105_01 TB499272.[MT7]-TYVYVLTVTEILEDWEDSVNIGRK[MT7].3y7_1.heavy 1044.22 / 917.565 N/A N/A - - - - - - - - - 0.0 - - - - - - - NUDT4 nudix (nucleoside diphosphate linked moiety X)-type motif 4 1817 231 B20140407_SF105_01 B20140407_SF105_01 TB499272.[MT7]-TYVYVLTVTEILEDWEDSVNIGRK[MT7].3b4_1.heavy 1044.22 / 671.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - NUDT4 nudix (nucleoside diphosphate linked moiety X)-type motif 4 1819 231 B20140407_SF105_01 B20140407_SF105_01 TB499272.[MT7]-TYVYVLTVTEILEDWEDSVNIGRK[MT7].3b3_1.heavy 1044.22 / 508.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - NUDT4 nudix (nucleoside diphosphate linked moiety X)-type motif 4 1821 231 B20140407_SF105_01 B20140407_SF105_01 TB499272.[MT7]-TYVYVLTVTEILEDWEDSVNIGRK[MT7].3y9_1.heavy 1044.22 / 1161.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - NUDT4 nudix (nucleoside diphosphate linked moiety X)-type motif 4 1823 232 B20140407_SF105_01 B20140407_SF105_01 TB498996.[MT7]-LFPWGNK[MT7].2y4_1.heavy 575.337 / 648.359 36649.0 33.84280014038086 30 10 2 10 8 0.7113097059930689 70.64077549240096 0.0 4 0.8464276127978022 3.108024062372504 36649.0 33.13910549343704 0.0 - - - - - - - 616.0 73 1 SUMF1 sulfatase modifying factor 1 1825 232 B20140407_SF105_01 B20140407_SF105_01 TB498996.[MT7]-LFPWGNK[MT7].2y3_1.heavy 575.337 / 462.279 54049.0 33.84280014038086 30 10 2 10 8 0.7113097059930689 70.64077549240096 0.0 4 0.8464276127978022 3.108024062372504 54049.0 17.512076297869477 1.0 - - - - - - - 2618.0 338 1 SUMF1 sulfatase modifying factor 1 1827 232 B20140407_SF105_01 B20140407_SF105_01 TB498996.[MT7]-LFPWGNK[MT7].2y6_1.heavy 575.337 / 892.48 74067.0 33.84280014038086 30 10 2 10 8 0.7113097059930689 70.64077549240096 0.0 4 0.8464276127978022 3.108024062372504 74067.0 47.74581810453279 0.0 - - - - - - - 1078.0 148 7 SUMF1 sulfatase modifying factor 1 1829 233 B20140407_SF105_01 B20140407_SF105_01 TB149967.[MT7]-VEGVWLK[MT7].2y5_1.heavy 559.844 / 746.468 16370.0 31.299699783325195 38 20 4 10 4 7.554801912366713 13.236614428805417 0.0 7 0.9960321289803854 19.58573571351502 16370.0 10.31498484301681 0.0 - - - - - - - 1299.2857142857142 32 7 IGSF22 immunoglobulin superfamily, member 22 1831 233 B20140407_SF105_01 B20140407_SF105_01 TB149967.[MT7]-VEGVWLK[MT7].2b4_1.heavy 559.844 / 529.31 26525.0 31.299699783325195 38 20 4 10 4 7.554801912366713 13.236614428805417 0.0 7 0.9960321289803854 19.58573571351502 26525.0 3.025473783511765 3.0 - - - - - - - 1213.0 105 1 IGSF22 immunoglobulin superfamily, member 22 1833 233 B20140407_SF105_01 B20140407_SF105_01 TB149967.[MT7]-VEGVWLK[MT7].2y3_1.heavy 559.844 / 590.378 30314.0 31.299699783325195 38 20 4 10 4 7.554801912366713 13.236614428805417 0.0 7 0.9960321289803854 19.58573571351502 30314.0 12.095065918879142 1.0 - - - - - - - 1174.75 80 4 IGSF22 immunoglobulin superfamily, member 22 1835 233 B20140407_SF105_01 B20140407_SF105_01 TB149967.[MT7]-VEGVWLK[MT7].2y6_1.heavy 559.844 / 875.511 23342.0 31.299699783325195 38 20 4 10 4 7.554801912366713 13.236614428805417 0.0 7 0.9960321289803854 19.58573571351502 23342.0 20.731527610730886 0.0 - - - - - - - 353.8333333333333 46 6 IGSF22 immunoglobulin superfamily, member 22 1837 234 B20140407_SF105_01 B20140407_SF105_01 TB498999.[MT7]-TC[CAM]WLAAFR.2b3_1.heavy 584.806 / 592.267 32176.0 35.61790084838867 50 20 10 10 10 8.082199815185792 12.372869056281953 0.0 3 0.9946656280867732 16.88991552988713 32176.0 36.85135039968311 0.0 - - - - - - - 449.0 64 2 GRB7 growth factor receptor-bound protein 7 1839 234 B20140407_SF105_01 B20140407_SF105_01 TB498999.[MT7]-TC[CAM]WLAAFR.2y5_1.heavy 584.806 / 577.346 49835.0 35.61790084838867 50 20 10 10 10 8.082199815185792 12.372869056281953 0.0 3 0.9946656280867732 16.88991552988713 49835.0 51.443046830821515 0.0 - - - - - - - 449.0 99 1 GRB7 growth factor receptor-bound protein 7 1841 234 B20140407_SF105_01 B20140407_SF105_01 TB498999.[MT7]-TC[CAM]WLAAFR.2y6_1.heavy 584.806 / 763.425 52828.0 35.61790084838867 50 20 10 10 10 8.082199815185792 12.372869056281953 0.0 3 0.9946656280867732 16.88991552988713 52828.0 106.86340006907805 0.0 - - - - - - - 239.4 105 5 GRB7 growth factor receptor-bound protein 7 1843 234 B20140407_SF105_01 B20140407_SF105_01 TB498999.[MT7]-TC[CAM]WLAAFR.2y7_1.heavy 584.806 / 923.456 100269.0 35.61790084838867 50 20 10 10 10 8.082199815185792 12.372869056281953 0.0 3 0.9946656280867732 16.88991552988713 100269.0 368.8377889384663 0.0 - - - - - - - 282.77777777777777 200 9 GRB7 growth factor receptor-bound protein 7 1845 235 B20140407_SF105_01 B20140407_SF105_01 TB499343.[MT7]-DITELLMQLLLASGHTFPC[CAM]QLDK[MT7].4y7_1.heavy 733.645 / 1051.54 7304.0 46.01739978790283 46 18 10 8 10 6.003545860294078 16.656822872192002 0.016399383544921875 3 0.98785732836739 11.188318082955755 7304.0 -4.536645962732919 0.0 - - - - - - - 123.33333333333333 14 27 ACTRT2 actin-related protein T2 1847 235 B20140407_SF105_01 B20140407_SF105_01 TB499343.[MT7]-DITELLMQLLLASGHTFPC[CAM]QLDK[MT7].4y3_1.heavy 733.645 / 519.326 13642.0 46.01739978790283 46 18 10 8 10 6.003545860294078 16.656822872192002 0.016399383544921875 3 0.98785732836739 11.188318082955755 13642.0 23.571989659658975 0.0 - - - - - - - 676.7 27 10 ACTRT2 actin-related protein T2 1849 235 B20140407_SF105_01 B20140407_SF105_01 TB499343.[MT7]-DITELLMQLLLASGHTFPC[CAM]QLDK[MT7].4y6_1.heavy 733.645 / 904.468 30829.0 46.01739978790283 46 18 10 8 10 6.003545860294078 16.656822872192002 0.016399383544921875 3 0.98785732836739 11.188318082955755 30829.0 68.89162011173184 0.0 - - - - - - - 254.42105263157896 61 19 ACTRT2 actin-related protein T2 1851 235 B20140407_SF105_01 B20140407_SF105_01 TB499343.[MT7]-DITELLMQLLLASGHTFPC[CAM]QLDK[MT7].4b6_1.heavy 733.645 / 829.479 48875.0 46.01739978790283 46 18 10 8 10 6.003545860294078 16.656822872192002 0.016399383544921875 3 0.98785732836739 11.188318082955755 48875.0 106.42393140184487 0.0 - - - - - - - 692.4444444444445 97 9 ACTRT2 actin-related protein T2 1853 236 B20140407_SF105_01 B20140407_SF105_01 TB149931.[MT7]-EDGISAAK[MT7].2y4_1.heavy 539.803 / 520.321 51713.0 21.322799682617188 50 20 10 10 10 4.956782132948798 20.174378723502585 0.0 3 0.99077735757107 12.841044172779933 51713.0 23.308260495089385 0.0 - - - - - - - 999.0 103 1 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1855 236 B20140407_SF105_01 B20140407_SF105_01 TB149931.[MT7]-EDGISAAK[MT7].2b4_1.heavy 539.803 / 559.284 26509.0 21.322799682617188 50 20 10 10 10 4.956782132948798 20.174378723502585 0.0 3 0.99077735757107 12.841044172779933 26509.0 21.72098810861668 0.0 - - - - - - - 409.6666666666667 53 3 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1857 236 B20140407_SF105_01 B20140407_SF105_01 TB149931.[MT7]-EDGISAAK[MT7].2y6_1.heavy 539.803 / 690.427 32503.0 21.322799682617188 50 20 10 10 10 4.956782132948798 20.174378723502585 0.0 3 0.99077735757107 12.841044172779933 32503.0 17.809084440145497 0.0 - - - - - - - 1734.4285714285713 65 7 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1859 236 B20140407_SF105_01 B20140407_SF105_01 TB149931.[MT7]-EDGISAAK[MT7].2y7_1.heavy 539.803 / 805.454 26048.0 21.322799682617188 50 20 10 10 10 4.956782132948798 20.174378723502585 0.0 3 0.99077735757107 12.841044172779933 26048.0 28.95164423833932 0.0 - - - - - - - 1258.125 52 8 GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1861 237 B20140407_SF105_01 B20140407_SF105_01 TB499346.[MT7]-LTQVSSLVSY[MT7]LGSISTLVTLPTGDIK[MT7].4y5_1.heavy 781.957 / 677.395 3972.0 42.770198822021484 41 13 10 10 8 2.8882083962264082 34.623540368712696 0.0 4 0.9143776922636345 4.18716723386835 3972.0 9.893626373626374 1.0 - - - - - - - 240.0 8 7 CEP68 centrosomal protein 68kDa 1863 237 B20140407_SF105_01 B20140407_SF105_01 TB499346.