Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140408_SF107_03 B20140408_SF107_03 TB498075.[MT7]-LIDRENFVDIVDAK[MT7].3b9_2.heavy 645.698 / 623.831 472603.0 33.11289978027344 39 9 10 10 10 5.1486487171225885 19.42257192016913 0.0 3 0.8166611977822114 2.8370363796967846 472603.0 108.50620616246903 0.0 - - - - - - - 1353.0 945 2 C7orf44 chromosome 7 open reading frame 44 3 1 B20140408_SF107_03 B20140408_SF107_03 TB498075.[MT7]-LIDRENFVDIVDAK[MT7].3b9_1.heavy 645.698 / 1246.65 31800.0 33.11289978027344 39 9 10 10 10 5.1486487171225885 19.42257192016913 0.0 3 0.8166611977822114 2.8370363796967846 31800.0 104.68163582809646 0.0 - - - - - - - 281.6666666666667 63 9 C7orf44 chromosome 7 open reading frame 44 5 1 B20140408_SF107_03 B20140408_SF107_03 TB498075.[MT7]-LIDRENFVDIVDAK[MT7].3y4_1.heavy 645.698 / 576.347 175239.0 33.11289978027344 39 9 10 10 10 5.1486487171225885 19.42257192016913 0.0 3 0.8166611977822114 2.8370363796967846 175239.0 49.21098142116584 0.0 - - - - - - - 1099.5 350 2 C7orf44 chromosome 7 open reading frame 44 7 1 B20140408_SF107_03 B20140408_SF107_03 TB498075.[MT7]-LIDRENFVDIVDAK[MT7].3y5_1.heavy 645.698 / 689.431 94216.0 33.11289978027344 39 9 10 10 10 5.1486487171225885 19.42257192016913 0.0 3 0.8166611977822114 2.8370363796967846 94216.0 70.86634766972723 0.0 - - - - - - - 846.0 188 1 C7orf44 chromosome 7 open reading frame 44 9 2 B20140408_SF107_03 B20140408_SF107_03 TB498300.[MT7]-YFGTFFGLAAISLTAGAIK[MT7]K[MT7].4y5_1.heavy 627.87 / 804.555 21122.0 42.4109001159668 50 20 10 10 10 9.820904482055965 10.182361531232958 0.0 3 0.9951034523825565 17.629500493717362 21122.0 38.14099396363472 1.0 - - - - - - - 317.3 45 10 C9orf46 chromosome 9 open reading frame 46 11 2 B20140408_SF107_03 B20140408_SF107_03 TB498300.[MT7]-YFGTFFGLAAISLTAGAIK[MT7]K[MT7].4b7_1.heavy 627.87 / 964.469 53449.0 42.4109001159668 50 20 10 10 10 9.820904482055965 10.182361531232958 0.0 3 0.9951034523825565 17.629500493717362 53449.0 180.3353928526958 0.0 - - - - - - - 212.14285714285714 106 7 C9orf46 chromosome 9 open reading frame 46 13 2 B20140408_SF107_03 B20140408_SF107_03 TB498300.[MT7]-YFGTFFGLAAISLTAGAIK[MT7]K[MT7].4b5_1.heavy 627.87 / 760.379 31336.0 42.4109001159668 50 20 10 10 10 9.820904482055965 10.182361531232958 0.0 3 0.9951034523825565 17.629500493717362 31336.0 39.72348517244585 0.0 - - - - - - - 322.125 62 8 C9orf46 chromosome 9 open reading frame 46 15 2 B20140408_SF107_03 B20140408_SF107_03 TB498300.[MT7]-YFGTFFGLAAISLTAGAIK[MT7]K[MT7].4y7_1.heavy 627.87 / 976.639 13486.0 42.4109001159668 50 20 10 10 10 9.820904482055965 10.182361531232958 0.0 3 0.9951034523825565 17.629500493717362 13486.0 144.95300672430355 0.0 - - - - - - - 175.23076923076923 26 13 C9orf46 chromosome 9 open reading frame 46 17 3 B20140408_SF107_03 B20140408_SF107_03 TB498171.[MT7]-GIEDDLMDLIK[MT7].3b6_1.heavy 517.284 / 787.395 102563.0 39.377201080322266 43 13 10 10 10 1.9903831708558408 50.241582356728436 0.0 3 0.9110588709370899 4.107129076128945 102563.0 108.30451120179458 0.0 - - - - - - - 315.0 205 3 CPPED1 calcineurin-like phosphoesterase domain containing 1 19 3 B20140408_SF107_03 B20140408_SF107_03 TB498171.[MT7]-GIEDDLMDLIK[MT7].3b4_1.heavy 517.284 / 559.284 47368.0 39.377201080322266 43 13 10 10 10 1.9903831708558408 50.241582356728436 0.0 3 0.9110588709370899 4.107129076128945 47368.0 76.03042015969585 0.0 - - - - - - - 405.0 94 3 CPPED1 calcineurin-like phosphoesterase domain containing 1 21 3 B20140408_SF107_03 B20140408_SF107_03 TB498171.[MT7]-GIEDDLMDLIK[MT7].3b5_1.heavy 517.284 / 674.311 112955.0 39.377201080322266 43 13 10 10 10 1.9903831708558408 50.241582356728436 0.0 3 0.9110588709370899 4.107129076128945 112955.0 90.92295232534381 0.0 - - - - - - - 135.0 225 1 CPPED1 calcineurin-like phosphoesterase domain containing 1 23 3 B20140408_SF107_03 B20140408_SF107_03 TB498171.[MT7]-GIEDDLMDLIK[MT7].3b8_1.heavy 517.284 / 1033.46 20243.0 39.377201080322266 43 13 10 10 10 1.9903831708558408 50.241582356728436 0.0 3 0.9110588709370899 4.107129076128945 20243.0 30.316336062027887 0.0 - - - - - - - 297.0 40 5 CPPED1 calcineurin-like phosphoesterase domain containing 1 25 4 B20140408_SF107_03 B20140408_SF107_03 TB498076.[MT7]-YVFGFELK[MT7].2y5_1.heavy 645.87 / 737.431 49543.0 36.617000579833984 50 20 10 10 10 11.204875130755534 8.92468669512581 0.0 3 0.9968324171105526 21.922176514454836 49543.0 66.56476156863769 0.0 - - - - - - - 345.0 99 7 MAGEF1 melanoma antigen family F, 1 27 4 B20140408_SF107_03 B20140408_SF107_03 TB498076.[MT7]-YVFGFELK[MT7].2y3_1.heavy 645.87 / 533.341 16246.0 36.617000579833984 50 20 10 10 10 11.204875130755534 8.92468669512581 0.0 3 0.9968324171105526 21.922176514454836 16246.0 9.844476319510832 0.0 - - - - - - - 483.0 32 1 MAGEF1 melanoma antigen family F, 1 29 4 B20140408_SF107_03 B20140408_SF107_03 TB498076.[MT7]-YVFGFELK[MT7].2y6_1.heavy 645.87 / 884.5 55333.0 36.617000579833984 50 20 10 10 10 11.204875130755534 8.92468669512581 0.0 3 0.9968324171105526 21.922176514454836 55333.0 117.00460005318334 0.0 - - - - - - - 395.1818181818182 110 11 MAGEF1 melanoma antigen family F, 1 31 4 B20140408_SF107_03 B20140408_SF107_03 TB498076.[MT7]-YVFGFELK[MT7].2y7_1.heavy 645.87 / 983.568 35066.0 36.617000579833984 50 20 10 10 10 11.204875130755534 8.92468669512581 0.0 3 0.9968324171105526 21.922176514454836 35066.0 34.12256851417648 0.0 - - - - - - - 214.66666666666666 70 6 MAGEF1 melanoma antigen family F, 1 33 5 B20140408_SF107_03 B20140408_SF107_03 TB498077.[MT7]-LLQQLFLK[MT7].2y4_1.heavy 645.923 / 664.451 31804.0 37.78969955444336 50 20 10 10 10 4.260682716999917 18.68437317950845 0.0 3 0.9929000538120429 14.637858695919242 31804.0 36.594388094497035 0.0 - - - - - - - 385.75 63 4 BCCIP BRCA2 and CDKN1A interacting protein 35 5 B20140408_SF107_03 B20140408_SF107_03 TB498077.[MT7]-LLQQLFLK[MT7].2b4_1.heavy 645.923 / 627.395 28562.0 37.78969955444336 50 20 10 10 10 4.260682716999917 18.68437317950845 0.0 3 0.9929000538120429 14.637858695919242 28562.0 31.859575498697673 0.0 - - - - - - - 386.0 57 2 BCCIP BRCA2 and CDKN1A interacting protein 37 5 B20140408_SF107_03 B20140408_SF107_03 TB498077.[MT7]-LLQQLFLK[MT7].2y3_1.heavy 645.923 / 551.367 40913.0 37.78969955444336 50 20 10 10 10 4.260682716999917 18.68437317950845 0.0 3 0.9929000538120429 14.637858695919242 40913.0 28.001316511900843 0.0 - - - - - - - 270.25 81 4 BCCIP BRCA2 and CDKN1A interacting protein 39 5 B20140408_SF107_03 B20140408_SF107_03 TB498077.[MT7]-LLQQLFLK[MT7].2b5_1.heavy 645.923 / 740.479 19144.0 37.78969955444336 50 20 10 10 10 4.260682716999917 18.68437317950845 0.0 3 0.9929000538120429 14.637858695919242 19144.0 18.897804748946957 0.0 - - - - - - - 328.0 38 8 BCCIP BRCA2 and CDKN1A interacting protein 41 6 B20140408_SF107_03 B20140408_SF107_03 TB377443.[MT7]-HYDSIAEK[MT7].3y3_1.heavy 417.559 / 491.295 313676.0 21.78219985961914 45 17 10 10 8 3.298449551813355 30.3172743524375 0.0 4 0.9747406893511897 7.7487775721155945 313676.0 65.4451018603196 1.0 - - - - - - - 929.0 653 1 AP1AR adaptor-related protein complex 1 associated regulatory protein 43 6 B20140408_SF107_03 B20140408_SF107_03 TB377443.[MT7]-HYDSIAEK[MT7].3b4_1.heavy 417.559 / 647.291 96366.0 21.78219985961914 45 17 10 10 8 3.298449551813355 30.3172743524375 0.0 4 0.9747406893511897 7.7487775721155945 96366.0 112.78817677694059 0.0 - - - - - - - 1194.4285714285713 192 7 AP1AR adaptor-related protein complex 1 associated regulatory protein 45 6 B20140408_SF107_03 B20140408_SF107_03 TB377443.[MT7]-HYDSIAEK[MT7].3b3_1.heavy 417.559 / 560.258 62921.0 21.78219985961914 45 17 10 10 8 3.298449551813355 30.3172743524375 0.0 4 0.9747406893511897 7.7487775721155945 62921.0 49.27026265961093 0.0 - - - - - - - 1698.5555555555557 125 9 AP1AR adaptor-related protein complex 1 associated regulatory protein 47 6 B20140408_SF107_03 B20140408_SF107_03 TB377443.[MT7]-HYDSIAEK[MT7].3y3_2.heavy 417.559 / 246.151 23902.0 21.78219985961914 45 17 10 10 8 3.298449551813355 30.3172743524375 0.0 4 0.9747406893511897 7.7487775721155945 23902.0 5.3097935482008785 3.0 - - - - - - - 1774.0 209 1 AP1AR adaptor-related protein complex 1 associated regulatory protein 49 7 B20140408_SF107_03 B20140408_SF107_03 TB498178.[MT7]-AIDIYEQVGTNAMDSPLLK[MT7].3b6_1.heavy 789.422 / 849.447 43426.0 36.075401306152344 47 17 10 10 10 2.7041460306156653 31.635687826695513 0.0 3 0.971254634727 7.261604609045566 43426.0 36.600212116152775 0.0 - - - - - - - 325.5 86 2 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 51 7 B20140408_SF107_03 B20140408_SF107_03 TB498178.[MT7]-AIDIYEQVGTNAMDSPLLK[MT7].3b4_1.heavy 789.422 / 557.341 104579.0 36.075401306152344 47 17 10 10 10 2.7041460306156653 31.635687826695513 0.0 3 0.971254634727 7.261604609045566 104579.0 75.56681820522259 0.0 - - - - - - - 1742.4285714285713 209 7 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 53 7 B20140408_SF107_03 B20140408_SF107_03 TB498178.[MT7]-AIDIYEQVGTNAMDSPLLK[MT7].3b5_1.heavy 789.422 / 720.405 63919.0 36.075401306152344 47 17 10 10 10 2.7041460306156653 31.635687826695513 0.0 3 0.971254634727 7.261604609045566 63919.0 51.301109972677594 0.0 - - - - - - - 325.0 127 1 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 55 7 B20140408_SF107_03 B20140408_SF107_03 TB498178.[MT7]-AIDIYEQVGTNAMDSPLLK[MT7].3y4_1.heavy 789.422 / 614.436 85550.0 36.075401306152344 47 17 10 10 10 2.7041460306156653 31.635687826695513 0.0 3 0.971254634727 7.261604609045566 85550.0 57.056776096296474 0.0 - - - - - - - 406.5 171 2 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 57 8 B20140408_SF107_03 B20140408_SF107_03 TB240251.[MT7]-NSQSFFSGLFGGSSK[MT7]IEEAC[CAM]EIYAR.4b8_1.heavy 768.88 / 999.465 17598.0 37.36130142211914 39 9 10 10 10 1.4638817437609881 54.16192374143694 0.0 3 0.8075216431199249 2.7665954447861023 17598.0 62.93753517369015 0.0 - - - - - - - 255.125 35 8 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 59 8 B20140408_SF107_03 B20140408_SF107_03 TB240251.[MT7]-NSQSFFSGLFGGSSK[MT7]IEEAC[CAM]EIYAR.4y15_2.heavy 768.88 / 907.447 46038.0 37.36130142211914 39 9 10 10 10 1.4638817437609881 54.16192374143694 0.0 3 0.8075216431199249 2.7665954447861023 46038.0 43.26084919640958 0.0 - - - - - - - 287.8333333333333 92 6 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 61 8 B20140408_SF107_03 B20140408_SF107_03 TB240251.[MT7]-NSQSFFSGLFGGSSK[MT7]IEEAC[CAM]EIYAR.4b4_1.heavy 768.88 / 561.275 15398.0 37.36130142211914 39 9 10 10 10 1.4638817437609881 54.16192374143694 0.0 3 0.8075216431199249 2.7665954447861023 15398.0 12.773894026255853 0.0 - - - - - - - 786.0 30 8 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 63 8 B20140408_SF107_03 B20140408_SF107_03 TB240251.[MT7]-NSQSFFSGLFGGSSK[MT7]IEEAC[CAM]EIYAR.4b5_1.heavy 768.88 / 708.343 25769.0 37.36130142211914 39 9 10 10 10 1.4638817437609881 54.16192374143694 0.0 3 0.8075216431199249 2.7665954447861023 25769.0 22.65868207815855 0.0 - - - - - - - 471.0 51 3 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 65 9 B20140408_SF107_03 B20140408_SF107_03 TB240252.[MT7]-DTLVHLFAGGC[CAM]GGTVGAILTC[CAM]PLEVVK[MT7].4b4_1.heavy 768.917 / 573.336 21737.0 39.819698333740234 36 8 10 10 8 0.6525157892122646 78.05017096417424 0.0 4 0.75125217789076 2.4212466597854783 21737.0 19.006185257068584 0.0 - - - - - - - 848.8333333333334 43 6 SLC25A36 solute carrier family 25, member 36 67 9 B20140408_SF107_03 B20140408_SF107_03 TB240252.[MT7]-DTLVHLFAGGC[CAM]GGTVGAILTC[CAM]PLEVVK[MT7].4b5_1.heavy 768.917 / 710.395 13788.0 39.819698333740234 36 8 10 10 8 0.6525157892122646 78.05017096417424 0.0 4 0.75125217789076 2.4212466597854783 13788.0 18.87035271659238 1.0 - - - - - - - 1366.2857142857142 39 7 SLC25A36 solute carrier family 25, member 36 69 9 B20140408_SF107_03 B20140408_SF107_03 TB240252.[MT7]-DTLVHLFAGGC[CAM]GGTVGAILTC[CAM]PLEVVK[MT7].4y6_1.heavy 768.917 / 828.531 63845.0 39.819698333740234 36 8 10 10 8 0.6525157892122646 78.05017096417424 0.0 4 0.75125217789076 2.4212466597854783 63845.0 123.03380020615865 0.0 - - - - - - - 1295.4285714285713 127 7 SLC25A36 solute carrier family 25, member 36 71 9 B20140408_SF107_03 B20140408_SF107_03 TB240252.[MT7]-DTLVHLFAGGC[CAM]GGTVGAILTC[CAM]PLEVVK[MT7].4b6_1.heavy 768.917 / 823.479 12918.0 39.819698333740234 36 8 10 10 8 0.6525157892122646 78.05017096417424 0.0 4 0.75125217789076 2.4212466597854783 12918.0 11.763707402821703 1.0 - - - - - - - 869.2857142857143 26 7 SLC25A36 solute carrier family 25, member 36 73 10 B20140408_SF107_03 B20140408_SF107_03 TB498071.[MT7]-QLIMQSEMR.2y8_1.heavy 640.335 / 1007.5 25907.0 28.365699768066406 48 18 10 10 10 4.047003361835825 19.891200770918445 0.0 3 0.9867534793318397 10.711021299848703 25907.0 42.82485831234257 0.0 - - - - - - - 372.5 51 6 C9orf46 chromosome 9 open reading frame 46 75 10 B20140408_SF107_03 B20140408_SF107_03 TB498071.[MT7]-QLIMQSEMR.2b4_1.heavy 640.335 / 630.377 7891.0 28.365699768066406 48 18 10 10 10 4.047003361835825 19.891200770918445 0.0 3 0.9867534793318397 10.711021299848703 7891.0 1.8092890575728742 3.0 - - - - - - - 149.0 22 1 C9orf46 chromosome 9 open reading frame 46 77 10 B20140408_SF107_03 B20140408_SF107_03 TB498071.