Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140408_SF106_04 B20140408_SF106_04 TB378561.[MT7]-ELLATLEGLDLDGEDWLPR.3y7_1.heavy 767.069 / 872.426 25461.0 43.31800079345703 44 14 10 10 10 12.581928631762644 7.947907107623664 0.0 3 0.9386608811124347 4.957335038238348 25461.0 62.543837837837835 0.0 - - - - - - - 715.9 50 20 PARP10 poly (ADP-ribose) polymerase family, member 10 3 1 B20140408_SF106_04 B20140408_SF106_04 TB378561.[MT7]-ELLATLEGLDLDGEDWLPR.3b5_1.heavy 767.069 / 672.405 25613.0 43.31800079345703 44 14 10 10 10 12.581928631762644 7.947907107623664 0.0 3 0.9386608811124347 4.957335038238348 25613.0 52.28929914529915 0.0 - - - - - - - 699.3076923076923 51 26 PARP10 poly (ADP-ribose) polymerase family, member 10 5 1 B20140408_SF106_04 B20140408_SF106_04 TB378561.[MT7]-ELLATLEGLDLDGEDWLPR.3b3_1.heavy 767.069 / 500.32 21094.0 43.31800079345703 44 14 10 10 10 12.581928631762644 7.947907107623664 0.0 3 0.9386608811124347 4.957335038238348 21094.0 50.58124279587296 0.0 - - - - - - - 648.44 42 25 PARP10 poly (ADP-ribose) polymerase family, member 10 7 1 B20140408_SF106_04 B20140408_SF106_04 TB378561.[MT7]-ELLATLEGLDLDGEDWLPR.3y8_1.heavy 767.069 / 987.453 24244.0 43.31800079345703 44 14 10 10 10 12.581928631762644 7.947907107623664 0.0 3 0.9386608811124347 4.957335038238348 24244.0 43.779079497907944 0.0 - - - - - - - 672.0666666666667 48 15 PARP10 poly (ADP-ribose) polymerase family, member 10 9 2 B20140408_SF106_04 B20140408_SF106_04 TB498627.[MT7]-GLPPAVPDELLTLYFENR.3y7_1.heavy 730.064 / 942.468 83023.0 41.6255989074707 44 14 10 10 10 2.1581619132671257 36.840802054744614 0.0 3 0.9350615511117385 4.816512833175205 83023.0 168.67699860174588 0.0 - - - - - - - 305.0 166 9 PARP10 poly (ADP-ribose) polymerase family, member 10 11 2 B20140408_SF106_04 B20140408_SF106_04 TB498627.[MT7]-GLPPAVPDELLTLYFENR.3b6_1.heavy 730.064 / 679.426 220119.0 41.6255989074707 44 14 10 10 10 2.1581619132671257 36.840802054744614 0.0 3 0.9350615511117385 4.816512833175205 220119.0 178.17657002971103 0.0 - - - - - - - 360.0 440 2 PARP10 poly (ADP-ribose) polymerase family, member 10 13 2 B20140408_SF106_04 B20140408_SF106_04 TB498627.[MT7]-GLPPAVPDELLTLYFENR.3b5_1.heavy 730.064 / 580.357 115665.0 41.6255989074707 44 14 10 10 10 2.1581619132671257 36.840802054744614 0.0 3 0.9350615511117385 4.816512833175205 115665.0 55.03261507991592 0.0 - - - - - - - 420.0 231 3 PARP10 poly (ADP-ribose) polymerase family, member 10 15 2 B20140408_SF106_04 B20140408_SF106_04 TB498627.[MT7]-GLPPAVPDELLTLYFENR.3y8_1.heavy 730.064 / 1055.55 30616.0 41.6255989074707 44 14 10 10 10 2.1581619132671257 36.840802054744614 0.0 3 0.9350615511117385 4.816512833175205 30616.0 218.4746354882385 0.0 - - - - - - - 196.36363636363637 61 11 PARP10 poly (ADP-ribose) polymerase family, member 10 17 3 B20140408_SF106_04 B20140408_SF106_04 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 1215090.0 26.043100357055664 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1215090.0 846.1732304319108 0.0 - - - - - - - 6266.0 2430 1 19 3 B20140408_SF106_04 B20140408_SF106_04 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 1601160.0 26.043100357055664 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1601160.0 864.7944559819304 0.0 - - - - - - - 8064.0 3202 1 21 3 B20140408_SF106_04 B20140408_SF106_04 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 1859440.0 26.043100357055664 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1859440.0 1319.9118408294175 0.0 - - - - - - - 10201.0 3718 2 23 4 B20140408_SF106_04 B20140408_SF106_04 TB149680.[MT7]-LFSLK[MT7]PTSGPVLTVTLFGR.4y5_1.heavy 581.101 / 593.341 60590.0 38.6245002746582 43 13 10 10 10 1.3546024097899148 48.27373977906646 0.0 3 0.9240861002159124 4.45056599441254 60590.0 95.56742911893917 0.0 - - - - - - - 683.5 121 10 VNN1 vanin 1 25 4 B20140408_SF106_04 B20140408_SF106_04 TB149680.[MT7]-LFSLK[MT7]PTSGPVLTVTLFGR.4b5_1.heavy 581.101 / 877.575 7229.0 38.6245002746582 43 13 10 10 10 1.3546024097899148 48.27373977906646 0.0 3 0.9240861002159124 4.45056599441254 7229.0 19.02780263395273 0.0 - - - - - - - 221.75 14 16 VNN1 vanin 1 27 4 B20140408_SF106_04 B20140408_SF106_04 TB149680.[MT7]-LFSLK[MT7]PTSGPVLTVTLFGR.4y6_1.heavy 581.101 / 692.409 17612.0 38.6245002746582 43 13 10 10 10 1.3546024097899148 48.27373977906646 0.0 3 0.9240861002159124 4.45056599441254 17612.0 66.86136170212767 0.0 - - - - - - - 312.4166666666667 35 12 VNN1 vanin 1 29 4 B20140408_SF106_04 B20140408_SF106_04 TB149680.[MT7]-LFSLK[MT7]PTSGPVLTVTLFGR.4b9_2.heavy 581.101 / 610.368 47907.0 38.6245002746582 43 13 10 10 10 1.3546024097899148 48.27373977906646 0.0 3 0.9240861002159124 4.45056599441254 47907.0 156.18558502878903 0.0 - - - - - - - 268.0769230769231 95 13 VNN1 vanin 1 31 5 B20140408_SF106_04 B20140408_SF106_04 TB498692.[MT7]-FLDEDFVFDIYR.3b5_1.heavy 574.955 / 764.358 268771.0 40.770301818847656 45 15 10 10 10 2.505353935528445 33.1311408310823 0.0 3 0.9563005581452804 5.882068310426173 268771.0 146.39827890114265 0.0 - - - - - - - 240.0 537 3 CDC123 cell division cycle 123 homolog (S. cerevisiae) 33 5 B20140408_SF106_04 B20140408_SF106_04 TB498692.[MT7]-FLDEDFVFDIYR.3y4_1.heavy 574.955 / 566.293 158209.0 40.770301818847656 45 15 10 10 10 2.505353935528445 33.1311408310823 0.0 3 0.9563005581452804 5.882068310426173 158209.0 176.50937505222302 0.0 - - - - - - - 411.3333333333333 316 3 CDC123 cell division cycle 123 homolog (S. cerevisiae) 35 5 B20140408_SF106_04 B20140408_SF106_04 TB498692.[MT7]-FLDEDFVFDIYR.3b3_1.heavy 574.955 / 520.289 87534.0 40.770301818847656 45 15 10 10 10 2.505353935528445 33.1311408310823 0.0 3 0.9563005581452804 5.882068310426173 87534.0 106.50165409952143 0.0 - - - - - - - 1189.5714285714287 175 7 CDC123 cell division cycle 123 homolog (S. cerevisiae) 37 5 B20140408_SF106_04 B20140408_SF106_04 TB498692.[MT7]-FLDEDFVFDIYR.3y5_1.heavy 574.955 / 713.362 291233.0 40.770301818847656 45 15 10 10 10 2.505353935528445 33.1311408310823 0.0 3 0.9563005581452804 5.882068310426173 291233.0 200.97526387058235 0.0 - - - - - - - 257.0 582 1 CDC123 cell division cycle 123 homolog (S. cerevisiae) 39 6 B20140408_SF106_04 B20140408_SF106_04 TB378421.[MT7]-DYLLDDGTLVVSGR.2y8_1.heavy 833.942 / 788.463 22374.0 33.87200164794922 50 20 10 10 10 6.967459824124676 14.352432956089995 0.0 3 0.9930288299541905 14.772599145002062 22374.0 33.55863314041578 0.0 - - - - - - - 1276.4285714285713 44 7 CDC123 cell division cycle 123 homolog (S. cerevisiae) 41 6 B20140408_SF106_04 B20140408_SF106_04 TB378421.[MT7]-DYLLDDGTLVVSGR.2y9_1.heavy 833.942 / 903.489 18169.0 33.87200164794922 50 20 10 10 10 6.967459824124676 14.352432956089995 0.0 3 0.9930288299541905 14.772599145002062 18169.0 35.56825407411 0.0 - - - - - - - 722.1538461538462 36 13 CDC123 cell division cycle 123 homolog (S. cerevisiae) 43 6 B20140408_SF106_04 B20140408_SF106_04 TB378421.[MT7]-DYLLDDGTLVVSGR.2y10_1.heavy 833.942 / 1018.52 21848.0 33.87200164794922 50 20 10 10 10 6.967459824124676 14.352432956089995 0.0 3 0.9930288299541905 14.772599145002062 21848.0 54.98985938735987 0.0 - - - - - - - 683.5 43 10 CDC123 cell division cycle 123 homolog (S. cerevisiae) 45 6 B20140408_SF106_04 B20140408_SF106_04 TB378421.[MT7]-DYLLDDGTLVVSGR.2y11_1.heavy 833.942 / 1131.6 20272.0 33.87200164794922 50 20 10 10 10 6.967459824124676 14.352432956089995 0.0 3 0.9930288299541905 14.772599145002062 20272.0 90.49688010139417 0.0 - - - - - - - 236.25 40 20 CDC123 cell division cycle 123 homolog (S. cerevisiae) 47 7 B20140408_SF106_04 B20140408_SF106_04 TB498693.[MT7]-GTVFFDEFTFVK[MT7].3y3_1.heavy 575.643 / 537.352 183506.0 38.829898834228516 44 14 10 10 10 1.4673417732045235 48.01067258971971 0.0 3 0.9488679794109421 5.434352014842582 183506.0 185.25701203724964 0.0 - - - - - - - 309.6666666666667 367 3 VNN1 vanin 1 49 7 B20140408_SF106_04 B20140408_SF106_04 TB498693.[MT7]-GTVFFDEFTFVK[MT7].3b6_1.heavy 575.643 / 811.411 112942.0 38.829898834228516 44 14 10 10 10 1.4673417732045235 48.01067258971971 0.0 3 0.9488679794109421 5.434352014842582 112942.0 199.3511432160804 0.0 - - - - - - - 184.33333333333334 225 9 VNN1 vanin 1 51 7 B20140408_SF106_04 B20140408_SF106_04 TB498693.[MT7]-GTVFFDEFTFVK[MT7].3b4_1.heavy 575.643 / 549.315 155055.0 38.829898834228516 44 14 10 10 10 1.4673417732045235 48.01067258971971 0.0 3 0.9488679794109421 5.434352014842582 155055.0 220.50535175879395 0.0 - - - - - - - 847.5555555555555 310 9 VNN1 vanin 1 53 7 B20140408_SF106_04 B20140408_SF106_04 TB498693.[MT7]-GTVFFDEFTFVK[MT7].3b7_1.heavy 575.643 / 940.453 86613.0 38.829898834228516 44 14 10 10 10 1.4673417732045235 48.01067258971971 0.0 3 0.9488679794109421 5.434352014842582 86613.0 246.90583710407236 0.0 - - - - - - - 271.9 173 10 VNN1 vanin 1 55 8 B20140408_SF106_04 B20140408_SF106_04 TB377966.[MT7]-QYETAR.2y4_1.heavy 456.239 / 476.246 6613.0 18.761899948120117 50 20 10 10 10 5.778932347707689 17.304234412722742 0.0 3 0.9930052038275704 14.74760043541694 6613.0 11.897095117428325 1.0 - - - - - - - 696.4666666666667 13 15 THOC5 THO complex 5 57 8 B20140408_SF106_04 B20140408_SF106_04 TB377966.[MT7]-QYETAR.2b3_1.heavy 456.239 / 565.274 8780.0 18.761899948120117 50 20 10 10 10 5.778932347707689 17.304234412722742 0.0 3 0.9930052038275704 14.74760043541694 8780.0 29.698528743926794 0.0 - - - - - - - 735.9090909090909 17 11 THOC5 THO complex 5 59 8 B20140408_SF106_04 B20140408_SF106_04 TB377966.[MT7]-QYETAR.2y5_1.heavy 456.239 / 639.31 36342.0 18.761899948120117 50 20 10 10 10 5.778932347707689 17.304234412722742 0.0 3 0.9930052038275704 14.74760043541694 36342.0 74.66361497217493 0.0 - - - - - - - 700.8333333333334 72 12 THOC5 THO complex 5 61 8 B20140408_SF106_04 B20140408_SF106_04 TB377966.[MT7]-QYETAR.2y3_1.heavy 456.239 / 347.204 10132.0 18.761899948120117 50 20 10 10 10 5.778932347707689 17.304234412722742 0.0 3 0.9930052038275704 14.74760043541694 10132.0 21.531588121843107 0.0 - - - - - - - 713.6315789473684 20 19 THOC5 THO complex 5 63 9 B20140408_SF106_04 B20140408_SF106_04 TB149545.[MT7]-DYLLDDGTLVVSGR.3y6_1.heavy 556.297 / 630.393 44177.0 33.87200164794922 48 18 10 10 10 5.522974333326955 18.10618589997349 0.0 3 0.9870428143520635 10.830212424266684 44177.0 38.299106562635814 0.0 - - - - - - - 1311.25 88 8 CDC123 cell division cycle 123 homolog (S. cerevisiae) 65 9 B20140408_SF106_04 B20140408_SF106_04 TB149545.[MT7]-DYLLDDGTLVVSGR.3b4_1.heavy 556.297 / 649.368 31470.0 33.87200164794922 48 18 10 10 10 5.522974333326955 18.10618589997349 0.0 3 0.9870428143520635 10.830212424266684 31470.0 26.00084874858616 0.0 - - - - - - - 1688.4285714285713 62 7 CDC123 cell division cycle 123 homolog (S. cerevisiae) 67 9 B20140408_SF106_04 B20140408_SF106_04 TB149545.[MT7]-DYLLDDGTLVVSGR.3b5_1.heavy 556.297 / 764.395 29254.0 33.87200164794922 48 18 10 10 10 5.522974333326955 18.10618589997349 0.0 3 0.9870428143520635 10.830212424266684 29254.0 48.60068481061503 0.0 - - - - - - - 746.8888888888889 58 9 CDC123 cell division cycle 123 homolog (S. cerevisiae) 69 9 B20140408_SF106_04 B20140408_SF106_04 TB149545.[MT7]-DYLLDDGTLVVSGR.3b3_1.heavy 556.297 / 536.284 70328.0 33.87200164794922 48 18 10 10 10 5.522974333326955 18.10618589997349 0.0 3 0.9870428143520635 10.830212424266684 70328.0 70.20900169204738 0.0 - - - - - - - 1781.2222222222222 140 9 CDC123 cell division cycle 123 homolog (S. cerevisiae) 71 10 B20140408_SF106_04 B20140408_SF106_04 TB378620.[MT7]-NIRFPLMTPQELINYVQTVDFMR.3b11_2.heavy 990.521 / 736.396 3409.0 43.71640110015869 36 8 10 8 10 0.6754125572087879 84.36767648747914 0.017597198486328125 3 0.7514121905537803 2.422061377417631 3409.0 27.534230769230767 0.0 - - - - - - - 165.2325581395349 6 43 KLHL13 kelch-like 13 (Drosophila) 73 10 B20140408_SF106_04 B20140408_SF106_04 TB378620.[MT7]-NIRFPLMTPQELINYVQTVDFMR.3b8_1.heavy 990.521 / 1117.63 1127.0 43.71640110015869 36 8 10 8 10 0.6754125572087879 84.36767648747914 0.017597198486328125 3 0.7514121905537803 2.422061377417631 1127.0 12.090421455938698 0.0 - - - - - - - 114.36170212765957 2 47 KLHL13 kelch-like 13 (Drosophila) 75 10 B20140408_SF106_04 B20140408_SF106_04 TB378620.[MT7]-NIRFPLMTPQELINYVQTVDFMR.3y8_1.heavy 990.521 / 995.498 1213.0 43.71640110015869 36 8 10 8 10 0.6754125572087879 84.36767648747914 0.017597198486328125 3 0.7514121905537803 2.422061377417631 1213.0 3.2861611506772794 0.0 - - - - - - - 109.26086956521739 2 46 KLHL13 kelch-like 13 (Drosophila) 77 10 B20140408_SF106_04 B20140408_SF106_04 TB378620.[MT7]-NIRFPLMTPQELINYVQTVDFMR.3b7_1.heavy 990.521 / 1016.58 766.0 43.71640110015869 36 8 10 8 10 0.6754125572087879 84.36767648747914 0.017597198486328125 3 0.7514121905537803 2.422061377417631 766.0 -0.697632058287796 2.0 - - - - - - - 0.0 1 0 KLHL13 kelch-like 13 (Drosophila) 79 11 B20140408_SF106_04 B20140408_SF106_04 TB149491.[MT7]-WC[CAM]ELIPGAEFR.3y6_1.heavy 507.926 / 676.341 354809.0 36.35100173950195 48 18 10 10 10 5.111619256354192 19.56327241620964 0.0 3 0.9899509105987199 12.300836733263056 354809.0 202.99809457806026 0.0 - - - - - - - 373.0 709 1 CDC123 cell division cycle 123 homolog (S. cerevisiae) 81 11 B20140408_SF106_04 B20140408_SF106_04 TB149491.[MT7]-WC[CAM]ELIPGAEFR.3b4_1.heavy 507.926 / 733.346 230425.0 36.35100173950195 48 18 10 10 10 5.111619256354192 19.56327241620964 0.0 3 0.9899509105987199 12.300836733263056 230425.0 216.0693354381615 0.0 - - - - - - - 727.0 460 8 CDC123 cell division cycle 123 homolog (S. cerevisiae) 83 11 B20140408_SF106_04 B20140408_SF106_04 TB149491.[MT7]-WC[CAM]ELIPGAEFR.3b3_1.heavy 507.926 / 620.262 288739.0 36.35100173950195 48 18 10 10 10 5.111619256354192 19.56327241620964 0.0 3 0.9899509105987199 12.300836733263056 288739.0 241.86052648110342 0.0 - - - - - - - 767.0 577 7 CDC123 cell division cycle 123 homolog (S. cerevisiae) 85 11 B20140408_SF106_04 B20140408_SF106_04 TB149491.[MT7]-WC[CAM]ELIPGAEFR.3y5_1.heavy 507.926 / 579.289 172856.0 36.35100173950195 48 18 10 10 10 5.111619256354192 19.56327241620964 0.0 3 0.9899509105987199 12.300836733263056 172856.0 148.83631406210552 0.0 - - - - - - - 298.0 345 2 CDC123 cell division cycle 123 homolog (S. cerevisiae) 87 12 B20140408_SF106_04 B20140408_SF106_04 TB498763.[MT7]-LPGPLGTVASFQQWQVAER.3y7_1.heavy 743.403 / 916.464 25408.0 38.35360145568848 45 20 10 5 10 9.600445238772686 10.416183574084313 0.041599273681640625 3 0.9974874436865074 24.615773846440455 25408.0 88.98677659400947 0.0 - - - - - - - 237.25 50 8 PARP10 poly (ADP-ribose) polymerase family, member 10 89 12 B20140408_SF106_04 B20140408_SF106_04 TB498763.[MT7]-LPGPLGTVASFQQWQVAER.3y6_1.heavy 743.403 / 788.405 35029.0 38.35360145568848 45 20 10 5 10 9.600445238772686 10.416183574084313 0.041599273681640625 3 0.9974874436865074 24.615773846440455 35029.0 45.6872544690774 0.0 - - - - - - - 840.3 70 10 PARP10 poly (ADP-ribose) polymerase family, member 10 91 12 B20140408_SF106_04 B20140408_SF106_04 TB498763.[MT7]-LPGPLGTVASFQQWQVAER.3y8_1.heavy 743.403 / 1044.52 22765.0 38.35360145568848 45 20 10 5 10 9.600445238772686 10.416183574084313 0.041599273681640625 3 0.9974874436865074 24.615773846440455 22765.0 106.93793640945259 0.0 - - - - - - - 323.2307692307692 45 13 PARP10 poly (ADP-ribose) polymerase family, member 10 93 12 B20140408_SF106_04 B20140408_SF106_04 TB498763.[MT7]-LPGPLGTVASFQQWQVAER.3b7_1.heavy 743.403 / 780.474 24594.0 38.35360145568848 45 20 10 5 10 9.600445238772686 10.416183574084313 0.041599273681640625 3 0.9974874436865074 24.615773846440455 24594.0 40.563020833333326 0.0 - - - - - - - 784.1428571428571 49 7 PARP10 poly (ADP-ribose) polymerase family, member 10 95 13 B20140408_SF106_04 B20140408_SF106_04 TB378189.[MT7]-YTC[CAM]QELQR.2b4_1.heavy 621.307 / 697.31 7744.0 23.293699264526367 50 20 10 10 10 3.412230447605446 22.288811290258117 0.0 3 0.9919637214396237 13.757629407287356 7744.0 22.900957370802573 0.0 - - - - - - - 280.2608695652174 15 23 THOC5 THO complex 5 97 13 B20140408_SF106_04 B20140408_SF106_04 TB378189.[MT7]-YTC[CAM]QELQR.2y6_1.heavy 621.307 / 833.393 20195.0 23.293699264526367 50 20 10 10 10 3.412230447605446 22.288811290258117 0.0 3 0.9919637214396237 13.757629407287356 20195.0 72.4014700445586 0.0 - - - - - - - 210.76923076923077 40 26 THOC5 THO complex 5 99 13 B20140408_SF106_04 B20140408_SF106_04 TB378189.[MT7]-YTC[CAM]QELQR.2b5_1.heavy 621.307 / 826.352 24493.0 23.293699264526367 50 20 10 10 10 3.412230447605446 22.288811290258117 0.0 3 0.9919637214396237 13.757629407287356 24493.0 93.41174174174174 0.0 - - - - - - - 259.25 48 24 THOC5 THO complex 5 101 13 B20140408_SF106_04 B20140408_SF106_04 TB378189.[MT7]-YTC[CAM]QELQR.2y7_1.heavy 621.307 / 934.441 61918.0 23.293699264526367 50 20 10 10 10 3.412230447605446 22.288811290258117 0.0 3 0.9919637214396237 13.757629407287356 61918.0 297.6911815412535 0.0 - - - - - - - 653.125 123 8 THOC5 THO complex 5 103 14 B20140408_SF106_04 B20140408_SF106_04 TB498586.[MT7]-LEQHVQALLR.2b3_1.heavy 675.902 / 515.295 11952.0 30.262800216674805 48 18 10 10 10 3.786029102589502 26.41289786483779 0.0 3 0.9837571353631661 9.670333458459732 11952.0 11.176312820671605 0.0 - - - - - - - 1207.9 23 10 PARP10 poly (ADP-ribose) polymerase family, member 10 105 14 B20140408_SF106_04 B20140408_SF106_04 TB498586.[MT7]-LEQHVQALLR.2y8_1.heavy 675.902 / 964.569 7261.0 30.262800216674805 48 18 10 10 10 3.786029102589502 26.41289786483779 0.0 3 0.9837571353631661 9.670333458459732 7261.0 18.080695384019243 0.0 - - - - - - - 649.7777777777778 14 9 PARP10 poly (ADP-ribose) polymerase family, member 10 107 14 B20140408_SF106_04 B20140408_SF106_04 TB498586.[MT7]-LEQHVQALLR.2y9_1.heavy 675.902 / 1093.61 N/A 30.262800216674805 48 18 10 10 10 3.786029102589502 26.41289786483779 0.0 3 0.9837571353631661 9.670333458459732 14009.0 42.92938979158393 0.0 - - - - - - - 275.57142857142856 28 14 PARP10 poly (ADP-ribose) polymerase family, member 10 109 14 B20140408_SF106_04 B20140408_SF106_04 TB498586.[MT7]-LEQHVQALLR.2y7_1.heavy 675.902 / 836.51 12081.0 30.262800216674805 48 18 10 10 10 3.786029102589502 26.41289786483779 0.0 3 0.9837571353631661 9.670333458459732 12081.0 21.406726339851417 0.0 - - - - - - - 697.5714285714286 24 14 PARP10 poly (ADP-ribose) polymerase family, member 10 111 15 B20140408_SF106_04 B20140408_SF106_04 TB149475.[MT7]-DAIAQAEMDLK[MT7].3y3_1.heavy 498.269 / 519.326 44962.0 31.29419994354248 43 17 10 6 10 2.0004338747424875 34.43764741911373 0.03180122375488281 3 0.9725956284028298 7.437990642768974 44962.0 20.502476665648437 0.0 - - - - - - - 1283.6666666666667 89 3 CCDC109A coiled-coil domain containing 109A 113 15 B20140408_SF106_04 B20140408_SF106_04 TB149475.[MT7]-DAIAQAEMDLK[MT7].3b4_1.heavy 498.269 / 515.295 42743.0 31.29419994354248 43 17 10 6 10 2.0004338747424875 34.43764741911373 0.03180122375488281 3 0.9725956284028298 7.437990642768974 42743.0 22.152201146891358 0.0 - - - - - - - 1805.4444444444443 85 9 CCDC109A coiled-coil domain containing 109A 115 15 B20140408_SF106_04 B20140408_SF106_04 TB149475.