[MT7]-LTQVSSLVSY[MT7]LGSISTLVTLPTGDIK[MT7].4b7_1.heavy 781.957 / 873.516 1146.0 42.770198822021484 41 13 10 10 8 2.8882083962264082 34.623540368712696 0.0 4 0.9143776922636345 4.18716723386835 1146.0 -0.316690909090909 14.0 - - - - - - - 346.6923076923077 3 13 CEP68 centrosomal protein 68kDa 1865 237 B20140407_SF105_01 B20140407_SF105_01 TB499346.[MT7]-LTQVSSLVSY[MT7]LGSISTLVTLPTGDIK[MT7].4b4_1.heavy 781.957 / 586.368 6034.0 42.770198822021484 41 13 10 10 8 2.8882083962264082 34.623540368712696 0.0 4 0.9143776922636345 4.18716723386835 6034.0 9.469463074618679 0.0 - - - - - - - 381.75 12 4 CEP68 centrosomal protein 68kDa 1867 237 B20140407_SF105_01 B20140407_SF105_01 TB499346.[MT7]-LTQVSSLVSY[MT7]LGSISTLVTLPTGDIK[MT7].4y6_1.heavy 781.957 / 774.448 34678.0 42.770198822021484 41 13 10 10 8 2.8882083962264082 34.623540368712696 0.0 4 0.9143776922636345 4.18716723386835 34678.0 22.214118999843826 0.0 - - - - - - - 420.0 69 2 CEP68 centrosomal protein 68kDa 1869 238 B20140407_SF105_01 B20140407_SF105_01 TB150332.[MT7]-K[MT7]LC[CAM]YVALEPEK[MT7].3b6_2.heavy 594.678 / 512.299 149561.0 28.301300048828125 43 13 10 10 10 1.570901107122529 63.65773093328152 0.0 3 0.929965672118514 4.635953527502041 149561.0 112.6426118757558 0.0 - - - - - - - 904.5 299 2 ACTRT2 actin-related protein T2 1871 238 B20140407_SF105_01 B20140407_SF105_01 TB150332.[MT7]-K[MT7]LC[CAM]YVALEPEK[MT7].3b6_1.heavy 594.678 / 1023.59 12382.0 28.301300048828125 43 13 10 10 10 1.570901107122529 63.65773093328152 0.0 3 0.929965672118514 4.635953527502041 12382.0 51.75215304668294 0.0 - - - - - - - 265.3636363636364 24 11 ACTRT2 actin-related protein T2 1873 238 B20140407_SF105_01 B20140407_SF105_01 TB150332.[MT7]-K[MT7]LC[CAM]YVALEPEK[MT7].3y3_1.heavy 594.678 / 517.31 225245.0 28.301300048828125 43 13 10 10 10 1.570901107122529 63.65773093328152 0.0 3 0.929965672118514 4.635953527502041 225245.0 179.39901572035612 0.0 - - - - - - - 904.5 450 2 ACTRT2 actin-related protein T2 1875 238 B20140407_SF105_01 B20140407_SF105_01 TB150332.[MT7]-K[MT7]LC[CAM]YVALEPEK[MT7].3b4_1.heavy 594.678 / 853.484 15304.0 28.301300048828125 43 13 10 10 10 1.570901107122529 63.65773093328152 0.0 3 0.929965672118514 4.635953527502041 15304.0 41.55827586206897 1.0 - - - - - - - 303.27272727272725 30 11 ACTRT2 actin-related protein T2 1877 239 B20140407_SF105_01 B20140407_SF105_01 TB150080.[MT7]-ALLQDVLPK[MT7].3b6_1.heavy 428.943 / 784.469 58407.0 33.74720001220703 50 20 10 10 10 12.585286953581262 7.945786247769588 0.0 3 0.9949001435148936 17.274228083397972 58407.0 156.06498006318006 0.0 - - - - - - - 277.2 116 5 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1879 239 B20140407_SF105_01 B20140407_SF105_01 TB150080.[MT7]-ALLQDVLPK[MT7].3b4_1.heavy 428.943 / 570.373 60564.0 33.74720001220703 50 20 10 10 10 12.585286953581262 7.945786247769588 0.0 3 0.9949001435148936 17.274228083397972 60564.0 34.88931639841647 0.0 - - - - - - - 359.3333333333333 121 3 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1881 239 B20140407_SF105_01 B20140407_SF105_01 TB150080.[MT7]-ALLQDVLPK[MT7].3b5_1.heavy 428.943 / 685.4 275236.0 33.74720001220703 50 20 10 10 10 12.585286953581262 7.945786247769588 0.0 3 0.9949001435148936 17.274228083397972 275236.0 685.0502155631253 0.0 - - - - - - - 385.0 550 2 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1883 239 B20140407_SF105_01 B20140407_SF105_01 TB150080.[MT7]-ALLQDVLPK[MT7].3b3_1.heavy 428.943 / 442.315 124827.0 33.74720001220703 50 20 10 10 10 12.585286953581262 7.945786247769588 0.0 3 0.9949001435148936 17.274228083397972 124827.0 101.96794005201215 0.0 - - - - - - - 308.0 249 1 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1885 240 B20140407_SF105_01 B20140407_SF105_01 TB499345.[MT7]-ITAPPDRWFSTWIGASIVTSLSSFK[MT7].4y4_1.heavy 764.668 / 612.347 167140.0 45.159698486328125 50 20 10 10 10 94.6131810838239 1.056935184447541 0.0 3 0.9992597508069007 45.35723838366195 167140.0 119.95087658263236 0.0 - - - - - - - 310.0 334 1 ACTRT2 actin-related protein T2 1887 240 B20140407_SF105_01 B20140407_SF105_01 TB499345.[MT7]-ITAPPDRWFSTWIGASIVTSLSSFK[MT7].4b12_2.heavy 764.668 / 801.913 69439.0 45.159698486328125 50 20 10 10 10 94.6131810838239 1.056935184447541 0.0 3 0.9992597508069007 45.35723838366195 69439.0 130.44478811443932 0.0 - - - - - - - 708.7142857142857 138 7 ACTRT2 actin-related protein T2 1889 240 B20140407_SF105_01 B20140407_SF105_01 TB499345.[MT7]-ITAPPDRWFSTWIGASIVTSLSSFK[MT7].4y7_1.heavy 764.668 / 913.511 62258.0 45.159698486328125 50 20 10 10 10 94.6131810838239 1.056935184447541 0.0 3 0.9992597508069007 45.35723838366195 62258.0 121.9142829275905 0.0 - - - - - - - 348.5 124 8 ACTRT2 actin-related protein T2 1891 240 B20140407_SF105_01 B20140407_SF105_01 TB499345.[MT7]-ITAPPDRWFSTWIGASIVTSLSSFK[MT7].4y3_1.heavy 764.668 / 525.315 79101.0 45.159698486328125 50 20 10 10 10 94.6131810838239 1.056935184447541 0.0 3 0.9992597508069007 45.35723838366195 79101.0 94.70919764082812 0.0 - - - - - - - 756.2727272727273 158 11 ACTRT2 actin-related protein T2 1893 241 B20140407_SF105_01 B20140407_SF105_01 TB150331.[MT7]-K[MT7]LC[CAM]YVALEPEK[MT7].4b4_1.heavy 446.26 / 853.484 15033.0 28.301300048828125 38 8 10 10 10 0.6553526453016695 81.61554849009286 0.0 3 0.7773757577116804 2.5654791255816773 15033.0 126.49792916833499 0.0 - - - - - - - 243.5 30 8 ACTRT2 actin-related protein T2 1895 241 B20140407_SF105_01 B20140407_SF105_01 TB150331.[MT7]-K[MT7]LC[CAM]YVALEPEK[MT7].4b5_2.heavy 446.26 / 476.78 196262.0 28.301300048828125 38 8 10 10 10 0.6553526453016695 81.61554849009286 0.0 3 0.7773757577116804 2.5654791255816773 196262.0 85.1797484922609 0.0 - - - - - - - 730.75 392 4 ACTRT2 actin-related protein T2 1897 241 B20140407_SF105_01 B20140407_SF105_01 TB150331.[MT7]-K[MT7]LC[CAM]YVALEPEK[MT7].4y3_1.heavy 446.26 / 517.31 187214.0 28.301300048828125 38 8 10 10 10 0.6553526453016695 81.61554849009286 0.0 3 0.7773757577116804 2.5654791255816773 187214.0 63.17592598659401 0.0 - - - - - - - 835.0 374 1 ACTRT2 actin-related protein T2 1899 241 B20140407_SF105_01 B20140407_SF105_01 TB150331.[MT7]-K[MT7]LC[CAM]YVALEPEK[MT7].4b6_2.heavy 446.26 / 512.299 286180.0 28.301300048828125 38 8 10 10 10 0.6553526453016695 81.61554849009286 0.0 3 0.7773757577116804 2.5654791255816773 286180.0 214.14025849277635 0.0 - - - - - - - 779.4 572 5 ACTRT2 actin-related protein T2 1901 242 B20140407_SF105_01 B20140407_SF105_01 TB150496.[MT7]-NLSQERPFPWFDLTAVQLK[MT7].3y3_1.heavy 859.807 / 532.357 47753.0 39.2848014831543 41 11 10 10 10 1.6721212595223283 59.804275216599315 0.0 3 0.8580370558410315 3.23592057505966 47753.0 106.5452549481729 0.0 - - - - - - - 1589.857142857143 95 7 C14orf148 chromosome 14 open reading frame 148 1903 242 B20140407_SF105_01 B20140407_SF105_01 TB150496.[MT7]-NLSQERPFPWFDLTAVQLK[MT7].3y8_1.heavy 859.807 / 1031.62 20399.0 39.2848014831543 41 11 10 10 10 1.6721212595223283 59.804275216599315 0.0 3 0.8580370558410315 3.23592057505966 20399.0 71.66028017241379 0.0 - - - - - - - 306.57142857142856 40 14 C14orf148 chromosome 14 open reading frame 148 1905 242 B20140407_SF105_01 B20140407_SF105_01 TB150496.[MT7]-NLSQERPFPWFDLTAVQLK[MT7].3b8_1.heavy 859.807 / 1116.59 12402.0 39.2848014831543 41 11 10 10 10 1.6721212595223283 59.804275216599315 0.0 3 0.8580370558410315 3.23592057505966 12402.0 41.37563793103449 0.0 - - - - - - - 266.8 24 10 C14orf148 chromosome 14 open reading frame 148 1907 242 B20140407_SF105_01 B20140407_SF105_01 TB150496.