[MT7]-QLIMQSEMR.2y6_1.heavy 640.335 / 781.333 28140.0 28.365699768066406 48 18 10 10 10 4.047003361835825 19.891200770918445 0.0 3 0.9867534793318397 10.711021299848703 28140.0 27.125844913984604 0.0 - - - - - - - 298.0 56 5 C9orf46 chromosome 9 open reading frame 46 79 10 B20140408_SF107_03 B20140408_SF107_03 TB498071.[MT7]-QLIMQSEMR.2y7_1.heavy 640.335 / 894.417 17718.0 28.365699768066406 48 18 10 10 10 4.047003361835825 19.891200770918445 0.0 3 0.9867534793318397 10.711021299848703 17718.0 15.613570057581574 1.0 - - - - - - - 238.4 35 5 C9orf46 chromosome 9 open reading frame 46 81 11 B20140408_SF107_03 B20140408_SF107_03 TB498072.[MT7]-MEVLGFVAK[MT7].2b3_1.heavy 641.378 / 504.261 30016.0 34.58530044555664 47 17 10 10 10 3.352410089107063 24.981993512162926 0.0 3 0.9756367402055298 7.890580789793282 30016.0 26.45379349675014 0.0 - - - - - - - 1121.857142857143 60 7 MAGEF1 melanoma antigen family F, 1 83 11 B20140408_SF107_03 B20140408_SF107_03 TB498072.[MT7]-MEVLGFVAK[MT7].2y5_1.heavy 641.378 / 665.41 31936.0 34.58530044555664 47 17 10 10 10 3.352410089107063 24.981993512162926 0.0 3 0.9756367402055298 7.890580789793282 31936.0 79.7841177628557 0.0 - - - - - - - 291.0 63 3 MAGEF1 melanoma antigen family F, 1 85 11 B20140408_SF107_03 B20140408_SF107_03 TB498072.[MT7]-MEVLGFVAK[MT7].2y6_1.heavy 641.378 / 778.494 13263.0 34.58530044555664 47 17 10 10 10 3.352410089107063 24.981993512162926 0.0 3 0.9756367402055298 7.890580789793282 13263.0 1.5450793895932042 2.0 - - - - - - - 314.2 36 5 MAGEF1 melanoma antigen family F, 1 87 11 B20140408_SF107_03 B20140408_SF107_03 TB498072.[MT7]-MEVLGFVAK[MT7].2b5_1.heavy 641.378 / 674.366 8726.0 34.58530044555664 47 17 10 10 10 3.352410089107063 24.981993512162926 0.0 3 0.9756367402055298 7.890580789793282 8726.0 14.621520987800196 0.0 - - - - - - - 218.5 63 4 MAGEF1 melanoma antigen family F, 1 89 12 B20140408_SF107_03 B20140408_SF107_03 TB498176.[MT7]-IIEAMGFTGPLK[MT7].3y3_1.heavy 522.305 / 501.352 135763.0 35.767398834228516 43 13 10 10 10 1.5334084312718061 44.50798560256516 0.0 3 0.919052902852255 4.308118940129905 135763.0 111.41433433580634 0.0 - - - - - - - 497.0 271 1 UQCC ubiquinol-cytochrome c reductase complex chaperone 91 12 B20140408_SF107_03 B20140408_SF107_03 TB498176.[MT7]-IIEAMGFTGPLK[MT7].3b4_1.heavy 522.305 / 571.357 99173.0 35.767398834228516 43 13 10 10 10 1.5334084312718061 44.50798560256516 0.0 3 0.919052902852255 4.308118940129905 99173.0 93.63825705862668 0.0 - - - - - - - 1308.2 198 10 UQCC ubiquinol-cytochrome c reductase complex chaperone 93 12 B20140408_SF107_03 B20140408_SF107_03 TB498176.[MT7]-IIEAMGFTGPLK[MT7].3y4_1.heavy 522.305 / 558.373 112584.0 35.767398834228516 43 13 10 10 10 1.5334084312718061 44.50798560256516 0.0 3 0.919052902852255 4.308118940129905 112584.0 27.653349379233365 0.0 - - - - - - - 1303.875 225 8 UQCC ubiquinol-cytochrome c reductase complex chaperone 95 12 B20140408_SF107_03 B20140408_SF107_03 TB498176.[MT7]-IIEAMGFTGPLK[MT7].3b3_1.heavy 522.305 / 500.32 56292.0 35.767398834228516 43 13 10 10 10 1.5334084312718061 44.50798560256516 0.0 3 0.919052902852255 4.308118940129905 56292.0 37.10973041904424 1.0 - - - - - - - 882.6666666666666 263 3 UQCC ubiquinol-cytochrome c reductase complex chaperone 97 13 B20140408_SF107_03 B20140408_SF107_03 TB377667.[MT7]-LC[CAM]SALTLSGLVEVK[MT7].2b3_1.heavy 889.52 / 505.256 2913.0 36.7906494140625 37 12 10 5 10 0.8409150679330305 72.15698472426621 0.04949951171875 3 0.8886956036074454 3.6643179771932366 2913.0 7.126509149585077 0.0 - - - - - - - 292.90909090909093 5 11 CIAPIN1 cytokine induced apoptosis inhibitor 1 99 13 B20140408_SF107_03 B20140408_SF107_03 TB377667.[MT7]-LC[CAM]SALTLSGLVEVK[MT7].2y9_1.heavy 889.52 / 1089.66 7512.0 36.7906494140625 37 12 10 5 10 0.8409150679330305 72.15698472426621 0.04949951171875 3 0.8886956036074454 3.6643179771932366 7512.0 21.029426903236775 0.0 - - - - - - - 306.6666666666667 15 12 CIAPIN1 cytokine induced apoptosis inhibitor 1 101 13 B20140408_SF107_03 B20140408_SF107_03 TB377667.[MT7]-LC[CAM]SALTLSGLVEVK[MT7].2b4_1.heavy 889.52 / 576.293 5366.0 36.7906494140625 37 12 10 5 10 0.8409150679330305 72.15698472426621 0.04949951171875 3 0.8886956036074454 3.6643179771932366 5366.0 1.8414130434782605 2.0 - - - - - - - 747.625 10 8 CIAPIN1 cytokine induced apoptosis inhibitor 1 103 13 B20140408_SF107_03 B20140408_SF107_03 TB377667.[MT7]-LC[CAM]SALTLSGLVEVK[MT7].2b5_1.heavy 889.52 / 689.377 9812.0 36.7906494140625 37 12 10 5 10 0.8409150679330305 72.15698472426621 0.04949951171875 3 0.8886956036074454 3.6643179771932366 9812.0 8.832720156555773 0.0 - - - - - - - 328.7142857142857 19 7 CIAPIN1 cytokine induced apoptosis inhibitor 1 105 14 B20140408_SF107_03 B20140408_SF107_03 TB239621.[MT7]-GGGFGAHGR.2y8_1.heavy 480.25 / 758.369 6122.0 18.796300888061523 28 8 0 10 10 0.8982112342791834 70.78772728796096 0.0 3 0.7591567291698506 2.4624424151731428 6122.0 35.38855378428838 0.0 - - - - - - - 769.1428571428571 12 7 RBM3 RNA binding motif (RNP1, RRM) protein 3 107 14 B20140408_SF107_03 B20140408_SF107_03 TB239621.[MT7]-GGGFGAHGR.2b6_1.heavy 480.25 / 591.301 N/A 18.796300888061523 28 8 0 10 10 0.8982112342791834 70.78772728796096 0.0 3 0.7591567291698506 2.4624424151731428 4908.0 4.384559055849828 9.0 - - - - - - - 701.8 131 10 RBM3 RNA binding motif (RNP1, RRM) protein 3 109 14 B20140408_SF107_03 B20140408_SF107_03 TB239621.[MT7]-GGGFGAHGR.2b5_1.heavy 480.25 / 520.264 2797.0 18.796300888061523 28 8 0 10 10 0.8982112342791834 70.78772728796096 0.0 3 0.7591567291698506 2.4624424151731428 2797.0 7.128310479562121 2.0 - - - - - - - 643.0909090909091 5 11 RBM3 RNA binding motif (RNP1, RRM) protein 3 111 14 B20140408_SF107_03 B20140408_SF107_03 TB239621.[MT7]-GGGFGAHGR.2y7_1.heavy 480.25 / 701.348 2217.0 18.796300888061523 28 8 0 10 10 0.8982112342791834 70.78772728796096 0.0 3 0.7591567291698506 2.4624424151731428 2217.0 2.948098459511503 2.0 - - - - - - - 214.05555555555554 4 18 RBM3 RNA binding motif (RNP1, RRM) protein 3 113 15 B20140408_SF107_03 B20140408_SF107_03 TB240257.[MT7]-NAGGTYQNLDMVVSSAIGC[CAM]QLGRDPHGLR.4y5_1.heavy 808.403 / 579.336 33033.0 35.33340072631836 44 14 10 10 10 1.6800338240425026 49.31821401742144 0.0 3 0.9365814390069526 4.8745196097541275 33033.0 38.10819716377193 0.0 - - - - - - - 339.0 66 3 CPPED1 calcineurin-like phosphoesterase domain containing 1 115 15 B20140408_SF107_03 B20140408_SF107_03 TB240257.[MT7]-NAGGTYQNLDMVVSSAIGC[CAM]QLGRDPHGLR.4b7_1.heavy 808.403 / 836.402 11180.0 35.33340072631836 44 14 10 10 10 1.6800338240425026 49.31821401742144 0.0 3 0.9365814390069526 4.8745196097541275 11180.0 27.004733914595782 0.0 - - - - - - - 677.7142857142857 22 7 CPPED1 calcineurin-like phosphoesterase domain containing 1 117 15 B20140408_SF107_03 B20140408_SF107_03 TB240257.[MT7]-NAGGTYQNLDMVVSSAIGC[CAM]QLGRDPHGLR.4b5_1.heavy 808.403 / 545.28 14568.0 35.33340072631836 44 14 10 10 10 1.6800338240425026 49.31821401742144 0.0 3 0.9365814390069526 4.8745196097541275 14568.0 21.11481696247121 0.0 - - - - - - - 677.75 29 8 CPPED1 calcineurin-like phosphoesterase domain containing 1 119 15 B20140408_SF107_03 B20140408_SF107_03 TB240257.[MT7]-NAGGTYQNLDMVVSSAIGC[CAM]QLGRDPHGLR.4y17_2.heavy 808.403 / 911.971 23038.0 35.33340072631836 44 14 10 10 10 1.6800338240425026 49.31821401742144 0.0 3 0.9365814390069526 4.8745196097541275 23038.0 34.458651591400994 0.0 - - - - - - - 339.0 46 2 CPPED1 calcineurin-like phosphoesterase domain containing 1 121 16 B20140408_SF107_03 B20140408_SF107_03 TB239827.[MT7]-VNIIPIIAK[MT7].2y8_1.heavy 634.931 / 1025.68 42360.0 34.6775016784668 44 14 10 10 10 2.6100529909751176 38.31339836615345 0.0 3 0.9392023646142392 4.9795917746713645 42360.0 134.88391933745004 0.0 - - - - - - - 232.33333333333334 84 9 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 123 16 B20140408_SF107_03 B20140408_SF107_03 TB239827.[MT7]-VNIIPIIAK[MT7].2y5_1.heavy 634.931 / 685.473 436323.0 34.6775016784668 44 14 10 10 10 2.6100529909751176 38.31339836615345 0.0 3 0.9392023646142392 4.9795917746713645 436323.0 216.45586840363583 0.0 - - - - - - - 349.0 872 1 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 125 16 B20140408_SF107_03 B20140408_SF107_03 TB239827.[MT7]-VNIIPIIAK[MT7].2b4_1.heavy 634.931 / 584.389 302619.0 34.6775016784668 44 14 10 10 10 2.6100529909751176 38.31339836615345 0.0 3 0.9392023646142392 4.9795917746713645 302619.0 213.33971598626593 0.0 - - - - - - - 697.0 605 1 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 127 16 B20140408_SF107_03 B20140408_SF107_03 TB239827.[MT7]-VNIIPIIAK[MT7].2y6_1.heavy 634.931 / 798.557 88032.0 34.6775016784668 44 14 10 10 10 2.6100529909751176 38.31339836615345 0.0 3 0.9392023646142392 4.9795917746713645 88032.0 45.26557070872288 1.0 - - - - - - - 566.5 185 4 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 129 17 B20140408_SF107_03 B20140408_SF107_03 TB377668.[MT7]-LC[CAM]SALTLSGLVEVK[MT7].3y3_1.heavy 593.349 / 519.326 96742.0 36.765899658203125 39 9 10 10 10 0.6738468654993054 85.15621780171608 0.0 3 0.8197684745355509 2.862182250598225 96742.0 44.79739976614759 0.0 - - - - - - - 409.0 193 3 CIAPIN1 cytokine induced apoptosis inhibitor 1 131 17 B20140408_SF107_03 B20140408_SF107_03 TB377668.[MT7]-LC[CAM]SALTLSGLVEVK[MT7].3b4_1.heavy 593.349 / 576.293 41702.0 36.765899658203125 39 9 10 10 10 0.6738468654993054 85.15621780171608 0.0 3 0.8197684745355509 2.862182250598225 41702.0 26.834966551150472 0.0 - - - - - - - 358.0 83 3 CIAPIN1 cytokine induced apoptosis inhibitor 1 133 17 B20140408_SF107_03 B20140408_SF107_03 TB377668.[MT7]-LC[CAM]SALTLSGLVEVK[MT7].3b5_1.heavy 593.349 / 689.377 39249.0 36.765899658203125 39 9 10 10 10 0.6738468654993054 85.15621780171608 0.0 3 0.8197684745355509 2.862182250598225 39249.0 40.625157055030684 0.0 - - - - - - - 230.0 78 2 CIAPIN1 cytokine induced apoptosis inhibitor 1 135 17 B20140408_SF107_03 B20140408_SF107_03 TB377668.[MT7]-LC[CAM]SALTLSGLVEVK[MT7].3y4_1.heavy 593.349 / 618.394 74358.0 36.765899658203125 39 9 10 10 10 0.6738468654993054 85.15621780171608 0.0 3 0.8197684745355509 2.862182250598225 74358.0 35.347882496524726 0.0 - - - - - - - 153.0 148 2 CIAPIN1 cytokine induced apoptosis inhibitor 1 137 18 B20140408_SF107_03 B20140408_SF107_03 TB240051.[MT7]-RLPTHTQLADTSK[MT7].4y4_1.heavy 439.754 / 594.321 99763.0 22.09687566757202 37 11 10 6 10 0.9897086016270698 61.90180070969441 0.03989982604980469 3 0.8543652601899712 3.1938353414162473 99763.0 92.20288813044019 0.0 - - - - - - - 355.5 199 2 C6orf142 chromosome 6 open reading frame 142 139 18 B20140408_SF107_03 B20140408_SF107_03 TB240051.[MT7]-RLPTHTQLADTSK[MT7].4b7_2.heavy 439.754 / 489.784 211696.0 22.09687566757202 37 11 10 6 10 0.9897086016270698 61.90180070969441 0.03989982604980469 3 0.8543652601899712 3.1938353414162473 211696.0 121.97956733696815 0.0 - - - - - - - 399.5 423 2 C6orf142 chromosome 6 open reading frame 142 141 18 B20140408_SF107_03 B20140408_SF107_03 TB240051.[MT7]-RLPTHTQLADTSK[MT7].4b4_1.heavy 439.754 / 612.395 11460.0 22.09687566757202 37 11 10 6 10 0.9897086016270698 61.90180070969441 0.03989982604980469 3 0.8543652601899712 3.1938353414162473 11460.0 26.44389568311402 0.0 - - - - - - - 743.1818181818181 22 11 C6orf142 chromosome 6 open reading frame 142 143 18 B20140408_SF107_03 B20140408_SF107_03 TB240051.[MT7]-RLPTHTQLADTSK[MT7].4y3_1.heavy 439.754 / 479.295 88303.0 22.09687566757202 37 11 10 6 10 0.9897086016270698 61.90180070969441 0.03989982604980469 3 0.8543652601899712 3.1938353414162473 88303.0 49.46593439833467 0.0 - - - - - - - 355.5 176 2 C6orf142 chromosome 6 open reading frame 142 145 19 B20140408_SF107_03 B20140408_SF107_03 TB239824.[MT7]-ELQPLTFNR.2b3_1.heavy 631.355 / 515.295 68793.0 30.56220054626465 44 14 10 10 10 1.259807953247764 52.06326702881183 0.0 3 0.9348269909089377 4.80774133162866 68793.0 27.01363082147729 0.0 - - - - - - - 469.0 137 1 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 147 19 B20140408_SF107_03 B20140408_SF107_03 TB239824.[MT7]-ELQPLTFNR.2y8_1.heavy 631.355 / 988.557 22201.0 30.56220054626465 44 14 10 10 10 1.259807953247764 52.06326702881183 0.0 3 0.9348269909089377 4.80774133162866 22201.0 27.54913118257793 0.0 - - - - - - - 714.5714285714286 44 7 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 149 19 B20140408_SF107_03 B20140408_SF107_03 TB239824.[MT7]-ELQPLTFNR.2y6_1.heavy 631.355 / 747.415 83333.0 30.56220054626465 44 14 10 10 10 1.259807953247764 52.06326702881183 0.0 3 0.9348269909089377 4.80774133162866 83333.0 81.82544688241728 0.0 - - - - - - - 313.0 166 2 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 151 19 B20140408_SF107_03 B20140408_SF107_03 TB239824.[MT7]-ELQPLTFNR.2y7_1.heavy 631.355 / 875.473 15009.0 30.56220054626465 44 14 10 10 10 1.259807953247764 52.06326702881183 0.0 3 0.9348269909089377 4.80774133162866 15009.0 19.81164772233386 0.0 - - - - - - - 767.4545454545455 30 11 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 153 20 B20140408_SF107_03 B20140408_SF107_03 TB377305.[MT7]-SIVYGVK[MT7].2y4_1.heavy 527.331 / 610.368 77789.0 27.04640007019043 41 11 10 10 10 0.691882378547048 75.25312078909914 0.0 3 0.8600231871716135 3.2593659819356033 77789.0 74.96355906016385 0.0 - - - - - - - 292.0 155 1 C19orf66 chromosome 19 open reading frame 66 155 20 B20140408_SF107_03 B20140408_SF107_03 TB377305.