[MT7]-DAIAQAEMDLK[MT7].3b5_1.heavy 498.269 / 643.353 29170.0 31.29419994354248 43 17 10 6 10 2.0004338747424875 34.43764741911373 0.03180122375488281 3 0.9725956284028298 7.437990642768974 29170.0 9.883920294663685 0.0 - - - - - - - 1223.625 58 8 CCDC109A coiled-coil domain containing 109A 117 15 B20140408_SF106_04 B20140408_SF106_04 TB149475.[MT7]-DAIAQAEMDLK[MT7].3y4_1.heavy 498.269 / 650.366 28648.0 31.29419994354248 43 17 10 6 10 2.0004338747424875 34.43764741911373 0.03180122375488281 3 0.9725956284028298 7.437990642768974 28648.0 43.228372719145135 0.0 - - - - - - - 741.2857142857143 57 14 CCDC109A coiled-coil domain containing 109A 119 16 B20140408_SF106_04 B20140408_SF106_04 TB498583.[MT7]-LMAEIQDLK[MT7].3y3_1.heavy 450.263 / 519.326 98471.0 34.064226150512695 43 17 10 6 10 1.9591460201273447 39.96723356799654 0.03730010986328125 3 0.9747518236540257 7.7504932259605415 98471.0 165.49530527606188 0.0 - - - - - - - 629.0 196 8 THOC5 THO complex 5 121 16 B20140408_SF106_04 B20140408_SF106_04 TB498583.[MT7]-LMAEIQDLK[MT7].3b4_1.heavy 450.263 / 589.314 159158.0 34.064226150512695 43 17 10 6 10 1.9591460201273447 39.96723356799654 0.03730010986328125 3 0.9747518236540257 7.7504932259605415 159158.0 310.9299637293954 0.0 - - - - - - - 611.125 318 8 THOC5 THO complex 5 123 16 B20140408_SF106_04 B20140408_SF106_04 TB498583.[MT7]-LMAEIQDLK[MT7].3b5_1.heavy 450.263 / 702.398 17433.0 34.064226150512695 43 17 10 6 10 1.9591460201273447 39.96723356799654 0.03730010986328125 3 0.9747518236540257 7.7504932259605415 17433.0 64.21767405117343 0.0 - - - - - - - 231.88235294117646 34 17 THOC5 THO complex 5 125 16 B20140408_SF106_04 B20140408_SF106_04 TB498583.[MT7]-LMAEIQDLK[MT7].3b3_1.heavy 450.263 / 460.271 53685.0 34.064226150512695 43 17 10 6 10 1.9591460201273447 39.96723356799654 0.03730010986328125 3 0.9747518236540257 7.7504932259605415 53685.0 63.02431679593228 0.0 - - - - - - - 711.125 107 8 THOC5 THO complex 5 127 17 B20140408_SF106_04 B20140408_SF106_04 TB378181.[MT7]-LDWELEQR.2y4_1.heavy 616.823 / 545.304 41022.0 31.656875610351562 45 18 10 7 10 4.368561840220352 17.988611281784532 0.02989959716796875 3 0.9839264750736226 9.721278016974829 41022.0 23.02394400488981 0.0 - - - - - - - 1269.0 82 7 THOC5 THO complex 5 129 17 B20140408_SF106_04 B20140408_SF106_04 TB378181.[MT7]-LDWELEQR.2b4_1.heavy 616.823 / 688.342 49122.0 31.656875610351562 45 18 10 7 10 4.368561840220352 17.988611281784532 0.02989959716796875 3 0.9839264750736226 9.721278016974829 49122.0 73.89955612336703 0.0 - - - - - - - 1146.5555555555557 98 9 THOC5 THO complex 5 131 17 B20140408_SF106_04 B20140408_SF106_04 TB378181.[MT7]-LDWELEQR.2y6_1.heavy 616.823 / 860.426 81522.0 31.656875610351562 45 18 10 7 10 4.368561840220352 17.988611281784532 0.02989959716796875 3 0.9839264750736226 9.721278016974829 81522.0 144.34115955076643 0.0 - - - - - - - 680.5833333333334 163 12 THOC5 THO complex 5 133 17 B20140408_SF106_04 B20140408_SF106_04 TB378181.[MT7]-LDWELEQR.2y7_1.heavy 616.823 / 975.453 84984.0 31.656875610351562 45 18 10 7 10 4.368561840220352 17.988611281784532 0.02989959716796875 3 0.9839264750736226 9.721278016974829 84984.0 90.63511214551849 0.0 - - - - - - - 1287.5714285714287 169 7 THOC5 THO complex 5 135 18 B20140408_SF106_04 B20140408_SF106_04 TB498822.[MT7]-NLDILEGAITSAADQGAHIIVTPEDAIYGWNFNR.4b8_1.heavy 957.988 / 970.533 9498.0 42.66462516784668 42 15 10 7 10 2.0853618448925135 38.30168943210475 0.02970123291015625 3 0.9576025082593467 5.972357593185213 9498.0 18.70322590598282 0.0 - - - - - - - 687.9333333333333 18 15 VNN1 vanin 1 137 18 B20140408_SF106_04 B20140408_SF106_04 TB498822.[MT7]-NLDILEGAITSAADQGAHIIVTPEDAIYGWNFNR.4b4_1.heavy 957.988 / 600.347 13784.0 42.66462516784668 42 15 10 7 10 2.0853618448925135 38.30168943210475 0.02970123291015625 3 0.9576025082593467 5.972357593185213 13784.0 27.15444013337044 0.0 - - - - - - - 665.5294117647059 27 17 VNN1 vanin 1 139 18 B20140408_SF106_04 B20140408_SF106_04 TB498822.[MT7]-NLDILEGAITSAADQGAHIIVTPEDAIYGWNFNR.4y7_1.heavy 957.988 / 956.437 24825.0 42.66462516784668 42 15 10 7 10 2.0853618448925135 38.30168943210475 0.02970123291015625 3 0.9576025082593467 5.972357593185213 24825.0 106.62610174041431 0.0 - - - - - - - 207.125 49 24 VNN1 vanin 1 141 18 B20140408_SF106_04 B20140408_SF106_04 TB498822.[MT7]-NLDILEGAITSAADQGAHIIVTPEDAIYGWNFNR.4y6_1.heavy 957.988 / 793.374 23042.0 42.66462516784668 42 15 10 7 10 2.0853618448925135 38.30168943210475 0.02970123291015625 3 0.9576025082593467 5.972357593185213 23042.0 59.403809835452506 0.0 - - - - - - - 726.2727272727273 46 11 VNN1 vanin 1 143 19 B20140408_SF106_04 B20140408_SF106_04 TB149671.[MT7]-EHVLHC[CAM]QFSAWYPFFR.4y5_1.heavy 567.779 / 729.372 6962.0 35.942949295043945 23 10 2 5 6 0.8559356084664067 77.88747892626455 0.042301177978515625 5 0.8301518418304641 2.951100761145436 6962.0 16.292389166242252 2.0 - - - - - - - 707.9090909090909 64 11 CDC123 cell division cycle 123 homolog (S. cerevisiae) 145 19 B20140408_SF106_04 B20140408_SF106_04 TB149671.[MT7]-EHVLHC[CAM]QFSAWYPFFR.4b7_2.heavy 567.779 / 524.759 12427.0 35.942949295043945 23 10 2 5 6 0.8559356084664067 77.88747892626455 0.042301177978515625 5 0.8301518418304641 2.951100761145436 12427.0 47.755605246603984 0.0 - - - - - - - 259.15384615384613 24 13 CDC123 cell division cycle 123 homolog (S. cerevisiae) 147 19 B20140408_SF106_04 B20140408_SF106_04 TB149671.[MT7]-EHVLHC[CAM]QFSAWYPFFR.4b4_1.heavy 567.779 / 623.363 5465.0 35.942949295043945 23 10 2 5 6 0.8559356084664067 77.88747892626455 0.042301177978515625 5 0.8301518418304641 2.951100761145436 5465.0 9.670169286027955 0.0 - - - - - - - 696.2 10 10 CDC123 cell division cycle 123 homolog (S. cerevisiae) 149 19 B20140408_SF106_04 B20140408_SF106_04 TB149671.[MT7]-EHVLHC[CAM]QFSAWYPFFR.4b3_1.heavy 567.779 / 510.279 6363.0 35.942949295043945 23 10 2 5 6 0.8559356084664067 77.88747892626455 0.042301177978515625 5 0.8301518418304641 2.951100761145436 6363.0 8.845084670163189 1.0 - - - - - - - 756.8888888888889 12 9 CDC123 cell division cycle 123 homolog (S. cerevisiae) 151 20 B20140408_SF106_04 B20140408_SF106_04 TB149092.[MT7]-LSC[CAM]LAK[MT7].2b3_1.heavy 490.296 / 505.256 9581.0 25.91390037536621 42 20 6 10 6 11.823134949395497 8.45799362250474 0.0 5 0.9928739255115587 14.610966737958305 9581.0 6.708017212182183 0.0 - - - - - - - 1736.5555555555557 19 9 VNN2;VNN1 vanin 2;vanin 1 153 20 B20140408_SF106_04 B20140408_SF106_04 TB149092.[MT7]-LSC[CAM]LAK[MT7].2y4_1.heavy 490.296 / 635.367 17877.0 25.91390037536621 42 20 6 10 6 11.823134949395497 8.45799362250474 0.0 5 0.9928739255115587 14.610966737958305 17877.0 26.725720720196456 1.0 - - - - - - - 1223.5714285714287 235 7 VNN2;VNN1 vanin 2;vanin 1 155 20 B20140408_SF106_04 B20140408_SF106_04 TB149092.[MT7]-LSC[CAM]LAK[MT7].2y5_1.heavy 490.296 / 722.399 80447.0 25.91390037536621 42 20 6 10 6 11.823134949395497 8.45799362250474 0.0 5 0.9928739255115587 14.610966737958305 80447.0 29.571481798133377 0.0 - - - - - - - 2745.8 160 10 VNN2;VNN1 vanin 2;vanin 1 157 20 B20140408_SF106_04 B20140408_SF106_04 TB149092.[MT7]-LSC[CAM]LAK[MT7].2b4_1.heavy 490.296 / 618.34 10865.0 25.91390037536621 42 20 6 10 6 11.823134949395497 8.45799362250474 0.0 5 0.9928739255115587 14.610966737958305 10865.0 12.513964453464283 1.0 - - - - - - - 1231.1 30 10 VNN2;VNN1 vanin 2;vanin 1 159 21 B20140408_SF106_04 B20140408_SF106_04 TB498611.[MT7]-IALTQSAANVK[MT7].3y3_1.heavy 468.62 / 504.326 195097.0 27.025299072265625 48 18 10 10 10 3.7845193189514506 26.423434939078675 0.0 3 0.9811456714551076 8.973711489185387 195097.0 77.11805140098556 0.0 - - - - - - - 924.0 390 2 HOMER2 homer homolog 2 (Drosophila) 161 21 B20140408_SF106_04 B20140408_SF106_04 TB498611.[MT7]-IALTQSAANVK[MT7].3b4_1.heavy 468.62 / 543.362 70131.0 27.025299072265625 48 18 10 10 10 3.7845193189514506 26.423434939078675 0.0 3 0.9811456714551076 8.973711489185387 70131.0 29.987902932610858 0.0 - - - - - - - 1905.0 140 8 HOMER2 homer homolog 2 (Drosophila) 163 21 B20140408_SF106_04 B20140408_SF106_04 TB498611.[MT7]-IALTQSAANVK[MT7].3b5_1.heavy 468.62 / 671.421 43349.0 27.025299072265625 48 18 10 10 10 3.7845193189514506 26.423434939078675 0.0 3 0.9811456714551076 8.973711489185387 43349.0 50.2650975298467 0.0 - - - - - - - 763.4444444444445 86 9 HOMER2 homer homolog 2 (Drosophila) 165 21 B20140408_SF106_04 B20140408_SF106_04 TB498611.[MT7]-IALTQSAANVK[MT7].3y4_1.heavy 468.62 / 575.363 180436.0 27.025299072265625 48 18 10 10 10 3.7845193189514506 26.423434939078675 0.0 3 0.9811456714551076 8.973711489185387 180436.0 74.37395188605097 0.0 - - - - - - - 462.0 360 1 HOMER2 homer homolog 2 (Drosophila) 167 22 B20140408_SF106_04 B20140408_SF106_04 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 540078.0 32.964500427246094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 540078.0 110.11214575508876 0.0 - - - - - - - 734.6666666666666 1080 6 169 22 B20140408_SF106_04 B20140408_SF106_04 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 1328920.0 32.964500427246094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1328920.0 134.8148908077105 0.0 - - - - - - - 796.875 2657 8 171 22 B20140408_SF106_04 B20140408_SF106_04 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 1220380.0 32.964500427246094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1220380.0 139.4044735670504 0.0 - - - - - - - 407.0 2440 1 173 23 B20140408_SF106_04 B20140408_SF106_04 TB378364.[MT7]-WC[CAM]ELIPGAEFR.2b3_1.heavy 761.386 / 620.262 80807.0 36.35100173950195 43 13 10 10 10 1.860918164983934 43.01023526896623 0.0 3 0.9182090110847815 4.2855257648714185 80807.0 81.65837738153363 0.0 - - - - - - - 1263.9 161 10 CDC123 cell division cycle 123 homolog (S. cerevisiae) 175 23 B20140408_SF106_04 B20140408_SF106_04 TB378364.[MT7]-WC[CAM]ELIPGAEFR.2b4_1.heavy 761.386 / 733.346 139257.0 36.35100173950195 43 13 10 10 10 1.860918164983934 43.01023526896623 0.0 3 0.9182090110847815 4.2855257648714185 139257.0 51.213358900734576 0.0 - - - - - - - 2666.5 278 2 CDC123 cell division cycle 123 homolog (S. cerevisiae) 177 23 B20140408_SF106_04 B20140408_SF106_04 TB378364.[MT7]-WC[CAM]ELIPGAEFR.2y6_1.heavy 761.386 / 676.341 260395.0 36.35100173950195 43 13 10 10 10 1.860918164983934 43.01023526896623 0.0 3 0.9182090110847815 4.2855257648714185 260395.0 185.58463883051218 0.0 - - - - - - - 745.4 520 5 CDC123 cell division cycle 123 homolog (S. cerevisiae) 179 23 B20140408_SF106_04 B20140408_SF106_04 TB378364.[MT7]-WC[CAM]ELIPGAEFR.2y10_1.heavy 761.386 / 1191.58 71455.0 36.35100173950195 43 13 10 10 10 1.860918164983934 43.01023526896623 0.0 3 0.9182090110847815 4.2855257648714185 71455.0 494.57206339752497 0.0 - - - - - - - 229.42857142857142 142 14 CDC123 cell division cycle 123 homolog (S. cerevisiae) 181 24 B20140408_SF106_04 B20140408_SF106_04 TB378430.[MT7]-QAVTVSYFYDVTR.3y7_1.heavy 564.962 / 963.457 6822.0 33.76490020751953 46 16 10 10 10 3.8250824183289254 26.143227534346117 0.0 3 0.9632105489587562 6.414461294562782 6822.0 21.54519885556208 0.0 - - - - - - - 226.1 13 20 HOMER2 homer homolog 2 (Drosophila) 183 24 B20140408_SF106_04 B20140408_SF106_04 TB378430.[MT7]-QAVTVSYFYDVTR.3y6_1.heavy 564.962 / 800.394 33664.0 33.76490020751953 46 16 10 10 10 3.8250824183289254 26.143227534346117 0.0 3 0.9632105489587562 6.414461294562782 33664.0 32.65456733421669 0.0 - - - - - - - 726.5 67 10 HOMER2 homer homolog 2 (Drosophila) 185 24 B20140408_SF106_04 B20140408_SF106_04 TB378430.[MT7]-QAVTVSYFYDVTR.3b4_1.heavy 564.962 / 544.321 25507.0 33.76490020751953 46 16 10 10 10 3.8250824183289254 26.143227534346117 0.0 3 0.9632105489587562 6.414461294562782 25507.0 18.471399090989657 0.0 - - - - - - - 1747.7142857142858 51 7 HOMER2 homer homolog 2 (Drosophila) 187 24 B20140408_SF106_04 B20140408_SF106_04 TB378430.[MT7]-QAVTVSYFYDVTR.3y5_1.heavy 564.962 / 653.325 66141.0 33.76490020751953 46 16 10 10 10 3.8250824183289254 26.143227534346117 0.0 3 0.9632105489587562 6.414461294562782 66141.0 71.90996493809732 0.0 - - - - - - - 794.2857142857143 132 7 HOMER2 homer homolog 2 (Drosophila) 189 25 B20140408_SF106_04 B20140408_SF106_04 TB149292.[MT7]-VAIYSPDGVR.2y8_1.heavy 610.841 / 906.468 27558.0 27.869199752807617 44 14 10 10 10 2.061754126840785 38.56965522940371 0.0 3 0.9372453369164222 4.900513730667045 27558.0 42.150089539452054 0.0 - - - - - - - 669.7142857142857 55 7 CCDC109A coiled-coil domain containing 109A 191 25 B20140408_SF106_04 B20140408_SF106_04 TB149292.[MT7]-VAIYSPDGVR.2y9_1.heavy 610.841 / 977.505 75326.0 27.869199752807617 44 14 10 10 10 2.061754126840785 38.56965522940371 0.0 3 0.9372453369164222 4.900513730667045 75326.0 102.9260807471492 0.0 - - - - - - - 665.25 150 8 CCDC109A coiled-coil domain containing 109A 193 25 B20140408_SF106_04 B20140408_SF106_04 TB149292.[MT7]-VAIYSPDGVR.2y6_1.heavy 610.841 / 630.321 39468.0 27.869199752807617 44 14 10 10 10 2.061754126840785 38.56965522940371 0.0 3 0.9372453369164222 4.900513730667045 39468.0 20.396717276382795 0.0 - - - - - - - 1185.5714285714287 78 7 CCDC109A coiled-coil domain containing 109A 195 25 B20140408_SF106_04 B20140408_SF106_04 TB149292.[MT7]-VAIYSPDGVR.2y7_1.heavy 610.841 / 793.384 87109.0 27.869199752807617 44 14 10 10 10 2.061754126840785 38.56965522940371 0.0 3 0.9372453369164222 4.900513730667045 87109.0 29.226950294927097 0.0 - - - - - - - 316.6666666666667 174 3 CCDC109A coiled-coil domain containing 109A 197 26 B20140408_SF106_04 B20140408_SF106_04 TB149480.[MT7]-SVILPLPQNVK[MT7].2y8_1.heavy 748.476 / 1052.66 37219.0 32.68519973754883 38 8 10 10 10 1.3484222455345605 55.82112293959198 0.0 3 0.7996884794669599 2.710053879339649 37219.0 77.59690296631473 0.0 - - - - - - - 774.0 74 8 CDC123 cell division cycle 123 homolog (S. cerevisiae) 199 26 B20140408_SF106_04 B20140408_SF106_04 TB149480.[MT7]-SVILPLPQNVK[MT7].2y5_1.heavy 748.476 / 729.438 98787.0 32.68519973754883 38 8 10 10 10 1.3484222455345605 55.82112293959198 0.0 3 0.7996884794669599 2.710053879339649 98787.0 84.79186556210334 0.0 - - - - - - - 487.0 197 1 CDC123 cell division cycle 123 homolog (S. cerevisiae) 201 26 B20140408_SF106_04 B20140408_SF106_04 TB149480.[MT7]-SVILPLPQNVK[MT7].2y3_1.heavy 748.476 / 504.326 12592.0 32.68519973754883 38 8 10 10 10 1.3484222455345605 55.82112293959198 0.0 3 0.7996884794669599 2.710053879339649 12592.0 11.95474934331166 1.0 - - - - - - - 1232.5714285714287 25 7 CDC123 cell division cycle 123 homolog (S. cerevisiae) 203 26 B20140408_SF106_04 B20140408_SF106_04 TB149480.[MT7]-SVILPLPQNVK[MT7].2y7_1.heavy 748.476 / 939.574 215870.0 32.68519973754883 38 8 10 10 10 1.3484222455345605 55.82112293959198 0.0 3 0.7996884794669599 2.710053879339649 215870.0 461.0438864005056 0.0 - - - - - - - 324.6666666666667 431 3 CDC123 cell division cycle 123 homolog (S. cerevisiae) 205 27 B20140408_SF106_04 B20140408_SF106_04 TB149343.[MT7]-SGGGPVLSWQR.2y4_1.heavy 644.35 / 576.289 8476.0 29.226200103759766 47 17 10 10 10 3.1273537753828484 31.975915480735168 0.0 3 0.9790376335015369 8.509041249332782 8476.0 6.72463818657367 0.0 - - - - - - - 1234.0 16 11 PARP10 poly (ADP-ribose) polymerase family, member 10 207 27 B20140408_SF106_04 B20140408_SF106_04 TB149343.[MT7]-SGGGPVLSWQR.2b6_1.heavy 644.35 / 599.327 12810.0 29.226200103759766 47 17 10 10 10 3.1273537753828484 31.975915480735168 0.0 3 0.9790376335015369 8.509041249332782 12810.0 6.144020284158191 0.0 - - - - - - - 1402.0 25 3 PARP10 poly (ADP-ribose) polymerase family, member 10 209 27 B20140408_SF106_04 B20140408_SF106_04 TB149343.[MT7]-SGGGPVLSWQR.2y10_1.heavy 644.35 / 1056.56 12874.0 29.226200103759766 47 17 10 10 10 3.1273537753828484 31.975915480735168 0.0 3 0.9790376335015369 8.509041249332782 12874.0 49.07130044843049 0.0 - - - - - - - 273.85 25 20 PARP10 poly (ADP-ribose) polymerase family, member 10 211 27 B20140408_SF106_04 B20140408_SF106_04 TB149343.[MT7]-SGGGPVLSWQR.2y7_1.heavy 644.35 / 885.494 7265.0 29.226200103759766 47 17 10 10 10 3.1273537753828484 31.975915480735168 0.0 3 0.9790376335015369 8.509041249332782 7265.0 8.902508046798756 2.0 - - - - - - - 745.8 14 10 PARP10 poly (ADP-ribose) polymerase family, member 10 213 28 B20140408_SF106_04 B20140408_SF106_04 TB378436.[MT7]-TPNPANQYQFDK[MT7].3y3_1.heavy 570.961 / 553.31 N/A 26.339399337768555 50 20 10 10 10 9.18075017440719 10.892356082051553 0.0 3 0.9968455690751156 21.967853827716855 36310.0 11.731943182309283 0.0 - - - - - - - 5275.428571428572 72 7 THOC5 THO complex 5 215 28 B20140408_SF106_04 B20140408_SF106_04 TB378436.[MT7]-TPNPANQYQFDK[MT7].3b5_1.heavy 570.961 / 625.343 17433.0 26.339399337768555 50 20 10 10 10 9.18075017440719 10.892356082051553 0.0 3 0.9968455690751156 21.967853827716855 17433.0 21.082194274466296 0.0 - - - - - - - 1256.6363636363637 34 11 THOC5 THO complex 5 217 28 B20140408_SF106_04 B20140408_SF106_04 TB378436.[MT7]-TPNPANQYQFDK[MT7].3y5_1.heavy 570.961 / 844.432 9387.0 26.339399337768555 50 20 10 10 10 9.18075017440719 10.892356082051553 0.0 3 0.9968455690751156 21.967853827716855 9387.0 43.66708033826638 0.0 - - - - - - - 709.0 18 8 THOC5 THO complex 5 219 28 B20140408_SF106_04 B20140408_SF106_04 TB378436.[MT7]-TPNPANQYQFDK[MT7].3b7_1.heavy 570.961 / 867.444 8304.0 26.339399337768555 50 20 10 10 10 9.18075017440719 10.892356082051553 0.0 3 0.9968455690751156 21.967853827716855 8304.0 10.023577047956916 0.0 - - - - - - - 1164.2857142857142 16 7 THOC5 THO complex 5 221 29 B20140408_SF106_04 B20140408_SF106_04 TB149348.[MT7]-SFLEVLDGK[MT7].3y3_1.heavy 432.586 / 463.263 181777.0 36.30720138549805 45 15 10 10 10 2.4247557716448136 32.962341682904864 0.0 3 0.9588577263471729 6.063423139799455 181777.0 259.6363304971255 0.0 - - - - - - - 239.8 363 5 HOMER2 homer homolog 2 (Drosophila) 223 29 B20140408_SF106_04 B20140408_SF106_04 TB149348.[MT7]-SFLEVLDGK[MT7].3b4_1.heavy 432.586 / 621.336 108707.0 36.30720138549805 45 15 10 10 10 2.4247557716448136 32.962341682904864 0.0 3 0.9588577263471729 6.063423139799455 108707.0 189.19308361414738 0.0 - - - - - - - 216.22222222222223 217 9 HOMER2 homer homolog 2 (Drosophila) 225 29 B20140408_SF106_04 B20140408_SF106_04 TB149348.[MT7]-SFLEVLDGK[MT7].3b5_1.heavy 432.586 / 720.405 53755.0 36.30720138549805 45 15 10 10 10 2.4247557716448136 32.962341682904864 0.0 3 0.9588577263471729 6.063423139799455 53755.0 102.58283464224485 0.0 - - - - - - - 775.8181818181819 107 11 HOMER2 homer homolog 2 (Drosophila) 227 29 B20140408_SF106_04 B20140408_SF106_04 TB149348.[MT7]-SFLEVLDGK[MT7].3b3_1.heavy 432.586 / 492.294 53006.0 36.30720138549805 45 15 10 10 10 2.4247557716448136 32.962341682904864 0.0 3 0.9588577263471729 6.063423139799455 53006.0 167.90288343167364 0.0 - - - - - - - 218.92307692307693 106 13 HOMER2 homer homolog 2 (Drosophila) 229 30 B20140408_SF106_04 B20140408_SF106_04 TB498817.[MT7]-HLVALLAGPWDQSLAFPLAASGPTLAGQTLK[MT7].4y5_1.heavy 858.738 / 690.427 16332.0 41.06420135498047 39 13 10 6 10 1.4089915459025508 46.97125954176862 0.0373992919921875 3 0.9285555503212665 4.589421131938392 16332.0 41.7164956808471 0.0 - - - - - - - 732.375 32 8 PARP10 poly (ADP-ribose) polymerase family, member 10 231 30 B20140408_SF106_04 B20140408_SF106_04 TB498817.