[MT7]-NLSQERPFPWFDLTAVQLK[MT7].3b12_2.heavy 859.807 / 831.413 92608.0 39.2848014831543 41 11 10 10 10 1.6721212595223283 59.804275216599315 0.0 3 0.8580370558410315 3.23592057505966 92608.0 129.96082439056096 0.0 - - - - - - - 464.0 185 2 C14orf148 chromosome 14 open reading frame 148 1909 243 B20140407_SF105_01 B20140407_SF105_01 TB360457.[MT7]-LQEESR.2y4_1.heavy 453.244 / 520.236 17726.0 19.511749267578125 42 16 10 6 10 2.4537600053427444 32.443740771235575 0.0373992919921875 3 0.9686982702103886 6.9572690023704045 17726.0 17.420433975763537 1.0 - - - - - - - 1212.375 35 8 FUT6 fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1911 243 B20140407_SF105_01 B20140407_SF105_01 TB360457.[MT7]-LQEESR.2b3_1.heavy 453.244 / 515.295 35384.0 19.511749267578125 42 16 10 6 10 2.4537600053427444 32.443740771235575 0.0373992919921875 3 0.9686982702103886 6.9572690023704045 35384.0 26.88009104014229 0.0 - - - - - - - 702.5 70 2 FUT6 fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1913 243 B20140407_SF105_01 B20140407_SF105_01 TB360457.[MT7]-LQEESR.2y5_1.heavy 453.244 / 648.295 75451.0 19.511749267578125 42 16 10 6 10 2.4537600053427444 32.443740771235575 0.0373992919921875 3 0.9686982702103886 6.9572690023704045 75451.0 66.03671674281401 0.0 - - - - - - - 468.0 150 1 FUT6 fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1915 243 B20140407_SF105_01 B20140407_SF105_01 TB360457.[MT7]-LQEESR.2b4_1.heavy 453.244 / 644.337 65418.0 19.511749267578125 42 16 10 6 10 2.4537600053427444 32.443740771235575 0.0373992919921875 3 0.9686982702103886 6.9572690023704045 65418.0 61.880260243632335 0.0 - - - - - - - 268.0 130 2 FUT6 fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1917 244 B20140407_SF105_01 B20140407_SF105_01 TB499285.[MT7]-TYYANPAVVRPHAQIPQR.4y8_1.heavy 557.057 / 946.522 38922.0 25.304500579833984 37 7 10 10 10 0.8418334485594937 70.64429886114866 0.0 3 0.7484349468934026 2.4070279107150436 38922.0 109.71215439333926 0.0 - - - - - - - 365.42857142857144 77 7 CSN3 casein kappa 1919 244 B20140407_SF105_01 B20140407_SF105_01 TB499285.[MT7]-TYYANPAVVRPHAQIPQR.4y11_2.heavy 557.057 / 650.883 301923.0 25.304500579833984 37 7 10 10 10 0.8418334485594937 70.64429886114866 0.0 3 0.7484349468934026 2.4070279107150436 301923.0 292.4883718760269 0.0 - - - - - - - 667.0 603 2 CSN3 casein kappa 1921 244 B20140407_SF105_01 B20140407_SF105_01 TB499285.[MT7]-TYYANPAVVRPHAQIPQR.4b4_1.heavy 557.057 / 643.321 157689.0 25.304500579833984 37 7 10 10 10 0.8418334485594937 70.64429886114866 0.0 3 0.7484349468934026 2.4070279107150436 157689.0 103.87455865660544 0.0 - - - - - - - 667.0 315 2 CSN3 casein kappa 1923 244 B20140407_SF105_01 B20140407_SF105_01 TB499285.[MT7]-TYYANPAVVRPHAQIPQR.4b3_1.heavy 557.057 / 572.284 180486.0 25.304500579833984 37 7 10 10 10 0.8418334485594937 70.64429886114866 0.0 3 0.7484349468934026 2.4070279107150436 180486.0 168.82372793903605 0.0 - - - - - - - 667.0 360 1 CSN3 casein kappa 1925 245 B20140407_SF105_01 B20140407_SF105_01 TB499286.[MT7]-LYAYEPADTALLLDNMK[MT7].3b4_1.heavy 743.729 / 655.357 15901.0 37.777000427246094 42 12 10 10 10 2.2622512936847325 44.203754144890326 0.0 3 0.8947174612860183 3.7696248973245963 15901.0 20.978246523174697 0.0 - - - - - - - 265.3333333333333 31 3 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1927 245 B20140407_SF105_01 B20140407_SF105_01 TB499286.[MT7]-LYAYEPADTALLLDNMK[MT7].3b5_1.heavy 743.729 / 784.4 79372.0 37.777000427246094 42 12 10 10 10 2.2622512936847325 44.203754144890326 0.0 3 0.8947174612860183 3.7696248973245963 79372.0 66.80462904762426 0.0 - - - - - - - 1249.5714285714287 158 7 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1929 245 B20140407_SF105_01 B20140407_SF105_01 TB499286.[MT7]-LYAYEPADTALLLDNMK[MT7].3y4_1.heavy 743.729 / 651.325 58171.0 37.777000427246094 42 12 10 10 10 2.2622512936847325 44.203754144890326 0.0 3 0.8947174612860183 3.7696248973245963 58171.0 106.150788679293 0.0 - - - - - - - 738.5714285714286 116 7 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1931 245 B20140407_SF105_01 B20140407_SF105_01 TB499286.[MT7]-LYAYEPADTALLLDNMK[MT7].3y5_1.heavy 743.729 / 764.409 57243.0 37.777000427246094 42 12 10 10 10 2.2622512936847325 44.203754144890326 0.0 3 0.8947174612860183 3.7696248973245963 57243.0 53.61008233276158 0.0 - - - - - - - 265.0 114 1 AGR2 anterior gradient homolog 2 (Xenopus laevis) 1933 246 B20140407_SF105_01 B20140407_SF105_01 TB499289.[MT7]-FLPPDAFIHVDDFQSPK[MT7].3y7_1.heavy 754.4 / 980.481 18798.0 35.8577995300293 48 18 10 10 10 4.138811830702334 19.33530203709184 0.0 3 0.9845434228430034 9.913904305881356 18798.0 31.674300722857186 0.0 - - - - - - - 418.0 37 5 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1935 246 B20140407_SF105_01 B20140407_SF105_01 TB499289.[MT7]-FLPPDAFIHVDDFQSPK[MT7].3b6_1.heavy 754.4 / 785.431 14024.0 35.8577995300293 48 18 10 10 10 4.138811830702334 19.33530203709184 0.0 3 0.9845434228430034 9.913904305881356 14024.0 10.288641682547372 0.0 - - - - - - - 298.0 28 1 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1937 246 B20140407_SF105_01 B20140407_SF105_01 TB499289.[MT7]-FLPPDAFIHVDDFQSPK[MT7].3b5_1.heavy 754.4 / 714.394 14770.0 35.8577995300293 48 18 10 10 10 4.138811830702334 19.33530203709184 0.0 3 0.9845434228430034 9.913904305881356 14770.0 13.754025450596831 0.0 - - - - - - - 448.0 29 1 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1939 246 B20140407_SF105_01 B20140407_SF105_01 TB499289.[MT7]-FLPPDAFIHVDDFQSPK[MT7].3y5_1.heavy 754.4 / 750.427 15665.0 35.8577995300293 48 18 10 10 10 4.138811830702334 19.33530203709184 0.0 3 0.9845434228430034 9.913904305881356 15665.0 15.046660996607919 0.0 - - - - - - - 895.0 31 3 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 1941 247 B20140407_SF105_01 B20140407_SF105_01 TB361024.[MT7]-AGAGPSPAGDDVTFPEFLR.3y7_1.heavy 683.345 / 909.483 101087.0 35.8577995300293 44 14 10 10 10 1.4074008333425483 47.368642313742754 0.0 3 0.9445722643418227 5.217615876529996 101087.0 178.18991743937326 0.0 - - - - - - - 144.0 202 2 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1943 247 B20140407_SF105_01 B20140407_SF105_01 TB361024.[MT7]-AGAGPSPAGDDVTFPEFLR.3y6_1.heavy 683.345 / 808.435 57723.0 35.8577995300293 44 14 10 10 10 1.4074008333425483 47.368642313742754 0.0 3 0.9445722643418227 5.217615876529996 57723.0 105.37673578582285 0.0 - - - - - - - 287.0 115 1 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1945 247 B20140407_SF105_01 B20140407_SF105_01 TB361024.[MT7]-AGAGPSPAGDDVTFPEFLR.3b6_1.heavy 683.345 / 585.311 156226.0 35.8577995300293 44 14 10 10 10 1.4074008333425483 47.368642313742754 0.0 3 0.9445722643418227 5.217615876529996 156226.0 126.46692821941915 0.0 - - - - - - - 862.0 312 2 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1947 247 B20140407_SF105_01 B20140407_SF105_01 TB361024.[MT7]-AGAGPSPAGDDVTFPEFLR.3y5_1.heavy 683.345 / 661.367 149621.0 35.8577995300293 44 14 10 10 10 1.4074008333425483 47.368642313742754 0.0 3 0.9445722643418227 5.217615876529996 149621.0 132.53708801139734 0.0 - - - - - - - 718.0 299 2 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 1949 248 B20140407_SF105_01 B20140407_SF105_01 TB499347.[MT7]-ATSLPSIPNPFPELC[CAM]SPPSQSPILGGPSSAR.4y8_1.heavy 827.179 / 744.4 17914.0 38.095298767089844 44 14 10 10 10 1.5584980687759173 44.46451879370194 0.0 3 0.9397406778617671 5.002013849624157 17914.0 23.966961338437777 0.0 - - - - - - - 787.4285714285714 35 7 GRB7 growth factor receptor-bound protein 7 1951 248 B20140407_SF105_01 B20140407_SF105_01 TB499347.