[MT7]-SIVYGVK[MT7].2y5_1.heavy 527.331 / 709.437 94427.0 27.04640007019043 41 11 10 10 10 0.691882378547048 75.25312078909914 0.0 3 0.8600231871716135 3.2593659819356033 94427.0 17.325349753235066 0.0 - - - - - - - 3357.0 188 1 C19orf66 chromosome 19 open reading frame 66 157 20 B20140408_SF107_03 B20140408_SF107_03 TB377305.[MT7]-SIVYGVK[MT7].2y3_1.heavy 527.331 / 447.305 42470.0 27.04640007019043 41 11 10 10 10 0.691882378547048 75.25312078909914 0.0 3 0.8600231871716135 3.2593659819356033 42470.0 22.003224323743943 0.0 - - - - - - - 146.0 84 1 C19orf66 chromosome 19 open reading frame 66 159 20 B20140408_SF107_03 B20140408_SF107_03 TB377305.[MT7]-SIVYGVK[MT7].2y6_1.heavy 527.331 / 822.521 16638.0 27.04640007019043 41 11 10 10 10 0.691882378547048 75.25312078909914 0.0 3 0.8600231871716135 3.2593659819356033 16638.0 48.147636986301364 0.0 - - - - - - - 243.33333333333334 33 9 C19orf66 chromosome 19 open reading frame 66 161 21 B20140408_SF107_03 B20140408_SF107_03 TB498207.[MT7]-QQTEELC[CAM]ATIDK[MT7].3b6_1.heavy 575.297 / 873.443 44750.0 26.733299255371094 45 15 10 10 10 3.6583329873664923 21.27798326668462 0.0 3 0.9596064869284393 6.119750531034087 44750.0 70.56794437279426 0.0 - - - - - - - 301.72727272727275 89 11 C6orf142 chromosome 6 open reading frame 142 163 21 B20140408_SF107_03 B20140408_SF107_03 TB498207.[MT7]-QQTEELC[CAM]ATIDK[MT7].3b4_1.heavy 575.297 / 631.317 40564.0 26.733299255371094 45 15 10 10 10 3.6583329873664923 21.27798326668462 0.0 3 0.9596064869284393 6.119750531034087 40564.0 16.52941112990922 0.0 - - - - - - - 794.0 81 2 C6orf142 chromosome 6 open reading frame 142 165 21 B20140408_SF107_03 B20140408_SF107_03 TB498207.[MT7]-QQTEELC[CAM]ATIDK[MT7].3b5_1.heavy 575.297 / 760.359 114185.0 26.733299255371094 45 15 10 10 10 3.6583329873664923 21.27798326668462 0.0 3 0.9596064869284393 6.119750531034087 114185.0 96.78517377007697 0.0 - - - - - - - 289.0 228 2 C6orf142 chromosome 6 open reading frame 142 167 21 B20140408_SF107_03 B20140408_SF107_03 TB498207.[MT7]-QQTEELC[CAM]ATIDK[MT7].3y4_1.heavy 575.297 / 620.374 63083.0 26.733299255371094 45 15 10 10 10 3.6583329873664923 21.27798326668462 0.0 3 0.9596064869284393 6.119750531034087 63083.0 46.046675381844175 0.0 - - - - - - - 144.0 126 1 C6orf142 chromosome 6 open reading frame 142 169 22 B20140408_SF107_03 B20140408_SF107_03 TB240050.[MT7]-TIPSNLLDELQLPR.2y8_1.heavy 877.002 / 983.552 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC22A14 solute carrier family 22, member 14 171 22 B20140408_SF107_03 B20140408_SF107_03 TB240050.[MT7]-TIPSNLLDELQLPR.2y5_1.heavy 877.002 / 626.398 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC22A14 solute carrier family 22, member 14 173 22 B20140408_SF107_03 B20140408_SF107_03 TB240050.[MT7]-TIPSNLLDELQLPR.2y6_1.heavy 877.002 / 755.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC22A14 solute carrier family 22, member 14 175 22 B20140408_SF107_03 B20140408_SF107_03 TB240050.[MT7]-TIPSNLLDELQLPR.2y7_1.heavy 877.002 / 870.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC22A14 solute carrier family 22, member 14 177 23 B20140408_SF107_03 B20140408_SF107_03 TB240255.[MT7]-LAVEQLQSHPEAQEALGPPLNIHYLK[MT7].4y8_1.heavy 796.691 / 1141.69 5027.0 32.68454933166504 36 13 10 3 10 0.9780082926459045 58.670145199388124 0.050701141357421875 3 0.9017693122153521 3.9049715643093093 5027.0 13.393677600269505 0.0 - - - - - - - 607.625 10 8 C7orf44 chromosome 7 open reading frame 44 179 23 B20140408_SF107_03 B20140408_SF107_03 TB240255.[MT7]-LAVEQLQSHPEAQEALGPPLNIHYLK[MT7].4b4_1.heavy 796.691 / 557.341 8211.0 32.68454933166504 36 13 10 3 10 0.9780082926459045 58.670145199388124 0.050701141357421875 3 0.9017693122153521 3.9049715643093093 8211.0 12.501812080536913 0.0 - - - - - - - 1221.0 16 7 C7orf44 chromosome 7 open reading frame 44 181 23 B20140408_SF107_03 B20140408_SF107_03 TB240255.[MT7]-LAVEQLQSHPEAQEALGPPLNIHYLK[MT7].4b5_1.heavy 796.691 / 685.4 6535.0 32.68454933166504 36 13 10 3 10 0.9780082926459045 58.670145199388124 0.050701141357421875 3 0.9017693122153521 3.9049715643093093 6535.0 12.845902740052129 0.0 - - - - - - - 223.66666666666666 13 6 C7orf44 chromosome 7 open reading frame 44 183 23 B20140408_SF107_03 B20140408_SF107_03 TB240255.[MT7]-LAVEQLQSHPEAQEALGPPLNIHYLK[MT7].4y3_1.heavy 796.691 / 567.362 16756.0 32.68454933166504 36 13 10 3 10 0.9780082926459045 58.670145199388124 0.050701141357421875 3 0.9017693122153521 3.9049715643093093 16756.0 10.570855846230554 0.0 - - - - - - - 251.5 33 2 C7orf44 chromosome 7 open reading frame 44 185 24 B20140408_SF107_03 B20140408_SF107_03 TB498308.[MT7]-C[CAM]TYLPALEPFLYDAPPNILK[MT7].3y6_1.heavy 875.141 / 825.531 62841.0 41.1525993347168 46 16 10 10 10 10.815252047910663 9.246201526973977 0.0 3 0.9627656761965324 6.375786776705312 62841.0 68.15124144214784 0.0 - - - - - - - 331.0 125 1 SPAG6 sperm associated antigen 6 187 24 B20140408_SF107_03 B20140408_SF107_03 TB498308.[MT7]-C[CAM]TYLPALEPFLYDAPPNILK[MT7].3b4_1.heavy 875.141 / 682.335 77284.0 41.1525993347168 46 16 10 10 10 10.815252047910663 9.246201526973977 0.0 3 0.9627656761965324 6.375786776705312 77284.0 122.66883336309863 0.0 - - - - - - - 661.4 154 5 SPAG6 sperm associated antigen 6 189 24 B20140408_SF107_03 B20140408_SF107_03 TB498308.[MT7]-C[CAM]TYLPALEPFLYDAPPNILK[MT7].3b3_1.heavy 875.141 / 569.251 19404.0 41.1525993347168 46 16 10 10 10 10.815252047910663 9.246201526973977 0.0 3 0.9627656761965324 6.375786776705312 19404.0 12.386926766040181 1.0 - - - - - - - 330.6666666666667 44 3 SPAG6 sperm associated antigen 6 191 24 B20140408_SF107_03 B20140408_SF107_03 TB498308.[MT7]-C[CAM]TYLPALEPFLYDAPPNILK[MT7].3b8_1.heavy 875.141 / 1092.55 22050.0 41.1525993347168 46 16 10 10 10 10.815252047910663 9.246201526973977 0.0 3 0.9627656761965324 6.375786776705312 22050.0 46.219424407528805 0.0 - - - - - - - 349.1666666666667 44 6 SPAG6 sperm associated antigen 6 193 25 B20140408_SF107_03 B20140408_SF107_03 TB498305.[MT7]-LTVSAGGSEAK[MT7]PLIFTFVPTVR.4y5_1.heavy 645.377 / 571.356 46148.0 37.78969955444336 43 13 10 10 10 1.2735567400446892 54.54502743636864 0.0 3 0.9067944480920797 4.010597596517962 46148.0 60.17733606710158 0.0 - - - - - - - 268.25 92 4 C6orf142 chromosome 6 open reading frame 142 195 25 B20140408_SF107_03 B20140408_SF107_03 TB498305.[MT7]-LTVSAGGSEAK[MT7]PLIFTFVPTVR.4b13_2.heavy 645.377 / 750.437 62399.0 37.78969955444336 43 13 10 10 10 1.2735567400446892 54.54502743636864 0.0 3 0.9067944480920797 4.010597596517962 62399.0 63.55744566114391 1.0 - - - - - - - 368.0 126 5 C6orf142 chromosome 6 open reading frame 142 197 25 B20140408_SF107_03 B20140408_SF107_03 TB498305.[MT7]-LTVSAGGSEAK[MT7]PLIFTFVPTVR.4y7_1.heavy 645.377 / 819.472 30356.0 37.78969955444336 43 13 10 10 10 1.2735567400446892 54.54502743636864 0.0 3 0.9067944480920797 4.010597596517962 30356.0 60.75528696463428 0.0 - - - - - - - 744.7142857142857 60 7 C6orf142 chromosome 6 open reading frame 142 199 25 B20140408_SF107_03 B20140408_SF107_03 TB498305.[MT7]-LTVSAGGSEAK[MT7]PLIFTFVPTVR.4y6_1.heavy 645.377 / 718.425 42621.0 37.78969955444336 43 13 10 10 10 1.2735567400446892 54.54502743636864 0.0 3 0.9067944480920797 4.010597596517962 42621.0 33.71921397777703 0.0 - - - - - - - 460.0 85 1 C6orf142 chromosome 6 open reading frame 142 201 26 B20140408_SF107_03 B20140408_SF107_03 TB498183.[MT7]-HQILSALSQVSK[MT7].2b3_1.heavy 799.977 / 523.311 11680.0 29.31339931488037 39 14 10 5 10 2.2522383529109673 30.023255939021283 0.04500007629394531 3 0.9476957591064773 5.372575737358933 11680.0 26.52374960132216 0.0 - - - - - - - 303.3 23 10 SPAG6 sperm associated antigen 6 203 26 B20140408_SF107_03 B20140408_SF107_03 TB498183.[MT7]-HQILSALSQVSK[MT7].2y8_1.heavy 799.977 / 963.559 7129.0 29.31339931488037 39 14 10 5 10 2.2522383529109673 30.023255939021283 0.04500007629394531 3 0.9476957591064773 5.372575737358933 7129.0 9.376535978146148 0.0 - - - - - - - 289.45454545454544 14 11 SPAG6 sperm associated antigen 6 205 26 B20140408_SF107_03 B20140408_SF107_03 TB498183.[MT7]-HQILSALSQVSK[MT7].2y5_1.heavy 799.977 / 692.406 7129.0 29.31339931488037 39 14 10 5 10 2.2522383529109673 30.023255939021283 0.04500007629394531 3 0.9476957591064773 5.372575737358933 7129.0 18.36488323044336 0.0 - - - - - - - 303.2 14 10 SPAG6 sperm associated antigen 6 207 26 B20140408_SF107_03 B20140408_SF107_03 TB498183.[MT7]-HQILSALSQVSK[MT7].2y9_1.heavy 799.977 / 1076.64 6371.0 29.31339931488037 39 14 10 5 10 2.2522383529109673 30.023255939021283 0.04500007629394531 3 0.9476957591064773 5.372575737358933 6371.0 23.343301555117037 0.0 - - - - - - - 289.45454545454544 12 11 SPAG6 sperm associated antigen 6 209 27 B20140408_SF107_03 B20140408_SF107_03 TB498085.[MT7]-AIEIYTDMGR.2y8_1.heavy 656.838 / 984.445 40926.0 30.70609951019287 42 17 10 5 10 4.8759891162952975 20.508659395035416 0.04220008850097656 3 0.9792631135943632 8.555339197033053 40926.0 117.054773960217 0.0 - - - - - - - 298.44444444444446 81 9 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 211 27 B20140408_SF107_03 B20140408_SF107_03 TB498085.[MT7]-AIEIYTDMGR.2y9_1.heavy 656.838 / 1097.53 31919.0 30.70609951019287 42 17 10 5 10 4.8759891162952975 20.508659395035416 0.04220008850097656 3 0.9792631135943632 8.555339197033053 31919.0 75.03562386980109 0.0 - - - - - - - 276.5 63 8 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 213 27 B20140408_SF107_03 B20140408_SF107_03 TB498085.[MT7]-AIEIYTDMGR.2y6_1.heavy 656.838 / 742.319 42980.0 30.70609951019287 42 17 10 5 10 4.8759891162952975 20.508659395035416 0.04220008850097656 3 0.9792631135943632 8.555339197033053 42980.0 26.425316455696205 0.0 - - - - - - - 410.8 85 5 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 215 27 B20140408_SF107_03 B20140408_SF107_03 TB498085.[MT7]-AIEIYTDMGR.2y7_1.heavy 656.838 / 855.403 37449.0 30.70609951019287 42 17 10 5 10 4.8759891162952975 20.508659395035416 0.04220008850097656 3 0.9792631135943632 8.555339197033053 37449.0 55.30443037974684 0.0 - - - - - - - 289.6666666666667 74 6 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 217 28 B20140408_SF107_03 B20140408_SF107_03 TB240166.[MT7]-SNLEISK[MT7]MEVLGFVAK[MT7].4y5_1.heavy 550.071 / 665.41 23687.0 35.33340072631836 43 13 10 10 10 1.197812172555301 53.64324706155939 0.0 3 0.9293639081512326 4.61592632016535 23687.0 19.404517847308632 0.0 - - - - - - - 1256.857142857143 47 7 MAGEF1 melanoma antigen family F, 1 219 28 B20140408_SF107_03 B20140408_SF107_03 TB240166.[MT7]-SNLEISK[MT7]MEVLGFVAK[MT7].4b7_2.heavy 550.071 / 530.816 13874.0 35.33340072631836 43 13 10 10 10 1.197812172555301 53.64324706155939 0.0 3 0.9293639081512326 4.61592632016535 13874.0 16.856703186278857 0.0 - - - - - - - 270.4 27 5 MAGEF1 melanoma antigen family F, 1 221 28 B20140408_SF107_03 B20140408_SF107_03 TB240166.[MT7]-SNLEISK[MT7]MEVLGFVAK[MT7].4b4_1.heavy 550.071 / 588.311 18273.0 35.33340072631836 43 13 10 10 10 1.197812172555301 53.64324706155939 0.0 3 0.9293639081512326 4.61592632016535 18273.0 35.2641167730378 0.0 - - - - - - - 225.33333333333334 36 3 MAGEF1 melanoma antigen family F, 1 223 28 B20140408_SF107_03 B20140408_SF107_03 TB240166.[MT7]-SNLEISK[MT7]MEVLGFVAK[MT7].4b9_2.heavy 550.071 / 660.857 68524.0 35.33340072631836 43 13 10 10 10 1.197812172555301 53.64324706155939 0.0 3 0.9293639081512326 4.61592632016535 68524.0 70.8519940915805 0.0 - - - - - - - 253.5 137 4 MAGEF1 melanoma antigen family F, 1 225 29 B20140408_SF107_03 B20140408_SF107_03 TB498089.[MT7]-TIQGDEEDLR.2b8_1.heavy 660.332 / 1032.46 28144.0 24.617000579833984 37 12 10 5 10 1.0310311029142358 59.06776546052972 0.046199798583984375 3 0.896604289231591 3.8044866732826446 28144.0 15.235899618107034 0.0 - - - - - - - 890.5 56 2 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 227 29 B20140408_SF107_03 B20140408_SF107_03 TB498089.[MT7]-TIQGDEEDLR.2y8_1.heavy 660.332 / 961.422 11875.0 24.617000579833984 37 12 10 5 10 1.0310311029142358 59.06776546052972 0.046199798583984375 3 0.896604289231591 3.8044866732826446 11875.0 35.57913708145542 0.0 - - - - - - - 257.5 23 6 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 229 29 B20140408_SF107_03 B20140408_SF107_03 TB498089.[MT7]-TIQGDEEDLR.2y9_1.heavy 660.332 / 1074.51 13894.0 24.617000579833984 37 12 10 5 10 1.0310311029142358 59.06776546052972 0.046199798583984375 3 0.896604289231591 3.8044866732826446 13894.0 23.689113989914738 0.0 - - - - - - - 729.7142857142857 27 7 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 231 29 B20140408_SF107_03 B20140408_SF107_03 TB498089.[MT7]-TIQGDEEDLR.2y7_1.heavy 660.332 / 833.364 12825.0 24.617000579833984 37 12 10 5 10 1.0310311029142358 59.06776546052972 0.046199798583984375 3 0.896604289231591 3.8044866732826446 12825.0 27.459 0.0 - - - - - - - 316.8333333333333 25 6 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 233 30 B20140408_SF107_03 B20140408_SF107_03 TB239830.[MT7]-ALAVGGLGSIIR.3b6_1.heavy 424.27 / 613.379 499388.0 34.63169860839844 46 16 10 10 10 2.1787715743896836 39.35699514448614 0.0 3 0.9637877189596429 6.465692910713537 499388.0 777.8024314367581 0.0 - - - - - - - 174.0 998 2 ARPC5L actin related protein 2/3 complex, subunit 5-like 235 30 B20140408_SF107_03 B20140408_SF107_03 TB239830.