[MT7]-HLVALLAGPWDQSLAFPLAASGPTLAGQTLK[MT7].4b7_1.heavy 858.738 / 862.563 7542.0 41.06420135498047 39 13 10 6 10 1.4089915459025508 46.97125954176862 0.0373992919921875 3 0.9285555503212665 4.589421131938392 7542.0 21.00397553641092 0.0 - - - - - - - 261.0 15 16 PARP10 poly (ADP-ribose) polymerase family, member 10 233 30 B20140408_SF106_04 B20140408_SF106_04 TB498817.[MT7]-HLVALLAGPWDQSLAFPLAASGPTLAGQTLK[MT7].4b5_1.heavy 858.738 / 678.442 14651.0 41.06420135498047 39 13 10 6 10 1.4089915459025508 46.97125954176862 0.0373992919921875 3 0.9285555503212665 4.589421131938392 14651.0 54.08034722222222 0.0 - - - - - - - 744.5 29 8 PARP10 poly (ADP-ribose) polymerase family, member 10 235 30 B20140408_SF106_04 B20140408_SF106_04 TB498817.[MT7]-HLVALLAGPWDQSLAFPLAASGPTLAGQTLK[MT7].4b6_1.heavy 858.738 / 791.526 8310.0 41.06420135498047 39 13 10 6 10 1.4089915459025508 46.97125954176862 0.0373992919921875 3 0.9285555503212665 4.589421131938392 8310.0 32.201249999999995 0.0 - - - - - - - 336.0 16 17 PARP10 poly (ADP-ribose) polymerase family, member 10 237 31 B20140408_SF106_04 B20140408_SF106_04 TB498508.[MT7]-FGQTPVQER.2y8_1.heavy 603.323 / 914.469 67448.0 24.103099822998047 50 20 10 10 10 5.419681549962506 18.451268599110183 0.0 3 0.9907711469061975 12.836716013732955 67448.0 289.2468053472689 0.0 - - - - - - - 236.9090909090909 134 22 VNN1 vanin 1 239 31 B20140408_SF106_04 B20140408_SF106_04 TB498508.[MT7]-FGQTPVQER.2y5_1.heavy 603.323 / 628.341 47639.0 24.103099822998047 50 20 10 10 10 5.419681549962506 18.451268599110183 0.0 3 0.9907711469061975 12.836716013732955 47639.0 208.08062615338156 0.0 - - - - - - - 291.3333333333333 95 15 VNN1 vanin 1 241 31 B20140408_SF106_04 B20140408_SF106_04 TB498508.[MT7]-FGQTPVQER.2b4_1.heavy 603.323 / 578.305 28551.0 24.103099822998047 50 20 10 10 10 5.419681549962506 18.451268599110183 0.0 3 0.9907711469061975 12.836716013732955 28551.0 37.72933422380716 0.0 - - - - - - - 1182.875 57 8 VNN1 vanin 1 243 31 B20140408_SF106_04 B20140408_SF106_04 TB498508.[MT7]-FGQTPVQER.2y6_1.heavy 603.323 / 729.389 28270.0 24.103099822998047 50 20 10 10 10 5.419681549962506 18.451268599110183 0.0 3 0.9907711469061975 12.836716013732955 28270.0 67.39989410690345 0.0 - - - - - - - 673.5 56 10 VNN1 vanin 1 245 32 B20140408_SF106_04 B20140408_SF106_04 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 2827780.0 28.40169906616211 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2827780.0 450.8629545496192 0.0 - - - - - - - 1175.0 5655 1 247 32 B20140408_SF106_04 B20140408_SF106_04 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 857889.0 28.40169906616211 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 857889.0 206.735709667229 0.0 - - - - - - - 1330.0 1715 2 249 32 B20140408_SF106_04 B20140408_SF106_04 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 604045.0 28.40169906616211 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 604045.0 259.22526821239103 0.0 - - - - - - - 1423.0 1208 1 251 33 B20140408_SF106_04 B20140408_SF106_04 TB498810.[MT7]-FLLGPEGQHLLQGLEAQFQC[CAM]VFGTER.3b4_1.heavy 1040.2 / 575.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARP10 poly (ADP-ribose) polymerase family, member 10 253 33 B20140408_SF106_04 B20140408_SF106_04 TB498810.[MT7]-FLLGPEGQHLLQGLEAQFQC[CAM]VFGTER.3b3_1.heavy 1040.2 / 518.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARP10 poly (ADP-ribose) polymerase family, member 10 255 33 B20140408_SF106_04 B20140408_SF106_04 TB498810.[MT7]-FLLGPEGQHLLQGLEAQFQC[CAM]VFGTER.3b8_1.heavy 1040.2 / 986.543 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARP10 poly (ADP-ribose) polymerase family, member 10 257 33 B20140408_SF106_04 B20140408_SF106_04 TB498810.[MT7]-FLLGPEGQHLLQGLEAQFQC[CAM]VFGTER.3y9_1.heavy 1040.2 / 1143.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARP10 poly (ADP-ribose) polymerase family, member 10 259 34 B20140408_SF106_04 B20140408_SF106_04 TB149207.[MT7]-HWGAPQQR.3y3_1.heavy 375.201 / 431.236 125608.0 20.90690040588379 50 20 10 10 10 12.153158178588084 8.228313869573752 0.0 3 0.9960560974241713 19.645199464988 125608.0 61.45442150236815 0.0 - - - - - - - 1906.75 251 4 PEX16 peroxisomal biogenesis factor 16 261 34 B20140408_SF106_04 B20140408_SF106_04 TB149207.[MT7]-HWGAPQQR.3b4_1.heavy 375.201 / 596.306 64517.0 20.90690040588379 50 20 10 10 10 12.153158178588084 8.228313869573752 0.0 3 0.9960560974241713 19.645199464988 64517.0 215.05666666666667 0.0 - - - - - - - 771.8888888888889 129 9 PEX16 peroxisomal biogenesis factor 16 263 34 B20140408_SF106_04 B20140408_SF106_04 TB149207.[MT7]-HWGAPQQR.3b3_1.heavy 375.201 / 525.269 71725.0 20.90690040588379 50 20 10 10 10 12.153158178588084 8.228313869573752 0.0 3 0.9960560974241713 19.645199464988 71725.0 79.46778171683388 0.0 - - - - - - - 661.0 143 11 PEX16 peroxisomal biogenesis factor 16 265 34 B20140408_SF106_04 B20140408_SF106_04 TB149207.[MT7]-HWGAPQQR.3y4_1.heavy 375.201 / 528.289 302157.0 20.90690040588379 50 20 10 10 10 12.153158178588084 8.228313869573752 0.0 3 0.9960560974241713 19.645199464988 302157.0 449.96786552040237 0.0 - - - - - - - 748.0 604 7 PEX16 peroxisomal biogenesis factor 16 267 35 B20140408_SF106_04 B20140408_SF106_04 TB149679.[MT7]-LFSLK[MT7]PTSGPVLTVTLFGR.3y7_1.heavy 774.466 / 793.457 18666.0 38.6245002746582 44 14 10 10 10 2.8502637609063934 35.08447231150273 0.0 3 0.9477642880196292 5.376130071735528 18666.0 39.874176663031626 0.0 - - - - - - - 739.0 37 14 VNN1 vanin 1 269 35 B20140408_SF106_04 B20140408_SF106_04 TB149679.[MT7]-LFSLK[MT7]PTSGPVLTVTLFGR.3y11_1.heavy 774.466 / 1159.68 3930.0 38.6245002746582 44 14 10 10 10 2.8502637609063934 35.08447231150273 0.0 3 0.9477642880196292 5.376130071735528 3930.0 42.3 0.0 - - - - - - - 138.41176470588235 7 17 VNN1 vanin 1 271 35 B20140408_SF106_04 B20140408_SF106_04 TB149679.[MT7]-LFSLK[MT7]PTSGPVLTVTLFGR.3b5_1.heavy 774.466 / 877.575 6026.0 38.6245002746582 44 14 10 10 10 2.8502637609063934 35.08447231150273 0.0 3 0.9477642880196292 5.376130071735528 6026.0 21.16 0.0 - - - - - - - 240.0 12 15 VNN1 vanin 1 273 35 B20140408_SF106_04 B20140408_SF106_04 TB149679.[MT7]-LFSLK[MT7]PTSGPVLTVTLFGR.3y8_1.heavy 774.466 / 906.541 9693.0 38.6245002746582 44 14 10 10 10 2.8502637609063934 35.08447231150273 0.0 3 0.9477642880196292 5.376130071735528 9693.0 38.70904997264108 0.0 - - - - - - - 654.7777777777778 19 9 VNN1 vanin 1 275 36 B20140408_SF106_04 B20140408_SF106_04 TB149664.[MT7]-ASGLPVQPC[CAM]C[CAM]ALASPRPDR.3y18_2.heavy 732.709 / 990.991 19134.0 27.945199966430664 46 16 10 10 10 3.494880927572143 28.61327812660815 0.0 3 0.9638044407120203 6.46719539343362 19134.0 53.76222176675548 0.0 - - - - - - - 232.0 38 11 PARP10 poly (ADP-ribose) polymerase family, member 10 277 36 B20140408_SF106_04 B20140408_SF106_04 TB149664.[MT7]-ASGLPVQPC[CAM]C[CAM]ALASPRPDR.3y15_2.heavy 732.709 / 862.422 90949.0 27.945199966430664 46 16 10 10 10 3.494880927572143 28.61327812660815 0.0 3 0.9638044407120203 6.46719539343362 90949.0 82.54963282090029 0.0 - - - - - - - 414.5 181 2 PARP10 poly (ADP-ribose) polymerase family, member 10 279 36 B20140408_SF106_04 B20140408_SF106_04 TB149664.[MT7]-ASGLPVQPC[CAM]C[CAM]ALASPRPDR.3b6_1.heavy 732.709 / 669.405 13202.0 27.945199966430664 46 16 10 10 10 3.494880927572143 28.61327812660815 0.0 3 0.9638044407120203 6.46719539343362 13202.0 18.4 0.0 - - - - - - - 669.6666666666666 26 12 PARP10 poly (ADP-ribose) polymerase family, member 10 281 36 B20140408_SF106_04 B20140408_SF106_04 TB149664.[MT7]-ASGLPVQPC[CAM]C[CAM]ALASPRPDR.3y12_2.heavy 732.709 / 700.332 27552.0 27.945199966430664 46 16 10 10 10 3.494880927572143 28.61327812660815 0.0 3 0.9638044407120203 6.46719539343362 27552.0 35.97754172989378 0.0 - - - - - - - 751.2222222222222 55 9 PARP10 poly (ADP-ribose) polymerase family, member 10 283 37 B20140408_SF106_04 B20140408_SF106_04 TB149666.[MT7]-AQLVVHSAFEQDVEELDR.3y6_1.heavy 743.714 / 760.384 15307.0 33.31050109863281 50 20 10 10 10 6.493926546111037 15.399003867680973 0.0 3 0.9921602150899278 13.929199415674411 15307.0 16.388813037736835 0.0 - - - - - - - 1227.4285714285713 30 7 PARP10 poly (ADP-ribose) polymerase family, member 10 285 37 B20140408_SF106_04 B20140408_SF106_04 TB149666.[MT7]-AQLVVHSAFEQDVEELDR.3b4_1.heavy 743.714 / 556.357 35812.0 33.31050109863281 50 20 10 10 10 6.493926546111037 15.399003867680973 0.0 3 0.9921602150899278 13.929199415674411 35812.0 28.0963392760781 0.0 - - - - - - - 1191.375 71 8 PARP10 poly (ADP-ribose) polymerase family, member 10 287 37 B20140408_SF106_04 B20140408_SF106_04 TB149666.[MT7]-AQLVVHSAFEQDVEELDR.3b5_1.heavy 743.714 / 655.426 39783.0 33.31050109863281 50 20 10 10 10 6.493926546111037 15.399003867680973 0.0 3 0.9921602150899278 13.929199415674411 39783.0 39.92031116181116 0.0 - - - - - - - 1167.1666666666667 79 12 PARP10 poly (ADP-ribose) polymerase family, member 10 289 37 B20140408_SF106_04 B20140408_SF106_04 TB149666.[MT7]-AQLVVHSAFEQDVEELDR.3y9_1.heavy 743.714 / 1132.51 10758.0 33.31050109863281 50 20 10 10 10 6.493926546111037 15.399003867680973 0.0 3 0.9921602150899278 13.929199415674411 10758.0 19.163539175307186 0.0 - - - - - - - 216.66666666666666 21 12 PARP10 poly (ADP-ribose) polymerase family, member 10 291 38 B20140408_SF106_04 B20140408_SF106_04 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 1796330.0 18.89430046081543 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1796330.0 5371.683893407132 0.0 - - - - - - - 1722.625 3592 8 293 38 B20140408_SF106_04 B20140408_SF106_04 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 3281510.0 18.89430046081543 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 3281510.0 9620.373114336786 0.0 - - - - - - - 1759.5 6563 2 295 38 B20140408_SF106_04 B20140408_SF106_04 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 1267360.0 18.89430046081543 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1267360.0 1915.0300039851645 0.0 - - - - - - - 1249.4444444444443 2534 9 297 39 B20140408_SF106_04 B20140408_SF106_04 TB378441.[MT7]-FLDEDFVFDIYR.2b3_1.heavy 861.928 / 520.289 84351.0 40.770301818847656 42 12 10 10 10 1.0140789773891858 61.37152898441768 0.0 3 0.8974322873508931 3.8200860134191235 84351.0 87.08455409891505 0.0 - - - - - - - 318.75 168 4 CDC123 cell division cycle 123 homolog (S. cerevisiae) 299 39 B20140408_SF106_04 B20140408_SF106_04 TB378441.[MT7]-FLDEDFVFDIYR.2y9_1.heavy 861.928 / 1203.57 27828.0 40.770301818847656 42 12 10 10 10 1.0140789773891858 61.37152898441768 0.0 3 0.8974322873508931 3.8200860134191235 27828.0 228.99695614730095 0.0 - - - - - - - 683.25 55 8 CDC123 cell division cycle 123 homolog (S. cerevisiae) 301 39 B20140408_SF106_04 B20140408_SF106_04 TB378441.[MT7]-FLDEDFVFDIYR.2b5_1.heavy 861.928 / 764.358 43861.0 40.770301818847656 42 12 10 10 10 1.0140789773891858 61.37152898441768 0.0 3 0.8974322873508931 3.8200860134191235 43861.0 55.773951459686856 0.0 - - - - - - - 700.375 87 8 CDC123 cell division cycle 123 homolog (S. cerevisiae) 303 39 B20140408_SF106_04 B20140408_SF106_04 TB378441.[MT7]-FLDEDFVFDIYR.2y7_1.heavy 861.928 / 959.498 29924.0 40.770301818847656 42 12 10 10 10 1.0140789773891858 61.37152898441768 0.0 3 0.8974322873508931 3.8200860134191235 29924.0 116.90726862228081 0.0 - - - - - - - 724.9166666666666 59 12 CDC123 cell division cycle 123 homolog (S. cerevisiae) 305 40 B20140408_SF106_04 B20140408_SF106_04 TB378357.[MT7]-LDWELEQRK[MT7].3b4_1.heavy 502.284 / 688.342 24615.0 29.039899826049805 41 13 10 10 8 1.671922332539936 42.26476910789982 0.0 4 0.9211552027744166 4.3659644404310205 24615.0 16.38983280480771 1.0 - - - - - - - 1243.625 49 8 THOC5 THO complex 5 307 40 B20140408_SF106_04 B20140408_SF106_04 TB378357.[MT7]-LDWELEQRK[MT7].3y7_2.heavy 502.284 / 566.815 35137.0 29.039899826049805 41 13 10 10 8 1.671922332539936 42.26476910789982 0.0 4 0.9211552027744166 4.3659644404310205 35137.0 47.42077312016974 0.0 - - - - - - - 1259.5 70 8 THOC5 THO complex 5 309 40 B20140408_SF106_04 B20140408_SF106_04 TB378357.[MT7]-LDWELEQRK[MT7].3y4_1.heavy 502.284 / 704.417 4145.0 29.039899826049805 41 13 10 10 8 1.671922332539936 42.26476910789982 0.0 4 0.9211552027744166 4.3659644404310205 4145.0 5.398430370390737 3.0 - - - - - - - 784.8461538461538 8 13 THOC5 THO complex 5 311 40 B20140408_SF106_04 B20140408_SF106_04 TB378357.[MT7]-LDWELEQRK[MT7].3y8_2.heavy 502.284 / 624.329 36604.0 29.039899826049805 41 13 10 10 8 1.671922332539936 42.26476910789982 0.0 4 0.9211552027744166 4.3659644404310205 36604.0 16.335996022972168 0.0 - - - - - - - 1403.0 73 4 THOC5 THO complex 5 313 41 B20140408_SF106_04 B20140408_SF106_04 TB498746.[MT7]-FLDEDFVFDIYRDSR.3b6_1.heavy 694.341 / 911.427 7486.0 38.97919845581055 36 14 6 6 10 2.2380077873448228 35.16922849366631 0.0391998291015625 3 0.9497740014339715 5.483569684477517 7486.0 50.816244060180054 0.0 - - - - - - - 242.77777777777777 14 18 CDC123 cell division cycle 123 homolog (S. cerevisiae) 315 41 B20140408_SF106_04 B20140408_SF106_04 TB498746.[MT7]-FLDEDFVFDIYRDSR.3b4_1.heavy 694.341 / 649.331 3644.0 38.97919845581055 36 14 6 6 10 2.2380077873448228 35.16922849366631 0.0391998291015625 3 0.9497740014339715 5.483569684477517 3644.0 2.96260162601626 2.0 - - - - - - - 667.4615384615385 45 13 CDC123 cell division cycle 123 homolog (S. cerevisiae) 317 41 B20140408_SF106_04 B20140408_SF106_04 TB498746.[MT7]-FLDEDFVFDIYRDSR.3b5_1.heavy 694.341 / 764.358 12720.0 38.97919845581055 36 14 6 6 10 2.2380077873448228 35.16922849366631 0.0391998291015625 3 0.9497740014339715 5.483569684477517 12720.0 21.09764000153723 0.0 - - - - - - - 728.7142857142857 25 7 CDC123 cell division cycle 123 homolog (S. cerevisiae) 319 41 B20140408_SF106_04 B20140408_SF106_04 TB498746.[MT7]-FLDEDFVFDIYRDSR.3b3_1.heavy 694.341 / 520.289 14045.0 38.97919845581055 36 14 6 6 10 2.2380077873448228 35.16922849366631 0.0391998291015625 3 0.9497740014339715 5.483569684477517 14045.0 21.815845070422533 0.0 - - - - - - - 801.6 28 10 CDC123 cell division cycle 123 homolog (S. cerevisiae) 321 42 B20140408_SF106_04 B20140408_SF106_04 TB378440.[MT7]-DYTQYYDHISK[MT7].3b4_1.heavy 574.286 / 652.306 25031.0 26.945499420166016 45 17 10 10 8 2.6553673601379777 29.512663160515775 0.0 4 0.9780671594739867 8.317981347040293 25031.0 41.04824611398964 0.0 - - - - - - - 836.0 50 12 CDC123 cell division cycle 123 homolog (S. cerevisiae) 323 42 B20140408_SF106_04 B20140408_SF106_04 TB378440.[MT7]-DYTQYYDHISK[MT7].3b5_1.heavy 574.286 / 815.369 15879.0 26.945499420166016 45 17 10 10 8 2.6553673601379777 29.512663160515775 0.0 4 0.9780671594739867 8.317981347040293 15879.0 33.53519795671068 0.0 - - - - - - - 811.0714285714286 31 14 CDC123 cell division cycle 123 homolog (S. cerevisiae) 325 42 B20140408_SF106_04 B20140408_SF106_04 TB378440.[MT7]-DYTQYYDHISK[MT7].3b3_1.heavy 574.286 / 524.247 8766.0 26.945499420166016 45 17 10 10 8 2.6553673601379777 29.512663160515775 0.0 4 0.9780671594739867 8.317981347040293 8766.0 6.284400850774292 1.0 - - - - - - - 1644.8333333333333 22 12 CDC123 cell division cycle 123 homolog (S. cerevisiae) 327 42 B20140408_SF106_04 B20140408_SF106_04 TB378440.[MT7]-DYTQYYDHISK[MT7].3b7_1.heavy 574.286 / 1093.46 8435.0 26.945499420166016 45 17 10 10 8 2.6553673601379777 29.512663160515775 0.0 4 0.9780671594739867 8.317981347040293 8435.0 102.24242424242425 0.0 - - - - - - - 123.05882352941177 16 17 CDC123 cell division cycle 123 homolog (S. cerevisiae) 329 43 B20140408_SF106_04 B20140408_SF106_04 TB498510.[MT7]-EQLAPLEK[MT7].2b3_1.heavy 608.363 / 515.295 51818.0 26.827699661254883 44 14 10 10 10 1.550050930350687 52.08576639469384 0.0 3 0.931529696983599 4.689229787532707 51818.0 37.309732533372355 0.0 - - - - - - - 1633.142857142857 103 7 CCDC109A coiled-coil domain containing 109A 331 43 B20140408_SF106_04 B20140408_SF106_04 TB498510.[MT7]-EQLAPLEK[MT7].2y4_1.heavy 608.363 / 630.394 123461.0 26.827699661254883 44 14 10 10 10 1.550050930350687 52.08576639469384 0.0 3 0.931529696983599 4.689229787532707 123461.0 172.8524032482763 0.0 - - - - - - - 380.5 246 4 CCDC109A coiled-coil domain containing 109A 333 43 B20140408_SF106_04 B20140408_SF106_04 TB498510.[MT7]-EQLAPLEK[MT7].2y5_1.heavy 608.363 / 701.431 49508.0 26.827699661254883 44 14 10 10 10 1.550050930350687 52.08576639469384 0.0 3 0.931529696983599 4.689229787532707 49508.0 81.57789606078236 0.0 - - - - - - - 840.0 99 11 CCDC109A coiled-coil domain containing 109A 335 43 B20140408_SF106_04 B20140408_SF106_04 TB498510.[MT7]-EQLAPLEK[MT7].2b4_1.heavy 608.363 / 586.332 94229.0 26.827699661254883 44 14 10 10 10 1.550050930350687 52.08576639469384 0.0 3 0.931529696983599 4.689229787532707 94229.0 22.435706877408343 0.0 - - - - - - - 2215.6666666666665 188 3 CCDC109A coiled-coil domain containing 109A 337 44 B20140408_SF106_04 B20140408_SF106_04 TB498743.[MT7]-LTTALQESAASVEQWK[MT7].3b6_1.heavy 684.04 / 772.469 65102.0 35.47159957885742 46 16 10 10 10 2.586683556095324 38.659541390116146 0.0 3 0.9670021630508125 6.77513746087635 65102.0 52.84329818170941 0.0 - - - - - - - 794.3 130 10 HOMER2 homer homolog 2 (Drosophila) 339 44 B20140408_SF106_04 B20140408_SF106_04 TB498743.[MT7]-LTTALQESAASVEQWK[MT7].3b4_1.heavy 684.04 / 531.326 167616.0 35.47159957885742 46 16 10 10 10 2.586683556095324 38.659541390116146 0.0 3 0.9670021630508125 6.77513746087635 167616.0 232.1482477671336 0.0 - - - - - - - 742.4285714285714 335 7 HOMER2 homer homolog 2 (Drosophila) 341 44 B20140408_SF106_04 B20140408_SF106_04 TB498743.[MT7]-LTTALQESAASVEQWK[MT7].3b5_1.heavy 684.04 / 644.41 138220.0 35.47159957885742 46 16 10 10 10 2.586683556095324 38.659541390116146 0.0 3 0.9670021630508125 6.77513746087635 138220.0 191.43477237479243 0.0 - - - - - - - 881.625 276 8 HOMER2 homer homolog 2 (Drosophila) 343 44 B20140408_SF106_04 B20140408_SF106_04 TB498743.[MT7]-LTTALQESAASVEQWK[MT7].3y4_1.heavy 684.04 / 734.395 124116.0 35.47159957885742 46 16 10 10 10 2.586683556095324 38.659541390116146 0.0 3 0.9670021630508125 6.77513746087635 124116.0 196.23289322305246 0.0 - - - - - - - 779.5 248 10 HOMER2 homer homolog 2 (Drosophila) 345 45 B20140408_SF106_04 B20140408_SF106_04 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 703907.0 34.859500885009766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 703907.0 150.19582454415655 0.0 - - - - - - - 375.0 1407 2 347 45 B20140408_SF106_04 B20140408_SF106_04 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 1416830.0 34.859500885009766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1416830.0 177.87821977711948 0.0 - - - - - - - 840.0 2833 5 349 45 B20140408_SF106_04 B20140408_SF106_04 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 1663610.0 34.859500885009766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1663610.0 198.32840784313726 0.0 - - - - - - - 675.0 3327 2 351 46 B20140408_SF106_04 B20140408_SF106_04 TB498513.[MT7]-DVAIEIEER.2y8_1.heavy 609.328 / 958.52 63014.0 28.59040069580078 47 17 10 10 10 3.5291468686571994 28.335460019562426 0.0 3 0.9753623519767244 7.846338228546117 63014.0 182.47525156987763 0.0 - - - - - - - 312.0 126 10 THOC5 THO complex 5 353 46 B20140408_SF106_04 B20140408_SF106_04 TB498513.