[MT7]-ATSLPSIPNPFPELC[CAM]SPPSQSPILGGPSSAR.4y10_1.heavy 827.179 / 954.537 14155.0 38.095298767089844 44 14 10 10 10 1.5584980687759173 44.46451879370194 0.0 3 0.9397406778617671 5.002013849624157 14155.0 15.493463647685601 1.0 - - - - - - - 733.7142857142857 34 7 GRB7 growth factor receptor-bound protein 7 1953 248 B20140407_SF105_01 B20140407_SF105_01 TB499347.[MT7]-ATSLPSIPNPFPELC[CAM]SPPSQSPILGGPSSAR.4y11_1.heavy 827.179 / 1041.57 5762.0 38.095298767089844 44 14 10 10 10 1.5584980687759173 44.46451879370194 0.0 3 0.9397406778617671 5.002013849624157 5762.0 18.434937465494542 0.0 - - - - - - - 598.5555555555555 11 9 GRB7 growth factor receptor-bound protein 7 1955 248 B20140407_SF105_01 B20140407_SF105_01 TB499347.[MT7]-ATSLPSIPNPFPELC[CAM]SPPSQSPILGGPSSAR.4y7_1.heavy 827.179 / 631.316 27058.0 38.095298767089844 44 14 10 10 10 1.5584980687759173 44.46451879370194 0.0 3 0.9397406778617671 5.002013849624157 27058.0 35.54118494453121 0.0 - - - - - - - 802.0 54 5 GRB7 growth factor receptor-bound protein 7 1957 249 B20140407_SF105_01 B20140407_SF105_01 TB499348.[MT7]-NDPLFFK[MT7]PGSQFLYSTFGYTLLAAIVER.4y9_1.heavy 871.471 / 985.604 N/A N/A - - - - - - - - - 0.0 - - - - - - - LACTB lactamase, beta 1959 249 B20140407_SF105_01 B20140407_SF105_01 TB499348.[MT7]-NDPLFFK[MT7]PGSQFLYSTFGYTLLAAIVER.4b12_2.heavy 871.471 / 833.945 N/A N/A - - - - - - - - - 0.0 - - - - - - - LACTB lactamase, beta 1961 249 B20140407_SF105_01 B20140407_SF105_01 TB499348.[MT7]-NDPLFFK[MT7]PGSQFLYSTFGYTLLAAIVER.4y7_1.heavy 871.471 / 771.472 N/A N/A - - - - - - - - - 0.0 - - - - - - - LACTB lactamase, beta 1963 249 B20140407_SF105_01 B20140407_SF105_01 TB499348.[MT7]-NDPLFFK[MT7]PGSQFLYSTFGYTLLAAIVER.4y6_1.heavy 871.471 / 658.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - LACTB lactamase, beta 1965 250 B20140407_SF105_01 B20140407_SF105_01 TB498987.[MT7]-AGLSGEFGPR.2y8_1.heavy 567.805 / 862.442 11636.0 27.306400299072266 47 17 10 10 10 4.377150343876386 22.845913926602854 0.0 3 0.9710805688354037 7.239611708357627 11636.0 10.885603590584399 0.0 - - - - - - - 1239.5 23 8 ACTRT2 actin-related protein T2 1967 250 B20140407_SF105_01 B20140407_SF105_01 TB498987.[MT7]-AGLSGEFGPR.2y9_1.heavy 567.805 / 919.463 80656.0 27.306400299072266 47 17 10 10 10 4.377150343876386 22.845913926602854 0.0 3 0.9710805688354037 7.239611708357627 80656.0 63.487153878733515 0.0 - - - - - - - 264.3333333333333 161 6 ACTRT2 actin-related protein T2 1969 250 B20140407_SF105_01 B20140407_SF105_01 TB498987.[MT7]-AGLSGEFGPR.2b6_1.heavy 567.805 / 659.348 52096.0 27.306400299072266 47 17 10 10 10 4.377150343876386 22.845913926602854 0.0 3 0.9710805688354037 7.239611708357627 52096.0 26.072739367582397 0.0 - - - - - - - 859.5 104 2 ACTRT2 actin-related protein T2 1971 250 B20140407_SF105_01 B20140407_SF105_01 TB498987.[MT7]-AGLSGEFGPR.2y7_1.heavy 567.805 / 749.358 69021.0 27.306400299072266 47 17 10 10 10 4.377150343876386 22.845913926602854 0.0 3 0.9710805688354037 7.239611708357627 69021.0 60.936176446127156 0.0 - - - - - - - 661.0 138 1 ACTRT2 actin-related protein T2 1973 251 B20140407_SF105_01 B20140407_SF105_01 TB499282.[MT7]-TNIQQAVAAAPWWLPVK[MT7].4b7_1.heavy 546.066 / 899.507 26230.0 38.944000244140625 48 18 10 10 10 4.006853998781568 19.81111659730073 0.0 3 0.9866034925580399 10.650758660645064 26230.0 104.94919309961047 0.0 - - - - - - - 259.6666666666667 52 6 SUMF1 sulfatase modifying factor 1 1975 251 B20140407_SF105_01 B20140407_SF105_01 TB499282.[MT7]-TNIQQAVAAAPWWLPVK[MT7].4b4_1.heavy 546.066 / 601.343 96296.0 38.944000244140625 48 18 10 10 10 4.006853998781568 19.81111659730073 0.0 3 0.9866034925580399 10.650758660645064 96296.0 188.0992200954914 0.0 - - - - - - - 769.8571428571429 192 7 SUMF1 sulfatase modifying factor 1 1977 251 B20140407_SF105_01 B20140407_SF105_01 TB499282.[MT7]-TNIQQAVAAAPWWLPVK[MT7].4b5_1.heavy 546.066 / 729.401 53657.0 38.944000244140625 48 18 10 10 10 4.006853998781568 19.81111659730073 0.0 3 0.9866034925580399 10.650758660645064 53657.0 84.02190770970141 0.0 - - - - - - - 823.375 107 8 SUMF1 sulfatase modifying factor 1 1979 251 B20140407_SF105_01 B20140407_SF105_01 TB499282.[MT7]-TNIQQAVAAAPWWLPVK[MT7].4b6_1.heavy 546.066 / 800.438 71743.0 38.944000244140625 48 18 10 10 10 4.006853998781568 19.81111659730073 0.0 3 0.9866034925580399 10.650758660645064 71743.0 389.69038997214477 0.0 - - - - - - - 279.55555555555554 143 9 SUMF1 sulfatase modifying factor 1 1981 252 B20140407_SF105_01 B20140407_SF105_01 TB360716.[MT7]-DASRPHVVK[MT7].3b6_1.heavy 432.926 / 808.418 2961.0 19.038799285888672 40 10 10 10 10 0.7546074779719777 67.87317713446359 0.0 3 0.8292312273565562 2.9428943653205897 2961.0 30.321335983408233 0.0 - - - - - - - 123.5 5 16 GRB7 growth factor receptor-bound protein 7 1983 252 B20140407_SF105_01 B20140407_SF105_01 TB360716.[MT7]-DASRPHVVK[MT7].3y3_1.heavy 432.926 / 489.352 31118.0 19.038799285888672 40 10 10 10 10 0.7546074779719777 67.87317713446359 0.0 3 0.8292312273565562 2.9428943653205897 31118.0 33.76330833631485 0.0 - - - - - - - 1795.142857142857 62 7 GRB7 growth factor receptor-bound protein 7 1985 252 B20140407_SF105_01 B20140407_SF105_01 TB360716.[MT7]-DASRPHVVK[MT7].3y8_2.heavy 432.926 / 519.32 56908.0 19.038799285888672 40 10 10 10 10 0.7546074779719777 67.87317713446359 0.0 3 0.8292312273565562 2.9428943653205897 56908.0 38.244310258879125 0.0 - - - - - - - 1691.0 113 10 GRB7 growth factor receptor-bound protein 7 1987 252 B20140407_SF105_01 B20140407_SF105_01 TB360716.[MT7]-DASRPHVVK[MT7].3y5_1.heavy 432.926 / 723.463 20658.0 19.038799285888672 40 10 10 10 10 0.7546074779719777 67.87317713446359 0.0 3 0.8292312273565562 2.9428943653205897 20658.0 117.76163642489291 0.0 - - - - - - - 259.9 41 20 GRB7 growth factor receptor-bound protein 7 1989 253 B20140407_SF105_01 B20140407_SF105_01 TB360715.[MT7]-VGIIGGGHLGK[MT7].3b6_1.heavy 432.606 / 641.41 40255.0 26.912500381469727 50 20 10 10 10 9.798843299173905 10.205286169688064 0.0 3 0.9960766940412691 19.696732616978448 40255.0 66.77187797902765 0.0 - - - - - - - 715.3636363636364 80 11 C14orf148 chromosome 14 open reading frame 148 1991 253 B20140407_SF105_01 B20140407_SF105_01 TB360715.[MT7]-VGIIGGGHLGK[MT7].3y3_1.heavy 432.606 / 461.32 256740.0 26.912500381469727 50 20 10 10 10 9.798843299173905 10.205286169688064 0.0 3 0.9960766940412691 19.696732616978448 256740.0 78.95223583657089 0.0 - - - - - - - 918.0 513 1 C14orf148 chromosome 14 open reading frame 148 1993 253 B20140407_SF105_01 B20140407_SF105_01 TB360715.[MT7]-VGIIGGGHLGK[MT7].3b4_1.heavy 432.606 / 527.367 51007.0 26.912500381469727 50 20 10 10 10 9.798843299173905 10.205286169688064 0.0 3 0.9960766940412691 19.696732616978448 51007.0 9.24577800524321 0.0 - - - - - - - 1442.0 102 2 C14orf148 chromosome 14 open reading frame 148 1995 253 B20140407_SF105_01 B20140407_SF105_01 TB360715.[MT7]-VGIIGGGHLGK[MT7].3b7_1.heavy 432.606 / 698.432 135451.0 26.912500381469727 50 20 10 10 10 9.798843299173905 10.205286169688064 0.0 3 0.9960766940412691 19.696732616978448 135451.0 462.67659349066173 0.0 - - - - - - - 694.8 270 10 C14orf148 chromosome 14 open reading frame 148 1997 254 B20140407_SF105_01 B20140407_SF105_01 TB150091.[MT7]-QYPPVTLVSR.2y8_1.heavy 652.378 / 868.525 64840.0 29.0856990814209 50 20 10 10 10 31.30864003725307 3.1940065068624333 0.0 3 0.9992859871755333 46.18314658407696 64840.0 34.25630077881882 0.0 - - - - - - - 437.0 129 1 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 1999 254 B20140407_SF105_01 B20140407_SF105_01 TB150091.