[MT7]-ALAVGGLGSIIR.3b5_1.heavy 424.27 / 556.357 142732.0 34.63169860839844 46 16 10 10 10 2.1787715743896836 39.35699514448614 0.0 3 0.9637877189596429 6.465692910713537 142732.0 796.3394574736595 0.0 - - - - - - - 224.0 285 7 ARPC5L actin related protein 2/3 complex, subunit 5-like 237 30 B20140408_SF107_03 B20140408_SF107_03 TB239830.[MT7]-ALAVGGLGSIIR.3b3_1.heavy 424.27 / 400.268 567921.0 34.63169860839844 46 16 10 10 10 2.1787715743896836 39.35699514448614 0.0 3 0.9637877189596429 6.465692910713537 567921.0 1085.3998510553038 0.0 - - - - - - - 305.25 1135 4 ARPC5L actin related protein 2/3 complex, subunit 5-like 239 30 B20140408_SF107_03 B20140408_SF107_03 TB239830.[MT7]-ALAVGGLGSIIR.3y5_1.heavy 424.27 / 545.341 822829.0 34.63169860839844 46 16 10 10 10 2.1787715743896836 39.35699514448614 0.0 3 0.9637877189596429 6.465692910713537 822829.0 1583.632895882993 0.0 - - - - - - - 174.0 1645 3 ARPC5L actin related protein 2/3 complex, subunit 5-like 241 31 B20140408_SF107_03 B20140408_SF107_03 TB240064.[MT7]-NQTSISQWVPVC[CAM]SR.2y5_1.heavy 903.458 / 618.303 44604.0 31.401100158691406 48 18 10 10 10 3.7902924289996 26.383188599090165 0.0 3 0.9804211676464866 8.805577365106485 44604.0 160.4016871710994 0.0 - - - - - - - 276.75 89 8 UQCC ubiquinol-cytochrome c reductase complex chaperone 243 31 B20140408_SF107_03 B20140408_SF107_03 TB240064.[MT7]-NQTSISQWVPVC[CAM]SR.2b4_1.heavy 903.458 / 575.291 9965.0 31.401100158691406 48 18 10 10 10 3.7902924289996 26.383188599090165 0.0 3 0.9804211676464866 8.805577365106485 9965.0 17.913489110707804 0.0 - - - - - - - 334.0 19 9 UQCC ubiquinol-cytochrome c reductase complex chaperone 245 31 B20140408_SF107_03 B20140408_SF107_03 TB240064.[MT7]-NQTSISQWVPVC[CAM]SR.2y9_1.heavy 903.458 / 1118.54 11388.0 31.401100158691406 48 18 10 10 10 3.7902924289996 26.383188599090165 0.0 3 0.9804211676464866 8.805577365106485 11388.0 34.18199052132701 0.0 - - - - - - - 248.28571428571428 22 7 UQCC ubiquinol-cytochrome c reductase complex chaperone 247 31 B20140408_SF107_03 B20140408_SF107_03 TB240064.[MT7]-NQTSISQWVPVC[CAM]SR.2y6_1.heavy 903.458 / 717.371 8225.0 31.401100158691406 48 18 10 10 10 3.7902924289996 26.383188599090165 0.0 3 0.9804211676464866 8.805577365106485 8225.0 12.518321239587527 0.0 - - - - - - - 384.2857142857143 16 7 UQCC ubiquinol-cytochrome c reductase complex chaperone 249 32 B20140408_SF107_03 B20140408_SF107_03 TB377655.[MT7]-VAGYAALLEQYQK[MT7].2y3_1.heavy 871.49 / 582.337 20037.0 33.86000061035156 47 17 10 10 10 4.283866951208164 23.343395380614552 0.0 3 0.9765487014285824 8.043156483233993 20037.0 59.66762276937126 0.0 - - - - - - - 721.8571428571429 40 7 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 251 32 B20140408_SF107_03 B20140408_SF107_03 TB377655.[MT7]-VAGYAALLEQYQK[MT7].2b6_1.heavy 871.49 / 677.374 45649.0 33.86000061035156 47 17 10 10 10 4.283866951208164 23.343395380614552 0.0 3 0.9765487014285824 8.043156483233993 45649.0 187.85906353706514 0.0 - - - - - - - 275.5 91 12 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 253 32 B20140408_SF107_03 B20140408_SF107_03 TB377655.[MT7]-VAGYAALLEQYQK[MT7].2y6_1.heavy 871.49 / 952.522 23521.0 33.86000061035156 47 17 10 10 10 4.283866951208164 23.343395380614552 0.0 3 0.9765487014285824 8.043156483233993 23521.0 68.71225796982972 0.0 - - - - - - - 261.0 47 8 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 255 32 B20140408_SF107_03 B20140408_SF107_03 TB377655.[MT7]-VAGYAALLEQYQK[MT7].2b7_1.heavy 871.49 / 790.458 34149.0 33.86000061035156 47 17 10 10 10 4.283866951208164 23.343395380614552 0.0 3 0.9765487014285824 8.043156483233993 34149.0 27.6071846923273 0.0 - - - - - - - 290.0 68 3 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 257 33 B20140408_SF107_03 B20140408_SF107_03 TB239631.[MT7]-AANMFK[MT7].2y4_1.heavy 485.275 / 683.367 38692.0 25.883699417114258 45 15 10 10 10 2.649600969075918 33.1139590487285 0.0 3 0.959713744325556 6.127947268350962 38692.0 44.33346007783304 0.0 - - - - - - - 748.2857142857143 77 7 NAPB;NAPA N-ethylmaleimide-sensitive factor attachment protein, beta;N-ethylmaleimide-sensitive factor attachment protein, alpha 259 33 B20140408_SF107_03 B20140408_SF107_03 TB239631.[MT7]-AANMFK[MT7].2y5_1.heavy 485.275 / 754.404 87998.0 25.883699417114258 45 15 10 10 10 2.649600969075918 33.1139590487285 0.0 3 0.959713744325556 6.127947268350962 87998.0 177.93785672571988 0.0 - - - - - - - 201.375 175 8 NAPB;NAPA N-ethylmaleimide-sensitive factor attachment protein, beta;N-ethylmaleimide-sensitive factor attachment protein, alpha 261 33 B20140408_SF107_03 B20140408_SF107_03 TB239631.[MT7]-AANMFK[MT7].2b4_1.heavy 485.275 / 532.267 34125.0 25.883699417114258 45 15 10 10 10 2.649600969075918 33.1139590487285 0.0 3 0.959713744325556 6.127947268350962 34125.0 26.197590857747947 0.0 - - - - - - - 403.0 68 1 NAPB;NAPA N-ethylmaleimide-sensitive factor attachment protein, beta;N-ethylmaleimide-sensitive factor attachment protein, alpha 263 33 B20140408_SF107_03 B20140408_SF107_03 TB239631.[MT7]-AANMFK[MT7].2y3_1.heavy 485.275 / 569.324 35199.0 25.883699417114258 45 15 10 10 10 2.649600969075918 33.1139590487285 0.0 3 0.959713744325556 6.127947268350962 35199.0 23.805088733348384 0.0 - - - - - - - 709.8571428571429 70 7 NAPB;NAPA N-ethylmaleimide-sensitive factor attachment protein, beta;N-ethylmaleimide-sensitive factor attachment protein, alpha 265 34 B20140408_SF107_03 B20140408_SF107_03 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 2601710.0 28.365699768066406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2601710.0 583.0578332844084 0.0 - - - - - - - 884.0 5203 1 267 34 B20140408_SF107_03 B20140408_SF107_03 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 855674.0 28.365699768066406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 855674.0 164.8683992056276 0.0 - - - - - - - 884.0 1711 1 269 34 B20140408_SF107_03 B20140408_SF107_03 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 629145.0 28.365699768066406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 629145.0 222.67913679571564 0.0 - - - - - - - 1916.0 1258 1 271 35 B20140408_SF107_03 B20140408_SF107_03 TB240164.[MT7]-DSGDYPLTAPGLSWK[MT7]K[MT7].3y7_1.heavy 723.063 / 1103.68 25781.0 30.603099822998047 43 13 10 10 10 0.9508092002305298 71.16469059325469 0.0 3 0.9012535510179445 3.8945865163329776 25781.0 210.18904458598726 0.0 - - - - - - - 224.28571428571428 51 7 STAG3L4 stromal antigen 3-like 4 273 35 B20140408_SF107_03 B20140408_SF107_03 TB240164.[MT7]-DSGDYPLTAPGLSWK[MT7]K[MT7].3b4_1.heavy 723.063 / 519.217 47474.0 30.603099822998047 43 13 10 10 10 0.9508092002305298 71.16469059325469 0.0 3 0.9012535510179445 3.8945865163329776 47474.0 91.49418617539857 0.0 - - - - - - - 366.6666666666667 94 6 STAG3L4 stromal antigen 3-like 4 275 35 B20140408_SF107_03 B20140408_SF107_03 TB240164.[MT7]-DSGDYPLTAPGLSWK[MT7]K[MT7].3y7_2.heavy 723.063 / 552.344 50146.0 30.603099822998047 43 13 10 10 10 0.9508092002305298 71.16469059325469 0.0 3 0.9012535510179445 3.8945865163329776 50146.0 28.031622946941738 0.0 - - - - - - - 314.5 100 2 STAG3L4 stromal antigen 3-like 4 277 35 B20140408_SF107_03 B20140408_SF107_03 TB240164.[MT7]-DSGDYPLTAPGLSWK[MT7]K[MT7].3b5_1.heavy 723.063 / 682.28 51875.0 30.603099822998047 43 13 10 10 10 0.9508092002305298 71.16469059325469 0.0 3 0.9012535510179445 3.8945865163329776 51875.0 51.400195159225134 0.0 - - - - - - - 314.5 103 2 STAG3L4 stromal antigen 3-like 4 279 36 B20140408_SF107_03 B20140408_SF107_03 TB377233.[MT7]-RVLYPR.2b3_1.heavy 474.299 / 513.363 5619.0 22.412324905395508 41 17 10 6 8 3.29829862574004 30.318661633484737 0.03549957275390625 4 0.9760823042328469 7.964037016834645 5619.0 5.168291517930152 1.0 - - - - - - - 452.0 11 3 IER3 immediate early response 3 281 36 B20140408_SF107_03 B20140408_SF107_03 TB377233.[MT7]-RVLYPR.2y4_1.heavy 474.299 / 548.319 7654.0 22.412324905395508 41 17 10 6 8 3.29829862574004 30.318661633484737 0.03549957275390625 4 0.9760823042328469 7.964037016834645 7654.0 4.1216337839862005 2.0 - - - - - - - 716.8 33 5 IER3 immediate early response 3 283 36 B20140408_SF107_03 B20140408_SF107_03 TB377233.[MT7]-RVLYPR.2y5_1.heavy 474.299 / 647.388 28968.0 22.412324905395508 41 17 10 6 8 3.29829862574004 30.318661633484737 0.03549957275390625 4 0.9760823042328469 7.964037016834645 28968.0 31.57765700465094 0.0 - - - - - - - 445.6 57 5 IER3 immediate early response 3 285 36 B20140408_SF107_03 B20140408_SF107_03 TB377233.[MT7]-RVLYPR.2b4_1.heavy 474.299 / 676.426 20927.0 22.412324905395508 41 17 10 6 8 3.29829862574004 30.318661633484737 0.03549957275390625 4 0.9760823042328469 7.964037016834645 20927.0 30.899787964881128 1.0 - - - - - - - 761.1428571428571 41 7 IER3 immediate early response 3 287 37 B20140408_SF107_03 B20140408_SF107_03 TB377235.[MT7]-ELGTVMR.2y5_1.heavy 475.267 / 563.297 119340.0 26.184499740600586 48 18 10 10 10 3.617400198830411 27.644162797451138 0.0 3 0.986171257299899 10.482606154801092 119340.0 117.164095371669 0.0 - - - - - - - 784.0 238 4 TNNC2;CALM1;CALM2;CALM3;CALML3 troponin C type 2 (fast);calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 289 37 B20140408_SF107_03 B20140408_SF107_03 TB377235.[MT7]-ELGTVMR.2b4_1.heavy 475.267 / 545.305 44913.0 26.184499740600586 48 18 10 10 10 3.617400198830411 27.644162797451138 0.0 3 0.986171257299899 10.482606154801092 44913.0 16.342785981708708 0.0 - - - - - - - 713.0 89 1 TNNC2;CALM1;CALM2;CALM3;CALML3 troponin C type 2 (fast);calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 291 37 B20140408_SF107_03 B20140408_SF107_03 TB377235.[MT7]-ELGTVMR.2y6_1.heavy 475.267 / 676.381 244099.0 26.184499740600586 48 18 10 10 10 3.617400198830411 27.644162797451138 0.0 3 0.986171257299899 10.482606154801092 244099.0 118.14800094019208 0.0 - - - - - - - 807.6666666666666 488 3 TNNC2;CALM1;CALM2;CALM3;CALML3 troponin C type 2 (fast);calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 293 37 B20140408_SF107_03 B20140408_SF107_03 TB377235.[MT7]-ELGTVMR.2b5_1.heavy 475.267 / 644.374 60597.0 26.184499740600586 48 18 10 10 10 3.617400198830411 27.644162797451138 0.0 3 0.986171257299899 10.482606154801092 60597.0 81.6190492359932 0.0 - - - - - - - 621.9090909090909 121 11 TNNC2;CALM1;CALM2;CALM3;CALML3 troponin C type 2 (fast);calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 295 38 B20140408_SF107_03 B20140408_SF107_03 TB498058.[MT7]-ELALQEEK[MT7].2y4_1.heavy 624.358 / 677.359 56203.0 25.924999237060547 48 18 10 10 10 2.7514121262600866 25.02519844943042 0.0 3 0.9854373396266058 10.214416349974071 56203.0 80.44448721092562 0.0 - - - - - - - 843.75 112 8 AP1AR adaptor-related protein complex 1 associated regulatory protein 297 38 B20140408_SF107_03 B20140408_SF107_03 TB498058.[MT7]-ELALQEEK[MT7].2y5_1.heavy 624.358 / 790.443 52208.0 25.924999237060547 48 18 10 10 10 2.7514121262600866 25.02519844943042 0.0 3 0.9854373396266058 10.214416349974071 52208.0 126.74828452666705 0.0 - - - - - - - 676.2727272727273 104 11 AP1AR adaptor-related protein complex 1 associated regulatory protein 299 38 B20140408_SF107_03 B20140408_SF107_03 TB498058.[MT7]-ELALQEEK[MT7].2y6_1.heavy 624.358 / 861.48 46009.0 25.924999237060547 48 18 10 10 10 2.7514121262600866 25.02519844943042 0.0 3 0.9854373396266058 10.214416349974071 46009.0 73.1431994360459 0.0 - - - - - - - 726.4545454545455 92 11 AP1AR adaptor-related protein complex 1 associated regulatory protein 301 38 B20140408_SF107_03 B20140408_SF107_03 TB498058.[MT7]-ELALQEEK[MT7].2y7_1.heavy 624.358 / 974.564 40912.0 25.924999237060547 48 18 10 10 10 2.7514121262600866 25.02519844943042 0.0 3 0.9854373396266058 10.214416349974071 40912.0 98.94299975942621 0.0 - - - - - - - 256.0 81 7 AP1AR adaptor-related protein complex 1 associated regulatory protein 303 39 B20140408_SF107_03 B20140408_SF107_03 TB377420.[MT7]-LSEELLDK[MT7].2y4_1.heavy 617.86 / 632.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP20A1 cytochrome P450, family 20, subfamily A, polypeptide 1 305 39 B20140408_SF107_03 B20140408_SF107_03 TB377420.[MT7]-LSEELLDK[MT7].2b4_1.heavy 617.86 / 603.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP20A1 cytochrome P450, family 20, subfamily A, polypeptide 1 307 39 B20140408_SF107_03 B20140408_SF107_03 TB377420.[MT7]-LSEELLDK[MT7].2y3_1.heavy 617.86 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP20A1 cytochrome P450, family 20, subfamily A, polypeptide 1 309 39 B20140408_SF107_03 B20140408_SF107_03 TB377420.[MT7]-LSEELLDK[MT7].2y7_1.heavy 617.86 / 977.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP20A1 cytochrome P450, family 20, subfamily A, polypeptide 1 311 40 B20140408_SF107_03 B20140408_SF107_03 TB498053.[MT7]-Y[MT7]VIGDLK[MT7].3y3_1.heavy 413.927 / 519.326 19119.0 27.226200103759766 43 13 10 10 10 1.2549023267486166 61.94292208286805 0.0 3 0.9195995860410596 4.322943632076457 19119.0 12.526951876672243 1.0 - - - - - - - 292.0 38 1 MAGEF1 melanoma antigen family F, 1 313 40 B20140408_SF107_03 B20140408_SF107_03 TB498053.[MT7]-Y[MT7]VIGDLK[MT7].3b5_2.heavy 413.927 / 418.741 71659.0 27.226200103759766 43 13 10 10 10 1.2549023267486166 61.94292208286805 0.0 3 0.9195995860410596 4.322943632076457 71659.0 70.78089605678686 0.0 - - - - - - - 1186.125 143 8 MAGEF1 melanoma antigen family F, 1 315 40 B20140408_SF107_03 B20140408_SF107_03 TB498053.