[MT7]-DVAIEIEER.2y6_1.heavy 609.328 / 788.415 61296.0 28.59040069580078 47 17 10 10 10 3.5291468686571994 28.335460019562426 0.0 3 0.9753623519767244 7.846338228546117 61296.0 72.09991760363917 0.0 - - - - - - - 1241.1 122 10 THOC5 THO complex 5 355 46 B20140408_SF106_04 B20140408_SF106_04 TB498513.[MT7]-DVAIEIEER.2b5_1.heavy 609.328 / 672.369 62251.0 28.59040069580078 47 17 10 10 10 3.5291468686571994 28.335460019562426 0.0 3 0.9753623519767244 7.846338228546117 62251.0 98.96526668664539 0.0 - - - - - - - 392.8333333333333 124 6 THOC5 THO complex 5 357 46 B20140408_SF106_04 B20140408_SF106_04 TB498513.[MT7]-DVAIEIEER.2y7_1.heavy 609.328 / 859.452 75808.0 28.59040069580078 47 17 10 10 10 3.5291468686571994 28.335460019562426 0.0 3 0.9753623519767244 7.846338228546117 75808.0 128.00041884816753 0.0 - - - - - - - 742.5555555555555 151 9 THOC5 THO complex 5 359 47 B20140408_SF106_04 B20140408_SF106_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 873980.0 31.519833246866863 23 -3 10 6 10 null 0.0 0.03140068054199219 3 0.0 0.0 873980.0 260.30745698546093 0.0 - - - - - - - 1233.3333333333333 1747 3 361 47 B20140408_SF106_04 B20140408_SF106_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 137428.0 31.519833246866863 23 -3 10 6 10 null 0.0 0.03140068054199219 3 0.0 0.0 137428.0 136.54863010607087 1.0 - - - - - - - 2308.1111111111113 274 9 363 47 B20140408_SF106_04 B20140408_SF106_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 108281.0 31.519833246866863 23 -3 10 6 10 null 0.0 0.03140068054199219 3 0.0 0.0 108281.0 118.31613622846399 0.0 - - - - - - - 1257.75 216 8 365 48 B20140408_SF106_04 B20140408_SF106_04 TB378054.[MT7]-VLQQEHR.2y4_1.heavy 527.3 / 569.279 4548.0 20.029499053955078 43 13 10 10 10 1.406306541668762 57.52685341126471 0.0 3 0.9088571803549896 4.056449058528678 4548.0 12.169999221798534 0.0 - - - - - - - 652.25 9 8 PARP10 poly (ADP-ribose) polymerase family, member 10 367 48 B20140408_SF106_04 B20140408_SF106_04 TB378054.[MT7]-VLQQEHR.2y5_1.heavy 527.3 / 697.338 6473.0 20.029499053955078 43 13 10 10 10 1.406306541668762 57.52685341126471 0.0 3 0.9088571803549896 4.056449058528678 6473.0 13.728158934228954 0.0 - - - - - - - 215.89473684210526 12 19 PARP10 poly (ADP-ribose) polymerase family, member 10 369 48 B20140408_SF106_04 B20140408_SF106_04 TB378054.[MT7]-VLQQEHR.2b4_1.heavy 527.3 / 613.379 13978.0 20.029499053955078 43 13 10 10 10 1.406306541668762 57.52685341126471 0.0 3 0.9088571803549896 4.056449058528678 13978.0 40.260955550055456 0.0 - - - - - - - 652.125 27 8 PARP10 poly (ADP-ribose) polymerase family, member 10 371 48 B20140408_SF106_04 B20140408_SF106_04 TB378054.[MT7]-VLQQEHR.2y6_1.heavy 527.3 / 810.422 18247.0 20.029499053955078 43 13 10 10 10 1.406306541668762 57.52685341126471 0.0 3 0.9088571803549896 4.056449058528678 18247.0 79.04469905501958 0.0 - - - - - - - 191.33333333333334 36 21 PARP10 poly (ADP-ribose) polymerase family, member 10 373 49 B20140408_SF106_04 B20140408_SF106_04 TB498641.[MT7]-SVILPLPQNVK[MT7].3y3_1.heavy 499.32 / 504.326 426219.0 32.68519973754883 50 20 10 10 10 17.37323172209773 5.755981477689374 0.0 3 0.9988360475658913 36.17034236152803 426219.0 314.9136949334035 0.0 - - - - - - - 682.0 852 1 CDC123 cell division cycle 123 homolog (S. cerevisiae) 375 49 B20140408_SF106_04 B20140408_SF106_04 TB498641.[MT7]-SVILPLPQNVK[MT7].3b4_1.heavy 499.32 / 557.378 997923.0 32.68519973754883 50 20 10 10 10 17.37323172209773 5.755981477689374 0.0 3 0.9988360475658913 36.17034236152803 997923.0 629.6314815272381 0.0 - - - - - - - 1227.0 1995 1 CDC123 cell division cycle 123 homolog (S. cerevisiae) 377 49 B20140408_SF106_04 B20140408_SF106_04 TB498641.[MT7]-SVILPLPQNVK[MT7].3y4_1.heavy 499.32 / 632.385 142641.0 32.68519973754883 50 20 10 10 10 17.37323172209773 5.755981477689374 0.0 3 0.9988360475658913 36.17034236152803 142641.0 62.95021086552204 0.0 - - - - - - - 954.0 285 1 CDC123 cell division cycle 123 homolog (S. cerevisiae) 379 49 B20140408_SF106_04 B20140408_SF106_04 TB498641.[MT7]-SVILPLPQNVK[MT7].3y5_1.heavy 499.32 / 729.438 416473.0 32.68519973754883 50 20 10 10 10 17.37323172209773 5.755981477689374 0.0 3 0.9988360475658913 36.17034236152803 416473.0 239.19195036674816 0.0 - - - - - - - 295.0 832 3 CDC123 cell division cycle 123 homolog (S. cerevisiae) 381 50 B20140408_SF106_04 B20140408_SF106_04 TB498635.[MT7]-TLSDIFLLFK[MT7].3b6_1.heavy 495.637 / 821.453 306788.0 43.20669937133789 40 10 10 10 10 0.6819438849892656 76.48653275508494 0.0 3 0.8314144618190713 2.9624637567287935 306788.0 1841.1368572779356 0.0 - - - - - - - 1246.4285714285713 613 7 CDC123 cell division cycle 123 homolog (S. cerevisiae) 383 50 B20140408_SF106_04 B20140408_SF106_04 TB498635.[MT7]-TLSDIFLLFK[MT7].3y3_1.heavy 495.637 / 551.367 539015.0 43.20669937133789 40 10 10 10 10 0.6819438849892656 76.48653275508494 0.0 3 0.8314144618190713 2.9624637567287935 539015.0 1882.4631830037474 0.0 - - - - - - - 1767.0 1078 7 CDC123 cell division cycle 123 homolog (S. cerevisiae) 385 50 B20140408_SF106_04 B20140408_SF106_04 TB498635.[MT7]-TLSDIFLLFK[MT7].3b4_1.heavy 495.637 / 561.3 422057.0 43.20669937133789 40 10 10 10 10 0.6819438849892656 76.48653275508494 0.0 3 0.8314144618190713 2.9624637567287935 422057.0 590.5427585078862 0.0 - - - - - - - 2816.1428571428573 844 7 CDC123 cell division cycle 123 homolog (S. cerevisiae) 387 50 B20140408_SF106_04 B20140408_SF106_04 TB498635.[MT7]-TLSDIFLLFK[MT7].3b5_1.heavy 495.637 / 674.384 528498.0 43.20669937133789 40 10 10 10 10 0.6819438849892656 76.48653275508494 0.0 3 0.8314144618190713 2.9624637567287935 528498.0 308.25839306672367 0.0 - - - - - - - 1762.5714285714287 1056 7 CDC123 cell division cycle 123 homolog (S. cerevisiae) 389 51 B20140408_SF106_04 B20140408_SF106_04 TB148991.[MT7]-AVFVAR.2y4_1.heavy 403.754 / 492.293 32628.0 25.80882501602173 40 14 10 6 10 1.387178924985451 42.834201313377974 0.03230094909667969 3 0.9477911453118171 5.377524960054888 32628.0 8.646842678035421 0.0 - - - - - - - 1731.857142857143 65 7 PARP10 poly (ADP-ribose) polymerase family, member 10 391 51 B20140408_SF106_04 B20140408_SF106_04 TB148991.[MT7]-AVFVAR.2b3_1.heavy 403.754 / 462.283 30286.0 25.80882501602173 40 14 10 6 10 1.387178924985451 42.834201313377974 0.03230094909667969 3 0.9477911453118171 5.377524960054888 30286.0 24.492268399075773 1.0 - - - - - - - 1722.7777777777778 60 9 PARP10 poly (ADP-ribose) polymerase family, member 10 393 51 B20140408_SF106_04 B20140408_SF106_04 TB148991.[MT7]-AVFVAR.2y5_1.heavy 403.754 / 591.361 52715.0 25.80882501602173 40 14 10 6 10 1.387178924985451 42.834201313377974 0.03230094909667969 3 0.9477911453118171 5.377524960054888 52715.0 78.56928198833005 0.0 - - - - - - - 1254.7777777777778 105 9 PARP10 poly (ADP-ribose) polymerase family, member 10 395 51 B20140408_SF106_04 B20140408_SF106_04 TB148991.[MT7]-AVFVAR.2b4_1.heavy 403.754 / 561.352 27268.0 25.80882501602173 40 14 10 6 10 1.387178924985451 42.834201313377974 0.03230094909667969 3 0.9477911453118171 5.377524960054888 27268.0 15.427945046339444 0.0 - - - - - - - 826.375 54 8 PARP10 poly (ADP-ribose) polymerase family, member 10 397 52 B20140408_SF106_04 B20140408_SF106_04 TB149654.[MT7]-ANTVFGLGFSSEQQLTK[MT7].3b6_1.heavy 705.716 / 734.395 76811.0 34.58192443847656 46 20 10 6 10 10.4149428041633 9.60158897464379 0.0366973876953125 3 0.9971054490758844 22.933321506841857 76811.0 50.884440509204694 0.0 - - - - - - - 1740.142857142857 153 7 HOMER2 homer homolog 2 (Drosophila) 399 52 B20140408_SF106_04 B20140408_SF106_04 TB149654.[MT7]-ANTVFGLGFSSEQQLTK[MT7].3b4_1.heavy 705.716 / 530.305 64109.0 34.58192443847656 46 20 10 6 10 10.4149428041633 9.60158897464379 0.0366973876953125 3 0.9971054490758844 22.933321506841857 64109.0 25.871231216533143 0.0 - - - - - - - 896.75 128 4 HOMER2 homer homolog 2 (Drosophila) 401 52 B20140408_SF106_04 B20140408_SF106_04 TB149654.[MT7]-ANTVFGLGFSSEQQLTK[MT7].3b5_1.heavy 705.716 / 677.374 45355.0 34.58192443847656 46 20 10 6 10 10.4149428041633 9.60158897464379 0.0366973876953125 3 0.9971054490758844 22.933321506841857 45355.0 40.827199971711025 0.0 - - - - - - - 448.0 90 1 HOMER2 homer homolog 2 (Drosophila) 403 52 B20140408_SF106_04 B20140408_SF106_04 TB149654.[MT7]-ANTVFGLGFSSEQQLTK[MT7].3b8_1.heavy 705.716 / 904.501 43038.0 34.58192443847656 46 20 10 6 10 10.4149428041633 9.60158897464379 0.0366973876953125 3 0.9971054490758844 22.933321506841857 43038.0 37.446715509112394 0.0 - - - - - - - 1280.857142857143 86 7 HOMER2 homer homolog 2 (Drosophila) 405 53 B20140408_SF106_04 B20140408_SF106_04 TB498521.[MT7]-EYLSSLQPR.2b3_1.heavy 618.839 / 550.299 19798.0 28.853599548339844 50 20 10 10 10 15.449607264677997 6.4726564427710205 0.0 3 0.9906494900071665 12.752805396784588 19798.0 26.829296452522463 0.0 - - - - - - - 1313.857142857143 39 7 THOC5 THO complex 5 407 53 B20140408_SF106_04 B20140408_SF106_04 TB498521.[MT7]-EYLSSLQPR.2y8_1.heavy 618.839 / 963.526 34935.0 28.853599548339844 50 20 10 10 10 15.449607264677997 6.4726564427710205 0.0 3 0.9906494900071665 12.752805396784588 34935.0 107.6258351294677 0.0 - - - - - - - 287.3 69 10 THOC5 THO complex 5 409 53 B20140408_SF106_04 B20140408_SF106_04 TB498521.[MT7]-EYLSSLQPR.2y6_1.heavy 618.839 / 687.378 36659.0 28.853599548339844 50 20 10 10 10 15.449607264677997 6.4726564427710205 0.0 3 0.9906494900071665 12.752805396784588 36659.0 56.830485971127366 0.0 - - - - - - - 798.25 73 8 THOC5 THO complex 5 411 53 B20140408_SF106_04 B20140408_SF106_04 TB498521.[MT7]-EYLSSLQPR.2y7_1.heavy 618.839 / 800.463 20182.0 28.853599548339844 50 20 10 10 10 15.449607264677997 6.4726564427710205 0.0 3 0.9906494900071665 12.752805396784588 20182.0 35.9860294444148 0.0 - - - - - - - 718.625 40 16 THOC5 THO complex 5 413 54 B20140408_SF106_04 B20140408_SF106_04 TB498459.[MT7]-ERELIER.2y5_1.heavy 544.813 / 659.372 3944.0 22.31450080871582 32 8 10 10 4 1.2116143504405128 76.41190170146999 0.0 8 0.7841240028476488 2.606863933872161 3944.0 6.213539731053412 3.0 - - - - - - - 771.7142857142857 30 14 CCDC109A coiled-coil domain containing 109A 415 54 B20140408_SF106_04 B20140408_SF106_04 TB498459.[MT7]-ERELIER.2b4_1.heavy 544.813 / 672.38 2949.0 22.31450080871582 32 8 10 10 4 1.2116143504405128 76.41190170146999 0.0 8 0.7841240028476488 2.606863933872161 2949.0 3.850367096454927 2.0 - - - - - - - 741.8125 10 16 CCDC109A coiled-coil domain containing 109A 417 54 B20140408_SF106_04 B20140408_SF106_04 TB498459.[MT7]-ERELIER.2b6_1.heavy 544.813 / 914.506 19722.0 22.31450080871582 32 8 10 10 4 1.2116143504405128 76.41190170146999 0.0 8 0.7841240028476488 2.606863933872161 19722.0 67.18880585577253 0.0 - - - - - - - 299.94444444444446 39 18 CCDC109A coiled-coil domain containing 109A 419 54 B20140408_SF106_04 B20140408_SF106_04 TB498459.[MT7]-ERELIER.2b5_1.heavy 544.813 / 785.464 N/A 22.31450080871582 32 8 10 10 4 1.2116143504405128 76.41190170146999 0.0 8 0.7841240028476488 2.606863933872161 30170.0 45.280025235618744 1.0 - - - - - - - 716.0 67 7 CCDC109A coiled-coil domain containing 109A 421 55 B20140408_SF106_04 B20140408_SF106_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 3249540.0 20.685199737548828 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 3249540.0 3089.951464999273 0.0 - - - - - - - 2689.0 6499 2 423 55 B20140408_SF106_04 B20140408_SF106_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 2123650.0 20.685199737548828 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2123650.0 3974.473162319419 0.0 - - - - - - - 1205.0 4247 1 425 55 B20140408_SF106_04 B20140408_SF106_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 2050210.0 20.685199737548828 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2050210.0 3965.4970073741006 0.0 - - - - - - - 1499.0 4100 1 427 56 B20140408_SF106_04 B20140408_SF106_04 TB498730.[MT7]-EQGWDHIQTIDSLLR.3y7_1.heavy 652.342 / 817.478 46024.0 34.59109878540039 45 15 10 10 10 2.868782767018179 34.857989649714845 0.0 3 0.9539864865200711 5.731128659758937 46024.0 107.36001188635029 0.0 - - - - - - - 688.5 92 12 AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 429 56 B20140408_SF106_04 B20140408_SF106_04 TB498730.[MT7]-EQGWDHIQTIDSLLR.3b5_1.heavy 652.342 / 760.338 72828.0 34.59109878540039 45 15 10 10 10 2.868782767018179 34.857989649714845 0.0 3 0.9539864865200711 5.731128659758937 72828.0 120.35135593220339 0.0 - - - - - - - 760.375 145 16 AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 431 56 B20140408_SF106_04 B20140408_SF106_04 TB498730.[MT7]-EQGWDHIQTIDSLLR.3y8_1.heavy 652.342 / 945.536 52631.0 34.59109878540039 45 15 10 10 10 2.868782767018179 34.857989649714845 0.0 3 0.9539864865200711 5.731128659758937 52631.0 100.1474525614531 0.0 - - - - - - - 740.2857142857143 105 7 AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 433 56 B20140408_SF106_04 B20140408_SF106_04 TB498730.[MT7]-EQGWDHIQTIDSLLR.3y9_1.heavy 652.342 / 1058.62 9610.0 34.59109878540039 45 15 10 10 10 2.868782767018179 34.857989649714845 0.0 3 0.9539864865200711 5.731128659758937 9610.0 51.25333333333333 0.0 - - - - - - - 225.0 19 19 AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 435 57 B20140408_SF106_04 B20140408_SF106_04 TB498526.[MT7]-C[CAM]IQDFFK[MT7].2y4_1.heavy 623.331 / 700.379 13790.0 33.54819869995117 47 17 10 10 10 6.963859054786095 14.359854100044194 0.0 3 0.979738636560897 8.655497076271054 13790.0 16.466725188080492 0.0 - - - - - - - 809.125 27 8 CDC123 cell division cycle 123 homolog (S. cerevisiae) 437 57 B20140408_SF106_04 B20140408_SF106_04 TB498526.[MT7]-C[CAM]IQDFFK[MT7].2b4_1.heavy 623.331 / 661.31 35531.0 33.54819869995117 47 17 10 10 10 6.963859054786095 14.359854100044194 0.0 3 0.979738636560897 8.655497076271054 35531.0 26.29099765716517 0.0 - - - - - - - 858.3 71 10 CDC123 cell division cycle 123 homolog (S. cerevisiae) 439 57 B20140408_SF106_04 B20140408_SF106_04 TB498526.[MT7]-C[CAM]IQDFFK[MT7].2y3_1.heavy 623.331 / 585.352 44396.0 33.54819869995117 47 17 10 10 10 6.963859054786095 14.359854100044194 0.0 3 0.979738636560897 8.655497076271054 44396.0 36.494083357866856 0.0 - - - - - - - 1750.25 88 8 CDC123 cell division cycle 123 homolog (S. cerevisiae) 441 57 B20140408_SF106_04 B20140408_SF106_04 TB498526.[MT7]-C[CAM]IQDFFK[MT7].2y6_1.heavy 623.331 / 941.521 15690.0 33.54819869995117 47 17 10 10 10 6.963859054786095 14.359854100044194 0.0 3 0.979738636560897 8.655497076271054 15690.0 49.077725118483414 0.0 - - - - - - - 250.75 31 16 CDC123 cell division cycle 123 homolog (S. cerevisiae) 443 58 B20140408_SF106_04 B20140408_SF106_04 TB378348.[MT7]-TLSDIFLLFK[MT7].2b4_1.heavy 742.952 / 561.3 65977.0 43.18997383117676 45 18 10 7 10 3.3923599811556753 23.930041079562315 0.02230072021484375 3 0.9867075593241513 10.692463053184111 65977.0 108.9763129648278 0.0 - - - - - - - 707.5714285714286 131 14 CDC123 cell division cycle 123 homolog (S. cerevisiae) 445 58 B20140408_SF106_04 B20140408_SF106_04 TB378348.[MT7]-TLSDIFLLFK[MT7].2b6_1.heavy 742.952 / 821.453 22919.0 43.18997383117676 45 18 10 7 10 3.3923599811556753 23.930041079562315 0.02230072021484375 3 0.9867075593241513 10.692463053184111 22919.0 80.0277090327738 0.0 - - - - - - - 570.375 45 8 CDC123 cell division cycle 123 homolog (S. cerevisiae) 447 58 B20140408_SF106_04 B20140408_SF106_04 TB378348.[MT7]-TLSDIFLLFK[MT7].2y3_1.heavy 742.952 / 551.367 30957.0 43.18997383117676 45 18 10 7 10 3.3923599811556753 23.930041079562315 0.02230072021484375 3 0.9867075593241513 10.692463053184111 30957.0 85.6487605344296 0.0 - - - - - - - 659.9375 61 16 CDC123 cell division cycle 123 homolog (S. cerevisiae) 449 58 B20140408_SF106_04 B20140408_SF106_04 TB378348.[MT7]-TLSDIFLLFK[MT7].2b5_1.heavy 742.952 / 674.384 31783.0 43.18997383117676 45 18 10 7 10 3.3923599811556753 23.930041079562315 0.02230072021484375 3 0.9867075593241513 10.692463053184111 31783.0 88.31234769687964 0.0 - - - - - - - 662.5 63 8 CDC123 cell division cycle 123 homolog (S. cerevisiae) 451 59 B20140408_SF106_04 B20140408_SF106_04 TB378143.[MT7]-SRFDLEK[MT7].3y3_1.heavy 394.896 / 533.341 157712.0 24.79829978942871 46 16 10 10 10 2.73162353674846 36.6082656173893 0.0 3 0.9643236788427224 6.51437326038333 157712.0 108.2247912252243 0.0 - - - - - - - 905.75 315 4 CCDC109A coiled-coil domain containing 109A 453 59 B20140408_SF106_04 B20140408_SF106_04 TB378143.[MT7]-SRFDLEK[MT7].3b4_1.heavy 394.896 / 650.338 22345.0 24.79829978942871 46 16 10 10 10 2.73162353674846 36.6082656173893 0.0 3 0.9643236788427224 6.51437326038333 22345.0 38.86504545575242 0.0 - - - - - - - 617.0 44 10 CCDC109A coiled-coil domain containing 109A 455 59 B20140408_SF106_04 B20140408_SF106_04 TB378143.[MT7]-SRFDLEK[MT7].3y4_1.heavy 394.896 / 648.369 16263.0 24.79829978942871 46 16 10 10 10 2.73162353674846 36.6082656173893 0.0 3 0.9643236788427224 6.51437326038333 16263.0 22.30596705123684 0.0 - - - - - - - 760.375 32 8 CCDC109A coiled-coil domain containing 109A 457 59 B20140408_SF106_04 B20140408_SF106_04 TB378143.[MT7]-SRFDLEK[MT7].3y5_1.heavy 394.896 / 795.437 N/A 24.79829978942871 46 16 10 10 10 2.73162353674846 36.6082656173893 0.0 3 0.9643236788427224 6.51437326038333 475.0 11.00968992248062 1.0 - - - - - - - 0.0 0 0 CCDC109A coiled-coil domain containing 109A 459 60 B20140408_SF106_04 B20140408_SF106_04 TB498591.[MT7]-APITNEFRK[MT7].3y7_1.heavy 455.269 / 1051.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 461 60 B20140408_SF106_04 B20140408_SF106_04 TB498591.[MT7]-APITNEFRK[MT7].3y6_1.heavy 455.269 / 938.518 N/A N/A - - - - - - - - - 0.0 - - - - - - - AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 463 60 B20140408_SF106_04 B20140408_SF106_04 TB498591.[MT7]-APITNEFRK[MT7].3y8_2.heavy 455.269 / 574.831 N/A N/A - - - - - - - - - 0.0 - - - - - - - AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 465 60 B20140408_SF106_04 B20140408_SF106_04 TB498591.[MT7]-APITNEFRK[MT7].3y5_1.heavy 455.269 / 837.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 467 61 B20140408_SF106_04 B20140408_SF106_04 TB378557.[MT7]-VLEEQAQNLGLEGTLVSLAR.2y8_1.heavy 1142.64 / 816.494 7633.0 38.16659927368164 50 20 10 10 10 20.28564242630975 4.929594927213328 0.0 3 0.9948181533194554 17.136904422361802 7633.0 22.347748059306134 0.0 - - - - - - - 212.375 15 16 PARP10 poly (ADP-ribose) polymerase family, member 10 469 61 B20140408_SF106_04 B20140408_SF106_04 TB378557.[MT7]-VLEEQAQNLGLEGTLVSLAR.2y12_1.heavy 1142.64 / 1228.73 2502.0 38.16659927368164 50 20 10 10 10 20.28564242630975 4.929594927213328 0.0 3 0.9948181533194554 17.136904422361802 2502.0 28.603593749999998 0.0 - - - - - - - 133.15384615384616 5 13 PARP10 poly (ADP-ribose) polymerase family, member 10 471 61 B20140408_SF106_04 B20140408_SF106_04 TB378557.[MT7]-VLEEQAQNLGLEGTLVSLAR.2b5_1.heavy 1142.64 / 743.406 10327.0 38.16659927368164 50 20 10 10 10 20.28564242630975 4.929594927213328 0.0 3 0.9948181533194554 17.136904422361802 10327.0 41.18669350143034 0.0 - - - - - - - 231.55555555555554 20 18 PARP10 poly (ADP-ribose) polymerase family, member 10 473 61 B20140408_SF106_04 B20140408_SF106_04 TB378557.