[MT7]-QYPPVTLVSR.2y5_1.heavy 652.378 / 575.351 5100.0 29.0856990814209 50 20 10 10 10 31.30864003725307 3.1940065068624333 0.0 3 0.9992859871755333 46.18314658407696 5100.0 2.4741031271680036 6.0 - - - - - - - 1249.0 20 7 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 2001 254 B20140407_SF105_01 B20140407_SF105_01 TB150091.[MT7]-QYPPVTLVSR.2y9_1.heavy 652.378 / 1031.59 33659.0 29.0856990814209 50 20 10 10 10 31.30864003725307 3.1940065068624333 0.0 3 0.9992859871755333 46.18314658407696 33659.0 58.64763974514291 0.0 - - - - - - - 291.0 67 2 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 2003 254 B20140407_SF105_01 B20140407_SF105_01 TB150091.[MT7]-QYPPVTLVSR.2y7_1.heavy 652.378 / 771.472 13988.0 29.0856990814209 50 20 10 10 10 31.30864003725307 3.1940065068624333 0.0 3 0.9992859871755333 46.18314658407696 13988.0 13.765827091724692 0.0 - - - - - - - 437.0 27 1 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 2005 255 B20140407_SF105_01 B20140407_SF105_01 TB150469.[MT7]-FYLAFENSLHPDYITEK[MT7].3y7_1.heavy 792.41 / 1009.53 40521.0 35.90700149536133 48 18 10 10 10 5.152526608246293 19.4079541171037 0.0 3 0.9827905156445661 9.394066590364949 40521.0 44.885671702735806 0.0 - - - - - - - 370.75 81 4 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 2007 255 B20140407_SF105_01 B20140407_SF105_01 TB150469.[MT7]-FYLAFENSLHPDYITEK[MT7].3y3_1.heavy 792.41 / 521.305 18554.0 35.90700149536133 48 18 10 10 10 5.152526608246293 19.4079541171037 0.0 3 0.9827905156445661 9.394066590364949 18554.0 8.666074843038256 0.0 - - - - - - - 594.0 37 1 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 2009 255 B20140407_SF105_01 B20140407_SF105_01 TB150469.[MT7]-FYLAFENSLHPDYITEK[MT7].3b4_1.heavy 792.41 / 639.362 21819.0 35.90700149536133 48 18 10 10 10 5.152526608246293 19.4079541171037 0.0 3 0.9827905156445661 9.394066590364949 21819.0 16.137680608042473 0.0 - - - - - - - 445.0 43 1 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 2011 255 B20140407_SF105_01 B20140407_SF105_01 TB150469.[MT7]-FYLAFENSLHPDYITEK[MT7].3b3_1.heavy 792.41 / 568.325 14843.0 35.90700149536133 48 18 10 10 10 5.152526608246293 19.4079541171037 0.0 3 0.9827905156445661 9.394066590364949 14843.0 9.133808391978658 0.0 - - - - - - - 816.5 29 4 FUT3;FUT5;FUT6 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase 5 (alpha (1,3) fucosyltransferase);fucosyltransferase 6 (alpha (1,3) fucosyltransferase) 2013 256 B20140407_SF105_01 B20140407_SF105_01 TB149941.[MT7]-AGDADLQVR.2y4_1.heavy 544.794 / 515.33 107143.0 23.32902479171753 46 20 10 6 10 7.671104390107766 13.035932626461776 0.03690147399902344 3 0.9947163382237608 16.97084463225418 107143.0 26.381824786333038 0.0 - - - - - - - 1034.0 214 1 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 2015 256 B20140407_SF105_01 B20140407_SF105_01 TB149941.[MT7]-AGDADLQVR.2y8_1.heavy 544.794 / 873.443 52350.0 23.32902479171753 46 20 10 6 10 7.671104390107766 13.035932626461776 0.03690147399902344 3 0.9947163382237608 16.97084463225418 52350.0 82.07166853303471 0.0 - - - - - - - 684.8571428571429 104 7 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 2017 256 B20140407_SF105_01 B20140407_SF105_01 TB149941.[MT7]-AGDADLQVR.2y6_1.heavy 544.794 / 701.394 82707.0 23.32902479171753 46 20 10 6 10 7.671104390107766 13.035932626461776 0.03690147399902344 3 0.9947163382237608 16.97084463225418 82707.0 71.96011778115502 0.0 - - - - - - - 834.25 165 8 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 2019 256 B20140407_SF105_01 B20140407_SF105_01 TB149941.[MT7]-AGDADLQVR.2b5_1.heavy 544.794 / 574.259 97275.0 23.32902479171753 46 20 10 6 10 7.671104390107766 13.035932626461776 0.03690147399902344 3 0.9947163382237608 16.97084463225418 97275.0 21.448939676811094 0.0 - - - - - - - 1799.4285714285713 194 7 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 2021 257 B20140407_SF105_01 B20140407_SF105_01 TB150462.[MT7]-MVPIPAGVFTMGTDDPQIK[MT7].3b4_1.heavy 769.077 / 585.355 19762.0 37.40144920349121 45 20 10 5 10 4.96450298865301 20.143003283221393 0.044498443603515625 3 0.9904639598213433 12.62794285393306 19762.0 21.80750023527903 0.0 - - - - - - - 1286.5714285714287 39 7 SUMF1 sulfatase modifying factor 1 2023 257 B20140407_SF105_01 B20140407_SF105_01 TB150462.[MT7]-MVPIPAGVFTMGTDDPQIK[MT7].3y4_1.heavy 769.077 / 629.41 23930.0 37.40144920349121 45 20 10 5 10 4.96450298865301 20.143003283221393 0.044498443603515625 3 0.9904639598213433 12.62794285393306 23930.0 22.234983308556778 0.0 - - - - - - - 403.0 47 1 SUMF1 sulfatase modifying factor 1 2025 257 B20140407_SF105_01 B20140407_SF105_01 TB150462.[MT7]-MVPIPAGVFTMGTDDPQIK[MT7].3b8_1.heavy 769.077 / 909.535 7125.0 37.40144920349121 45 20 10 5 10 4.96450298865301 20.143003283221393 0.044498443603515625 3 0.9904639598213433 12.62794285393306 7125.0 20.130111524163567 0.0 - - - - - - - 657.3333333333334 14 9 SUMF1 sulfatase modifying factor 1 2027 257 B20140407_SF105_01 B20140407_SF105_01 TB150462.[MT7]-MVPIPAGVFTMGTDDPQIK[MT7].3b7_1.heavy 769.077 / 810.466 10217.0 37.40144920349121 45 20 10 5 10 4.96450298865301 20.143003283221393 0.044498443603515625 3 0.9904639598213433 12.62794285393306 10217.0 17.30067469982481 0.0 - - - - - - - 689.125 20 8 SUMF1 sulfatase modifying factor 1 2029 258 B20140407_SF105_01 B20140407_SF105_01 TB360981.[MT7]-SVFAVNWISYLASK[MT7].3y6_1.heavy 625.02 / 812.463 17381.0 42.0172004699707 33 15 0 10 8 1.366123936098117 43.95017476856454 0.0 4 0.9589830087829515 6.072740521376267 17381.0 43.378991296903976 1.0 - - - - - - - 796.3333333333334 236 12 FAP fibroblast activation protein, alpha 2031 258 B20140407_SF105_01 B20140407_SF105_01 TB360981.[MT7]-SVFAVNWISYLASK[MT7].3b6_1.heavy 625.02 / 762.427 25432.0 42.0172004699707 33 15 0 10 8 1.366123936098117 43.95017476856454 0.0 4 0.9589830087829515 6.072740521376267 25432.0 53.15550960118168 0.0 - - - - - - - 644.8571428571429 50 7 FAP fibroblast activation protein, alpha 2033 258 B20140407_SF105_01 B20140407_SF105_01 TB360981.[MT7]-SVFAVNWISYLASK[MT7].3b4_1.heavy 625.02 / 549.315 16403.0 42.0172004699707 33 15 0 10 8 1.366123936098117 43.95017476856454 0.0 4 0.9589830087829515 6.072740521376267 16403.0 45.839925737736955 0.0 - - - - - - - 711.4545454545455 32 11 FAP fibroblast activation protein, alpha 2035 258 B20140407_SF105_01 B20140407_SF105_01 TB360981.[MT7]-SVFAVNWISYLASK[MT7].3b5_1.heavy 625.02 / 648.384 13920.0 42.0172004699707 33 15 0 10 8 1.366123936098117 43.95017476856454 0.0 4 0.9589830087829515 6.072740521376267 13920.0 35.378073089701 0.0 - - - - - - - 724.375 27 8 FAP fibroblast activation protein, alpha 2037 259 B20140407_SF105_01 B20140407_SF105_01 TB498873.[MT7]-TVIEFR.2b3_1.heavy 454.77 / 458.31 184483.0 28.855499267578125 42 12 10 10 10 1.5715708037976308 49.979534807585594 0.0 3 0.8993242149980435 3.856444620735384 184483.0 88.3061388478582 0.0 - - - - - - - 775.5 368 2 GSG1L GSG1-like 2039 259 B20140407_SF105_01 B20140407_SF105_01 TB498873.[MT7]-TVIEFR.2y4_1.heavy 454.77 / 564.314 184483.0 28.855499267578125 42 12 10 10 10 1.5715708037976308 49.979534807585594 0.0 3 0.8993242149980435 3.856444620735384 184483.0 90.28932520798962 0.0 - - - - - - - 846.0 368 2 GSG1L GSG1-like 2041 259 B20140407_SF105_01 B20140407_SF105_01 TB498873.[MT7]-TVIEFR.2y5_1.heavy 454.77 / 663.382 367698.0 28.855499267578125 42 12 10 10 10 1.5715708037976308 49.979534807585594 0.0 3 0.8993242149980435 3.856444620735384 367698.0 382.187023044538 0.0 - - - - - - - 423.0 735 1 GSG1L GSG1-like 2043 259 B20140407_SF105_01 B20140407_SF105_01 TB498873.