[MT7]-Y[MT7]VIGDLK[MT7].3y4_1.heavy 413.927 / 576.347 96761.0 27.226200103759766 43 13 10 10 10 1.2549023267486166 61.94292208286805 0.0 3 0.9195995860410596 4.322943632076457 96761.0 138.6499374715665 0.0 - - - - - - - 389.3333333333333 193 3 MAGEF1 melanoma antigen family F, 1 317 40 B20140408_SF107_03 B20140408_SF107_03 TB498053.[MT7]-Y[MT7]VIGDLK[MT7].3y5_1.heavy 413.927 / 689.431 32400.0 27.226200103759766 43 13 10 10 10 1.2549023267486166 61.94292208286805 0.0 3 0.9195995860410596 4.322943632076457 32400.0 70.36972218665983 0.0 - - - - - - - 318.54545454545456 64 11 MAGEF1 melanoma antigen family F, 1 319 41 B20140408_SF107_03 B20140408_SF107_03 TB239700.[MT7]-SNLEISK[MT7].2y4_1.heavy 539.821 / 620.374 18693.0 24.171199798583984 50 20 10 10 10 16.996512684991103 5.883559872155759 0.0 3 0.9938823726037826 15.770635916906743 18693.0 29.014796693422788 0.0 - - - - - - - 744.4285714285714 37 7 MAGEF1 melanoma antigen family F, 1 321 41 B20140408_SF107_03 B20140408_SF107_03 TB239700.[MT7]-SNLEISK[MT7].2y5_1.heavy 539.821 / 733.458 5098.0 24.171199798583984 50 20 10 10 10 16.996512684991103 5.883559872155759 0.0 3 0.9938823726037826 15.770635916906743 5098.0 7.088543182743658 2.0 - - - - - - - 647.1428571428571 19 7 MAGEF1 melanoma antigen family F, 1 323 41 B20140408_SF107_03 B20140408_SF107_03 TB239700.[MT7]-SNLEISK[MT7].2b4_1.heavy 539.821 / 588.311 22431.0 24.171199798583984 50 20 10 10 10 16.996512684991103 5.883559872155759 0.0 3 0.9938823726037826 15.770635916906743 22431.0 21.65493624975977 0.0 - - - - - - - 1213.857142857143 44 7 MAGEF1 melanoma antigen family F, 1 325 41 B20140408_SF107_03 B20140408_SF107_03 TB239700.[MT7]-SNLEISK[MT7].2y6_1.heavy 539.821 / 847.5 9516.0 24.171199798583984 50 20 10 10 10 16.996512684991103 5.883559872155759 0.0 3 0.9938823726037826 15.770635916906743 9516.0 29.23856953642384 0.0 - - - - - - - 278.1818181818182 19 11 MAGEF1 melanoma antigen family F, 1 327 42 B20140408_SF107_03 B20140408_SF107_03 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 1395500.0 18.758800506591797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1395500.0 980.4811436181697 0.0 - - - - - - - 860.0 2791 2 329 42 B20140408_SF107_03 B20140408_SF107_03 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 2740680.0 18.758800506591797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2740680.0 4889.842908144989 0.0 - - - - - - - 1954.5 5481 2 331 42 B20140408_SF107_03 B20140408_SF107_03 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 999316.0 18.758800506591797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 999316.0 2659.7297821290426 0.0 - - - - - - - 781.5 1998 2 333 43 B20140408_SF107_03 B20140408_SF107_03 TB498194.[MT7]-TVAELVQFLLVK[MT7].3b6_1.heavy 550.014 / 757.458 301165.0 44.14059829711914 40 10 10 10 10 0.5257861480023381 92.20923105499838 0.0 3 0.8306767361554636 2.9558092956202087 301165.0 2206.0011144439727 0.0 - - - - - - - 283.8333333333333 602 6 MAGEF1 melanoma antigen family F, 1 335 43 B20140408_SF107_03 B20140408_SF107_03 TB498194.[MT7]-TVAELVQFLLVK[MT7].3y3_1.heavy 550.014 / 503.367 852271.0 44.14059829711914 40 10 10 10 10 0.5257861480023381 92.20923105499838 0.0 3 0.8306767361554636 2.9558092956202087 852271.0 -501.33588235294064 0.0 - - - - - - - 233.42857142857142 1704 7 MAGEF1 melanoma antigen family F, 1 337 43 B20140408_SF107_03 B20140408_SF107_03 TB498194.[MT7]-TVAELVQFLLVK[MT7].3b4_1.heavy 550.014 / 545.305 339518.0 44.14059829711914 40 10 10 10 10 0.5257861480023381 92.20923105499838 0.0 3 0.8306767361554636 2.9558092956202087 339518.0 4063.075147021603 0.0 - - - - - - - 170.0 679 6 MAGEF1 melanoma antigen family F, 1 339 43 B20140408_SF107_03 B20140408_SF107_03 TB498194.[MT7]-TVAELVQFLLVK[MT7].3b5_1.heavy 550.014 / 658.389 893038.0 44.14059829711914 40 10 10 10 10 0.5257861480023381 92.20923105499838 0.0 3 0.8306767361554636 2.9558092956202087 893038.0 -262.65823529411773 0.0 - - - - - - - 243.14285714285714 1786 7 MAGEF1 melanoma antigen family F, 1 341 44 B20140408_SF107_03 B20140408_SF107_03 TB239880.[MT7]-TPGPAVAIQSVR.2y9_1.heavy 670.394 / 940.557 31148.0 27.67259979248047 50 20 10 10 10 11.596924523751444 8.622975841154426 0.0 3 0.9961577184547203 19.903461930441427 31148.0 52.67566136282505 0.0 - - - - - - - 237.375 62 8 COX5A cytochrome c oxidase subunit Va 343 44 B20140408_SF107_03 B20140408_SF107_03 TB239880.[MT7]-TPGPAVAIQSVR.2y6_1.heavy 670.394 / 673.399 32026.0 27.67259979248047 50 20 10 10 10 11.596924523751444 8.622975841154426 0.0 3 0.9961577184547203 19.903461930441427 32026.0 46.90401564637483 0.0 - - - - - - - 292.1666666666667 64 6 COX5A cytochrome c oxidase subunit Va 345 44 B20140408_SF107_03 B20140408_SF107_03 TB239880.[MT7]-TPGPAVAIQSVR.2y10_1.heavy 670.394 / 997.579 28516.0 27.67259979248047 50 20 10 10 10 11.596924523751444 8.622975841154426 0.0 3 0.9961577184547203 19.903461930441427 28516.0 76.53678796169629 0.0 - - - - - - - 229.57142857142858 57 7 COX5A cytochrome c oxidase subunit Va 347 44 B20140408_SF107_03 B20140408_SF107_03 TB239880.[MT7]-TPGPAVAIQSVR.2y11_1.heavy 670.394 / 1094.63 258399.0 27.67259979248047 50 20 10 10 10 11.596924523751444 8.622975841154426 0.0 3 0.9961577184547203 19.903461930441427 258399.0 949.7737531249063 0.0 - - - - - - - 255.5 516 4 COX5A cytochrome c oxidase subunit Va 349 45 B20140408_SF107_03 B20140408_SF107_03 TB240033.[MT7]-WHLDEVFLELK[MT7].3y3_1.heavy 572.99 / 533.341 215355.0 37.660099029541016 42 12 10 10 10 1.067833833155376 55.43914313566093 0.0 3 0.8988227126046869 3.846708213205073 215355.0 326.33182499095045 0.0 - - - - - - - 469.0 430 1 C7orf44 chromosome 7 open reading frame 44 351 45 B20140408_SF107_03 B20140408_SF107_03 TB240033.[MT7]-WHLDEVFLELK[MT7].3b4_1.heavy 572.99 / 696.359 56845.0 37.660099029541016 42 12 10 10 10 1.067833833155376 55.43914313566093 0.0 3 0.8988227126046869 3.846708213205073 56845.0 104.15797469414963 0.0 - - - - - - - 329.77777777777777 113 9 C7orf44 chromosome 7 open reading frame 44 353 45 B20140408_SF107_03 B20140408_SF107_03 TB240033.[MT7]-WHLDEVFLELK[MT7].3b5_1.heavy 572.99 / 825.401 85424.0 37.660099029541016 42 12 10 10 10 1.067833833155376 55.43914313566093 0.0 3 0.8988227126046869 3.846708213205073 85424.0 65.45884002380667 1.0 - - - - - - - 214.5 203 8 C7orf44 chromosome 7 open reading frame 44 355 45 B20140408_SF107_03 B20140408_SF107_03 TB240033.[MT7]-WHLDEVFLELK[MT7].3y4_1.heavy 572.99 / 646.426 130244.0 37.660099029541016 42 12 10 10 10 1.067833833155376 55.43914313566093 0.0 3 0.8988227126046869 3.846708213205073 130244.0 282.4746351003603 0.0 - - - - - - - 870.1428571428571 260 7 C7orf44 chromosome 7 open reading frame 44 357 46 B20140408_SF107_03 B20140408_SF107_03 TB239800.[MT7]-SMVEQLDK[MT7].2y5_1.heavy 619.339 / 776.427 9720.0 26.506799697875977 45 16 9 10 10 3.229445104351284 30.965071945413214 0.0 3 0.9665491230577372 6.728844541099868 9720.0 11.941775943111313 0.0 - - - - - - - 364.0 19 11 BCCIP BRCA2 and CDKN1A interacting protein 359 46 B20140408_SF107_03 B20140408_SF107_03 TB239800.[MT7]-SMVEQLDK[MT7].2b4_1.heavy 619.339 / 591.293 N/A 26.506799697875977 45 16 9 10 10 3.229445104351284 30.965071945413214 0.0 3 0.9665491230577372 6.728844541099868 9863.0 3.7688622114133317 11.0 - - - - - - - 2287.0 22 1 BCCIP BRCA2 and CDKN1A interacting protein 361 46 B20140408_SF107_03 B20140408_SF107_03 TB239800.[MT7]-SMVEQLDK[MT7].2y3_1.heavy 619.339 / 519.326 5003.0 26.506799697875977 45 16 9 10 10 3.229445104351284 30.965071945413214 0.0 3 0.9665491230577372 6.728844541099868 5003.0 4.403993540614218 1.0 - - - - - - - 1206.6666666666667 10 9 BCCIP BRCA2 and CDKN1A interacting protein 363 46 B20140408_SF107_03 B20140408_SF107_03 TB239800.[MT7]-SMVEQLDK[MT7].2b5_1.heavy 619.339 / 719.351 4288.0 26.506799697875977 45 16 9 10 10 3.229445104351284 30.965071945413214 0.0 3 0.9665491230577372 6.728844541099868 4288.0 9.395617715617718 1.0 - - - - - - - 667.3333333333334 8 9 BCCIP BRCA2 and CDKN1A interacting protein 365 47 B20140408_SF107_03 B20140408_SF107_03 TB240034.[MT7]-WHLDEVFLELK[MT7].4b4_1.heavy 429.995 / 696.359 22926.0 37.68124961853027 30 5 10 5 10 0.36789436773150463 109.96798660595684 0.042301177978515625 3 0.6171672482104508 1.9271374661733498 22926.0 115.11987179487178 0.0 - - - - - - - 242.66666666666666 45 9 C7orf44 chromosome 7 open reading frame 44 367 47 B20140408_SF107_03 B20140408_SF107_03 TB240034.[MT7]-WHLDEVFLELK[MT7].4b5_1.heavy 429.995 / 825.401 25733.0 37.68124961853027 30 5 10 5 10 0.36789436773150463 109.96798660595684 0.042301177978515625 3 0.6171672482104508 1.9271374661733498 25733.0 218.2356346153846 0.0 - - - - - - - 312.0 51 4 C7orf44 chromosome 7 open reading frame 44 369 47 B20140408_SF107_03 B20140408_SF107_03 TB240034.[MT7]-WHLDEVFLELK[MT7].4y3_1.heavy 429.995 / 533.341 65346.0 37.68124961853027 30 5 10 5 10 0.36789436773150463 109.96798660595684 0.042301177978515625 3 0.6171672482104508 1.9271374661733498 65346.0 268.7842948717948 0.0 - - - - - - - 312.0 130 16 C7orf44 chromosome 7 open reading frame 44 371 47 B20140408_SF107_03 B20140408_SF107_03 TB240034.[MT7]-WHLDEVFLELK[MT7].4b6_1.heavy 429.995 / 924.47 468.0 37.68124961853027 30 5 10 5 10 0.36789436773150463 109.96798660595684 0.042301177978515625 3 0.6171672482104508 1.9271374661733498 468.0 2.85 1.0 - - - - - - - 0.0 1 0 C7orf44 chromosome 7 open reading frame 44 373 48 B20140408_SF107_03 B20140408_SF107_03 TB377685.[MT7]-QYEDALMQLESVLR.3b6_1.heavy 613.653 / 864.422 17695.0 40.891300201416016 41 11 10 10 10 2.8073655538179105 35.620583811753264 0.0 3 0.8665549057357277 3.34009504575367 17695.0 90.42256289308176 0.0 - - - - - - - 265.0 35 10 CYP20A1 cytochrome P450, family 20, subfamily A, polypeptide 1 375 48 B20140408_SF107_03 B20140408_SF107_03 TB377685.[MT7]-QYEDALMQLESVLR.3y6_1.heavy 613.653 / 716.43 20027.0 40.891300201416016 41 11 10 10 10 2.8073655538179105 35.620583811753264 0.0 3 0.8665549057357277 3.34009504575367 20027.0 73.93670606048148 0.0 - - - - - - - 279.45454545454544 40 11 CYP20A1 cytochrome P450, family 20, subfamily A, polypeptide 1 377 48 B20140408_SF107_03 B20140408_SF107_03 TB377685.[MT7]-QYEDALMQLESVLR.3b4_1.heavy 613.653 / 680.301 9007.0 40.891300201416016 41 11 10 10 10 2.8073655538179105 35.620583811753264 0.0 3 0.8665549057357277 3.34009504575367 9007.0 31.142127358490562 0.0 - - - - - - - 231.27272727272728 18 11 CYP20A1 cytochrome P450, family 20, subfamily A, polypeptide 1 379 48 B20140408_SF107_03 B20140408_SF107_03 TB377685.[MT7]-QYEDALMQLESVLR.3b5_1.heavy 613.653 / 751.338 25854.0 40.891300201416016 41 11 10 10 10 2.8073655538179105 35.620583811753264 0.0 3 0.8665549057357277 3.34009504575367 25854.0 91.22071698113207 0.0 - - - - - - - 257.42857142857144 51 7 CYP20A1 cytochrome P450, family 20, subfamily A, polypeptide 1 381 49 B20140408_SF107_03 B20140408_SF107_03 TB498050.[MT7]-TLAAFPAEK[MT7].2y4_1.heavy 618.366 / 588.347 212701.0 28.740800857543945 47 17 10 10 10 4.143197345257844 24.13594904294299 0.0 3 0.9751187185758324 7.807668729454132 212701.0 64.08492285486503 0.0 - - - - - - - 601.0 425 1 CPPED1 calcineurin-like phosphoesterase domain containing 1 383 49 B20140408_SF107_03 B20140408_SF107_03 TB498050.[MT7]-TLAAFPAEK[MT7].2y5_1.heavy 618.366 / 735.416 81415.0 28.740800857543945 47 17 10 10 10 4.143197345257844 24.13594904294299 0.0 3 0.9751187185758324 7.807668729454132 81415.0 60.75364254660052 0.0 - - - - - - - 901.0 162 2 CPPED1 calcineurin-like phosphoesterase domain containing 1 385 49 B20140408_SF107_03 B20140408_SF107_03 TB498050.[MT7]-TLAAFPAEK[MT7].2b4_1.heavy 618.366 / 501.315 138345.0 28.740800857543945 47 17 10 10 10 4.143197345257844 24.13594904294299 0.0 3 0.9751187185758324 7.807668729454132 138345.0 94.96070602662928 0.0 - - - - - - - 751.0 276 1 CPPED1 calcineurin-like phosphoesterase domain containing 1 387 49 B20140408_SF107_03 B20140408_SF107_03 TB498050.[MT7]-TLAAFPAEK[MT7].2y6_1.heavy 618.366 / 806.453 65342.0 28.740800857543945 47 17 10 10 10 4.143197345257844 24.13594904294299 0.0 3 0.9751187185758324 7.807668729454132 65342.0 86.22724563898575 0.0 - - - - - - - 300.0 130 3 CPPED1 calcineurin-like phosphoesterase domain containing 1 389 50 B20140408_SF107_03 B20140408_SF107_03 TB239609.[MT7]-GLTATLGR.2y5_1.heavy 466.786 / 517.309 28151.0 26.77720069885254 50 20 10 10 10 9.731946900392558 10.275436253764013 0.0 3 0.9973731302164923 24.07398479502083 28151.0 12.59069053943692 1.0 - - - - - - - 575.0 56 1 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 391 50 B20140408_SF107_03 B20140408_SF107_03 TB239609.[MT7]-GLTATLGR.2y6_1.heavy 466.786 / 618.357 50412.0 26.77720069885254 50 20 10 10 10 9.731946900392558 10.275436253764013 0.0 3 0.9973731302164923 24.07398479502083 50412.0 13.974326503992891 0.0 - - - - - - - 1580.0 100 1 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 393 50 B20140408_SF107_03 B20140408_SF107_03 TB239609.[MT7]-GLTATLGR.2b5_1.heavy 466.786 / 588.347 19389.0 26.77720069885254 50 20 10 10 10 9.731946900392558 10.275436253764013 0.0 3 0.9973731302164923 24.07398479502083 19389.0 4.30426211007861 4.0 - - - - - - - 2334.0 49 8 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 395 50 B20140408_SF107_03 B20140408_SF107_03 TB239609.