[MT7]-VLEEQAQNLGLEGTLVSLAR.2y11_1.heavy 1142.64 / 1115.64 11995.0 38.16659927368164 50 20 10 10 10 20.28564242630975 4.929594927213328 0.0 3 0.9948181533194554 17.136904422361802 11995.0 54.55443403728367 0.0 - - - - - - - 231.55555555555554 23 18 PARP10 poly (ADP-ribose) polymerase family, member 10 475 62 B20140408_SF106_04 B20140408_SF106_04 TB378083.[MT7]-GYLYAVGGR.2y8_1.heavy 550.304 / 898.478 8363.0 28.853599548339844 42 16 10 10 6 1.9618798728991298 40.23480045433929 0.0 5 0.9663491573880175 6.708708930243201 8363.0 24.48068323199047 0.0 - - - - - - - 670.3333333333334 16 12 KLHL13 kelch-like 13 (Drosophila) 477 62 B20140408_SF106_04 B20140408_SF106_04 TB378083.[MT7]-GYLYAVGGR.2y6_1.heavy 550.304 / 622.331 24897.0 28.853599548339844 42 16 10 10 6 1.9618798728991298 40.23480045433929 0.0 5 0.9663491573880175 6.708708930243201 24897.0 26.96476828565534 0.0 - - - - - - - 1759.111111111111 49 9 KLHL13 kelch-like 13 (Drosophila) 479 62 B20140408_SF106_04 B20140408_SF106_04 TB378083.[MT7]-GYLYAVGGR.2b5_1.heavy 550.304 / 712.379 18130.0 28.853599548339844 42 16 10 10 6 1.9618798728991298 40.23480045433929 0.0 5 0.9663491573880175 6.708708930243201 18130.0 20.30505779755959 0.0 - - - - - - - 1220.875 36 8 KLHL13 kelch-like 13 (Drosophila) 481 62 B20140408_SF106_04 B20140408_SF106_04 TB378083.[MT7]-GYLYAVGGR.2y7_1.heavy 550.304 / 735.415 10150.0 28.853599548339844 42 16 10 10 6 1.9618798728991298 40.23480045433929 0.0 5 0.9663491573880175 6.708708930243201 10150.0 29.53680450313921 2.0 - - - - - - - 702.25 54 4 KLHL13 kelch-like 13 (Drosophila) 483 63 B20140408_SF106_04 B20140408_SF106_04 TB498448.[MT7]-QLQEEDR.2b3_1.heavy 531.271 / 514.311 N/A 19.68053372701009 38 20 2 6 10 9.302734757815676 10.749527166297543 0.03740119934082031 3 0.9987267204072358 34.582340947459635 15942.0 5.316052327712249 6.0 - - - - - - - 2933.0 205 1 CCDC109A coiled-coil domain containing 109A 485 63 B20140408_SF106_04 B20140408_SF106_04 TB498448.[MT7]-QLQEEDR.2y5_1.heavy 531.271 / 676.29 12536.0 19.68053372701009 38 20 2 6 10 9.302734757815676 10.749527166297543 0.03740119934082031 3 0.9987267204072358 34.582340947459635 12536.0 40.66751598504041 0.0 - - - - - - - 232.34782608695653 25 23 CCDC109A coiled-coil domain containing 109A 487 63 B20140408_SF106_04 B20140408_SF106_04 TB498448.[MT7]-QLQEEDR.2b4_1.heavy 531.271 / 643.353 11874.0 19.68053372701009 38 20 2 6 10 9.302734757815676 10.749527166297543 0.03740119934082031 3 0.9987267204072358 34.582340947459635 11874.0 39.30391990579386 0.0 - - - - - - - 304.5882352941176 23 17 CCDC109A coiled-coil domain containing 109A 489 63 B20140408_SF106_04 B20140408_SF106_04 TB498448.[MT7]-QLQEEDR.2y6_1.heavy 531.271 / 789.374 38578.0 19.68053372701009 38 20 2 6 10 9.302734757815676 10.749527166297543 0.03740119934082031 3 0.9987267204072358 34.582340947459635 38578.0 124.50963020988371 1.0 - - - - - - - 387.1875 77 16 CCDC109A coiled-coil domain containing 109A 491 64 B20140408_SF106_04 B20140408_SF106_04 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 2486870.0 33.4474983215332 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2486870.0 286.0040838764372 0.0 - - - - - - - 267.0 4973 6 493 64 B20140408_SF106_04 B20140408_SF106_04 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 1112500.0 33.4474983215332 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1112500.0 146.96239746203378 0.0 - - - - - - - 288.85714285714283 2225 7 495 64 B20140408_SF106_04 B20140408_SF106_04 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1679710.0 33.4474983215332 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1679710.0 148.52977297845123 0.0 - - - - - - - 757.75 3359 8 497 65 B20140408_SF106_04 B20140408_SF106_04 TB498726.[MT7]-FTNEPYPLFVTWK[MT7].3b6_1.heavy 644.017 / 896.427 85972.0 38.497798919677734 44 14 10 10 10 3.2365334923449813 30.897254805649027 0.0 3 0.9445743735947508 5.217716091417275 85972.0 368.53292634372923 0.0 - - - - - - - 251.33333333333334 171 6 AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 499 65 B20140408_SF106_04 B20140408_SF106_04 TB498726.[MT7]-FTNEPYPLFVTWK[MT7].3y3_1.heavy 644.017 / 578.342 150502.0 38.497798919677734 44 14 10 10 10 3.2365334923449813 30.897254805649027 0.0 3 0.9445743735947508 5.217716091417275 150502.0 111.78734730058525 0.0 - - - - - - - 342.6666666666667 301 3 AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 501 65 B20140408_SF106_04 B20140408_SF106_04 TB498726.[MT7]-FTNEPYPLFVTWK[MT7].3b4_1.heavy 644.017 / 636.311 169956.0 38.497798919677734 44 14 10 10 10 3.2365334923449813 30.897254805649027 0.0 3 0.9445743735947508 5.217716091417275 169956.0 231.78313941579074 0.0 - - - - - - - 685.2 339 5 AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 503 65 B20140408_SF106_04 B20140408_SF106_04 TB498726.[MT7]-FTNEPYPLFVTWK[MT7].3b3_1.heavy 644.017 / 507.268 25963.0 38.497798919677734 44 14 10 10 10 3.2365334923449813 30.897254805649027 0.0 3 0.9445743735947508 5.217716091417275 25963.0 24.714763510681166 1.0 - - - - - - - 746.9 53 10 AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 505 66 B20140408_SF106_04 B20140408_SF106_04 TB498792.[MT7]-TLVQQLYTTLC[CAM]IEQHQLNK[MT7].4y5_1.heavy 655.361 / 783.459 24875.0 39.61399841308594 48 18 10 10 10 7.278220086213858 13.73962298686411 0.0 3 0.9891047874640597 11.812706555229289 24875.0 82.82608695652175 0.0 - - - - - - - 273.73333333333335 49 15 CCDC109A coiled-coil domain containing 109A 507 66 B20140408_SF106_04 B20140408_SF106_04 TB498792.[MT7]-TLVQQLYTTLC[CAM]IEQHQLNK[MT7].4b4_1.heavy 655.361 / 586.368 57777.0 39.61399841308594 48 18 10 10 10 7.278220086213858 13.73962298686411 0.0 3 0.9891047874640597 11.812706555229289 57777.0 68.29690141401181 0.0 - - - - - - - 1207.857142857143 115 7 CCDC109A coiled-coil domain containing 109A 509 66 B20140408_SF106_04 B20140408_SF106_04 TB498792.[MT7]-TLVQQLYTTLC[CAM]IEQHQLNK[MT7].4b5_1.heavy 655.361 / 714.427 81549.0 39.61399841308594 48 18 10 10 10 7.278220086213858 13.73962298686411 0.0 3 0.9891047874640597 11.812706555229289 81549.0 124.09275200316549 0.0 - - - - - - - 804.125 163 8 CCDC109A coiled-coil domain containing 109A 511 66 B20140408_SF106_04 B20140408_SF106_04 TB498792.[MT7]-TLVQQLYTTLC[CAM]IEQHQLNK[MT7].4y3_1.heavy 655.361 / 518.342 22486.0 39.61399841308594 48 18 10 10 10 7.278220086213858 13.73962298686411 0.0 3 0.9891047874640597 11.812706555229289 22486.0 46.14735191246801 0.0 - - - - - - - 664.4615384615385 44 13 CCDC109A coiled-coil domain containing 109A 513 67 B20140408_SF106_04 B20140408_SF106_04 TB378465.[MT7]-WLEEEAALQLALHR.3b6_1.heavy 608.336 / 902.438 60274.0 36.688899993896484 46 16 10 10 10 2.2134054092659943 39.5592960495259 0.0 3 0.96161811874814 6.279141575077302 60274.0 440.18937514144477 0.0 - - - - - - - 297.55555555555554 120 9 PARP10 poly (ADP-ribose) polymerase family, member 10 515 67 B20140408_SF106_04 B20140408_SF106_04 TB378465.[MT7]-WLEEEAALQLALHR.3b4_1.heavy 608.336 / 702.358 35238.0 36.688899993896484 46 16 10 10 10 2.2134054092659943 39.5592960495259 0.0 3 0.96161811874814 6.279141575077302 35238.0 36.37836379548051 0.0 - - - - - - - 1240.5714285714287 70 7 PARP10 poly (ADP-ribose) polymerase family, member 10 517 67 B20140408_SF106_04 B20140408_SF106_04 TB378465.[MT7]-WLEEEAALQLALHR.3b5_1.heavy 608.336 / 831.401 59840.0 36.688899993896484 46 16 10 10 10 2.2134054092659943 39.5592960495259 0.0 3 0.96161811874814 6.279141575077302 59840.0 150.00510402417 0.0 - - - - - - - 385.8333333333333 119 6 PARP10 poly (ADP-ribose) polymerase family, member 10 519 67 B20140408_SF106_04 B20140408_SF106_04 TB378465.[MT7]-WLEEEAALQLALHR.3b7_1.heavy 608.336 / 973.475 57742.0 36.688899993896484 46 16 10 10 10 2.2134054092659943 39.5592960495259 0.0 3 0.96161811874814 6.279141575077302 57742.0 248.66763461483407 0.0 - - - - - - - 683.4444444444445 115 9 PARP10 poly (ADP-ribose) polymerase family, member 10 521 68 B20140408_SF106_04 B20140408_SF106_04 TB378523.[MT7]-HEEIDLVSLEEFYK[MT7].3y3_1.heavy 680.357 / 601.347 9598.0 35.878299713134766 44 14 10 10 10 3.058204978724734 32.69892001866396 0.0 3 0.9489229177190399 5.437299182649204 9598.0 10.644494532402547 0.0 - - - - - - - 1242.7 19 10 THOC5 THO complex 5 523 68 B20140408_SF106_04 B20140408_SF106_04 TB378523.[MT7]-HEEIDLVSLEEFYK[MT7].3b5_1.heavy 680.357 / 768.364 13988.0 35.878299713134766 44 14 10 10 10 3.058204978724734 32.69892001866396 0.0 3 0.9489229177190399 5.437299182649204 13988.0 20.601413934204714 0.0 - - - - - - - 287.14285714285717 27 7 THOC5 THO complex 5 525 68 B20140408_SF106_04 B20140408_SF106_04 TB378523.[MT7]-HEEIDLVSLEEFYK[MT7].3b3_1.heavy 680.357 / 540.253 2679.0 35.878299713134766 44 14 10 10 10 3.058204978724734 32.69892001866396 0.0 3 0.9489229177190399 5.437299182649204 2679.0 1.0950573841531905 4.0 - - - - - - - 1292.75 12 8 THOC5 THO complex 5 527 68 B20140408_SF106_04 B20140408_SF106_04 TB378523.[MT7]-HEEIDLVSLEEFYK[MT7].3y5_1.heavy 680.357 / 859.432 6027.0 35.878299713134766 44 14 10 10 10 3.058204978724734 32.69892001866396 0.0 3 0.9489229177190399 5.437299182649204 6027.0 18.911873063538533 0.0 - - - - - - - 669.8 12 10 THOC5 THO complex 5 529 69 B20140408_SF106_04 B20140408_SF106_04 TB377922.[MT7]-LEAAER.2b3_1.heavy 416.736 / 458.273 13453.0 21.330699920654297 34 14 2 10 8 3.3718507309730414 29.657303356113342 0.0 4 0.9454040350609964 5.257582819092316 13453.0 9.374015087639236 1.0 - - - - - - - 1768.5 35 10 HOMER2 homer homolog 2 (Drosophila) 531 69 B20140408_SF106_04 B20140408_SF106_04 TB377922.[MT7]-LEAAER.2y4_1.heavy 416.736 / 446.236 20527.0 21.330699920654297 34 14 2 10 8 3.3718507309730414 29.657303356113342 0.0 4 0.9454040350609964 5.257582819092316 20527.0 17.48166788887842 0.0 - - - - - - - 1649.7 41 10 HOMER2 homer homolog 2 (Drosophila) 533 69 B20140408_SF106_04 B20140408_SF106_04 TB377922.[MT7]-LEAAER.2y5_1.heavy 416.736 / 575.278 56920.0 21.330699920654297 34 14 2 10 8 3.3718507309730414 29.657303356113342 0.0 4 0.9454040350609964 5.257582819092316 56920.0 27.142153972283097 0.0 - - - - - - - 1355.0 113 1 HOMER2 homer homolog 2 (Drosophila) 535 69 B20140408_SF106_04 B20140408_SF106_04 TB377922.[MT7]-LEAAER.2b4_1.heavy 416.736 / 529.31 18775.0 21.330699920654297 34 14 2 10 8 3.3718507309730414 29.657303356113342 0.0 4 0.9454040350609964 5.257582819092316 18775.0 17.648379226068414 1.0 - - - - - - - 1686.0 238 8 HOMER2 homer homolog 2 (Drosophila) 537 70 B20140408_SF106_04 B20140408_SF106_04 TB498437.[MT7]-LIDFLK[MT7].2y4_1.heavy 518.836 / 666.394 134001.0 36.30720138549805 48 18 10 10 10 3.426427075907662 23.070521078488515 0.0 3 0.9888204734340662 11.661253360139945 134001.0 152.95487712397374 0.0 - - - - - - - 449.0 268 1 CDC123 cell division cycle 123 homolog (S. cerevisiae) 539 70 B20140408_SF106_04 B20140408_SF106_04 TB498437.[MT7]-LIDFLK[MT7].2y5_1.heavy 518.836 / 779.478 172480.0 36.30720138549805 48 18 10 10 10 3.426427075907662 23.070521078488515 0.0 3 0.9888204734340662 11.661253360139945 172480.0 356.9350955951245 0.0 - - - - - - - 310.0 344 7 CDC123 cell division cycle 123 homolog (S. cerevisiae) 541 70 B20140408_SF106_04 B20140408_SF106_04 TB498437.[MT7]-LIDFLK[MT7].2b4_1.heavy 518.836 / 633.373 44393.0 36.30720138549805 48 18 10 10 10 3.426427075907662 23.070521078488515 0.0 3 0.9888204734340662 11.661253360139945 44393.0 51.114077608142495 0.0 - - - - - - - 311.6666666666667 88 6 CDC123 cell division cycle 123 homolog (S. cerevisiae) 543 70 B20140408_SF106_04 B20140408_SF106_04 TB498437.[MT7]-LIDFLK[MT7].2y3_1.heavy 518.836 / 551.367 244047.0 36.30720138549805 48 18 10 10 10 3.426427075907662 23.070521078488515 0.0 3 0.9888204734340662 11.661253360139945 244047.0 238.64629888873316 0.0 - - - - - - - 411.5 488 2 CDC123 cell division cycle 123 homolog (S. cerevisiae) 545 71 B20140408_SF106_04 B20140408_SF106_04 TB149250.[MT7]-SDTEQEGK[MT7].2y4_1.heavy 591.298 / 605.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - THOC5 THO complex 5 547 71 B20140408_SF106_04 B20140408_SF106_04 TB149250.[MT7]-SDTEQEGK[MT7].2b4_1.heavy 591.298 / 577.259 N/A N/A - - - - - - - - - 0.0 - - - - - - - THOC5 THO complex 5 549 71 B20140408_SF106_04 B20140408_SF106_04 TB149250.[MT7]-SDTEQEGK[MT7].2y6_1.heavy 591.298 / 835.428 N/A N/A - - - - - - - - - 0.0 - - - - - - - THOC5 THO complex 5 551 71 B20140408_SF106_04 B20140408_SF106_04 TB149250.[MT7]-SDTEQEGK[MT7].2y7_1.heavy 591.298 / 950.455 N/A N/A - - - - - - - - - 0.0 - - - - - - - THOC5 THO complex 5 553 72 B20140408_SF106_04 B20140408_SF106_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 808981.0 37.173099517822266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 808981.0 492.79334024214256 0.0 - - - - - - - 146.5 1617 2 555 72 B20140408_SF106_04 B20140408_SF106_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 1632740.0 37.173099517822266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1632740.0 345.69237568250213 0.0 - - - - - - - 293.0 3265 2 557 72 B20140408_SF106_04 B20140408_SF106_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 1428470.0 37.173099517822266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1428470.0 380.87595314309067 0.0 - - - - - - - 355.42857142857144 2856 7 559 73 B20140408_SF106_04 B20140408_SF106_04 TB498710.[MT7]-VQEAINSLGGSVFPK[MT7].2b3_1.heavy 917.519 / 501.279 12463.0 33.935173988342285 40 14 10 6 10 1.1486407629315614 57.394827065111464 0.036098480224609375 3 0.9346480940237785 4.801083035897183 12463.0 56.36066632842889 0.0 - - - - - - - 265.1818181818182 24 11 CDC123 cell division cycle 123 homolog (S. cerevisiae) 561 73 B20140408_SF106_04 B20140408_SF106_04 TB498710.[MT7]-VQEAINSLGGSVFPK[MT7].2b4_1.heavy 917.519 / 572.316 22229.0 33.935173988342285 40 14 10 6 10 1.1486407629315614 57.394827065111464 0.036098480224609375 3 0.9346480940237785 4.801083035897183 22229.0 70.50573162269022 0.0 - - - - - - - 637.75 44 8 CDC123 cell division cycle 123 homolog (S. cerevisiae) 563 73 B20140408_SF106_04 B20140408_SF106_04 TB498710.[MT7]-VQEAINSLGGSVFPK[MT7].2y3_1.heavy 917.519 / 535.336 16180.0 33.935173988342285 40 14 10 6 10 1.1486407629315614 57.394827065111464 0.036098480224609375 3 0.9346480940237785 4.801083035897183 16180.0 51.732132655531345 0.0 - - - - - - - 666.4285714285714 32 7 CDC123 cell division cycle 123 homolog (S. cerevisiae) 565 73 B20140408_SF106_04 B20140408_SF106_04 TB498710.[MT7]-VQEAINSLGGSVFPK[MT7].2y10_1.heavy 917.519 / 1149.64 7215.0 33.935173988342285 40 14 10 6 10 1.1486407629315614 57.394827065111464 0.036098480224609375 3 0.9346480940237785 4.801083035897183 7215.0 63.25479452054795 0.0 - - - - - - - 229.21428571428572 14 14 CDC123 cell division cycle 123 homolog (S. cerevisiae) 567 74 B20140408_SF106_04 B20140408_SF106_04 TB378090.[MT7]-TDIEESK[MT7].2y4_1.heavy 555.3 / 636.332 14569.0 20.78019905090332 47 17 10 10 10 3.474290689858579 23.76164141449101 0.0 3 0.9799377008068684 8.698477693018855 14569.0 42.91565923384791 0.0 - - - - - - - 698.5555555555555 29 9 HOMER2 homer homolog 2 (Drosophila) 569 74 B20140408_SF106_04 B20140408_SF106_04 TB378090.[MT7]-TDIEESK[MT7].2y5_1.heavy 555.3 / 749.416 13894.0 20.78019905090332 47 17 10 10 10 3.474290689858579 23.76164141449101 0.0 3 0.9799377008068684 8.698477693018855 13894.0 75.48802340516626 0.0 - - - - - - - 205.5 27 20 HOMER2 homer homolog 2 (Drosophila) 571 74 B20140408_SF106_04 B20140408_SF106_04 TB378090.[MT7]-TDIEESK[MT7].2y3_1.heavy 555.3 / 507.289 8527.0 20.78019905090332 47 17 10 10 10 3.474290689858579 23.76164141449101 0.0 3 0.9799377008068684 8.698477693018855 8527.0 9.360309534875112 0.0 - - - - - - - 736.1428571428571 17 7 HOMER2 homer homolog 2 (Drosophila) 573 74 B20140408_SF106_04 B20140408_SF106_04 TB378090.[MT7]-TDIEESK[MT7].2y6_1.heavy 555.3 / 864.443 11901.0 20.78019905090332 47 17 10 10 10 3.474290689858579 23.76164141449101 0.0 3 0.9799377008068684 8.698477693018855 11901.0 83.0903993933266 1.0 - - - - - - - 233.79166666666666 23 24 HOMER2 homer homolog 2 (Drosophila) 575 75 B20140408_SF106_04 B20140408_SF106_04 TB378267.[MT7]-LMAEIQDLK[MT7].2y8_1.heavy 674.891 / 1091.59 8645.0 34.054901123046875 50 20 10 10 10 8.919929628590982 11.210850776162042 0.0 3 0.9952298923947978 17.861811202304896 8645.0 29.51045174517812 0.0 - - - - - - - 277.3125 17 16 THOC5 THO complex 5 577 75 B20140408_SF106_04 B20140408_SF106_04 TB378267.[MT7]-LMAEIQDLK[MT7].2b4_1.heavy 674.891 / 589.314 17140.0 34.054901123046875 50 20 10 10 10 8.919929628590982 11.210850776162042 0.0 3 0.9952298923947978 17.861811202304896 17140.0 18.464778525217376 1.0 - - - - - - - 1776.0 34 8 THOC5 THO complex 5 579 75 B20140408_SF106_04 B20140408_SF106_04 TB378267.[MT7]-LMAEIQDLK[MT7].2y6_1.heavy 674.891 / 889.511 6390.0 34.054901123046875 50 20 10 10 10 8.919929628590982 11.210850776162042 0.0 3 0.9952298923947978 17.861811202304896 6390.0 11.809788977599418 1.0 - - - - - - - 641.4666666666667 20 15 THOC5 THO complex 5 581 75 B20140408_SF106_04 B20140408_SF106_04 TB378267.[MT7]-LMAEIQDLK[MT7].2y7_1.heavy 674.891 / 960.548 8044.0 34.054901123046875 50 20 10 10 10 8.919929628590982 11.210850776162042 0.0 3 0.9952298923947978 17.861811202304896 8044.0 18.747090665034175 0.0 - - - - - - - 662.8181818181819 16 11 THOC5 THO complex 5 583 76 B20140408_SF106_04 B20140408_SF106_04 TB149245.[MT7]-RASLSVQDR.3y3_1.heavy 392.559 / 418.204 99584.0 21.00200080871582 46 16 10 10 10 3.4656370874817632 24.630400708248622 0.0 3 0.963255036018687 6.418367228420176 99584.0 111.69087970274038 0.0 - - - - - - - 1190.8 199 10 PARP10 poly (ADP-ribose) polymerase family, member 10 585 76 B20140408_SF106_04 B20140408_SF106_04 TB149245.[MT7]-RASLSVQDR.3b5_1.heavy 392.559 / 659.396 24040.0 21.00200080871582 46 16 10 10 10 3.4656370874817632 24.630400708248622 0.0 3 0.963255036018687 6.418367228420176 24040.0 79.65264216906863 0.0 - - - - - - - 631.7272727272727 48 11 PARP10 poly (ADP-ribose) polymerase family, member 10 587 76 B20140408_SF106_04 B20140408_SF106_04 TB149245.[MT7]-RASLSVQDR.3y4_1.heavy 392.559 / 517.273 41817.0 21.00200080871582 46 16 10 10 10 3.4656370874817632 24.630400708248622 0.0 3 0.963255036018687 6.418367228420176 41817.0 36.9481275927496 0.0 - - - - - - - 1728.7142857142858 83 7 PARP10 poly (ADP-ribose) polymerase family, member 10 589 76 B20140408_SF106_04 B20140408_SF106_04 TB149245.[MT7]-RASLSVQDR.3y5_1.heavy 392.559 / 604.305 41752.0 21.00200080871582 46 16 10 10 10 3.4656370874817632 24.630400708248622 0.0 3 0.963255036018687 6.418367228420176 41752.0 86.93531053787473 0.0 - - - - - - - 704.7 83 10 PARP10 poly (ADP-ribose) polymerase family, member 10 591 77 B20140408_SF106_04 B20140408_SF106_04 TB149192.[MT7]-FGQWADSR.2b4_1.heavy 555.776 / 663.337 8873.0 28.43939971923828 43 13 10 10 10 2.98290820072258 33.52433037522777 0.0 3 0.9156867409123325 4.220022229242683 8873.0 13.965692580697514 0.0 - - - - - - - 1201.0 17 11 HOMER3;HOMER2;HOMER1 homer homolog 3 (Drosophila);homer homolog 2 (Drosophila);homer homolog 1 (Drosophila) 593 77 B20140408_SF106_04 B20140408_SF106_04 TB149192.