[MT7]-TVIEFR.2b4_1.heavy 454.77 / 587.352 564072.0 28.855499267578125 42 12 10 10 10 1.5715708037976308 49.979534807585594 0.0 3 0.8993242149980435 3.856444620735384 564072.0 435.551934908267 0.0 - - - - - - - 846.0 1128 1 GSG1L GSG1-like 2045 260 B20140407_SF105_01 B20140407_SF105_01 TB498870.[MT7]-IASISK[MT7].2y4_1.heavy 453.797 / 578.363 75130.0 24.329100131988525 46 20 10 6 10 8.035193123984987 12.445251589722318 0.03800010681152344 3 0.9960873439319544 19.723538279433864 75130.0 38.946818640948464 0.0 - - - - - - - 1259.0 150 4 LACTB lactamase, beta 2047 260 B20140407_SF105_01 B20140407_SF105_01 TB498870.[MT7]-IASISK[MT7].2y5_1.heavy 453.797 / 649.4 209756.0 24.329100131988525 46 20 10 6 10 8.035193123984987 12.445251589722318 0.03800010681152344 3 0.9960873439319544 19.723538279433864 209756.0 34.180531894627364 0.0 - - - - - - - 1311.5 419 2 LACTB lactamase, beta 2049 260 B20140407_SF105_01 B20140407_SF105_01 TB498870.[MT7]-IASISK[MT7].2b4_1.heavy 453.797 / 529.347 22560.0 24.329100131988525 46 20 10 6 10 8.035193123984987 12.445251589722318 0.03800010681152344 3 0.9960873439319544 19.723538279433864 22560.0 10.113884960356227 0.0 - - - - - - - 2260.7272727272725 45 11 LACTB lactamase, beta 2051 260 B20140407_SF105_01 B20140407_SF105_01 TB498870.[MT7]-IASISK[MT7].2y3_1.heavy 453.797 / 491.331 36726.0 24.329100131988525 46 20 10 6 10 8.035193123984987 12.445251589722318 0.03800010681152344 3 0.9960873439319544 19.723538279433864 36726.0 10.479330988673382 1.0 - - - - - - - 1469.0 73 1 LACTB lactamase, beta 2053 261 B20140407_SF105_01 B20140407_SF105_01 TB360985.[MT7]-DTDIVDEAIYYFK[MT7].2b8_1.heavy 940.482 / 1003.47 14521.0 39.811100006103516 48 18 10 10 10 3.8589038023505595 25.91409506997489 0.0 3 0.9814441519206957 9.045823523946954 14521.0 51.071958174904935 0.0 - - - - - - - 676.4285714285714 29 7 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 2055 261 B20140407_SF105_01 B20140407_SF105_01 TB360985.[MT7]-DTDIVDEAIYYFK[MT7].2y4_1.heavy 940.482 / 764.41 32830.0 39.811100006103516 48 18 10 10 10 3.8589038023505595 25.91409506997489 0.0 3 0.9814441519206957 9.045823523946954 32830.0 61.47164118428819 0.0 - - - - - - - 789.3 65 10 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 2057 261 B20140407_SF105_01 B20140407_SF105_01 TB360985.[MT7]-DTDIVDEAIYYFK[MT7].2b4_1.heavy 940.482 / 589.295 50402.0 39.811100006103516 48 18 10 10 10 3.8589038023505595 25.91409506997489 0.0 3 0.9814441519206957 9.045823523946954 50402.0 97.04259665387187 0.0 - - - - - - - 661.2857142857143 100 7 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 2059 261 B20140407_SF105_01 B20140407_SF105_01 TB360985.[MT7]-DTDIVDEAIYYFK[MT7].2y3_1.heavy 940.482 / 601.347 27253.0 39.811100006103516 48 18 10 10 10 3.8589038023505595 25.91409506997489 0.0 3 0.9814441519206957 9.045823523946954 27253.0 82.6966633955865 0.0 - - - - - - - 661.2857142857143 54 7 ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa 2061 262 B20140407_SF105_01 B20140407_SF105_01 TB499150.[MT7]-TLDFIDVLLLAR.2y9_1.heavy 766.962 / 1059.66 128066.0 45.00899887084961 46 16 10 10 10 1.9814573841990095 43.4227085428793 0.0 3 0.9628977158974086 6.387193036435899 128066.0 305.4253295193182 0.0 - - - - - - - 287.8 256 10 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 2063 262 B20140407_SF105_01 B20140407_SF105_01 TB499150.[MT7]-TLDFIDVLLLAR.2b6_1.heavy 766.962 / 849.447 72171.0 45.00899887084961 46 16 10 10 10 1.9814573841990095 43.4227085428793 0.0 3 0.9628977158974086 6.387193036435899 72171.0 156.1681306263224 0.0 - - - - - - - 780.1818181818181 144 11 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 2065 262 B20140407_SF105_01 B20140407_SF105_01 TB499150.[MT7]-TLDFIDVLLLAR.2y6_1.heavy 766.962 / 684.477 84365.0 45.00899887084961 46 16 10 10 10 1.9814573841990095 43.4227085428793 0.0 3 0.9628977158974086 6.387193036435899 84365.0 120.6943286176529 0.0 - - - - - - - 294.375 168 8 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 2067 262 B20140407_SF105_01 B20140407_SF105_01 TB499150.[MT7]-TLDFIDVLLLAR.2y7_1.heavy 766.962 / 799.504 82010.0 45.00899887084961 46 16 10 10 10 1.9814573841990095 43.4227085428793 0.0 3 0.9628977158974086 6.387193036435899 82010.0 256.3886358236679 0.0 - - - - - - - 665.2857142857143 164 7 CYP4F22 cytochrome P450, family 4, subfamily F, polypeptide 22 2069 263 B20140407_SF105_01 B20140407_SF105_01 TB361105.[MT7]-NLSQERPFPWFDLTAVQLK[MT7].4y4_1.heavy 645.107 / 631.426 177333.0 39.2848014831543 47 17 10 10 10 6.645170088294818 15.0485237655761 0.0 3 0.9788443816580369 8.469950526844151 177333.0 93.41912452220845 0.0 - - - - - - - 1584.25 354 4 C14orf148 chromosome 14 open reading frame 148 2071 263 B20140407_SF105_01 B20140407_SF105_01 TB361105.[MT7]-NLSQERPFPWFDLTAVQLK[MT7].4b8_2.heavy 645.107 / 558.799 167881.0 39.2848014831543 47 17 10 10 10 6.645170088294818 15.0485237655761 0.0 3 0.9788443816580369 8.469950526844151 167881.0 214.0784665702483 0.0 - - - - - - - 690.2857142857143 335 7 C14orf148 chromosome 14 open reading frame 148 2073 263 B20140407_SF105_01 B20140407_SF105_01 TB361105.[MT7]-NLSQERPFPWFDLTAVQLK[MT7].4b12_2.heavy 645.107 / 831.413 445106.0 39.2848014831543 47 17 10 10 10 6.645170088294818 15.0485237655761 0.0 3 0.9788443816580369 8.469950526844151 445106.0 235.46199724770827 0.0 - - - - - - - 1128.0 890 2 C14orf148 chromosome 14 open reading frame 148 2075 263 B20140407_SF105_01 B20140407_SF105_01 TB361105.[MT7]-NLSQERPFPWFDLTAVQLK[MT7].4y3_1.heavy 645.107 / 532.357 226527.0 39.2848014831543 47 17 10 10 10 6.645170088294818 15.0485237655761 0.0 3 0.9788443816580369 8.469950526844151 226527.0 75.35535161338706 0.0 - - - - - - - 1289.0 453 1 C14orf148 chromosome 14 open reading frame 148 2077 264 B20140407_SF105_01 B20140407_SF105_01 TB498875.[MT7]-LIPSGAGR.2y5_1.heavy 457.781 / 447.231 105302.0 25.735300064086914 50 20 10 10 10 46.52209384814693 2.1495163207058274 0.0 3 0.999171469904154 42.87244337751278 105302.0 48.95926321620766 0.0 - - - - - - - 1170.0 210 3 RABAC1 Rab acceptor 1 (prenylated) 2079 264 B20140407_SF105_01 B20140407_SF105_01 TB498875.[MT7]-LIPSGAGR.2y6_1.heavy 457.781 / 544.284 1201250.0 25.735300064086914 50 20 10 10 10 46.52209384814693 2.1495163207058274 0.0 3 0.999171469904154 42.87244337751278 1201250.0 416.62457643562294 0.0 - - - - - - - 1170.0 2402 1 RABAC1 Rab acceptor 1 (prenylated) 2081 264 B20140407_SF105_01 B20140407_SF105_01 TB498875.[MT7]-LIPSGAGR.2b5_1.heavy 457.781 / 612.384 18252.0 25.735300064086914 50 20 10 10 10 46.52209384814693 2.1495163207058274 0.0 3 0.999171469904154 42.87244337751278 18252.0 12.344444444444445 2.0 - - - - - - - 643.5 100 2 RABAC1 Rab acceptor 1 (prenylated) 2083 264 B20140407_SF105_01 B20140407_SF105_01 TB498875.[MT7]-LIPSGAGR.2y7_1.heavy 457.781 / 657.368 335444.0 25.735300064086914 50 20 10 10 10 46.52209384814693 2.1495163207058274 0.0 3 0.999171469904154 42.87244337751278 335444.0 198.6494609929078 0.0 - - - - - - - 1248.0 670 3 RABAC1 Rab acceptor 1 (prenylated) 2085 265 B20140407_SF105_01 B20140407_SF105_01 TB498874.[MT7]-ITAPPDR.2b3_1.heavy 457.265 / 430.278 30281.0 22.12892484664917 44 20 10 6 8 7.828558557372307 12.773743629448623 0.03890037536621094 4 0.9946662029390193 16.890826475009266 30281.0 0.6436977055072209 2.0 - - - - - - - 3691.0 91 1 ACTRT2 actin-related protein T2 2087 265 B20140407_SF105_01 B20140407_SF105_01 TB498874.[MT7]-ITAPPDR.2y4_1.heavy 457.265 / 484.251 31036.0 22.12892484664917 44 20 10 6 8 7.828558557372307 12.773743629448623 0.03890037536621094 4 0.9946662029390193 16.890826475009266 31036.0 12.203501353896065 0.0 - - - - - - - 2139.0 62 2 ACTRT2 actin-related protein T2 2089 265 B20140407_SF105_01 B20140407_SF105_01 TB498874.