[MT7]-GLTATLGR.2y7_1.heavy 466.786 / 731.441 29300.0 26.77720069885254 50 20 10 10 10 9.731946900392558 10.275436253764013 0.0 3 0.9973731302164923 24.07398479502083 29300.0 50.8288375355598 0.0 - - - - - - - 359.0 58 4 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 397 51 B20140408_SF107_03 B20140408_SF107_03 TB377682.[MT7]-LTC[CAM]PSEVSGTILQER.3y7_1.heavy 611.988 / 816.457 46199.0 30.643400192260742 50 20 10 10 10 7.494348324399232 13.343388333636906 0.0 3 0.996060299805984 19.65568109262618 46199.0 33.11323617299496 0.0 - - - - - - - 237.25 92 4 C6orf142 chromosome 6 open reading frame 142 399 51 B20140408_SF107_03 B20140408_SF107_03 TB377682.[MT7]-LTC[CAM]PSEVSGTILQER.3b3_1.heavy 611.988 / 519.272 74045.0 30.643400192260742 50 20 10 10 10 7.494348324399232 13.343388333636906 0.0 3 0.996060299805984 19.65568109262618 74045.0 74.26342182890855 0.0 - - - - - - - 1266.0 148 7 C6orf142 chromosome 6 open reading frame 142 401 51 B20140408_SF107_03 B20140408_SF107_03 TB377682.[MT7]-LTC[CAM]PSEVSGTILQER.3y4_1.heavy 611.988 / 545.304 75469.0 30.643400192260742 50 20 10 10 10 7.494348324399232 13.343388333636906 0.0 3 0.996060299805984 19.65568109262618 75469.0 53.98213815839131 0.0 - - - - - - - 475.0 150 1 C6orf142 chromosome 6 open reading frame 142 403 51 B20140408_SF107_03 B20140408_SF107_03 TB377682.[MT7]-LTC[CAM]PSEVSGTILQER.3y8_1.heavy 611.988 / 903.489 64394.0 30.643400192260742 50 20 10 10 10 7.494348324399232 13.343388333636906 0.0 3 0.996060299805984 19.65568109262618 64394.0 227.03038769037346 0.0 - - - - - - - 356.0 128 8 C6orf142 chromosome 6 open reading frame 142 405 52 B20140408_SF107_03 B20140408_SF107_03 TB239606.[MT7]-LLEQER.2b3_1.heavy 466.27 / 500.32 101135.0 24.963899612426758 50 20 10 10 10 26.60258814011448 3.7590327479907244 0.0 3 0.9997149800256792 73.09949988173298 101135.0 54.740348530216686 0.0 - - - - - - - 243.0 202 1 GOLGA6L3;CCDC127;AP1AR;GOLGA6L10;PHF17;FBF1;OXNAD1 golgin A6 family-like 3;coiled-coil domain containing 127;adaptor-related protein complex 1 associated regulatory protein;golgin A6 family-like 10;PHD finger protein 17;Fas (TNFRSF6) binding factor 1;oxidoreductase NAD-binding domain containing 1 407 52 B20140408_SF107_03 B20140408_SF107_03 TB239606.[MT7]-LLEQER.2y4_1.heavy 466.27 / 561.263 126176.0 24.963899612426758 50 20 10 10 10 26.60258814011448 3.7590327479907244 0.0 3 0.9997149800256792 73.09949988173298 126176.0 57.22545084839827 0.0 - - - - - - - 1337.0 252 1 GOLGA6L3;CCDC127;AP1AR;GOLGA6L10;PHF17;FBF1;OXNAD1 golgin A6 family-like 3;coiled-coil domain containing 127;adaptor-related protein complex 1 associated regulatory protein;golgin A6 family-like 10;PHD finger protein 17;Fas (TNFRSF6) binding factor 1;oxidoreductase NAD-binding domain containing 1 409 52 B20140408_SF107_03 B20140408_SF107_03 TB239606.[MT7]-LLEQER.2y5_1.heavy 466.27 / 674.347 477961.0 24.963899612426758 50 20 10 10 10 26.60258814011448 3.7590327479907244 0.0 3 0.9997149800256792 73.09949988173298 477961.0 232.65229693558382 0.0 - - - - - - - 1094.0 955 1 GOLGA6L3;CCDC127;AP1AR;GOLGA6L10;PHF17;FBF1;OXNAD1 golgin A6 family-like 3;coiled-coil domain containing 127;adaptor-related protein complex 1 associated regulatory protein;golgin A6 family-like 10;PHD finger protein 17;Fas (TNFRSF6) binding factor 1;oxidoreductase NAD-binding domain containing 1 411 52 B20140408_SF107_03 B20140408_SF107_03 TB239606.[MT7]-LLEQER.2b4_1.heavy 466.27 / 628.379 63574.0 24.963899612426758 50 20 10 10 10 26.60258814011448 3.7590327479907244 0.0 3 0.9997149800256792 73.09949988173298 63574.0 47.75187547240789 0.0 - - - - - - - 947.8 127 5 GOLGA6L3;CCDC127;AP1AR;GOLGA6L10;PHF17;FBF1;OXNAD1 golgin A6 family-like 3;coiled-coil domain containing 127;adaptor-related protein complex 1 associated regulatory protein;golgin A6 family-like 10;PHD finger protein 17;Fas (TNFRSF6) binding factor 1;oxidoreductase NAD-binding domain containing 1 413 53 B20140408_SF107_03 B20140408_SF107_03 TB239605.[MT7]-TPTTLPR.2y4_1.heavy 465.28 / 486.303 7478.0 23.366300582885742 44 20 10 6 8 7.582126436791747 13.188912217917771 0.0391998291015625 4 0.9931692941880532 14.923890622823814 7478.0 5.231355748373101 1.0 - - - - - - - 1770.7142857142858 14 7 C6orf142 chromosome 6 open reading frame 142 415 53 B20140408_SF107_03 B20140408_SF107_03 TB239605.[MT7]-TPTTLPR.2y5_1.heavy 465.28 / 587.351 9322.0 23.366300582885742 44 20 10 6 8 7.582126436791747 13.188912217917771 0.0391998291015625 4 0.9931692941880532 14.923890622823814 9322.0 6.227440904419321 1.0 - - - - - - - 1199.857142857143 20 7 C6orf142 chromosome 6 open reading frame 142 417 53 B20140408_SF107_03 B20140408_SF107_03 TB239605.[MT7]-TPTTLPR.2y3_1.heavy 465.28 / 385.256 4200.0 23.366300582885742 44 20 10 6 8 7.582126436791747 13.188912217917771 0.0391998291015625 4 0.9931692941880532 14.923890622823814 4200.0 2.373878960022324 11.0 - - - - - - - 666.0 27 4 C6orf142 chromosome 6 open reading frame 142 419 53 B20140408_SF107_03 B20140408_SF107_03 TB239605.[MT7]-TPTTLPR.2y6_1.heavy 465.28 / 684.404 134914.0 23.366300582885742 44 20 10 6 8 7.582126436791747 13.188912217917771 0.0391998291015625 4 0.9931692941880532 14.923890622823814 134914.0 422.6345579268293 0.0 - - - - - - - 273.1666666666667 269 6 C6orf142 chromosome 6 open reading frame 142 421 54 B20140408_SF107_03 B20140408_SF107_03 TB239604.[MT7]-EGWGLQGLNK[MT7].3b4_1.heavy 463.929 / 574.274 104617.0 30.56220054626465 37 15 4 10 8 3.3290022051071033 30.039030868344746 0.0 4 0.951169656703415 5.562041371574107 104617.0 47.534254655513365 0.0 - - - - - - - 1253.0 209 5 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 423 54 B20140408_SF107_03 B20140408_SF107_03 TB239604.[MT7]-EGWGLQGLNK[MT7].3b5_1.heavy 463.929 / 687.358 41346.0 30.56220054626465 37 15 4 10 8 3.3290022051071033 30.039030868344746 0.0 4 0.951169656703415 5.562041371574107 41346.0 48.47488088251574 0.0 - - - - - - - 391.625 82 8 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 425 54 B20140408_SF107_03 B20140408_SF107_03 TB239604.[MT7]-EGWGLQGLNK[MT7].3b3_1.heavy 463.929 / 517.253 16131.0 30.56220054626465 37 15 4 10 8 3.3290022051071033 30.039030868344746 0.0 4 0.951169656703415 5.562041371574107 16131.0 7.7328620124466125 1.0 - - - - - - - 887.6666666666666 32 3 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 427 54 B20140408_SF107_03 B20140408_SF107_03 TB239604.[MT7]-EGWGLQGLNK[MT7].3y4_1.heavy 463.929 / 575.363 93184.0 30.56220054626465 37 15 4 10 8 3.3290022051071033 30.039030868344746 0.0 4 0.951169656703415 5.562041371574107 93184.0 44.80280376424083 1.0 - - - - - - - 2237.4285714285716 350 7 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 429 55 B20140408_SF107_03 B20140408_SF107_03 TB377429.[MT7]-DTDSEEEIR.2y8_1.heavy 619.287 / 978.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - CALM1;CALM2;CALM3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta) 431 55 B20140408_SF107_03 B20140408_SF107_03 TB377429.[MT7]-DTDSEEEIR.2b6_1.heavy 619.287 / 821.328 N/A N/A - - - - - - - - - 0.0 - - - - - - - CALM1;CALM2;CALM3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta) 433 55 B20140408_SF107_03 B20140408_SF107_03 TB377429.[MT7]-DTDSEEEIR.2y6_1.heavy 619.287 / 762.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - CALM1;CALM2;CALM3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta) 435 55 B20140408_SF107_03 B20140408_SF107_03 TB377429.[MT7]-DTDSEEEIR.2b7_1.heavy 619.287 / 950.371 N/A N/A - - - - - - - - - 0.0 - - - - - - - CALM1;CALM2;CALM3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta) 437 56 B20140408_SF107_03 B20140408_SF107_03 TB377223.[MT7]-NRGERR.2b3_1.heavy 466.269 / 472.275 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A36;BDP1 solute carrier family 25, member 36;B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB 439 56 B20140408_SF107_03 B20140408_SF107_03 TB377223.[MT7]-NRGERR.2y4_1.heavy 466.269 / 517.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A36;BDP1 solute carrier family 25, member 36;B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB 441 56 B20140408_SF107_03 B20140408_SF107_03 TB377223.[MT7]-NRGERR.2b4_1.heavy 466.269 / 601.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A36;BDP1 solute carrier family 25, member 36;B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB 443 56 B20140408_SF107_03 B20140408_SF107_03 TB377223.[MT7]-NRGERR.2b5_1.heavy 466.269 / 757.419 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A36;BDP1 solute carrier family 25, member 36;B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB 445 57 B20140408_SF107_03 B20140408_SF107_03 TB498324.[MT7]-HSVDLAEMVVEAEIFPVVLTC[CAM]LK[MT7].3y8_1.heavy 963.19 / 1073.65 4741.0 44.341400146484375 28 7 10 3 8 0.6334429730755576 89.3883329543925 0.07080078125 4 0.7388173557755797 2.360203363449305 4741.0 33.11062542304048 0.0 - - - - - - - 207.6 9 20 SPAG6 sperm associated antigen 6 447 57 B20140408_SF107_03 B20140408_SF107_03 TB498324.[MT7]-HSVDLAEMVVEAEIFPVVLTC[CAM]LK[MT7].3b8_1.heavy 963.19 / 1027.5 1837.0 44.341400146484375 28 7 10 3 8 0.6334429730755576 89.3883329543925 0.07080078125 4 0.7388173557755797 2.360203363449305 1837.0 -0.20663667041619793 1.0 - - - - - - - 181.10526315789474 3 19 SPAG6 sperm associated antigen 6 449 57 B20140408_SF107_03 B20140408_SF107_03 TB498324.[MT7]-HSVDLAEMVVEAEIFPVVLTC[CAM]LK[MT7].3b7_1.heavy 963.19 / 896.459 1600.0 44.341400146484375 28 7 10 3 8 0.6334429730755576 89.3883329543925 0.07080078125 4 0.7388173557755797 2.360203363449305 1600.0 0.1255886970172684 1.0 - - - - - - - 192.0 5 21 SPAG6 sperm associated antigen 6 451 57 B20140408_SF107_03 B20140408_SF107_03 TB498324.[MT7]-HSVDLAEMVVEAEIFPVVLTC[CAM]LK[MT7].3b4_1.heavy 963.19 / 583.296 711.0 44.341400146484375 28 7 10 3 8 0.6334429730755576 89.3883329543925 0.07080078125 4 0.7388173557755797 2.360203363449305 711.0 1.397752808988764 10.0 - - - - - - - 0.0 1 0 SPAG6 sperm associated antigen 6 453 58 B20140408_SF107_03 B20140408_SF107_03 TB377544.[MT7]-GMITFESIEK[MT7].3y3_1.heavy 481.598 / 533.341 58306.0 32.408599853515625 50 20 10 10 10 6.22512316836524 16.06393918568212 0.0 3 0.9913493018400845 13.259379883281948 58306.0 50.427951416839726 0.0 - - - - - - - 886.3333333333334 116 3 C9orf46 chromosome 9 open reading frame 46 455 58 B20140408_SF107_03 B20140408_SF107_03 TB377544.[MT7]-GMITFESIEK[MT7].3b4_1.heavy 481.598 / 547.303 91031.0 32.408599853515625 50 20 10 10 10 6.22512316836524 16.06393918568212 0.0 3 0.9913493018400845 13.259379883281948 91031.0 86.9943258315277 0.0 - - - - - - - 387.3333333333333 182 6 C9orf46 chromosome 9 open reading frame 46 457 58 B20140408_SF107_03 B20140408_SF107_03 TB377544.[MT7]-GMITFESIEK[MT7].3b5_1.heavy 481.598 / 694.371 43522.0 32.408599853515625 50 20 10 10 10 6.22512316836524 16.06393918568212 0.0 3 0.9913493018400845 13.259379883281948 43522.0 117.07670976785778 0.0 - - - - - - - 368.8888888888889 87 9 C9orf46 chromosome 9 open reading frame 46 459 58 B20140408_SF107_03 B20140408_SF107_03 TB377544.[MT7]-GMITFESIEK[MT7].3y4_1.heavy 481.598 / 620.374 115450.0 32.408599853515625 50 20 10 10 10 6.22512316836524 16.06393918568212 0.0 3 0.9913493018400845 13.259379883281948 115450.0 134.14180232358777 0.0 - - - - - - - 955.5 230 4 C9orf46 chromosome 9 open reading frame 46 461 59 B20140408_SF107_03 B20140408_SF107_03 TB498326.[MT7]-ESEWK[MT7]GPFYFILGADPQFGLIK[MT7].4y4_1.heavy 744.407 / 574.404 82598.0 42.320499420166016 44 14 10 10 10 2.0517268189272992 35.23300731721115 0.0 3 0.9314339615939693 4.6859166226754345 82598.0 37.873010211667676 1.0 - - - - - - - 651.5 175 2 CPPED1 calcineurin-like phosphoesterase domain containing 1 463 59 B20140408_SF107_03 B20140408_SF107_03 TB498326.[MT7]-ESEWK[MT7]GPFYFILGADPQFGLIK[MT7].4b8_2.heavy 744.407 / 625.326 27967.0 42.320499420166016 44 14 10 10 10 2.0517268189272992 35.23300731721115 0.0 3 0.9314339615939693 4.6859166226754345 27967.0 43.81191801434537 0.0 - - - - - - - 325.75 55 4 CPPED1 calcineurin-like phosphoesterase domain containing 1 465 59 B20140408_SF107_03 B20140408_SF107_03 TB498326.[MT7]-ESEWK[MT7]GPFYFILGADPQFGLIK[MT7].4b10_2.heavy 744.407 / 780.392 112269.0 42.320499420166016 44 14 10 10 10 2.0517268189272992 35.23300731721115 0.0 3 0.9314339615939693 4.6859166226754345 112269.0 70.28200273126707 0.0 - - - - - - - 301.0 224 1 CPPED1 calcineurin-like phosphoesterase domain containing 1 467 59 B20140408_SF107_03 B20140408_SF107_03 TB498326.[MT7]-ESEWK[MT7]GPFYFILGADPQFGLIK[MT7].4b9_2.heavy 744.407 / 706.858 62048.0 42.320499420166016 44 14 10 10 10 2.0517268189272992 35.23300731721115 0.0 3 0.9314339615939693 4.6859166226754345 62048.0 58.33036108067124 0.0 - - - - - - - 701.6666666666666 124 3 CPPED1 calcineurin-like phosphoesterase domain containing 1 469 60 B20140408_SF107_03 B20140408_SF107_03 TB377423.[MT7]-GYC[CAM]LIINNHNFAK[MT7].3b4_1.heavy 617.997 / 638.309 61784.0 29.94300079345703 43 13 10 10 10 1.4759856642747686 46.35814979853103 0.0 3 0.9203626101841003 4.343888401124348 61784.0 45.788692189380946 0.0 - - - - - - - 389.0 123 2 CASP8 caspase 8, apoptosis-related cysteine peptidase 471 60 B20140408_SF107_03 B20140408_SF107_03 TB377423.[MT7]-GYC[CAM]LIINNHNFAK[MT7].3b5_1.heavy 617.997 / 751.393 64741.0 29.94300079345703 43 13 10 10 10 1.4759856642747686 46.35814979853103 0.0 3 0.9203626101841003 4.343888401124348 64741.0 47.733759091469025 0.0 - - - - - - - 778.3333333333334 129 3 CASP8 caspase 8, apoptosis-related cysteine peptidase 473 60 B20140408_SF107_03 B20140408_SF107_03 TB377423.