[MT7]-FGQWADSR.2b6_1.heavy 555.776 / 849.401 65045.0 28.43939971923828 43 13 10 10 10 2.98290820072258 33.52433037522777 0.0 3 0.9156867409123325 4.220022229242683 65045.0 242.8573107049608 0.0 - - - - - - - 738.5714285714286 130 7 HOMER3;HOMER2;HOMER1 homer homolog 3 (Drosophila);homer homolog 2 (Drosophila);homer homolog 1 (Drosophila) 595 77 B20140408_SF106_04 B20140408_SF106_04 TB149192.[MT7]-FGQWADSR.2b5_1.heavy 555.776 / 734.374 8298.0 28.43939971923828 43 13 10 10 10 2.98290820072258 33.52433037522777 0.0 3 0.9156867409123325 4.220022229242683 8298.0 13.56282145697843 0.0 - - - - - - - 775.6153846153846 16 13 HOMER3;HOMER2;HOMER1 homer homolog 3 (Drosophila);homer homolog 2 (Drosophila);homer homolog 1 (Drosophila) 597 77 B20140408_SF106_04 B20140408_SF106_04 TB149192.[MT7]-FGQWADSR.2y7_1.heavy 555.776 / 819.374 27256.0 28.43939971923828 43 13 10 10 10 2.98290820072258 33.52433037522777 0.0 3 0.9156867409123325 4.220022229242683 27256.0 65.48344516527649 0.0 - - - - - - - 744.5833333333334 54 12 HOMER3;HOMER2;HOMER1 homer homolog 3 (Drosophila);homer homolog 2 (Drosophila);homer homolog 1 (Drosophila) 599 78 B20140408_SF106_04 B20140408_SF106_04 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1530540.0 31.468599319458008 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1530540.0 129.28406517201736 0.0 - - - - - - - 4211.5 3061 2 601 78 B20140408_SF106_04 B20140408_SF106_04 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 425269.0 31.468599319458008 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 425269.0 99.15166658843327 0.0 - - - - - - - 1620.0 850 1 603 78 B20140408_SF106_04 B20140408_SF106_04 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 577111.0 31.468599319458008 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 577111.0 91.23778762573113 0.0 - - - - - - - 2678.3333333333335 1154 3 605 79 B20140408_SF106_04 B20140408_SF106_04 TB378121.[MT7]-SLLLLLSSR.2y8_1.heavy 573.372 / 914.603 83967.0 39.027099609375 47 17 10 10 10 2.7390393843491916 29.13117885988659 0.0 3 0.9791324056470436 8.528409542096695 83967.0 276.4648043267679 0.0 - - - - - - - 256.5 167 10 CCDC109A coiled-coil domain containing 109A 607 79 B20140408_SF106_04 B20140408_SF106_04 TB378121.[MT7]-SLLLLLSSR.2y5_1.heavy 573.372 / 575.351 120189.0 39.027099609375 47 17 10 10 10 2.7390393843491916 29.13117885988659 0.0 3 0.9791324056470436 8.528409542096695 120189.0 205.65276318260055 0.0 - - - - - - - 766.2857142857143 240 7 CCDC109A coiled-coil domain containing 109A 609 79 B20140408_SF106_04 B20140408_SF106_04 TB378121.[MT7]-SLLLLLSSR.2y6_1.heavy 573.372 / 688.435 126464.0 39.027099609375 47 17 10 10 10 2.7390393843491916 29.13117885988659 0.0 3 0.9791324056470436 8.528409542096695 126464.0 200.1463733171619 0.0 - - - - - - - 746.6666666666666 252 12 CCDC109A coiled-coil domain containing 109A 611 79 B20140408_SF106_04 B20140408_SF106_04 TB378121.[MT7]-SLLLLLSSR.2y7_1.heavy 573.372 / 801.519 83282.0 39.027099609375 47 17 10 10 10 2.7390393843491916 29.13117885988659 0.0 3 0.9791324056470436 8.528409542096695 83282.0 423.6546132970463 0.0 - - - - - - - 648.75 166 8 CCDC109A coiled-coil domain containing 109A 613 80 B20140408_SF106_04 B20140408_SF106_04 TB498433.[MT7]-QVETELFPC[CAM]LR.3b5_1.heavy 512.605 / 731.369 200570.0 34.703399658203125 50 20 10 10 10 22.780724268618048 4.389676062132783 0.0 3 0.9934850566613733 15.28167582066362 200570.0 179.7224341888003 0.0 - - - - - - - 301.0 401 2 AKR7A3;AKR7L;AKR7A2 aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase);aldo-keto reductase family 7-like;aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase) 615 80 B20140408_SF106_04 B20140408_SF106_04 TB498433.[MT7]-QVETELFPC[CAM]LR.3b3_1.heavy 512.605 / 501.279 63900.0 34.703399658203125 50 20 10 10 10 22.780724268618048 4.389676062132783 0.0 3 0.9934850566613733 15.28167582066362 63900.0 63.28698586398073 0.0 - - - - - - - 845.75 127 4 AKR7A3;AKR7L;AKR7A2 aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase);aldo-keto reductase family 7-like;aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase) 617 80 B20140408_SF106_04 B20140408_SF106_04 TB498433.[MT7]-QVETELFPC[CAM]LR.3y4_1.heavy 512.605 / 545.286 425722.0 34.703399658203125 50 20 10 10 10 22.780724268618048 4.389676062132783 0.0 3 0.9934850566613733 15.28167582066362 425722.0 319.22230124633495 0.0 - - - - - - - 677.0 851 1 AKR7A3;AKR7L;AKR7A2 aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase);aldo-keto reductase family 7-like;aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase) 619 80 B20140408_SF106_04 B20140408_SF106_04 TB498433.[MT7]-QVETELFPC[CAM]LR.3y5_1.heavy 512.605 / 692.355 83897.0 34.703399658203125 50 20 10 10 10 22.780724268618048 4.389676062132783 0.0 3 0.9934850566613733 15.28167582066362 83897.0 179.6631770306241 0.0 - - - - - - - 195.4 167 5 AKR7A3;AKR7L;AKR7A2 aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase);aldo-keto reductase family 7-like;aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase) 621 81 B20140408_SF106_04 B20140408_SF106_04 TB498673.[MT7]-SDTTHLVTLGGVLR.3y7_1.heavy 538.309 / 715.446 123928.0 31.483749389648438 42 16 10 6 10 1.8550931527410115 42.825396955071305 0.030300140380859375 3 0.9629808810831554 6.394408503162002 123928.0 130.5976799541583 0.0 - - - - - - - 1280.1818181818182 247 11 KLHL13 kelch-like 13 (Drosophila) 623 81 B20140408_SF106_04 B20140408_SF106_04 TB498673.[MT7]-SDTTHLVTLGGVLR.3b4_1.heavy 538.309 / 549.264 47171.0 31.483749389648438 42 16 10 6 10 1.8550931527410115 42.825396955071305 0.030300140380859375 3 0.9629808810831554 6.394408503162002 47171.0 35.070250289048325 0.0 - - - - - - - 1240.875 94 8 KLHL13 kelch-like 13 (Drosophila) 625 81 B20140408_SF106_04 B20140408_SF106_04 TB498673.[MT7]-SDTTHLVTLGGVLR.3y8_1.heavy 538.309 / 814.515 78315.0 31.483749389648438 42 16 10 6 10 1.8550931527410115 42.825396955071305 0.030300140380859375 3 0.9629808810831554 6.394408503162002 78315.0 86.64870822825992 0.0 - - - - - - - 778.75 156 8 KLHL13 kelch-like 13 (Drosophila) 627 81 B20140408_SF106_04 B20140408_SF106_04 TB498673.[MT7]-SDTTHLVTLGGVLR.3y5_1.heavy 538.309 / 501.314 90448.0 31.483749389648438 42 16 10 6 10 1.8550931527410115 42.825396955071305 0.030300140380859375 3 0.9629808810831554 6.394408503162002 90448.0 27.713446088379133 0.0 - - - - - - - 2708.75 180 8 KLHL13 kelch-like 13 (Drosophila) 629 82 B20140408_SF106_04 B20140408_SF106_04 TB378063.[MT7]-EFPQEK[MT7].2y4_1.heavy 533.295 / 645.369 20315.0 23.04337501525879 41 20 10 3 8 5.162512083804645 19.37041470831821 0.06529998779296875 4 0.9953424087336037 18.076442952665804 20315.0 51.13523423423423 0.0 - - - - - - - 703.0 40 7 THOC5 THO complex 5 631 82 B20140408_SF106_04 B20140408_SF106_04 TB378063.[MT7]-EFPQEK[MT7].2y5_1.heavy 533.295 / 792.437 9399.0 23.04337501525879 41 20 10 3 8 5.162512083804645 19.37041470831821 0.06529998779296875 4 0.9953424087336037 18.076442952665804 9399.0 2.3093366093366092 1.0 - - - - - - - 1170.125 18 8 THOC5 THO complex 5 633 82 B20140408_SF106_04 B20140408_SF106_04 TB378063.[MT7]-EFPQEK[MT7].2b4_1.heavy 533.295 / 646.332 3552.0 23.04337501525879 41 20 10 3 8 5.162512083804645 19.37041470831821 0.06529998779296875 4 0.9953424087336037 18.076442952665804 3552.0 5.684098671726755 2.0 - - - - - - - 758.5 7 12 THOC5 THO complex 5 635 82 B20140408_SF106_04 B20140408_SF106_04 TB378063.[MT7]-EFPQEK[MT7].2y3_1.heavy 533.295 / 548.316 2553.0 23.04337501525879 41 20 10 3 8 5.162512083804645 19.37041470831821 0.06529998779296875 4 0.9953424087336037 18.076442952665804 2553.0 0.0 6.0 - - - - - - - 1239.5 18 8 THOC5 THO complex 5 637 83 B20140408_SF106_04 B20140408_SF106_04 TB498804.[MT7]-LLLQGLPPGTTPQRLEQHVQALLR.4y5_1.heavy 706.418 / 600.383 14424.0 37.33829879760742 47 17 10 10 10 3.043709543817457 32.85464613505098 0.0 3 0.9705459768200964 7.17328816470511 14424.0 7.671492650181803 0.0 - - - - - - - 1199.2727272727273 28 11 PARP10 poly (ADP-ribose) polymerase family, member 10 639 83 B20140408_SF106_04 B20140408_SF106_04 TB498804.[MT7]-LLLQGLPPGTTPQRLEQHVQALLR.4b4_1.heavy 706.418 / 612.42 15657.0 37.33829879760742 47 17 10 10 10 3.043709543817457 32.85464613505098 0.0 3 0.9705459768200964 7.17328816470511 15657.0 22.40570689655172 0.0 - - - - - - - 765.0 31 9 PARP10 poly (ADP-ribose) polymerase family, member 10 641 83 B20140408_SF106_04 B20140408_SF106_04 TB498804.[MT7]-LLLQGLPPGTTPQRLEQHVQALLR.4b5_1.heavy 706.418 / 669.442 88720.0 37.33829879760742 47 17 10 10 10 3.043709543817457 32.85464613505098 0.0 3 0.9705459768200964 7.17328816470511 88720.0 93.95562032553332 0.0 - - - - - - - 779.0 177 4 PARP10 poly (ADP-ribose) polymerase family, member 10 643 83 B20140408_SF106_04 B20140408_SF106_04 TB498804.[MT7]-LLLQGLPPGTTPQRLEQHVQALLR.4y18_2.heavy 706.418 / 1021.07 34212.0 37.33829879760742 47 17 10 10 10 3.043709543817457 32.85464613505098 0.0 3 0.9705459768200964 7.17328816470511 34212.0 103.4618068965517 0.0 - - - - - - - 652.2857142857143 68 7 PARP10 poly (ADP-ribose) polymerase family, member 10 645 84 B20140408_SF106_04 B20140408_SF106_04 TB377987.[MT7]-TLPAELR.2y5_1.heavy 472.288 / 585.336 157299.0 27.262800216674805 45 15 10 10 10 1.2348973631824787 51.44966503057401 0.0 3 0.9564920355574547 5.895093110605954 157299.0 83.4868150674697 0.0 - - - - - - - 2740.1428571428573 314 7 PARP10 poly (ADP-ribose) polymerase family, member 10 647 84 B20140408_SF106_04 B20140408_SF106_04 TB377987.[MT7]-TLPAELR.2b4_1.heavy 472.288 / 527.331 19359.0 27.262800216674805 45 15 10 10 10 1.2348973631824787 51.44966503057401 0.0 3 0.9564920355574547 5.895093110605954 19359.0 19.746664580725906 1.0 - - - - - - - 1731.625 38 8 PARP10 poly (ADP-ribose) polymerase family, member 10 649 84 B20140408_SF106_04 B20140408_SF106_04 TB377987.[MT7]-TLPAELR.2y6_1.heavy 472.288 / 698.42 72641.0 27.262800216674805 45 15 10 10 10 1.2348973631824787 51.44966503057401 0.0 3 0.9564920355574547 5.895093110605954 72641.0 85.33831881016344 0.0 - - - - - - - 820.2857142857143 145 7 PARP10 poly (ADP-ribose) polymerase family, member 10 651 84 B20140408_SF106_04 B20140408_SF106_04 TB377987.[MT7]-TLPAELR.2b5_1.heavy 472.288 / 656.374 88448.0 27.262800216674805 45 15 10 10 10 1.2348973631824787 51.44966503057401 0.0 3 0.9564920355574547 5.895093110605954 88448.0 45.32701513062267 0.0 - - - - - - - 888.0 176 2 PARP10 poly (ADP-ribose) polymerase family, member 10 653 85 B20140408_SF106_04 B20140408_SF106_04 TB498808.[MT7]-QALTLSLLEQPPLEAEEPPDGGTDGK[MT7].4y8_1.heavy 749.144 / 890.434 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARP10 poly (ADP-ribose) polymerase family, member 10 655 85 B20140408_SF106_04 B20140408_SF106_04 TB498808.[MT7]-QALTLSLLEQPPLEAEEPPDGGTDGK[MT7].4b4_1.heavy 749.144 / 558.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARP10 poly (ADP-ribose) polymerase family, member 10 657 85 B20140408_SF106_04 B20140408_SF106_04 TB498808.[MT7]-QALTLSLLEQPPLEAEEPPDGGTDGK[MT7].4y6_1.heavy 749.144 / 678.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARP10 poly (ADP-ribose) polymerase family, member 10 659 85 B20140408_SF106_04 B20140408_SF106_04 TB498808.[MT7]-QALTLSLLEQPPLEAEEPPDGGTDGK[MT7].4b6_1.heavy 749.144 / 758.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARP10 poly (ADP-ribose) polymerase family, member 10 661 86 B20140408_SF106_04 B20140408_SF106_04 TB498770.[MT7]-VLEEQAQNLGLEGTLVSLAR.3y11_1.heavy 762.092 / 1115.64 92515.0 38.16659927368164 46 16 10 10 10 2.0940068696370724 33.643953446564225 0.0 3 0.9694070706540465 7.037823645692257 92515.0 194.2068126581199 0.0 - - - - - - - 811.1428571428571 185 7 PARP10 poly (ADP-ribose) polymerase family, member 10 663 86 B20140408_SF106_04 B20140408_SF106_04 TB498770.[MT7]-VLEEQAQNLGLEGTLVSLAR.3b4_1.heavy 762.092 / 615.347 70356.0 38.16659927368164 46 16 10 10 10 2.0940068696370724 33.643953446564225 0.0 3 0.9694070706540465 7.037823645692257 70356.0 56.54947909952193 0.0 - - - - - - - 1184.888888888889 140 9 PARP10 poly (ADP-ribose) polymerase family, member 10 665 86 B20140408_SF106_04 B20140408_SF106_04 TB498770.[MT7]-VLEEQAQNLGLEGTLVSLAR.3b5_1.heavy 762.092 / 743.406 103040.0 38.16659927368164 46 16 10 10 10 2.0940068696370724 33.643953446564225 0.0 3 0.9694070706540465 7.037823645692257 103040.0 101.21644664954921 0.0 - - - - - - - 1715.5555555555557 206 9 PARP10 poly (ADP-ribose) polymerase family, member 10 667 86 B20140408_SF106_04 B20140408_SF106_04 TB498770.[MT7]-VLEEQAQNLGLEGTLVSLAR.3y8_1.heavy 762.092 / 816.494 138426.0 38.16659927368164 46 16 10 10 10 2.0940068696370724 33.643953446564225 0.0 3 0.9694070706540465 7.037823645692257 138426.0 81.6107841367594 0.0 - - - - - - - 208.0 276 1 PARP10 poly (ADP-ribose) polymerase family, member 10 669 87 B20140408_SF106_04 B20140408_SF106_04 TB498771.[MT7]-GGGGGGAGGC[CAM]GALTAGC[CAM]FPGLGVSR.3y7_1.heavy 765.368 / 685.399 67056.0 31.99650001525879 46 16 10 10 10 4.192452471873231 23.852387277110616 0.0 3 0.962546679542997 6.357001604447435 67056.0 68.66608127310687 0.0 - - - - - - - 1234.5555555555557 134 9 CCDC109A coiled-coil domain containing 109A 671 87 B20140408_SF106_04 B20140408_SF106_04 TB498771.[MT7]-GGGGGGAGGC[CAM]GALTAGC[CAM]FPGLGVSR.3b7_1.heavy 765.368 / 558.275 26428.0 31.99650001525879 46 16 10 10 10 4.192452471873231 23.852387277110616 0.0 3 0.962546679542997 6.357001604447435 26428.0 26.30050233116052 0.0 - - - - - - - 1183.5714285714287 52 7 CCDC109A coiled-coil domain containing 109A 673 87 B20140408_SF106_04 B20140408_SF106_04 TB498771.[MT7]-GGGGGGAGGC[CAM]GALTAGC[CAM]FPGLGVSR.3b12_1.heavy 765.368 / 960.407 39116.0 31.99650001525879 46 16 10 10 10 4.192452471873231 23.852387277110616 0.0 3 0.962546679542997 6.357001604447435 39116.0 66.46751829010218 0.0 - - - - - - - 706.9166666666666 78 12 CCDC109A coiled-coil domain containing 109A 675 87 B20140408_SF106_04 B20140408_SF106_04 TB498771.[MT7]-GGGGGGAGGC[CAM]GALTAGC[CAM]FPGLGVSR.3y10_1.heavy 765.368 / 1049.52 39839.0 31.99650001525879 46 16 10 10 10 4.192452471873231 23.852387277110616 0.0 3 0.962546679542997 6.357001604447435 39839.0 81.0758596491228 0.0 - - - - - - - 826.4285714285714 79 7 CCDC109A coiled-coil domain containing 109A 677 88 B20140408_SF106_04 B20140408_SF106_04 TB149524.[MT7]-K[MT7]WEIELQTLR.3y7_1.heavy 535.319 / 872.52 55251.0 32.363800048828125 46 16 10 10 10 5.413018878360943 18.47397953843455 0.0 3 0.9673802659378513 6.814507753678489 55251.0 219.79412408759123 0.0 - - - - - - - 633.375 110 8 HOMER2 homer homolog 2 (Drosophila) 679 88 B20140408_SF106_04 B20140408_SF106_04 TB149524.[MT7]-K[MT7]WEIELQTLR.3y6_1.heavy 535.319 / 759.436 113445.0 32.363800048828125 46 16 10 10 10 5.413018878360943 18.47397953843455 0.0 3 0.9673802659378513 6.814507753678489 113445.0 155.75214216163585 0.0 - - - - - - - 778.0 226 11 HOMER2 homer homolog 2 (Drosophila) 681 88 B20140408_SF106_04 B20140408_SF106_04 TB149524.[MT7]-K[MT7]WEIELQTLR.3b3_1.heavy 535.319 / 732.428 40257.0 32.363800048828125 46 16 10 10 10 5.413018878360943 18.47397953843455 0.0 3 0.9673802659378513 6.814507753678489 40257.0 64.55057992381035 0.0 - - - - - - - 765.6363636363636 80 11 HOMER2 homer homolog 2 (Drosophila) 683 88 B20140408_SF106_04 B20140408_SF106_04 TB149524.[MT7]-K[MT7]WEIELQTLR.3y5_1.heavy 535.319 / 630.393 114951.0 32.363800048828125 46 16 10 10 10 5.413018878360943 18.47397953843455 0.0 3 0.9673802659378513 6.814507753678489 114951.0 72.88260814354848 0.0 - - - - - - - 1822.875 229 8 HOMER2 homer homolog 2 (Drosophila) 685 89 B20140408_SF106_04 B20140408_SF106_04 TB378616.[MT7]-QFASLEHGIVPVTSDC[CAM]QYLFPAK[MT7].4y4_1.heavy 724.629 / 606.373 14167.0 34.963600158691406 32 8 10 6 8 0.9767292896754536 64.44555774362966 0.03900146484375 4 0.7968848985863971 2.690606123722798 14167.0 22.827008321549002 0.0 - - - - - - - 1245.3 28 10 THOC5 THO complex 5 687 89 B20140408_SF106_04 B20140408_SF106_04 TB378616.[MT7]-QFASLEHGIVPVTSDC[CAM]QYLFPAK[MT7].4b8_2.heavy 724.629 / 507.76 7680.0 34.963600158691406 32 8 10 6 8 0.9767292896754536 64.44555774362966 0.03900146484375 4 0.7968848985863971 2.690606123722798 7680.0 22.687783746317795 0.0 - - - - - - - 338.3076923076923 15 13 THOC5 THO complex 5 689 89 B20140408_SF106_04 B20140408_SF106_04 TB378616.[MT7]-QFASLEHGIVPVTSDC[CAM]QYLFPAK[MT7].4b10_1.heavy 724.629 / 1226.67 3057.0 34.963600158691406 32 8 10 6 8 0.9767292896754536 64.44555774362966 0.03900146484375 4 0.7968848985863971 2.690606123722798 3057.0 36.31792493297587 1.0 - - - - - - - 176.0 14 14 THOC5 THO complex 5 691 89 B20140408_SF106_04 B20140408_SF106_04 TB378616.[MT7]-QFASLEHGIVPVTSDC[CAM]QYLFPAK[MT7].4b6_1.heavy 724.629 / 820.432 N/A 34.963600158691406 32 8 10 6 8 0.9767292896754536 64.44555774362966 0.03900146484375 4 0.7968848985863971 2.690606123722798 2759.0 3.3064654097656665 2.0 - - - - - - - 1248.875 5 8 THOC5 THO complex 5 693 90 B20140408_SF106_04 B20140408_SF106_04 TB378505.[MT7]-LGC[CAM]GGVLTFREPADAER.3y7_1.heavy 664.674 / 787.358 7806.0 30.389400482177734 45 18 9 10 8 2.4032331802539697 32.51733146200779 0.0 4 0.9848795382428374 10.023769968206196 7806.0 14.424702719183967 2.0 - - - - - - - 811.1428571428571 19 14 PARP10 poly (ADP-ribose) polymerase family, member 10 695 90 B20140408_SF106_04 B20140408_SF106_04 TB378505.[MT7]-LGC[CAM]GGVLTFREPADAER.3b6_1.heavy 664.674 / 688.357 11741.0 30.389400482177734 45 18 9 10 8 2.4032331802539697 32.51733146200779 0.0 4 0.9848795382428374 10.023769968206196 11741.0 17.663811098626983 0.0 - - - - - - - 760.5714285714286 23 14 PARP10 poly (ADP-ribose) polymerase family, member 10 697 90 B20140408_SF106_04 B20140408_SF106_04 TB378505.[MT7]-LGC[CAM]GGVLTFREPADAER.3y6_1.heavy 664.674 / 658.315 22192.0 30.389400482177734 45 18 9 10 8 2.4032331802539697 32.51733146200779 0.0 4 0.9848795382428374 10.023769968206196 22192.0 13.757886402245918 1.0 - - - - - - - 919.25 49 4 PARP10 poly (ADP-ribose) polymerase family, member 10 699 90 B20140408_SF106_04 B20140408_SF106_04 TB378505.[MT7]-LGC[CAM]GGVLTFREPADAER.3b5_1.heavy 664.674 / 589.288 9096.0 30.389400482177734 45 18 9 10 8 2.4032331802539697 32.51733146200779 0.0 4 0.9848795382428374 10.023769968206196 9096.0 7.953423416881753 0.0 - - - - - - - 1208.6 18 15 PARP10 poly (ADP-ribose) polymerase family, member 10 701 91 B20140408_SF106_04 B20140408_SF106_04 TB378489.[MT7]-ALVQLPK[MT7]PLSEADVR.3y10_2.heavy 642.054 / 628.36 17887.0 31.99650001525879 42 14 10 10 8 1.5809326968676967 55.81970426202035 0.0 4 0.9303006150950448 4.6472124330588995 17887.0 5.509809463321689 1.0 - - - - - - - 1326.6 35 5 PARP10 poly (ADP-ribose) polymerase family, member 10 703 91 B20140408_SF106_04 B20140408_SF106_04 TB378489.[MT7]-ALVQLPK[MT7]PLSEADVR.3b4_1.heavy 642.054 / 556.357 24586.0 31.99650001525879 42 14 10 10 8 1.5809326968676967 55.81970426202035 0.0 4 0.9303006150950448 4.6472124330588995 24586.0 11.482147327876746 1.0 - - - - - - - 804.0 49 1 PARP10 poly (ADP-ribose) polymerase family, member 10 705 91 B20140408_SF106_04 B20140408_SF106_04 TB378489.[MT7]-ALVQLPK[MT7]PLSEADVR.3y8_1.heavy 642.054 / 886.463 19561.0 31.99650001525879 42 14 10 10 8 1.5809326968676967 55.81970426202035 0.0 4 0.9303006150950448 4.6472124330588995 19561.0 23.35641791044776 1.0 - - - - - - - 323.8333333333333 39 6 PARP10 poly (ADP-ribose) polymerase family, member 10 707 91 B20140408_SF106_04 B20140408_SF106_04 TB378489.