[MT7]-ITAPPDR.2y5_1.heavy 457.265 / 555.289 16524.0 22.12892484664917 44 20 10 6 8 7.828558557372307 12.773743629448623 0.03890037536621094 4 0.9946662029390193 16.890826475009266 16524.0 2.392017626856439 1.0 - - - - - - - 2181.0 33 1 ACTRT2 actin-related protein T2 2091 265 B20140407_SF105_01 B20140407_SF105_01 TB498874.[MT7]-ITAPPDR.2y6_1.heavy 457.265 / 656.336 76331.0 22.12892484664917 44 20 10 6 8 7.828558557372307 12.773743629448623 0.03890037536621094 4 0.9946662029390193 16.890826475009266 76331.0 18.46078851031954 0.0 - - - - - - - 797.0 152 2 ACTRT2 actin-related protein T2 2093 266 B20140407_SF105_01 B20140407_SF105_01 TB361102.[MT7]-VFEQGYREEPTFIDPEAIK[MT7].3b14_2.heavy 852.779 / 928.453 114354.0 32.923500061035156 46 16 10 10 10 2.643366573944276 37.83054570853027 0.0 3 0.9652368245364593 6.599885972462315 114354.0 188.931098674077 0.0 - - - - - - - 255.33333333333334 228 6 GSG1L GSG1-like 2095 266 B20140407_SF105_01 B20140407_SF105_01 TB361102.[MT7]-VFEQGYREEPTFIDPEAIK[MT7].3b11_2.heavy 852.779 / 740.863 37863.0 32.923500061035156 46 16 10 10 10 2.643366573944276 37.83054570853027 0.0 3 0.9652368245364593 6.599885972462315 37863.0 61.75232991612301 0.0 - - - - - - - 306.85714285714283 75 7 GSG1L GSG1-like 2097 266 B20140407_SF105_01 B20140407_SF105_01 TB361102.[MT7]-VFEQGYREEPTFIDPEAIK[MT7].3b3_1.heavy 852.779 / 520.289 29432.0 32.923500061035156 46 16 10 10 10 2.643366573944276 37.83054570853027 0.0 3 0.9652368245364593 6.599885972462315 29432.0 33.02292536529512 0.0 - - - - - - - 383.5 58 2 GSG1L GSG1-like 2099 266 B20140407_SF105_01 B20140407_SF105_01 TB361102.[MT7]-VFEQGYREEPTFIDPEAIK[MT7].3y5_1.heavy 852.779 / 701.431 262279.0 32.923500061035156 46 16 10 10 10 2.643366573944276 37.83054570853027 0.0 3 0.9652368245364593 6.599885972462315 262279.0 188.131414635346 0.0 - - - - - - - 307.0 524 1 GSG1L GSG1-like 2101 267 B20140407_SF105_01 B20140407_SF105_01 TB499156.[MT7]-LDLDIPVQHYVPEFPEK[MT7].3y6_1.heavy 776.422 / 890.474 97387.0 35.40770149230957 35 10 10 5 10 0.7334569483070296 82.84318501489551 0.047199249267578125 3 0.8498288473095771 3.1439678283545707 97387.0 80.15684763857588 0.0 - - - - - - - 448.0 194 1 LACTB lactamase, beta 2103 267 B20140407_SF105_01 B20140407_SF105_01 TB499156.[MT7]-LDLDIPVQHYVPEFPEK[MT7].3y3_1.heavy 776.422 / 517.31 63481.0 35.40770149230957 35 10 10 5 10 0.7334569483070296 82.84318501489551 0.047199249267578125 3 0.8498288473095771 3.1439678283545707 63481.0 45.36644376528741 0.0 - - - - - - - 373.5 126 2 LACTB lactamase, beta 2105 267 B20140407_SF105_01 B20140407_SF105_01 TB499156.[MT7]-LDLDIPVQHYVPEFPEK[MT7].3b4_1.heavy 776.422 / 601.331 64825.0 35.40770149230957 35 10 10 5 10 0.7334569483070296 82.84318501489551 0.047199249267578125 3 0.8498288473095771 3.1439678283545707 64825.0 60.94851635244896 0.0 - - - - - - - 1344.5 129 4 LACTB lactamase, beta 2107 267 B20140407_SF105_01 B20140407_SF105_01 TB499156.[MT7]-LDLDIPVQHYVPEFPEK[MT7].3b5_1.heavy 776.422 / 714.415 63780.0 35.40770149230957 35 10 10 5 10 0.7334569483070296 82.84318501489551 0.047199249267578125 3 0.8498288473095771 3.1439678283545707 63780.0 46.17242397961949 0.0 - - - - - - - 896.0 127 1 LACTB lactamase, beta 2109 268 B20140407_SF105_01 B20140407_SF105_01 TB149949.[MT7]-IQYSLGK[MT7].2y5_1.heavy 548.834 / 711.416 26688.0 27.075700759887695 47 17 10 10 10 2.363378808266795 37.62557923146962 0.0 3 0.9707771561995088 7.201746150831721 26688.0 23.525707257072575 0.0 - - - - - - - 1234.4444444444443 53 9 IGSF22 immunoglobulin superfamily, member 22 2111 268 B20140407_SF105_01 B20140407_SF105_01 TB149949.[MT7]-IQYSLGK[MT7].2b4_1.heavy 548.834 / 636.347 7722.0 27.075700759887695 47 17 10 10 10 2.363378808266795 37.62557923146962 0.0 3 0.9707771561995088 7.201746150831721 7722.0 4.514684213291871 3.0 - - - - - - - 745.0 17 2 IGSF22 immunoglobulin superfamily, member 22 2113 268 B20140407_SF105_01 B20140407_SF105_01 TB149949.[MT7]-IQYSLGK[MT7].2y3_1.heavy 548.834 / 461.32 13683.0 27.075700759887695 47 17 10 10 10 2.363378808266795 37.62557923146962 0.0 3 0.9707771561995088 7.201746150831721 13683.0 5.892599144583671 0.0 - - - - - - - 813.0 27 1 IGSF22 immunoglobulin superfamily, member 22 2115 268 B20140407_SF105_01 B20140407_SF105_01 TB149949.[MT7]-IQYSLGK[MT7].2y6_1.heavy 548.834 / 839.474 27907.0 27.075700759887695 47 17 10 10 10 2.363378808266795 37.62557923146962 0.0 3 0.9707771561995088 7.201746150831721 27907.0 16.283570505816677 0.0 - - - - - - - 1258.0 55 7 IGSF22 immunoglobulin superfamily, member 22 2117 269 B20140407_SF105_01 B20140407_SF105_01 TB499293.[MT7]-LAEQFVLLNLVYETTDK[MT7].3b6_1.heavy 762.094 / 832.469 237333.0 42.64030075073242 46 16 10 10 10 4.331838370862758 23.08488716306452 0.0 3 0.966207708171483 6.694573504425179 237333.0 130.67875263202956 0.0 - - - - - - - 759.6666666666666 474 3 AGR2 anterior gradient homolog 2 (Xenopus laevis) 2119 269 B20140407_SF105_01 B20140407_SF105_01 TB499293.[MT7]-LAEQFVLLNLVYETTDK[MT7].3b4_1.heavy 762.094 / 586.332 105852.0 42.64030075073242 46 16 10 10 10 4.331838370862758 23.08488716306452 0.0 3 0.966207708171483 6.694573504425179 105852.0 111.21580173765177 0.0 - - - - - - - 407.0 211 1 AGR2 anterior gradient homolog 2 (Xenopus laevis) 2121 269 B20140407_SF105_01 B20140407_SF105_01 TB499293.[MT7]-LAEQFVLLNLVYETTDK[MT7].3b5_1.heavy 762.094 / 733.4 192259.0 42.64030075073242 46 16 10 10 10 4.331838370862758 23.08488716306452 0.0 3 0.966207708171483 6.694573504425179 192259.0 97.80537867962275 0.0 - - - - - - - 488.0 384 1 AGR2 anterior gradient homolog 2 (Xenopus laevis) 2123 269 B20140407_SF105_01 B20140407_SF105_01 TB499293.[MT7]-LAEQFVLLNLVYETTDK[MT7].3b7_1.heavy 762.094 / 945.553 143604.0 42.64030075073242 46 16 10 10 10 4.331838370862758 23.08488716306452 0.0 3 0.966207708171483 6.694573504425179 143604.0 119.0162913751787 0.0 - - - - - - - 244.0 287 2 AGR2 anterior gradient homolog 2 (Xenopus laevis) 2125 270 B20140407_SF105_01 B20140407_SF105_01 TB498976.[MT7]-QTAVFEIR.2b4_1.heavy 554.318 / 544.321 32342.0 29.756099700927734 44 14 10 10 10 1.0553600437240893 60.9512330129019 0.0 3 0.9384432532041084 4.948472371179174 32342.0 10.429506586423987 1.0 - - - - - - - 1335.0 64 1 IGSF22 immunoglobulin superfamily, member 22 2127 270 B20140407_SF105_01 B20140407_SF105_01 TB498976.[MT7]-QTAVFEIR.2b6_1.heavy 554.318 / 820.432 54151.0 29.756099700927734 44 14 10 10 10 1.0553600437240893 60.9512330129019 0.0 3 0.9384432532041084 4.948472371179174 54151.0 120.50525372381284 0.0 - - - - - - - 346.3333333333333 108 6 IGSF22 immunoglobulin superfamily, member 22 2129 270 B20140407_SF105_01 B20140407_SF105_01 TB498976.[MT7]-QTAVFEIR.2y6_1.heavy 554.318 / 734.42 18545.0 29.756099700927734 44 14 10 10 10 1.0553600437240893 60.9512330129019 0.0 3 0.9384432532041084 4.948472371179174 18545.0 15.211067415730337 0.0 - - - - - - - 791.0 37 3 IGSF22 immunoglobulin superfamily, member 22 2131 270 B20140407_SF105_01 B20140407_SF105_01 TB498976.[MT7]-QTAVFEIR.2y7_1.heavy 554.318 / 835.467 82042.0 29.756099700927734 44 14 10 10 10 1.0553600437240893 60.9512330129019 0.0 3 0.9384432532041084 4.948472371179174 82042.0 64.15868764044943 0.0 - - - - - - - 356.2 164 5 IGSF22 immunoglobulin superfamily, member 22 2133 271 B20140407_SF105_01 B20140407_SF105_01 TB149815.[MT7]-VVALDLR.2y5_1.heavy 465.299 / 587.351 16514.0 30.608800888061523 43 13 10 10 10 2.6556237650609527 37.65593655082567 0.0 3 0.9136256629699488 4.1686295334106385 16514.0 19.61659833725308 0.0 - - - - - - - 152.0 33 1 EPHX4 epoxide hydrolase 4 2135 271 B20140407_SF105_01 B20140407_SF105_01 TB149815.