[MT7]-GYC[CAM]LIINNHNFAK[MT7].3y4_1.heavy 617.997 / 623.363 74390.0 29.94300079345703 43 13 10 10 10 1.4759856642747686 46.35814979853103 0.0 3 0.9203626101841003 4.343888401124348 74390.0 54.34998001103844 0.0 - - - - - - - 389.0 148 2 CASP8 caspase 8, apoptosis-related cysteine peptidase 475 60 B20140408_SF107_03 B20140408_SF107_03 TB377423.[MT7]-GYC[CAM]LIINNHNFAK[MT7].3b3_1.heavy 617.997 / 525.225 38595.0 29.94300079345703 43 13 10 10 10 1.4759856642747686 46.35814979853103 0.0 3 0.9203626101841003 4.343888401124348 38595.0 15.452257647223043 0.0 - - - - - - - 1245.0 77 4 CASP8 caspase 8, apoptosis-related cysteine peptidase 477 61 B20140408_SF107_03 B20140408_SF107_03 TB498067.[MT7]-ALAVGGLGSIIR.2y8_1.heavy 635.902 / 772.468 346381.0 34.63169860839844 47 17 10 10 10 4.052111817292351 24.678489762609928 0.0 3 0.9749071749682484 7.77454969769892 346381.0 252.21399784482756 0.0 - - - - - - - 348.0 692 3 ARPC5L actin related protein 2/3 complex, subunit 5-like 479 61 B20140408_SF107_03 B20140408_SF107_03 TB498067.[MT7]-ALAVGGLGSIIR.2y9_1.heavy 635.902 / 871.536 181106.0 34.63169860839844 47 17 10 10 10 4.052111817292351 24.678489762609928 0.0 3 0.9749071749682484 7.77454969769892 181106.0 186.7283102465861 0.0 - - - - - - - 232.0 362 3 ARPC5L actin related protein 2/3 complex, subunit 5-like 481 61 B20140408_SF107_03 B20140408_SF107_03 TB498067.[MT7]-ALAVGGLGSIIR.2y10_1.heavy 635.902 / 942.573 157272.0 34.63169860839844 47 17 10 10 10 4.052111817292351 24.678489762609928 0.0 3 0.9749071749682484 7.77454969769892 157272.0 271.15862068965515 0.0 - - - - - - - 243.6 314 5 ARPC5L actin related protein 2/3 complex, subunit 5-like 483 61 B20140408_SF107_03 B20140408_SF107_03 TB498067.[MT7]-ALAVGGLGSIIR.2y11_1.heavy 635.902 / 1055.66 120911.0 34.63169860839844 47 17 10 10 10 4.052111817292351 24.678489762609928 0.0 3 0.9749071749682484 7.77454969769892 120911.0 386.8225478927203 0.0 - - - - - - - 717.75 241 8 ARPC5L actin related protein 2/3 complex, subunit 5-like 485 62 B20140408_SF107_03 B20140408_SF107_03 TB377805.[MT7]-HHISIAEIYETELVDIEK[MT7].4y4_1.heavy 607.581 / 648.369 164362.0 35.43960189819336 38 8 10 10 10 0.5903064219393883 86.7159006947391 0.0 3 0.799678562510025 2.709984378610088 164362.0 83.90361698151807 0.0 - - - - - - - 826.0 328 3 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 487 62 B20140408_SF107_03 B20140408_SF107_03 TB377805.[MT7]-HHISIAEIYETELVDIEK[MT7].4b7_1.heavy 607.581 / 932.507 43114.0 35.43960189819336 38 8 10 10 10 0.5903064219393883 86.7159006947391 0.0 3 0.799678562510025 2.709984378610088 43114.0 90.91659206465943 0.0 - - - - - - - 330.3333333333333 86 9 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 489 62 B20140408_SF107_03 B20140408_SF107_03 TB377805.[MT7]-HHISIAEIYETELVDIEK[MT7].4y3_1.heavy 607.581 / 533.341 98948.0 35.43960189819336 38 8 10 10 10 0.5903064219393883 86.7159006947391 0.0 3 0.799678562510025 2.709984378610088 98948.0 58.66047469692901 0.0 - - - - - - - 826.0 197 1 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 491 62 B20140408_SF107_03 B20140408_SF107_03 TB377805.[MT7]-HHISIAEIYETELVDIEK[MT7].4b3_1.heavy 607.581 / 532.311 30395.0 35.43960189819336 38 8 10 10 10 0.5903064219393883 86.7159006947391 0.0 3 0.799678562510025 2.709984378610088 30395.0 20.675825291096015 0.0 - - - - - - - 496.0 60 1 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 493 63 B20140408_SF107_03 B20140408_SF107_03 TB239893.[MT7]-AQDDLIPAVDR.2y5_1.heavy 678.866 / 557.304 36769.0 29.15489959716797 45 15 10 10 10 2.28435460264963 34.640242047015356 0.0 3 0.9546645909058151 5.77416310084766 36769.0 31.238564093213263 0.0 - - - - - - - 150.0 73 1 C19orf66 chromosome 19 open reading frame 66 495 63 B20140408_SF107_03 B20140408_SF107_03 TB239893.[MT7]-AQDDLIPAVDR.2b4_1.heavy 678.866 / 574.259 27464.0 29.15489959716797 45 15 10 10 10 2.28435460264963 34.640242047015356 0.0 3 0.9546645909058151 5.77416310084766 27464.0 8.250413104308725 1.0 - - - - - - - 450.0 56 3 C19orf66 chromosome 19 open reading frame 66 497 63 B20140408_SF107_03 B20140408_SF107_03 TB239893.[MT7]-AQDDLIPAVDR.2b5_1.heavy 678.866 / 687.343 20260.0 29.15489959716797 45 15 10 10 10 2.28435460264963 34.640242047015356 0.0 3 0.9546645909058151 5.77416310084766 20260.0 77.6533358006415 0.0 - - - - - - - 270.0 40 5 C19orf66 chromosome 19 open reading frame 66 499 63 B20140408_SF107_03 B20140408_SF107_03 TB239893.[MT7]-AQDDLIPAVDR.2y7_1.heavy 678.866 / 783.472 16358.0 29.15489959716797 45 15 10 10 10 2.28435460264963 34.640242047015356 0.0 3 0.9546645909058151 5.77416310084766 16358.0 24.19980391371365 0.0 - - - - - - - 375.0 32 2 C19orf66 chromosome 19 open reading frame 66 501 64 B20140408_SF107_03 B20140408_SF107_03 TB377530.[MT7]-FFTFEQYK[MT7].2y4_1.heavy 699.371 / 711.379 9036.0 34.44609832763672 47 17 10 10 10 2.194837261634833 31.185886773436827 0.0 3 0.9741108635123268 7.653536346138112 9036.0 12.284564346681456 0.0 - - - - - - - 791.6666666666666 18 9 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 503 64 B20140408_SF107_03 B20140408_SF107_03 TB377530.[MT7]-FFTFEQYK[MT7].2y5_1.heavy 699.371 / 858.448 9905.0 34.44609832763672 47 17 10 10 10 2.194837261634833 31.185886773436827 0.0 3 0.9741108635123268 7.653536346138112 9905.0 29.88970626165628 0.0 - - - - - - - 243.6 19 10 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 505 64 B20140408_SF107_03 B20140408_SF107_03 TB377530.[MT7]-FFTFEQYK[MT7].2y6_1.heavy 699.371 / 959.495 7646.0 34.44609832763672 47 17 10 10 10 2.194837261634833 31.185886773436827 0.0 3 0.9741108635123268 7.653536346138112 7646.0 15.890384182127981 0.0 - - - - - - - 243.6 15 10 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 507 64 B20140408_SF107_03 B20140408_SF107_03 TB377530.[MT7]-FFTFEQYK[MT7].2y7_1.heavy 699.371 / 1106.56 7820.0 34.44609832763672 47 17 10 10 10 2.194837261634833 31.185886773436827 0.0 3 0.9741108635123268 7.653536346138112 7820.0 55.75547686809187 1.0 - - - - - - - 217.5 15 8 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 509 65 B20140408_SF107_03 B20140408_SF107_03 TB377214.[MT7]-SFFASGR.2y4_1.heavy 458.244 / 390.21 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A15;SLC25A2 solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15;solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 2 511 65 B20140408_SF107_03 B20140408_SF107_03 TB377214.[MT7]-SFFASGR.2b3_1.heavy 458.244 / 526.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A15;SLC25A2 solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15;solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 2 513 65 B20140408_SF107_03 B20140408_SF107_03 TB377214.[MT7]-SFFASGR.2y5_1.heavy 458.244 / 537.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC25A15;SLC25A2 solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15;solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 2 515 66 B20140408_SF107_03 B20140408_SF107_03 TB239894.[MT7]-EALADEADRAR.3y10_2.heavy 454.236 / 544.278 49723.0 22.165300369262695 46 16 10 10 10 1.8127131289049618 43.95654986116613 0.0 3 0.9621827304469754 6.326143562085887 49723.0 44.595408226485006 1.0 - - - - - - - 965.0 99 1 MAGEF1 melanoma antigen family F, 1 517 66 B20140408_SF107_03 B20140408_SF107_03 TB239894.[MT7]-EALADEADRAR.3b4_1.heavy 454.236 / 529.31 20959.0 22.165300369262695 46 16 10 10 10 1.8127131289049618 43.95654986116613 0.0 3 0.9621827304469754 6.326143562085887 20959.0 17.135362761437396 0.0 - - - - - - - 1340.4285714285713 41 7 MAGEF1 melanoma antigen family F, 1 519 66 B20140408_SF107_03 B20140408_SF107_03 TB239894.[MT7]-EALADEADRAR.3b5_1.heavy 454.236 / 644.337 64017.0 22.165300369262695 46 16 10 10 10 1.8127131289049618 43.95654986116613 0.0 3 0.9621827304469754 6.326143562085887 64017.0 59.643572059007155 0.0 - - - - - - - 325.42857142857144 128 7 MAGEF1 melanoma antigen family F, 1 521 66 B20140408_SF107_03 B20140408_SF107_03 TB239894.[MT7]-EALADEADRAR.3b3_1.heavy 454.236 / 458.273 39550.0 22.165300369262695 46 16 10 10 10 1.8127131289049618 43.95654986116613 0.0 3 0.9621827304469754 6.326143562085887 39550.0 41.098261827895804 1.0 - - - - - - - 1190.0 79 7 MAGEF1 melanoma antigen family F, 1 523 67 B20140408_SF107_03 B20140408_SF107_03 TB239810.[MT7]-EAFSLFDK[MT7].2y5_1.heavy 622.842 / 753.426 29200.0 33.773101806640625 50 20 10 10 10 37.33986631433217 2.6781027858585817 0.0 3 0.999092093654189 40.95519331921154 29200.0 51.54607177497575 0.0 - - - - - - - 706.1111111111111 58 9 CALM1;CALM2;CALM3;CALML3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 525 67 B20140408_SF107_03 B20140408_SF107_03 TB239810.[MT7]-EAFSLFDK[MT7].2b4_1.heavy 622.842 / 579.289 14256.0 33.773101806640625 50 20 10 10 10 37.33986631433217 2.6781027858585817 0.0 3 0.999092093654189 40.95519331921154 14256.0 9.156478052065427 0.0 - - - - - - - 1202.3333333333333 28 3 CALM1;CALM2;CALM3;CALML3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 527 67 B20140408_SF107_03 B20140408_SF107_03 TB239810.[MT7]-EAFSLFDK[MT7].2y3_1.heavy 622.842 / 553.31 28341.0 33.773101806640625 50 20 10 10 10 37.33986631433217 2.6781027858585817 0.0 3 0.999092093654189 40.95519331921154 28341.0 30.524826709501923 1.0 - - - - - - - 708.5 56 8 CALM1;CALM2;CALM3;CALML3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 529 67 B20140408_SF107_03 B20140408_SF107_03 TB239810.[MT7]-EAFSLFDK[MT7].2y7_1.heavy 622.842 / 971.532 24562.0 33.773101806640625 50 20 10 10 10 37.33986631433217 2.6781027858585817 0.0 3 0.999092093654189 40.95519331921154 24562.0 85.2026155051658 0.0 - - - - - - - 215.0 49 8 CALM1;CALM2;CALM3;CALML3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta);calmodulin-like 3 531 68 B20140408_SF107_03 B20140408_SF107_03 TB377674.[MT7]-NQTSISQWVPVC[CAM]SR.3b4_1.heavy 602.641 / 575.291 42289.0 31.401100158691406 50 20 10 10 10 6.942508681087613 14.404015118110593 0.0 3 0.9942379901423183 16.250495829492973 42289.0 25.036428378824365 0.0 - - - - - - - 954.0 84 1 UQCC ubiquinol-cytochrome c reductase complex chaperone 533 68 B20140408_SF107_03 B20140408_SF107_03 TB377674.[MT7]-NQTSISQWVPVC[CAM]SR.3b5_1.heavy 602.641 / 688.375 38791.0 31.401100158691406 50 20 10 10 10 6.942508681087613 14.404015118110593 0.0 3 0.9942379901423183 16.250495829492973 38791.0 19.431908725910894 0.0 - - - - - - - 318.0 77 1 UQCC ubiquinol-cytochrome c reductase complex chaperone 535 68 B20140408_SF107_03 B20140408_SF107_03 TB377674.[MT7]-NQTSISQWVPVC[CAM]SR.3y4_1.heavy 602.641 / 521.25 18442.0 31.401100158691406 50 20 10 10 10 6.942508681087613 14.404015118110593 0.0 3 0.9942379901423183 16.250495829492973 18442.0 12.346216631726065 0.0 - - - - - - - 318.0 36 2 UQCC ubiquinol-cytochrome c reductase complex chaperone 537 68 B20140408_SF107_03 B20140408_SF107_03 TB377674.[MT7]-NQTSISQWVPVC[CAM]SR.3y5_1.heavy 602.641 / 618.303 350712.0 31.401100158691406 50 20 10 10 10 6.942508681087613 14.404015118110593 0.0 3 0.9942379901423183 16.250495829492973 350712.0 110.78582595973013 0.0 - - - - - - - 874.5 701 2 UQCC ubiquinol-cytochrome c reductase complex chaperone 539 69 B20140408_SF107_03 B20140408_SF107_03 TB377804.[MT7]-MQDFWSLLTFSSDLVDVK[MT7].3y3_1.heavy 807.087 / 505.31 16523.0 45.8217248916626 35 8 10 7 10 0.8868630661382796 77.70662870662579 0.022899627685546875 3 0.7796095183553616 2.5789704719095297 16523.0 42.32781888616413 0.0 - - - - - - - 651.5833333333334 33 12 STAG3L4 stromal antigen 3-like 4 541 69 B20140408_SF107_03 B20140408_SF107_03 TB377804.[MT7]-MQDFWSLLTFSSDLVDVK[MT7].3b6_1.heavy 807.087 / 939.415 9410.0 45.8217248916626 35 8 10 7 10 0.8868630661382796 77.70662870662579 0.022899627685546875 3 0.7796095183553616 2.5789704719095297 9410.0 48.578497195924214 0.0 - - - - - - - 191.91764705882352 18 85 STAG3L4 stromal antigen 3-like 4 543 69 B20140408_SF107_03 B20140408_SF107_03 TB377804.[MT7]-MQDFWSLLTFSSDLVDVK[MT7].3b4_1.heavy 807.087 / 666.304 9410.0 45.8217248916626 35 8 10 7 10 0.8868630661382796 77.70662870662579 0.022899627685546875 3 0.7796095183553616 2.5789704719095297 9410.0 19.229500258264466 0.0 - - - - - - - 611.0 18 7 STAG3L4 stromal antigen 3-like 4 545 69 B20140408_SF107_03 B20140408_SF107_03 TB377804.[MT7]-MQDFWSLLTFSSDLVDVK[MT7].3b3_1.heavy 807.087 / 519.235 6878.0 45.8217248916626 35 8 10 7 10 0.8868630661382796 77.70662870662579 0.022899627685546875 3 0.7796095183553616 2.5789704719095297 6878.0 34.83670190553639 0.0 - - - - - - - 291.5529411764706 13 85 STAG3L4 stromal antigen 3-like 4 547 70 B20140408_SF107_03 B20140408_SF107_03 TB377311.[MT7]-AASC[CAM]GEGK[MT7].2y6_1.heavy 534.273 / 781.363 1818.0 17.085800170898438 40 20 0 10 10 6.907184398944683 14.477679214019325 0.0 3 0.9952281202333981 17.85849152875704 1818.0 33.816070248324046 0.0 - - - - - - - 123.5 3 14 CIAPIN1 cytokine induced apoptosis inhibitor 1 549 70 B20140408_SF107_03 B20140408_SF107_03 TB377311.[MT7]-AASC[CAM]GEGK[MT7].2y5_1.heavy 534.273 / 694.331 1103.0 17.085800170898438 40 20 0 10 10 6.907184398944683 14.477679214019325 0.0 3 0.9952281202333981 17.85849152875704 1103.0 17.13108342225849 0.0 - - - - - - - 84.0625 2 16 CIAPIN1 cytokine induced apoptosis inhibitor 1 551 70 B20140408_SF107_03 B20140408_SF107_03 TB377311.