[MT7]-ALVQLPK[MT7]PLSEADVR.3b12_2.heavy 642.054 / 768.474 N/A 31.99650001525879 42 14 10 10 8 1.5809326968676967 55.81970426202035 0.0 4 0.9303006150950448 4.6472124330588995 2010.0 0.0 12.0 - - - - - - - 1770.7142857142858 14 7 PARP10 poly (ADP-ribose) polymerase family, member 10 709 92 B20140408_SF106_04 B20140408_SF106_04 TB377981.[MT7]-LIGISQR.2b3_1.heavy 465.796 / 428.299 70510.0 27.88819980621338 46 20 10 6 10 9.429435733072808 10.605088451821135 0.03800010681152344 3 0.9930291525977933 14.772941411947274 70510.0 31.14558799248924 0.0 - - - - - - - 3210.714285714286 141 7 CDC123 cell division cycle 123 homolog (S. cerevisiae) 711 92 B20140408_SF106_04 B20140408_SF106_04 TB377981.[MT7]-LIGISQR.2y5_1.heavy 465.796 / 560.315 363602.0 27.88819980621338 46 20 10 6 10 9.429435733072808 10.605088451821135 0.03800010681152344 3 0.9930291525977933 14.772941411947274 363602.0 199.43486317857955 0.0 - - - - - - - 1775.0 727 4 CDC123 cell division cycle 123 homolog (S. cerevisiae) 713 92 B20140408_SF106_04 B20140408_SF106_04 TB377981.[MT7]-LIGISQR.2b4_1.heavy 465.796 / 541.383 71004.0 27.88819980621338 46 20 10 6 10 9.429435733072808 10.605088451821135 0.03800010681152344 3 0.9930291525977933 14.772941411947274 71004.0 59.74908430845154 0.0 - - - - - - - 2195.1111111111113 142 9 CDC123 cell division cycle 123 homolog (S. cerevisiae) 715 92 B20140408_SF106_04 B20140408_SF106_04 TB377981.[MT7]-LIGISQR.2y6_1.heavy 465.796 / 673.399 459797.0 27.88819980621338 46 20 10 6 10 9.429435733072808 10.605088451821135 0.03800010681152344 3 0.9930291525977933 14.772941411947274 459797.0 243.54398707004222 0.0 - - - - - - - 2819.6666666666665 919 3 CDC123 cell division cycle 123 homolog (S. cerevisiae) 717 93 B20140408_SF106_04 B20140408_SF106_04 TB498420.[MT7]-ASPGSQAVPTSGK[MT7].3b6_1.heavy 492.275 / 672.343 107961.0 20.970300674438477 46 16 10 10 10 3.5420900017644605 28.23191955884404 0.0 3 0.967276609017388 6.8036466509172335 107961.0 323.49346951240204 0.0 - - - - - - - 325.7 215 10 TMEM88 transmembrane protein 88 719 93 B20140408_SF106_04 B20140408_SF106_04 TB498420.[MT7]-ASPGSQAVPTSGK[MT7].3y4_1.heavy 492.275 / 536.316 85449.0 20.970300674438477 46 16 10 10 10 3.5420900017644605 28.23191955884404 0.0 3 0.967276609017388 6.8036466509172335 85449.0 124.92078478296747 0.0 - - - - - - - 730.375 170 8 TMEM88 transmembrane protein 88 721 93 B20140408_SF106_04 B20140408_SF106_04 TB498420.[MT7]-ASPGSQAVPTSGK[MT7].3b7_1.heavy 492.275 / 743.38 184725.0 20.970300674438477 46 16 10 10 10 3.5420900017644605 28.23191955884404 0.0 3 0.967276609017388 6.8036466509172335 184725.0 459.33153155608153 0.0 - - - - - - - 304.72727272727275 369 11 TMEM88 transmembrane protein 88 723 93 B20140408_SF106_04 B20140408_SF106_04 TB498420.[MT7]-ASPGSQAVPTSGK[MT7].3y5_1.heavy 492.275 / 633.369 478145.0 20.970300674438477 46 16 10 10 10 3.5420900017644605 28.23191955884404 0.0 3 0.967276609017388 6.8036466509172335 478145.0 788.6466016740679 0.0 - - - - - - - 367.0 956 4 TMEM88 transmembrane protein 88 725 94 B20140408_SF106_04 B20140408_SF106_04 TB498421.[MT7]-LNWSAPR.2b3_1.heavy 494.278 / 558.316 32882.0 28.47719955444336 50 20 10 10 10 8.681734640849621 11.518435443704565 0.0 3 0.9965397693297824 20.97415797302187 32882.0 13.40640798502734 1.0 - - - - - - - 2226.285714285714 65 7 CDC123 cell division cycle 123 homolog (S. cerevisiae) 727 94 B20140408_SF106_04 B20140408_SF106_04 TB498421.[MT7]-LNWSAPR.2y5_1.heavy 494.278 / 616.32 79450.0 28.47719955444336 50 20 10 10 10 8.681734640849621 11.518435443704565 0.0 3 0.9965397693297824 20.97415797302187 79450.0 64.84825057012318 0.0 - - - - - - - 1351.6666666666667 158 3 CDC123 cell division cycle 123 homolog (S. cerevisiae) 729 94 B20140408_SF106_04 B20140408_SF106_04 TB498421.[MT7]-LNWSAPR.2b4_1.heavy 494.278 / 645.348 20274.0 28.47719955444336 50 20 10 10 10 8.681734640849621 11.518435443704565 0.0 3 0.9965397693297824 20.97415797302187 20274.0 21.1779377427288 0.0 - - - - - - - 1216.1 40 10 CDC123 cell division cycle 123 homolog (S. cerevisiae) 731 94 B20140408_SF106_04 B20140408_SF106_04 TB498421.[MT7]-LNWSAPR.2y6_1.heavy 494.278 / 730.363 249119.0 28.47719955444336 50 20 10 10 10 8.681734640849621 11.518435443704565 0.0 3 0.9965397693297824 20.97415797302187 249119.0 88.49465861399871 0.0 - - - - - - - 1394.0 498 1 CDC123 cell division cycle 123 homolog (S. cerevisiae) 733 95 B20140408_SF106_04 B20140408_SF106_04 TB378402.[MT7]-YYLQIC[CAM]TLLK[MT7].3y3_1.heavy 534.977 / 517.383 N/A 37.43730163574219 43 13 10 10 10 0.9424221319546857 65.4981565700358 0.0 3 0.9102609112189644 4.088546879416316 33037.0 14.13447692602702 0.0 - - - - - - - 3691.6363636363635 66 11 VNN1 vanin 1 735 95 B20140408_SF106_04 B20140408_SF106_04 TB378402.[MT7]-YYLQIC[CAM]TLLK[MT7].3b4_1.heavy 534.977 / 712.379 59054.0 37.43730163574219 43 13 10 10 10 0.9424221319546857 65.4981565700358 0.0 3 0.9102609112189644 4.088546879416316 59054.0 162.9712971971221 0.0 - - - - - - - 714.125 118 8 VNN1 vanin 1 737 95 B20140408_SF106_04 B20140408_SF106_04 TB378402.[MT7]-YYLQIC[CAM]TLLK[MT7].3y4_1.heavy 534.977 / 618.431 37924.0 37.43730163574219 43 13 10 10 10 0.9424221319546857 65.4981565700358 0.0 3 0.9102609112189644 4.088546879416316 37924.0 112.88233895083334 0.0 - - - - - - - 260.57142857142856 75 14 VNN1 vanin 1 739 95 B20140408_SF106_04 B20140408_SF106_04 TB378402.[MT7]-YYLQIC[CAM]TLLK[MT7].3b3_1.heavy 534.977 / 584.32 37029.0 37.43730163574219 43 13 10 10 10 0.9424221319546857 65.4981565700358 0.0 3 0.9102609112189644 4.088546879416316 37029.0 126.34214156079855 0.0 - - - - - - - 657.7777777777778 74 9 VNN1 vanin 1 741 96 B20140408_SF106_04 B20140408_SF106_04 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 1004610.0 23.531700134277344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1004610.0 601.8155478506504 0.0 - - - - - - - 1146.0714285714287 2009 14 743 96 B20140408_SF106_04 B20140408_SF106_04 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 1720680.0 23.531700134277344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1720680.0 857.4943468790566 0.0 - - - - - - - 222.37037037037038 3441 27 745 96 B20140408_SF106_04 B20140408_SF106_04 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 5045710.0 23.531700134277344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 5045710.0 938.0610684140613 0.0 - - - - - - - 658.6666666666666 10091 9 747 97 B20140408_SF106_04 B20140408_SF106_04 TB149310.[MT7]-IEELEAELR.2b3_1.heavy 623.344 / 516.279 17900.0 32.929500579833984 50 20 10 10 10 4.21598114199961 23.719271180746013 0.0 3 0.9920187666321059 13.80505340065789 17900.0 16.533831324180554 0.0 - - - - - - - 1761.75 35 8 HOMER2 homer homolog 2 (Drosophila) 749 97 B20140408_SF106_04 B20140408_SF106_04 TB149310.[MT7]-IEELEAELR.2y8_1.heavy 623.344 / 988.495 35870.0 32.929500579833984 50 20 10 10 10 4.21598114199961 23.719271180746013 0.0 3 0.9920187666321059 13.80505340065789 35870.0 71.92435972275342 0.0 - - - - - - - 367.8888888888889 71 9 HOMER2 homer homolog 2 (Drosophila) 751 97 B20140408_SF106_04 B20140408_SF106_04 TB149310.[MT7]-IEELEAELR.2y6_1.heavy 623.344 / 730.409 16349.0 32.929500579833984 50 20 10 10 10 4.21598114199961 23.719271180746013 0.0 3 0.9920187666321059 13.80505340065789 16349.0 16.56657479668118 0.0 - - - - - - - 1315.3333333333333 32 9 HOMER2 homer homolog 2 (Drosophila) 753 97 B20140408_SF106_04 B20140408_SF106_04 TB149310.[MT7]-IEELEAELR.2b5_1.heavy 623.344 / 758.405 14799.0 32.929500579833984 50 20 10 10 10 4.21598114199961 23.719271180746013 0.0 3 0.9920187666321059 13.80505340065789 14799.0 10.888485500033717 0.0 - - - - - - - 1278.5714285714287 29 7 HOMER2 homer homolog 2 (Drosophila) 755 98 B20140408_SF106_04 B20140408_SF106_04 TB378110.[MT7]-GFSYLLAGR.2y8_1.heavy 564.32 / 926.509 26537.0 34.16419982910156 47 17 10 10 10 4.59614315703163 21.757372776130833 0.0 3 0.9769665045026974 8.116060802425574 26537.0 70.2531125943922 0.0 - - - - - - - 230.6 53 15 PEX16 peroxisomal biogenesis factor 16 757 98 B20140408_SF106_04 B20140408_SF106_04 TB378110.[MT7]-GFSYLLAGR.2b4_1.heavy 564.32 / 599.295 25635.0 34.16419982910156 47 17 10 10 10 4.59614315703163 21.757372776130833 0.0 3 0.9769665045026974 8.116060802425574 25635.0 23.10219594706687 1.0 - - - - - - - 758.0833333333334 51 12 PEX16 peroxisomal biogenesis factor 16 759 98 B20140408_SF106_04 B20140408_SF106_04 TB378110.[MT7]-GFSYLLAGR.2b5_1.heavy 564.32 / 712.379 29544.0 34.16419982910156 47 17 10 10 10 4.59614315703163 21.757372776130833 0.0 3 0.9769665045026974 8.116060802425574 29544.0 43.70573641208158 0.0 - - - - - - - 1240.25 59 8 PEX16 peroxisomal biogenesis factor 16 761 98 B20140408_SF106_04 B20140408_SF106_04 TB378110.[MT7]-GFSYLLAGR.2y7_1.heavy 564.32 / 779.441 29319.0 34.16419982910156 47 17 10 10 10 4.59614315703163 21.757372776130833 0.0 3 0.9769665045026974 8.116060802425574 29319.0 32.115211716851796 0.0 - - - - - - - 718.3333333333334 58 9 PEX16 peroxisomal biogenesis factor 16 763 99 B20140408_SF106_04 B20140408_SF106_04 TB498416.[MT7]-SSDFITR.2y4_1.heavy 485.26 / 536.319 193028.0 24.91860008239746 47 17 10 10 10 2.3570527641590955 33.50032397376367 0.0 3 0.971204782177889 7.255285492025185 193028.0 48.90041488306311 0.0 - - - - - - - 455.5 386 2 CDC123 cell division cycle 123 homolog (S. cerevisiae) 765 99 B20140408_SF106_04 B20140408_SF106_04 TB498416.[MT7]-SSDFITR.2b4_1.heavy 485.26 / 581.269 87925.0 24.91860008239746 47 17 10 10 10 2.3570527641590955 33.50032397376367 0.0 3 0.971204782177889 7.255285492025185 87925.0 50.73261364554983 0.0 - - - - - - - 1284.875 175 8 CDC123 cell division cycle 123 homolog (S. cerevisiae) 767 99 B20140408_SF106_04 B20140408_SF106_04 TB498416.[MT7]-SSDFITR.2y6_1.heavy 485.26 / 738.378 100071.0 24.91860008239746 47 17 10 10 10 2.3570527641590955 33.50032397376367 0.0 3 0.971204782177889 7.255285492025185 100071.0 71.13596541786744 0.0 - - - - - - - 352.375 200 8 CDC123 cell division cycle 123 homolog (S. cerevisiae) 769 99 B20140408_SF106_04 B20140408_SF106_04 TB498416.[MT7]-SSDFITR.2b5_1.heavy 485.26 / 694.353 58646.0 24.91860008239746 47 17 10 10 10 2.3570527641590955 33.50032397376367 0.0 3 0.971204782177889 7.255285492025185 58646.0 61.63987362119288 0.0 - - - - - - - 1262.3 117 10 CDC123 cell division cycle 123 homolog (S. cerevisiae) 771 100 B20140408_SF106_04 B20140408_SF106_04 TB378105.[MT7]-HWGAPQQR.2y4_1.heavy 562.297 / 528.289 8203.0 20.90690040588379 50 20 10 10 10 10.429454124463618 9.588229528277727 0.0 3 0.9938097869255446 15.677805948958524 8203.0 11.85643030401205 0.0 - - - - - - - 800.25 16 16 PEX16 peroxisomal biogenesis factor 16 773 100 B20140408_SF106_04 B20140408_SF106_04 TB378105.[MT7]-HWGAPQQR.2b4_1.heavy 562.297 / 596.306 6562.0 20.90690040588379 50 20 10 10 10 10.429454124463618 9.588229528277727 0.0 3 0.9938097869255446 15.677805948958524 6562.0 41.40848275862069 0.0 - - - - - - - 185.4 13 25 PEX16 peroxisomal biogenesis factor 16 775 100 B20140408_SF106_04 B20140408_SF106_04 TB378105.[MT7]-HWGAPQQR.2y6_1.heavy 562.297 / 656.347 17210.0 20.90690040588379 50 20 10 10 10 10.429454124463618 9.588229528277727 0.0 3 0.9938097869255446 15.677805948958524 17210.0 80.80926121158058 0.0 - - - - - - - 239.95833333333334 34 24 PEX16 peroxisomal biogenesis factor 16 777 100 B20140408_SF106_04 B20140408_SF106_04 TB378105.[MT7]-HWGAPQQR.2y7_1.heavy 562.297 / 842.427 35802.0 20.90690040588379 50 20 10 10 10 10.429454124463618 9.588229528277727 0.0 3 0.9938097869255446 15.677805948958524 35802.0 209.91980124223602 0.0 - - - - - - - 199.04545454545453 71 22 PEX16 peroxisomal biogenesis factor 16 779 101 B20140408_SF106_04 B20140408_SF106_04 TB378383.[MT7]-RRIEELEAELR.3b9_2.heavy 519.966 / 635.847 169702.0 27.745924949645996 34 8 10 6 10 0.6436210829335782 84.64541021854487 0.036701202392578125 3 0.7634848269874075 2.485854445858705 169702.0 159.4124564107569 0.0 - - - - - - - 1213.4545454545455 339 11 HOMER2 homer homolog 2 (Drosophila) 781 101 B20140408_SF106_04 B20140408_SF106_04 TB378383.[MT7]-RRIEELEAELR.3y6_1.heavy 519.966 / 730.409 22986.0 27.745924949645996 34 8 10 6 10 0.6436210829335782 84.64541021854487 0.036701202392578125 3 0.7634848269874075 2.485854445858705 22986.0 28.460164670157297 0.0 - - - - - - - 759.5 45 16 HOMER2 homer homolog 2 (Drosophila) 783 101 B20140408_SF106_04 B20140408_SF106_04 TB378383.[MT7]-RRIEELEAELR.3y5_1.heavy 519.966 / 617.325 27296.0 27.745924949645996 34 8 10 6 10 0.6436210829335782 84.64541021854487 0.036701202392578125 3 0.7634848269874075 2.485854445858705 27296.0 21.411235273179244 0.0 - - - - - - - 1710.142857142857 54 7 HOMER2 homer homolog 2 (Drosophila) 785 101 B20140408_SF106_04 B20140408_SF106_04 TB378383.[MT7]-RRIEELEAELR.3b7_2.heavy 519.966 / 535.807 35916.0 27.745924949645996 34 8 10 6 10 0.6436210829335782 84.64541021854487 0.036701202392578125 3 0.7634848269874075 2.485854445858705 35916.0 52.677913429109864 0.0 - - - - - - - 1231.4285714285713 71 7 HOMER2 homer homolog 2 (Drosophila) 787 102 B20140408_SF106_04 B20140408_SF106_04 TB149272.[MT7]-AGELGLGGAGTR.2y8_1.heavy 601.834 / 688.374 21292.0 26.026949882507324 36 10 10 6 10 1.0896968934118672 72.07700071376772 0.03230094909667969 3 0.8360356410465513 3.005153602102506 21292.0 24.550979591836732 0.0 - - - - - - - 794.0 42 12 AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 789 102 B20140408_SF106_04 B20140408_SF106_04 TB149272.[MT7]-AGELGLGGAGTR.2y9_1.heavy 601.834 / 801.458 16064.0 26.026949882507324 36 10 10 6 10 1.0896968934118672 72.07700071376772 0.03230094909667969 3 0.8360356410465513 3.005153602102506 16064.0 32.904065490603024 0.0 - - - - - - - 690.9375 32 16 AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 791 102 B20140408_SF106_04 B20140408_SF106_04 TB149272.[MT7]-AGELGLGGAGTR.2b5_1.heavy 601.834 / 572.316 48900.0 26.026949882507324 36 10 10 6 10 1.0896968934118672 72.07700071376772 0.03230094909667969 3 0.8360356410465513 3.005153602102506 48900.0 35.59158690254985 0.0 - - - - - - - 490.0 97 1 AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 793 102 B20140408_SF106_04 B20140408_SF106_04 TB149272.[MT7]-AGELGLGGAGTR.2y11_1.heavy 601.834 / 987.522 90395.0 26.026949882507324 36 10 10 6 10 1.0896968934118672 72.07700071376772 0.03230094909667969 3 0.8360356410465513 3.005153602102506 90395.0 208.3786776939823 0.0 - - - - - - - 308.5 180 12 AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 795 103 B20140408_SF106_04 B20140408_SF106_04 TB498680.[MT7]-LAENTGEFQEVVR.2y8_1.heavy 818.427 / 963.489 8326.0 29.822800159454346 43 17 10 6 10 2.592454322221998 30.93466814418582 0.03439903259277344 3 0.9774473222879567 8.202452204013891 8326.0 65.91416666666667 0.0 - - - - - - - 226.9090909090909 16 22 PARP10 poly (ADP-ribose) polymerase family, member 10 797 103 B20140408_SF106_04 B20140408_SF106_04 TB498680.[MT7]-LAENTGEFQEVVR.2y6_1.heavy 818.427 / 777.425 8134.0 29.822800159454346 43 17 10 6 10 2.592454322221998 30.93466814418582 0.03439903259277344 3 0.9774473222879567 8.202452204013891 8134.0 8.680679557165451 0.0 - - - - - - - 731.8571428571429 16 14 PARP10 poly (ADP-ribose) polymerase family, member 10 799 103 B20140408_SF106_04 B20140408_SF106_04 TB498680.[MT7]-LAENTGEFQEVVR.2b7_1.heavy 818.427 / 859.428 4931.0 29.822800159454346 43 17 10 6 10 2.592454322221998 30.93466814418582 0.03439903259277344 3 0.9774473222879567 8.202452204013891 4931.0 12.273673123374211 0.0 - - - - - - - 224.0 9 18 PARP10 poly (ADP-ribose) polymerase family, member 10 801 103 B20140408_SF106_04 B20140408_SF106_04 TB498680.[MT7]-LAENTGEFQEVVR.2y10_1.heavy 818.427 / 1178.58 7685.0 29.822800159454346 43 17 10 6 10 2.592454322221998 30.93466814418582 0.03439903259277344 3 0.9774473222879567 8.202452204013891 7685.0 110.471875 0.0 - - - - - - - 152.38095238095238 15 21 PARP10 poly (ADP-ribose) polymerase family, member 10 803 104 B20140408_SF106_04 B20140408_SF106_04 TB378282.[MT7]-DVAIEIEERR.2y8_1.heavy 687.379 / 1015.55 12300.0 24.933650016784668 46 20 10 6 10 8.440478360618169 11.847669732391346 0.030099868774414062 3 0.9935332987715532 15.338632981951331 12300.0 107.84863636363636 0.0 - - - - - - - 167.9375 24 16 THOC5 THO complex 5 805 104 B20140408_SF106_04 B20140408_SF106_04 TB378282.[MT7]-DVAIEIEERR.2y9_1.heavy 687.379 / 1114.62 5687.0 24.933650016784668 46 20 10 6 10 8.440478360618169 11.847669732391346 0.030099868774414062 3 0.9935332987715532 15.338632981951331 5687.0 29.687166666666663 0.0 - - - - - - - 212.94444444444446 11 18 THOC5 THO complex 5 807 104 B20140408_SF106_04 B20140408_SF106_04 TB378282.[MT7]-DVAIEIEERR.2b7_1.heavy 687.379 / 914.495 1675.0 24.933650016784668 46 20 10 6 10 8.440478360618169 11.847669732391346 0.030099868774414062 3 0.9935332987715532 15.338632981951331 1675.0 5.2102272727272725 1.0 - - - - - - - 160.91304347826087 3 23 THOC5 THO complex 5 809 104 B20140408_SF106_04 B20140408_SF106_04 TB378282.[MT7]-DVAIEIEERR.2y7_1.heavy 687.379 / 944.516 13799.0 24.933650016784668 46 20 10 6 10 8.440478360618169 11.847669732391346 0.030099868774414062 3 0.9935332987715532 15.338632981951331 13799.0 37.05243474637269 0.0 - - - - - - - 230.76470588235293 27 17 THOC5 THO complex 5 811 105 B20140408_SF106_04 B20140408_SF106_04 TB378075.[MT7]-ERELIER.3y3_1.heavy 363.544 / 417.246 169250.0 22.31450080871582 50 20 10 10 10 12.61178571108114 7.929091271518881 0.0 3 0.9972892790339658 23.698551901720794 169250.0 116.31661153987504 0.0 - - - - - - - 1676.857142857143 338 7 CCDC109A coiled-coil domain containing 109A 813 105 B20140408_SF106_04 B20140408_SF106_04 TB378075.[MT7]-ERELIER.3b4_1.heavy 363.544 / 672.38 29489.0 22.31450080871582 50 20 10 10 10 12.61178571108114 7.929091271518881 0.0 3 0.9972892790339658 23.698551901720794 29489.0 91.8238248296187 0.0 - - - - - - - 307.7 58 20 CCDC109A coiled-coil domain containing 109A 815 105 B20140408_SF106_04 B20140408_SF106_04 TB378075.[MT7]-ERELIER.3y4_1.heavy 363.544 / 530.33 75448.0 22.31450080871582 50 20 10 10 10 12.61178571108114 7.929091271518881 0.0 3 0.9972892790339658 23.698551901720794 75448.0 88.24794932742938 0.0 - - - - - - - 771.8 150 10 CCDC109A coiled-coil domain containing 109A 817 105 B20140408_SF106_04 B20140408_SF106_04 TB378075.[MT7]-ERELIER.3y5_1.heavy 363.544 / 659.372 34718.0 22.31450080871582 50 20 10 10 10 12.61178571108114 7.929091271518881 0.0 3 0.9972892790339658 23.698551901720794 34718.0 90.98758093197866 0.0 - - - - - - - 247.05555555555554 69 18 CCDC109A coiled-coil domain containing 109A 819 106 B20140408_SF106_04 B20140408_SF106_04 TB149592.[MT7]-VQEAINSLGGSVFPK[MT7].3y3_1.heavy 612.015 / 535.336 226533.0 33.92614936828613 37 11 10 6 10 0.865810224271068 69.71770704348499 0.036098480224609375 3 0.8562462256169764 3.2151948898670866 226533.0 178.99361653973241 0.0 - - - - - - - 820.0 453 1 CDC123 cell division cycle 123 homolog (S. cerevisiae) 821 106 B20140408_SF106_04 B20140408_SF106_04 TB149592.