[MT7]-VVALDLR.2b4_1.heavy 465.299 / 527.367 12727.0 30.608800888061523 43 13 10 10 10 2.6556237650609527 37.65593655082567 0.0 3 0.9136256629699488 4.1686295334106385 12727.0 4.521082508250825 1.0 - - - - - - - 757.6666666666666 39 3 EPHX4 epoxide hydrolase 4 2137 271 B20140407_SF105_01 B20140407_SF105_01 TB149815.[MT7]-VVALDLR.2y6_1.heavy 465.299 / 686.42 38180.0 30.608800888061523 43 13 10 10 10 2.6556237650609527 37.65593655082567 0.0 3 0.9136256629699488 4.1686295334106385 38180.0 35.369275516206244 0.0 - - - - - - - 354.0 76 3 EPHX4 epoxide hydrolase 4 2139 271 B20140407_SF105_01 B20140407_SF105_01 TB149815.[MT7]-VVALDLR.2b5_1.heavy 465.299 / 642.394 99994.0 30.608800888061523 43 13 10 10 10 2.6556237650609527 37.65593655082567 0.0 3 0.9136256629699488 4.1686295334106385 99994.0 80.71419322845989 0.0 - - - - - - - 455.0 199 2 EPHX4 epoxide hydrolase 4 2141 272 B20140407_SF105_01 B20140407_SF105_01 TB149943.[MT7]-DRLTIGK[MT7].3y3_1.heavy 364.232 / 461.32 85141.0 23.510499954223633 48 20 10 10 8 10.543099763769906 9.484876577155987 0.0 4 0.9965332968476242 20.954557686396708 85141.0 23.421606077261306 0.0 - - - - - - - 293.0 170 1 CEP68 centrosomal protein 68kDa 2143 272 B20140407_SF105_01 B20140407_SF105_01 TB149943.[MT7]-DRLTIGK[MT7].3b4_1.heavy 364.232 / 630.369 18964.0 23.510499954223633 48 20 10 10 8 10.543099763769906 9.484876577155987 0.0 4 0.9965332968476242 20.954557686396708 18964.0 20.631239728823495 1.0 - - - - - - - 293.3333333333333 47 3 CEP68 centrosomal protein 68kDa 2145 272 B20140407_SF105_01 B20140407_SF105_01 TB149943.[MT7]-DRLTIGK[MT7].3y4_1.heavy 364.232 / 562.368 26686.0 23.510499954223633 48 20 10 10 8 10.543099763769906 9.484876577155987 0.0 4 0.9965332968476242 20.954557686396708 26686.0 66.74457073286726 0.0 - - - - - - - 712.2857142857143 53 7 CEP68 centrosomal protein 68kDa 2147 272 B20140407_SF105_01 B20140407_SF105_01 TB149943.[MT7]-DRLTIGK[MT7].3y5_1.heavy 364.232 / 675.452 12414.0 23.510499954223633 48 20 10 10 8 10.543099763769906 9.484876577155987 0.0 4 0.9965332968476242 20.954557686396708 12414.0 141.29761365415732 0.0 - - - - - - - 273.93333333333334 24 15 CEP68 centrosomal protein 68kDa 2149 273 B20140407_SF105_01 B20140407_SF105_01 TB499294.[MT7]-YILDFSLFAYPLPNVTK[MT7].4y4_1.heavy 573.075 / 605.374 9744.0 43.37900161743164 47 17 10 10 10 4.277830145079861 23.376337210352972 0.0 3 0.9733316098163092 7.540394263474 9744.0 17.6991868380145 0.0 - - - - - - - 242.93333333333334 19 15 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 2151 273 B20140407_SF105_01 B20140407_SF105_01 TB499294.[MT7]-YILDFSLFAYPLPNVTK[MT7].4y5_1.heavy 573.075 / 702.427 31054.0 43.37900161743164 47 17 10 10 10 4.277830145079861 23.376337210352972 0.0 3 0.9733316098163092 7.540394263474 31054.0 63.40408394225889 0.0 - - - - - - - 291.9166666666667 62 12 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 2153 273 B20140407_SF105_01 B20140407_SF105_01 TB499294.[MT7]-YILDFSLFAYPLPNVTK[MT7].4b6_1.heavy 573.075 / 883.468 8272.0 43.37900161743164 47 17 10 10 10 4.277830145079861 23.376337210352972 0.0 3 0.9733316098163092 7.540394263474 8272.0 83.01542857142857 0.0 - - - - - - - 192.6 16 20 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 2155 273 B20140407_SF105_01 B20140407_SF105_01 TB499294.[MT7]-YILDFSLFAYPLPNVTK[MT7].4b3_1.heavy 573.075 / 534.341 10445.0 43.37900161743164 47 17 10 10 10 4.277830145079861 23.376337210352972 0.0 3 0.9733316098163092 7.540394263474 10445.0 26.06080025758273 0.0 - - - - - - - 267.88235294117646 20 17 CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 2157 274 B20140407_SF105_01 B20140407_SF105_01 TB361107.[MT7]-AGLPPLGHGWVGGLGLGLGLALGVK[MT7].4y4_1.heavy 650.144 / 560.389 58347.0 40.97959899902344 41 11 10 10 10 1.1177738463608087 59.5031297133856 0.0 3 0.8565240362896666 3.2183848344553843 58347.0 85.39098322561654 0.0 - - - - - - - 256.25 116 4 LACTB lactamase, beta 2159 274 B20140407_SF105_01 B20140407_SF105_01 TB361107.[MT7]-AGLPPLGHGWVGGLGLGLGLALGVK[MT7].4b7_1.heavy 650.144 / 750.463 2905.0 40.97959899902344 41 11 10 10 10 1.1177738463608087 59.5031297133856 0.0 3 0.8565240362896666 3.2183848344553843 2905.0 6.91016840827022 2.0 - - - - - - - 299.0 27 6 LACTB lactamase, beta 2161 274 B20140407_SF105_01 B20140407_SF105_01 TB361107.[MT7]-AGLPPLGHGWVGGLGLGLGLALGVK[MT7].4b15_2.heavy 650.144 / 757.423 59885.0 40.97959899902344 41 11 10 10 10 1.1177738463608087 59.5031297133856 0.0 3 0.8565240362896666 3.2183848344553843 59885.0 34.8480637355511 1.0 - - - - - - - 341.8 120 5 LACTB lactamase, beta 2163 274 B20140407_SF105_01 B20140407_SF105_01 TB361107.[MT7]-AGLPPLGHGWVGGLGLGLGLALGVK[MT7].4b13_2.heavy 650.144 / 672.371 21101.0 40.97959899902344 41 11 10 10 10 1.1177738463608087 59.5031297133856 0.0 3 0.8565240362896666 3.2183848344553843 21101.0 65.33247348298616 0.0 - - - - - - - 268.57142857142856 42 7 LACTB lactamase, beta 2165 275 B20140407_SF105_01 B20140407_SF105_01 TB149817.[MT7]-VIAVNK[MT7].2y4_1.heavy 466.313 / 575.363 51415.0 24.22249984741211 46 20 8 10 8 22.19948014878227 4.50460998770214 0.0 4 0.9954743370781849 18.338226923319954 51415.0 32.06756756756757 0.0 - - - - - - - 2859.25 102 8 IGSF22 immunoglobulin superfamily, member 22 2167 275 B20140407_SF105_01 B20140407_SF105_01 TB149817.[MT7]-VIAVNK[MT7].2y5_1.heavy 466.313 / 688.447 57829.0 24.22249984741211 46 20 8 10 8 22.19948014878227 4.50460998770214 0.0 4 0.9954743370781849 18.338226923319954 57829.0 36.031813239483604 1.0 - - - - - - - 267.5 144 2 IGSF22 immunoglobulin superfamily, member 22 2169 275 B20140407_SF105_01 B20140407_SF105_01 TB149817.[MT7]-VIAVNK[MT7].2b4_1.heavy 466.313 / 527.367 12186.0 24.22249984741211 46 20 8 10 8 22.19948014878227 4.50460998770214 0.0 4 0.9954743370781849 18.338226923319954 12186.0 9.976101323996062 2.0 - - - - - - - 428.0 44 1 IGSF22 immunoglobulin superfamily, member 22 2171 275 B20140407_SF105_01 B20140407_SF105_01 TB149817.[MT7]-VIAVNK[MT7].2y3_1.heavy 466.313 / 504.326 28540.0 24.22249984741211 46 20 8 10 8 22.19948014878227 4.50460998770214 0.0 4 0.9954743370781849 18.338226923319954 28540.0 14.867776584317937 0.0 - - - - - - - 2209.3333333333335 57 9 IGSF22 immunoglobulin superfamily, member 22 2173 276 B20140407_SF105_01 B20140407_SF105_01 TB360706.[MT7]-EDSGLILLK[MT7].2y4_1.heavy 638.392 / 630.467 6291.0 32.83440017700195 47 17 10 10 10 6.88293461755261 14.528686607741943 0.0 3 0.9735866016916256 7.576866472124179 6291.0 2.9769168406890874 4.0 - - - - - - - 767.0 12 1 IGSF22 immunoglobulin superfamily, member 22 2175 276 B20140407_SF105_01 B20140407_SF105_01 TB360706.[MT7]-EDSGLILLK[MT7].2b4_1.heavy 638.392 / 533.232 4910.0 32.83440017700195 47 17 10 10 10 6.88293461755261 14.528686607741943 0.0 3 0.9735866016916256 7.576866472124179 4910.0 3.06526077544212 8.0 - - - - - - - 921.0 25 1 IGSF22 immunoglobulin superfamily, member 22 2177 276 B20140407_SF105_01 B20140407_SF105_01 TB360706.[MT7]-EDSGLILLK[MT7].2b6_1.heavy 638.392 / 759.401 7058.0 32.83440017700195 47 17 10 10 10 6.88293461755261 14.528686607741943 0.0 3 0.9735866016916256 7.576866472124179 7058.0 6.063423250294117 1.0 - - - - - - - 882.5 14 4 IGSF22 immunoglobulin superfamily, member 22 2179 276 B20140407_SF105_01 B20140407_SF105_01 TB360706.[MT7]-EDSGLILLK[MT7].2b5_1.heavy 638.392 / 646.316 12122.0 32.83440017700195 47 17 10 10 10 6.88293461755261 14.528686607741943 0.0 3 0.9735866016916256 7.576866472124179 12122.0 6.545546986103897 0.0 - - - - - - - 460.0 24 1 IGSF22 immunoglobulin superfamily, member 22