[MT7]-VQEAINSLGGSVFPK[MT7].3b4_1.heavy 612.015 / 572.316 179289.0 33.92614936828613 37 11 10 6 10 0.865810224271068 69.71770704348499 0.036098480224609375 3 0.8562462256169764 3.2151948898670866 179289.0 150.03141198575923 0.0 - - - - - - - 1844.25 358 4 CDC123 cell division cycle 123 homolog (S. cerevisiae) 823 106 B20140408_SF106_04 B20140408_SF106_04 TB149592.[MT7]-VQEAINSLGGSVFPK[MT7].3b5_1.heavy 612.015 / 685.4 142328.0 33.92614936828613 37 11 10 6 10 0.865810224271068 69.71770704348499 0.036098480224609375 3 0.8562462256169764 3.2151948898670866 142328.0 208.3327543329154 0.0 - - - - - - - 894.0 284 1 CDC123 cell division cycle 123 homolog (S. cerevisiae) 825 106 B20140408_SF106_04 B20140408_SF106_04 TB149592.[MT7]-VQEAINSLGGSVFPK[MT7].3b3_1.heavy 612.015 / 501.279 58273.0 33.92614936828613 37 11 10 6 10 0.865810224271068 69.71770704348499 0.036098480224609375 3 0.8562462256169764 3.2151948898670866 58273.0 45.764756336296486 0.0 - - - - - - - 1043.0 116 1 CDC123 cell division cycle 123 homolog (S. cerevisiae) 827 107 B20140408_SF106_04 B20140408_SF106_04 TB149370.[MT7]-GRDQTHEAK[MT7].3y3_1.heavy 443.909 / 491.295 9800.0 15.644350051879883 28 16 0 6 6 2.699158084875306 29.812733729757976 0.03260040283203125 6 0.9666659551255785 6.74069258933111 9800.0 162.37254901960785 2.0 - - - - - - - 157.16129032258064 89 31 THOC5 THO complex 5 829 107 B20140408_SF106_04 B20140408_SF106_04 TB149370.[MT7]-GRDQTHEAK[MT7].3b5_1.heavy 443.909 / 702.365 1411.0 15.644350051879883 28 16 0 6 6 2.699158084875306 29.812733729757976 0.03260040283203125 6 0.9666659551255785 6.74069258933111 1411.0 34.251358820819895 0.0 - - - - - - - 64.27586206896552 2 29 THOC5 THO complex 5 831 107 B20140408_SF106_04 B20140408_SF106_04 TB149370.[MT7]-GRDQTHEAK[MT7].3y4_1.heavy 443.909 / 628.354 3920.0 15.644350051879883 28 16 0 6 6 2.699158084875306 29.812733729757976 0.03260040283203125 6 0.9666659551255785 6.74069258933111 3920.0 47.60486750610788 0.0 - - - - - - - 85.57142857142857 7 28 THOC5 THO complex 5 833 107 B20140408_SF106_04 B20140408_SF106_04 TB149370.[MT7]-GRDQTHEAK[MT7].3b3_1.heavy 443.909 / 473.259 6852.0 15.644350051879883 28 16 0 6 6 2.699158084875306 29.812733729757976 0.03260040283203125 6 0.9666659551255785 6.74069258933111 6852.0 231.81863225806453 2.0 - - - - - - - 93.90322580645162 24 31 THOC5 THO complex 5 835 108 B20140408_SF106_04 B20140408_SF106_04 TB498555.[MT7]-SFLEVLDGK[MT7].2y4_1.heavy 648.376 / 576.347 14291.0 36.30720138549805 50 20 10 10 10 17.44310961152131 5.732922754435322 0.0 3 0.99731176636835 23.79751045536986 14291.0 14.65628991050204 0.0 - - - - - - - 1225.25 28 8 HOMER2 homer homolog 2 (Drosophila) 837 108 B20140408_SF106_04 B20140408_SF106_04 TB498555.[MT7]-SFLEVLDGK[MT7].2y5_1.heavy 648.376 / 675.416 12645.0 36.30720138549805 50 20 10 10 10 17.44310961152131 5.732922754435322 0.0 3 0.99731176636835 23.79751045536986 12645.0 18.189380616484684 0.0 - - - - - - - 740.8 25 10 HOMER2 homer homolog 2 (Drosophila) 839 108 B20140408_SF106_04 B20140408_SF106_04 TB498555.[MT7]-SFLEVLDGK[MT7].2b4_1.heavy 648.376 / 621.336 19977.0 36.30720138549805 50 20 10 10 10 17.44310961152131 5.732922754435322 0.0 3 0.99731176636835 23.79751045536986 19977.0 14.519624060150376 0.0 - - - - - - - 449.0 39 1 HOMER2 homer homolog 2 (Drosophila) 841 108 B20140408_SF106_04 B20140408_SF106_04 TB498555.[MT7]-SFLEVLDGK[MT7].2y6_1.heavy 648.376 / 804.458 11148.0 36.30720138549805 50 20 10 10 10 17.44310961152131 5.732922754435322 0.0 3 0.99731176636835 23.79751045536986 11148.0 33.78477087984999 0.0 - - - - - - - 720.25 22 8 HOMER2 homer homolog 2 (Drosophila) 843 109 B20140408_SF106_04 B20140408_SF106_04 TB149223.[MT7]-EAPPDISK[MT7].2y5_1.heavy 572.826 / 703.411 13571.0 23.154675483703613 31 8 10 3 10 1.6035220232695122 62.362723148700084 0.053600311279296875 3 0.7711513464788591 2.5289176441759764 13571.0 25.175387879589614 0.0 - - - - - - - 633.0 27 7 THOC5 THO complex 5 845 109 B20140408_SF106_04 B20140408_SF106_04 TB149223.[MT7]-EAPPDISK[MT7].2y6_1.heavy 572.826 / 800.463 31613.0 23.154675483703613 31 8 10 3 10 1.6035220232695122 62.362723148700084 0.053600311279296875 3 0.7711513464788591 2.5289176441759764 31613.0 30.074684617409762 0.0 - - - - - - - 365.8333333333333 63 6 THOC5 THO complex 5 847 109 B20140408_SF106_04 B20140408_SF106_04 TB149223.[MT7]-EAPPDISK[MT7].2b5_1.heavy 572.826 / 654.321 564354.0 23.154675483703613 31 8 10 3 10 1.6035220232695122 62.362723148700084 0.053600311279296875 3 0.7711513464788591 2.5289176441759764 564354.0 619.6749537017282 0.0 - - - - - - - 732.3333333333334 1128 3 THOC5 THO complex 5 849 109 B20140408_SF106_04 B20140408_SF106_04 TB149223.[MT7]-EAPPDISK[MT7].2y7_1.heavy 572.826 / 871.5 22356.0 23.154675483703613 31 8 10 3 10 1.6035220232695122 62.362723148700084 0.053600311279296875 3 0.7711513464788591 2.5289176441759764 22356.0 43.93523115172327 0.0 - - - - - - - 702.9230769230769 44 13 THOC5 THO complex 5 851 110 B20140408_SF106_04 B20140408_SF106_04 TB149279.[MT7]-VLTGDYGQGR.2y8_1.heavy 605.321 / 853.38 15131.0 25.411500930786133 48 18 10 10 10 17.906226794901613 5.58464947112547 0.0 3 0.9868364092833032 10.744782388478281 15131.0 30.88158695745811 0.0 - - - - - - - 614.25 30 12 PARP10 poly (ADP-ribose) polymerase family, member 10 853 110 B20140408_SF106_04 B20140408_SF106_04 TB149279.[MT7]-VLTGDYGQGR.2y5_1.heavy 605.321 / 580.284 23612.0 25.411500930786133 48 18 10 10 10 17.906226794901613 5.58464947112547 0.0 3 0.9868364092833032 10.744782388478281 23612.0 20.582370899097278 0.0 - - - - - - - 1190.857142857143 47 7 PARP10 poly (ADP-ribose) polymerase family, member 10 855 110 B20140408_SF106_04 B20140408_SF106_04 TB149279.[MT7]-VLTGDYGQGR.2y9_1.heavy 605.321 / 966.464 21926.0 25.411500930786133 48 18 10 10 10 17.906226794901613 5.58464947112547 0.0 3 0.9868364092833032 10.744782388478281 21926.0 52.627845836232154 0.0 - - - - - - - 734.875 43 8 PARP10 poly (ADP-ribose) polymerase family, member 10 857 110 B20140408_SF106_04 B20140408_SF106_04 TB149279.[MT7]-VLTGDYGQGR.2b5_1.heavy 605.321 / 630.358 14697.0 25.411500930786133 48 18 10 10 10 17.906226794901613 5.58464947112547 0.0 3 0.9868364092833032 10.744782388478281 14697.0 16.355364178847424 1.0 - - - - - - - 1168.6666666666667 44 12 PARP10 poly (ADP-ribose) polymerase family, member 10 859 111 B20140408_SF106_04 B20140408_SF106_04 TB149510.[MT7]-AHVFQIDPNTK[MT7].3y3_1.heavy 519.959 / 506.306 42261.0 26.827699661254883 50 20 10 10 10 17.95218661390089 5.570352077477134 0.0 3 0.9905668590335699 12.696739780238337 42261.0 11.867062309136946 0.0 - - - - - - - 2155.0 84 1 HOMER2;HOMER1 homer homolog 2 (Drosophila);homer homolog 1 (Drosophila) 861 111 B20140408_SF106_04 B20140408_SF106_04 TB149510.[MT7]-AHVFQIDPNTK[MT7].3b4_1.heavy 519.959 / 599.342 43937.0 26.827699661254883 50 20 10 10 10 17.95218661390089 5.570352077477134 0.0 3 0.9905668590335699 12.696739780238337 43937.0 26.67379401401935 0.0 - - - - - - - 818.0 87 3 HOMER2;HOMER1 homer homolog 2 (Drosophila);homer homolog 1 (Drosophila) 863 111 B20140408_SF106_04 B20140408_SF106_04 TB149510.[MT7]-AHVFQIDPNTK[MT7].3b5_1.heavy 519.959 / 727.401 33043.0 26.827699661254883 50 20 10 10 10 17.95218661390089 5.570352077477134 0.0 3 0.9905668590335699 12.696739780238337 33043.0 38.093427923609205 0.0 - - - - - - - 723.9090909090909 66 11 HOMER2;HOMER1 homer homolog 2 (Drosophila);homer homolog 1 (Drosophila) 865 111 B20140408_SF106_04 B20140408_SF106_04 TB149510.[MT7]-AHVFQIDPNTK[MT7].3y5_1.heavy 519.959 / 718.385 24483.0 26.827699661254883 50 20 10 10 10 17.95218661390089 5.570352077477134 0.0 3 0.9905668590335699 12.696739780238337 24483.0 25.900173577508127 0.0 - - - - - - - 479.0 48 2 HOMER2;HOMER1 homer homolog 2 (Drosophila);homer homolog 1 (Drosophila) 867 112 B20140408_SF106_04 B20140408_SF106_04 TB149174.[MT7]-IISVDGAK[MT7].2y4_1.heavy 545.839 / 534.3 40099.0 26.92549991607666 46 20 10 6 10 7.849820521380733 12.739144764855165 0.03999900817871094 3 0.9949319018347367 17.328312417458775 40099.0 12.65181448832212 1.0 - - - - - - - 3217.0 80 1 HOMER2 homer homolog 2 (Drosophila) 869 112 B20140408_SF106_04 B20140408_SF106_04 TB149174.[MT7]-IISVDGAK[MT7].2y5_1.heavy 545.839 / 633.369 20258.0 26.92549991607666 46 20 10 6 10 7.849820521380733 12.739144764855165 0.03999900817871094 3 0.9949319018347367 17.328312417458775 20258.0 15.886980389480037 0.0 - - - - - - - 1787.3636363636363 40 11 HOMER2 homer homolog 2 (Drosophila) 871 112 B20140408_SF106_04 B20140408_SF106_04 TB149174.[MT7]-IISVDGAK[MT7].2y6_1.heavy 545.839 / 720.401 54815.0 26.92549991607666 46 20 10 6 10 7.849820521380733 12.739144764855165 0.03999900817871094 3 0.9949319018347367 17.328312417458775 54815.0 16.37827109464255 0.0 - - - - - - - 1161.5 109 8 HOMER2 homer homolog 2 (Drosophila) 873 112 B20140408_SF106_04 B20140408_SF106_04 TB149174.[MT7]-IISVDGAK[MT7].2y7_1.heavy 545.839 / 833.485 54636.0 26.92549991607666 46 20 10 6 10 7.849820521380733 12.739144764855165 0.03999900817871094 3 0.9949319018347367 17.328312417458775 54636.0 41.82125255832992 0.0 - - - - - - - 814.0 109 3 HOMER2 homer homolog 2 (Drosophila) 875 113 B20140408_SF106_04 B20140408_SF106_04 TB378513.[MT7]-VFLISGVTLDNC[CAM]VEVGR.3b3_1.heavy 674.699 / 504.33 40856.0 37.13999938964844 48 18 10 10 10 4.07825057280448 24.520317772243516 0.0 3 0.98339646799091 9.564436507086523 40856.0 13.412718006732215 0.0 - - - - - - - 277.0 81 1 KLHL13 kelch-like 13 (Drosophila) 877 113 B20140408_SF106_04 B20140408_SF106_04 TB378513.[MT7]-VFLISGVTLDNC[CAM]VEVGR.3y8_1.heavy 674.699 / 948.42 27214.0 37.13999938964844 48 18 10 10 10 4.07825057280448 24.520317772243516 0.0 3 0.98339646799091 9.564436507086523 27214.0 20.411346943856593 0.0 - - - - - - - 334.5 54 6 KLHL13 kelch-like 13 (Drosophila) 879 113 B20140408_SF106_04 B20140408_SF106_04 TB378513.[MT7]-VFLISGVTLDNC[CAM]VEVGR.3y5_1.heavy 674.699 / 559.32 17935.0 37.13999938964844 48 18 10 10 10 4.07825057280448 24.520317772243516 0.0 3 0.98339646799091 9.564436507086523 17935.0 7.4087275405618485 0.0 - - - - - - - 1226.7142857142858 35 7 KLHL13 kelch-like 13 (Drosophila) 881 113 B20140408_SF106_04 B20140408_SF106_04 TB378513.[MT7]-VFLISGVTLDNC[CAM]VEVGR.3y10_1.heavy 674.699 / 1162.55 4709.0 37.13999938964844 48 18 10 10 10 4.07825057280448 24.520317772243516 0.0 3 0.98339646799091 9.564436507086523 4709.0 16.0010399392847 0.0 - - - - - - - 267.0 9 14 KLHL13 kelch-like 13 (Drosophila) 883 114 B20140408_SF106_04 B20140408_SF106_04 TB378498.[MT7]-YQYNTDVVFDSQGK[MT7].3y6_1.heavy 651.326 / 825.422 49073.0 29.54800033569336 45 15 10 10 10 3.0978643335196407 32.2803032134028 0.0 3 0.9558439783099851 5.851352266821561 49073.0 57.798276809489224 0.0 - - - - - - - 749.0 98 8 VNN1 vanin 1 885 114 B20140408_SF106_04 B20140408_SF106_04 TB378498.[MT7]-YQYNTDVVFDSQGK[MT7].3b6_1.heavy 651.326 / 929.412 59397.0 29.54800033569336 45 15 10 10 10 3.0978643335196407 32.2803032134028 0.0 3 0.9558439783099851 5.851352266821561 59397.0 100.256205383758 0.0 - - - - - - - 675.7 118 10 VNN1 vanin 1 887 114 B20140408_SF106_04 B20140408_SF106_04 TB378498.[MT7]-YQYNTDVVFDSQGK[MT7].3y4_1.heavy 651.326 / 563.327 54809.0 29.54800033569336 45 15 10 10 10 3.0978643335196407 32.2803032134028 0.0 3 0.9558439783099851 5.851352266821561 54809.0 42.10730920156413 0.0 - - - - - - - 1704.875 109 8 VNN1 vanin 1 889 114 B20140408_SF106_04 B20140408_SF106_04 TB378498.[MT7]-YQYNTDVVFDSQGK[MT7].3y5_1.heavy 651.326 / 678.354 45058.0 29.54800033569336 45 15 10 10 10 3.0978643335196407 32.2803032134028 0.0 3 0.9558439783099851 5.851352266821561 45058.0 44.66211316245041 0.0 - - - - - - - 828.5 90 10 VNN1 vanin 1 891 115 B20140408_SF106_04 B20140408_SF106_04 TB498552.[MT7]-AFYDTLDAAR.2y8_1.heavy 643.828 / 924.442 22348.0 30.859800338745117 48 18 10 10 10 4.5486442083464835 21.984572857227683 0.0 3 0.9898272544817441 12.225719492913708 22348.0 71.36175999128231 0.0 - - - - - - - 655.0 44 7 PARP10 poly (ADP-ribose) polymerase family, member 10 893 115 B20140408_SF106_04 B20140408_SF106_04 TB498552.[MT7]-AFYDTLDAAR.2b4_1.heavy 643.828 / 641.305 29905.0 30.859800338745117 48 18 10 10 10 4.5486442083464835 21.984572857227683 0.0 3 0.9898272544817441 12.225719492913708 29905.0 26.063058461342536 0.0 - - - - - - - 1235.25 59 8 PARP10 poly (ADP-ribose) polymerase family, member 10 895 115 B20140408_SF106_04 B20140408_SF106_04 TB498552.[MT7]-AFYDTLDAAR.2y9_1.heavy 643.828 / 1071.51 24350.0 30.859800338745117 48 18 10 10 10 4.5486442083464835 21.984572857227683 0.0 3 0.9898272544817441 12.225719492913708 24350.0 72.48100766622437 0.0 - - - - - - - 222.55555555555554 48 18 PARP10 poly (ADP-ribose) polymerase family, member 10 897 115 B20140408_SF106_04 B20140408_SF106_04 TB498552.[MT7]-AFYDTLDAAR.2y6_1.heavy 643.828 / 646.352 36881.0 30.859800338745117 48 18 10 10 10 4.5486442083464835 21.984572857227683 0.0 3 0.9898272544817441 12.225719492913708 36881.0 27.427898896802123 0.0 - - - - - - - 1310.2857142857142 73 7 PARP10 poly (ADP-ribose) polymerase family, member 10 899 116 B20140408_SF106_04 B20140408_SF106_04 TB378598.[MT7]-VVGDGASVDLLLLELYLENERR.4y11_2.heavy 655.113 / 724.399 43919.0 41.007999420166016 43 13 10 10 10 1.503620475839316 53.18103315355333 0.0 3 0.9069467181531674 4.013930418116682 43919.0 45.95979258792651 0.0 - - - - - - - 312.6 87 10 PARP10 poly (ADP-ribose) polymerase family, member 10 901 116 B20140408_SF106_04 B20140408_SF106_04 TB378598.[MT7]-VVGDGASVDLLLLELYLENERR.4b4_1.heavy 655.113 / 515.295 18168.0 41.007999420166016 43 13 10 10 10 1.503620475839316 53.18103315355333 0.0 3 0.9069467181531674 4.013930418116682 18168.0 27.828835546475993 0.0 - - - - - - - 652.7777777777778 36 9 PARP10 poly (ADP-ribose) polymerase family, member 10 903 116 B20140408_SF106_04 B20140408_SF106_04 TB378598.[MT7]-VVGDGASVDLLLLELYLENERR.4b5_1.heavy 655.113 / 572.316 21459.0 41.007999420166016 43 13 10 10 10 1.503620475839316 53.18103315355333 0.0 3 0.9069467181531674 4.013930418116682 21459.0 34.92595346620772 0.0 - - - - - - - 729.2 42 10 PARP10 poly (ADP-ribose) polymerase family, member 10 905 116 B20140408_SF106_04 B20140408_SF106_04 TB378598.[MT7]-VVGDGASVDLLLLELYLENERR.4b6_1.heavy 655.113 / 643.353 21168.0 41.007999420166016 43 13 10 10 10 1.503620475839316 53.18103315355333 0.0 3 0.9069467181531674 4.013930418116682 21168.0 48.04529139937553 0.0 - - - - - - - 341.6 42 10 PARP10 poly (ADP-ribose) polymerase family, member 10 907 117 B20140408_SF106_04 B20140408_SF106_04 TB378101.[MT7]-SDGAPAEGK[MT7].2y4_1.heavy 560.298 / 548.316 2452.0 18.209400177001953 50 20 10 10 10 14.1666157901065 7.0588488797611575 0.0 3 0.9941357135026695 16.108025775895594 2452.0 8.292459250741956 1.0 - - - - - - - 320.9047619047619 4 21 THOC5 THO complex 5 909 117 B20140408_SF106_04 B20140408_SF106_04 TB378101.[MT7]-SDGAPAEGK[MT7].2y8_1.heavy 560.298 / 888.454 4888.0 18.209400177001953 50 20 10 10 10 14.1666157901065 7.0588488797611575 0.0 3 0.9941357135026695 16.108025775895594 4888.0 42.14663898411472 0.0 - - - - - - - 169.58333333333334 9 24 THOC5 THO complex 5 911 117 B20140408_SF106_04 B20140408_SF106_04 TB378101.[MT7]-SDGAPAEGK[MT7].2y5_1.heavy 560.298 / 645.369 34296.0 18.209400177001953 50 20 10 10 10 14.1666157901065 7.0588488797611575 0.0 3 0.9941357135026695 16.108025775895594 34296.0 131.34350312029798 0.0 - - - - - - - 299.8888888888889 68 18 THOC5 THO complex 5 913 117 B20140408_SF106_04 B20140408_SF106_04 TB378101.[MT7]-SDGAPAEGK[MT7].2y7_1.heavy 560.298 / 773.427 10825.0 18.209400177001953 50 20 10 10 10 14.1666157901065 7.0588488797611575 0.0 3 0.9941357135026695 16.108025775895594 10825.0 37.20062533929093 0.0 - - - - - - - 124.94736842105263 21 19 THOC5 THO complex 5 915 118 B20140408_SF106_04 B20140408_SF106_04 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 1020790.0 29.667233149210613 23 -3 10 6 10 null 0.0 0.03579902648925781 3 0.0 0.0 1020790.0 483.45696859808913 0.0 - - - - - - - 1820.6666666666667 2041 3 917 118 B20140408_SF106_04 B20140408_SF106_04 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 1085200.0 29.667233149210613 23 -3 10 6 10 null 0.0 0.03579902648925781 3 0.0 0.0 1085200.0 489.37261533601134 0.0 - - - - - - - 2223.0 2170 1 919 118 B20140408_SF106_04 B20140408_SF106_04 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1798890.0 29.667233149210613 23 -3 10 6 10 null 0.0 0.03579902648925781 3 0.0 0.0 1798890.0 558.0326903197331 0.0 - - - - - - - 4255.0 3597 1 921 119 B20140408_SF106_04 B20140408_SF106_04 TB378597.[MT7]-VVGDGASVDLLLLELYLENERR.3b6_1.heavy 873.149 / 643.353 8841.0 41.007999420166016 42 12 10 10 10 1.2552294010430327 47.100355239873565 0.0 3 0.8923331789880137 3.7268812243711436 8841.0 15.447983870967741 0.0 - - - - - - - 686.3846153846154 17 13 PARP10 poly (ADP-ribose) polymerase family, member 10 923 119 B20140408_SF106_04 B20140408_SF106_04 TB378597.[MT7]-VVGDGASVDLLLLELYLENERR.3b4_1.heavy 873.149 / 515.295 36189.0 41.007999420166016 42 12 10 10 10 1.2552294010430327 47.100355239873565 0.0 3 0.8923331789880137 3.7268812243711436 36189.0 42.43666052603158 0.0 - - - - - - - 351.0 72 4 PARP10 poly (ADP-ribose) polymerase family, member 10 925 119 B20140408_SF106_04 B20140408_SF106_04 TB378597.[MT7]-VVGDGASVDLLLLELYLENERR.3y13_2.heavy 873.149 / 837.483 15698.0 41.007999420166016 42 12 10 10 10 1.2552294010430327 47.100355239873565 0.0 3 0.8923331789880137 3.7268812243711436 15698.0 23.46880355574828 0.0 - - - - - - - 840.0 31 9 PARP10 poly (ADP-ribose) polymerase family, member 10 927 119 B20140408_SF106_04 B20140408_SF106_04 TB378597.[MT7]-VVGDGASVDLLLLELYLENERR.3y21_2.heavy 873.149 / 1187.63 26150.0 41.007999420166016 42 12 10 10 10 1.2552294010430327 47.100355239873565 0.0 3 0.8923331789880137 3.7268812243711436 26150.0 54.482205385640356 0.0 - - - - - - - 223.83333333333334 52 12 PARP10 poly (ADP-ribose) polymerase family, member 10 929 120 B20140408_SF106_04 B20140408_SF106_04 TB378609.[MT7]-HLPPPLYVLFVQATAYGQAC[CAM]DK[MT7].4y4_1.heavy 694.874 / 637.31 13503.0 41.294575691223145 42 16 10 6 10 8.984731692566687 11.12999290593538 0.036098480224609375 3 0.9613267583336818 6.255289576572996 13503.0 33.12973776041667 0.0 - - - - - - - 686.1428571428571 27 7 THOC5 THO complex 5 931 120 B20140408_SF106_04 B20140408_SF106_04 TB378609.[MT7]-HLPPPLYVLFVQATAYGQAC[CAM]DK[MT7].4b7_1.heavy 694.874 / 962.558 5118.0 41.294575691223145 42 16 10 6 10 8.984731692566687 11.12999290593538 0.036098480224609375 3 0.9613267583336818 6.255289576572996 5118.0 19.07526112019272 0.0 - - - - - - - 216.45 10 20 THOC5 THO complex 5 933 120 B20140408_SF106_04 B20140408_SF106_04 TB378609.[MT7]-HLPPPLYVLFVQATAYGQAC[CAM]DK[MT7].4y3_1.heavy 694.874 / 566.273 12480.0 41.294575691223145 42 16 10 6 10 8.984731692566687 11.12999290593538 0.036098480224609375 3 0.9613267583336818 6.255289576572996 12480.0 33.61944444444444 0.0 - - - - - - - 680.0909090909091 24 11 THOC5 THO complex 5 935 120 B20140408_SF106_04 B20140408_SF106_04 TB378609.[MT7]-HLPPPLYVLFVQATAYGQAC[CAM]DK[MT7].4b6_1.heavy 694.874 / 799.495 9448.0 41.294575691223145 42 16 10 6 10 8.984731692566687 11.12999290593538 0.036098480224609375 3 0.9613267583336818 6.255289576572996 9448.0 26.917481846060653 0.0 - - - - - - - 303.7142857142857 18 14 THOC5 THO complex 5