[MT7]-AASC[CAM]GEGK[MT7].2b6_1.heavy 534.273 / 720.31 N/A 17.085800170898438 40 20 0 10 10 6.907184398944683 14.477679214019325 0.0 3 0.9952281202333981 17.85849152875704 1341.0 2.7375 9.0 - - - - - - - 244.6315789473684 18 19 CIAPIN1 cytokine induced apoptosis inhibitor 1 553 70 B20140408_SF107_03 B20140408_SF107_03 TB377311.[MT7]-AASC[CAM]GEGK[MT7].2y7_1.heavy 534.273 / 852.4 2503.0 17.085800170898438 40 20 0 10 10 6.907184398944683 14.477679214019325 0.0 3 0.9952281202333981 17.85849152875704 2503.0 108.12960000000001 0.0 - - - - - - - 119.33333333333333 5 9 CIAPIN1 cytokine induced apoptosis inhibitor 1 555 71 B20140408_SF107_03 B20140408_SF107_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 2641550.0 20.568500518798828 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2641550.0 4108.295683893742 0.0 - - - - - - - 1788.125 5283 8 557 71 B20140408_SF107_03 B20140408_SF107_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 1622210.0 20.568500518798828 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1622210.0 2702.9009933297525 0.0 - - - - - - - 894.0 3244 4 559 71 B20140408_SF107_03 B20140408_SF107_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 1471630.0 20.568500518798828 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1471630.0 1008.054146590712 0.0 - - - - - - - 1238.0 2943 8 561 72 B20140408_SF107_03 B20140408_SF107_03 TB239611.[MT7]-FTIAAK[MT7].2b3_1.heavy 469.799 / 506.31 48662.0 27.181499481201172 48 20 10 10 8 5.124743125913893 19.51317315678472 0.0 4 0.9916814141444388 13.521849511996281 48662.0 32.61764492753623 1.0 - - - - - - - 436.0 308 1 NAPB;NAPA N-ethylmaleimide-sensitive factor attachment protein, beta;N-ethylmaleimide-sensitive factor attachment protein, alpha 563 72 B20140408_SF107_03 B20140408_SF107_03 TB239611.[MT7]-FTIAAK[MT7].2y4_1.heavy 469.799 / 546.373 82362.0 27.181499481201172 48 20 10 10 8 5.124743125913893 19.51317315678472 0.0 4 0.9916814141444388 13.521849511996281 82362.0 9.62532121379819 0.0 - - - - - - - 3922.0 164 1 NAPB;NAPA N-ethylmaleimide-sensitive factor attachment protein, beta;N-ethylmaleimide-sensitive factor attachment protein, alpha 565 72 B20140408_SF107_03 B20140408_SF107_03 TB239611.[MT7]-FTIAAK[MT7].2y5_1.heavy 469.799 / 647.421 157316.0 27.181499481201172 48 20 10 10 8 5.124743125913893 19.51317315678472 0.0 4 0.9916814141444388 13.521849511996281 157316.0 69.39709427794008 0.0 - - - - - - - 1815.5 314 2 NAPB;NAPA N-ethylmaleimide-sensitive factor attachment protein, beta;N-ethylmaleimide-sensitive factor attachment protein, alpha 567 72 B20140408_SF107_03 B20140408_SF107_03 TB239611.[MT7]-FTIAAK[MT7].2b4_1.heavy 469.799 / 577.347 50841.0 27.181499481201172 48 20 10 10 8 5.124743125913893 19.51317315678472 0.0 4 0.9916814141444388 13.521849511996281 50841.0 28.020772971002224 1.0 - - - - - - - 872.0 107 1 NAPB;NAPA N-ethylmaleimide-sensitive factor attachment protein, beta;N-ethylmaleimide-sensitive factor attachment protein, alpha 569 73 B20140408_SF107_03 B20140408_SF107_03 TB239813.[MT7]-ELALQEEK[MT7].3y3_1.heavy 416.574 / 549.3 530787.0 25.924999237060547 50 20 10 10 10 8.295843223358036 12.054229727779434 0.0 3 0.9932628945800416 15.027321311555909 530787.0 199.43554045092839 0.0 - - - - - - - 678.0 1061 2 AP1AR adaptor-related protein complex 1 associated regulatory protein 571 73 B20140408_SF107_03 B20140408_SF107_03 TB239813.[MT7]-ELALQEEK[MT7].3b4_1.heavy 416.574 / 571.357 413314.0 25.924999237060547 50 20 10 10 10 8.295843223358036 12.054229727779434 0.0 3 0.9932628945800416 15.027321311555909 413314.0 204.14329524511612 0.0 - - - - - - - 1492.0 826 1 AP1AR adaptor-related protein complex 1 associated regulatory protein 573 73 B20140408_SF107_03 B20140408_SF107_03 TB239813.[MT7]-ELALQEEK[MT7].3b5_1.heavy 416.574 / 699.416 56022.0 25.924999237060547 50 20 10 10 10 8.295843223358036 12.054229727779434 0.0 3 0.9932628945800416 15.027321311555909 56022.0 104.21826585636322 0.0 - - - - - - - 723.4444444444445 112 9 AP1AR adaptor-related protein complex 1 associated regulatory protein 575 73 B20140408_SF107_03 B20140408_SF107_03 TB239813.[MT7]-ELALQEEK[MT7].3b3_1.heavy 416.574 / 458.273 1483420.0 25.924999237060547 50 20 10 10 10 8.295843223358036 12.054229727779434 0.0 3 0.9932628945800416 15.027321311555909 1483420.0 310.64546320298825 0.0 - - - - - - - 2781.0 2966 2 AP1AR adaptor-related protein complex 1 associated regulatory protein 577 74 B20140408_SF107_03 B20140408_SF107_03 TB377678.[MT7]-EAEAMALLAEAERK[MT7].3b6_1.heavy 607.332 / 747.346 134953.0 33.355201721191406 45 15 10 10 10 1.7776614167686784 41.213703117734696 0.0 3 0.9577360780541405 5.981855224365726 134953.0 184.0350772799411 0.0 - - - - - - - 230.33333333333334 269 3 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 579 74 B20140408_SF107_03 B20140408_SF107_03 TB377678.[MT7]-EAEAMALLAEAERK[MT7].3y6_1.heavy 607.332 / 847.475 111311.0 33.355201721191406 45 15 10 10 10 1.7776614167686784 41.213703117734696 0.0 3 0.9577360780541405 5.981855224365726 111311.0 309.539794266316 0.0 - - - - - - - 302.0 222 4 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 581 74 B20140408_SF107_03 B20140408_SF107_03 TB377678.[MT7]-EAEAMALLAEAERK[MT7].3b4_1.heavy 607.332 / 545.269 100093.0 33.355201721191406 45 15 10 10 10 1.7776614167686784 41.213703117734696 0.0 3 0.9577360780541405 5.981855224365726 100093.0 55.948370824812535 0.0 - - - - - - - 345.0 200 1 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 583 74 B20140408_SF107_03 B20140408_SF107_03 TB377678.[MT7]-EAEAMALLAEAERK[MT7].3b5_1.heavy 607.332 / 676.309 61782.0 33.355201721191406 45 15 10 10 10 1.7776614167686784 41.213703117734696 0.0 3 0.9577360780541405 5.981855224365726 61782.0 51.65350450561363 0.0 - - - - - - - 345.0 123 1 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 585 75 B20140408_SF107_03 B20140408_SF107_03 TB240041.[MT7]-VAGYAALLEQYQK[MT7].3b6_1.heavy 581.329 / 677.374 906797.0 33.86000061035156 48 18 10 10 10 4.5215711303568 22.116206317893077 0.0 3 0.9823287744730076 9.270163840451996 906797.0 375.78642524412174 0.0 - - - - - - - 604.5 1813 2 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 587 75 B20140408_SF107_03 B20140408_SF107_03 TB240041.[MT7]-VAGYAALLEQYQK[MT7].3y4_1.heavy 581.329 / 710.395 174513.0 33.86000061035156 48 18 10 10 10 4.5215711303568 22.116206317893077 0.0 3 0.9823287744730076 9.270163840451996 174513.0 219.9433092890738 0.0 - - - - - - - 715.7142857142857 349 7 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 589 75 B20140408_SF107_03 B20140408_SF107_03 TB240041.[MT7]-VAGYAALLEQYQK[MT7].3y5_1.heavy 581.329 / 839.438 196111.0 33.86000061035156 48 18 10 10 10 4.5215711303568 22.116206317893077 0.0 3 0.9823287744730076 9.270163840451996 196111.0 191.64744608942826 0.0 - - - - - - - 302.75 392 4 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 591 75 B20140408_SF107_03 B20140408_SF107_03 TB240041.[MT7]-VAGYAALLEQYQK[MT7].3b7_1.heavy 581.329 / 790.458 407428.0 33.86000061035156 48 18 10 10 10 4.5215711303568 22.116206317893077 0.0 3 0.9823287744730076 9.270163840451996 407428.0 320.0596132053692 0.0 - - - - - - - 346.0 814 2 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 593 76 B20140408_SF107_03 B20140408_SF107_03 TB377319.[MT7]-LREMLIR.3y3_1.heavy 358.891 / 401.287 104938.0 28.576599597930908 34 13 10 1 10 1.7724463892552609 44.42238913680811 0.09319877624511719 3 0.9267260715639528 4.531055675959454 104938.0 161.33396140565543 0.0 - - - - - - - 1197.5714285714287 209 7 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 595 76 B20140408_SF107_03 B20140408_SF107_03 TB377319.[MT7]-LREMLIR.3b5_1.heavy 358.891 / 787.462 150.0 28.576599597930908 34 13 10 1 10 1.7724463892552609 44.42238913680811 0.09319877624511719 3 0.9267260715639528 4.531055675959454 150.0 1.5016722408026757 10.0 - - - - - - - 0.0 0 0 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 597 76 B20140408_SF107_03 B20140408_SF107_03 TB377319.[MT7]-LREMLIR.3y4_1.heavy 358.891 / 532.328 51496.0 28.576599597930908 34 13 10 1 10 1.7724463892552609 44.42238913680811 0.09319877624511719 3 0.9267260715639528 4.531055675959454 51496.0 95.60791210075685 0.0 - - - - - - - 726.8571428571429 102 7 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 599 76 B20140408_SF107_03 B20140408_SF107_03 TB377319.[MT7]-LREMLIR.3b5_2.heavy 358.891 / 394.234 68562.0 28.576599597930908 34 13 10 1 10 1.7724463892552609 44.42238913680811 0.09319877624511719 3 0.9267260715639528 4.531055675959454 68562.0 128.28961403437154 0.0 - - - - - - - 187.375 137 8 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 601 77 B20140408_SF107_03 B20140408_SF107_03 TB377679.[MT7]-GIEDDLMDLIK[MT7]K[MT7].3b6_1.heavy 608.017 / 787.395 253333.0 36.276798248291016 43 13 10 10 10 1.4406026336859878 69.41539440625324 0.0 3 0.910515613500129 4.094451296046928 253333.0 98.16335479742807 0.0 - - - - - - - 389.0 506 2 CPPED1 calcineurin-like phosphoesterase domain containing 1 603 77 B20140408_SF107_03 B20140408_SF107_03 TB377679.[MT7]-GIEDDLMDLIK[MT7]K[MT7].3b5_1.heavy 608.017 / 674.311 406671.0 36.276798248291016 43 13 10 10 10 1.4406026336859878 69.41539440625324 0.0 3 0.910515613500129 4.094451296046928 406671.0 250.1015342388476 0.0 - - - - - - - 467.0 813 1 CPPED1 calcineurin-like phosphoesterase domain containing 1 605 77 B20140408_SF107_03 B20140408_SF107_03 TB377679.[MT7]-GIEDDLMDLIK[MT7]K[MT7].3y4_1.heavy 608.017 / 789.58 9797.0 36.276798248291016 43 13 10 10 10 1.4406026336859878 69.41539440625324 0.0 3 0.910515613500129 4.094451296046928 9797.0 18.265263806115108 0.0 - - - - - - - 378.14285714285717 19 7 CPPED1 calcineurin-like phosphoesterase domain containing 1 607 77 B20140408_SF107_03 B20140408_SF107_03 TB377679.[MT7]-GIEDDLMDLIK[MT7]K[MT7].3b8_1.heavy 608.017 / 1033.46 2022.0 36.276798248291016 43 13 10 10 10 1.4406026336859878 69.41539440625324 0.0 3 0.910515613500129 4.094451296046928 2022.0 17.646863715063073 2.0 - - - - - - - 280.26666666666665 8 15 CPPED1 calcineurin-like phosphoesterase domain containing 1 609 78 B20140408_SF107_03 B20140408_SF107_03 TB377536.[MT7]-LIMEDFVQQR.2y8_1.heavy 711.88 / 1052.48 19262.0 34.81890106201172 48 18 10 10 10 4.532149119204702 22.06458732265807 0.0 3 0.9876392334716276 11.088972328246752 19262.0 130.84482840236686 0.0 - - - - - - - 202.8 38 5 MAGEF1 melanoma antigen family F, 1 611 78 B20140408_SF107_03 B20140408_SF107_03 TB377536.[MT7]-LIMEDFVQQR.2y5_1.heavy 711.88 / 677.373 13686.0 34.81890106201172 48 18 10 10 10 4.532149119204702 22.06458732265807 0.0 3 0.9876392334716276 11.088972328246752 13686.0 10.069055367092115 0.0 - - - - - - - 732.3333333333334 27 3 MAGEF1 melanoma antigen family F, 1 613 78 B20140408_SF107_03 B20140408_SF107_03 TB377536.[MT7]-LIMEDFVQQR.2y9_1.heavy 711.88 / 1165.57 12334.0 34.81890106201172 48 18 10 10 10 4.532149119204702 22.06458732265807 0.0 3 0.9876392334716276 11.088972328246752 12334.0 49.84687573964497 0.0 - - - - - - - 244.11111111111111 24 9 MAGEF1 melanoma antigen family F, 1 615 78 B20140408_SF107_03 B20140408_SF107_03 TB377536.[MT7]-LIMEDFVQQR.2b5_1.heavy 711.88 / 746.388 11151.0 34.81890106201172 48 18 10 10 10 4.532149119204702 22.06458732265807 0.0 3 0.9876392334716276 11.088972328246752 11151.0 12.443929190231785 0.0 - - - - - - - 1158.857142857143 22 7 MAGEF1 melanoma antigen family F, 1 617 79 B20140408_SF107_03 B20140408_SF107_03 TB377538.[MT7]-HHTYILINK[MT7].3y3_1.heavy 476.285 / 518.342 56612.0 25.365800857543945 50 20 10 10 10 4.995244394089818 20.019040533495453 0.0 3 0.9947871012858259 17.085743598787744 56612.0 22.704122176367644 0.0 - - - - - - - 1246.0 113 3 MAGEF1 melanoma antigen family F, 1 619 79 B20140408_SF107_03 B20140408_SF107_03 TB377538.[MT7]-HHTYILINK[MT7].3b4_1.heavy 476.285 / 683.338 13752.0 25.365800857543945 50 20 10 10 10 4.995244394089818 20.019040533495453 0.0 3 0.9947871012858259 17.085743598787744 13752.0 14.229434989788972 0.0 - - - - - - - 707.8 27 10 MAGEF1 melanoma antigen family F, 1 621 79 B20140408_SF107_03 B20140408_SF107_03 TB377538.[MT7]-HHTYILINK[MT7].3b3_1.heavy 476.285 / 520.275 11750.0 25.365800857543945 50 20 10 10 10 4.995244394089818 20.019040533495453 0.0 3 0.9947871012858259 17.085743598787744 11750.0 6.5753252430694795 2.0 - - - - - - - 935.0 29 3 MAGEF1 melanoma antigen family F, 1 623 79 B20140408_SF107_03 B20140408_SF107_03 TB377538.[MT7]-HHTYILINK[MT7].3y4_1.heavy 476.285 / 631.426 30976.0 25.365800857543945 50 20 10 10 10 4.995244394089818 20.019040533495453 0.0 3 0.9947871012858259 17.085743598787744 30976.0 24.030492554777283 0.0 - - - - - - - 401.0 61 2 MAGEF1 melanoma antigen family F, 1 625 80 B20140408_SF107_03 B20140408_SF107_03 TB498317.[MT7]-C[CAM]TY[MT7]LPALEPFLYDAPPNILK[MT7].4y5_1.heavy 692.633 / 728.479 16620.0 38.448699951171875 36 11 9 10 6 1.045222924718271 62.710542650640335 0.0 6 0.8768595848741474 3.4801766862062338 16620.0 26.605576073494298 0.0 - - - - - - - 1174.25 33 8 SPAG6 sperm associated antigen 6 627 80 B20140408_SF107_03 B20140408_SF107_03 TB498317.[MT7]-C[CAM]TY[MT7]LPALEPFLYDAPPNILK[MT7].4b4_1.heavy 692.633 / 826.437 4625.0 38.448699951171875 36 11 9 10 6 1.045222924718271 62.710542650640335 0.0 6 0.8768595848741474 3.4801766862062338 4625.0 3.0045616292690833 3.0 - - - - - - - 1228.5 21 8 SPAG6 sperm associated antigen 6 629 80 B20140408_SF107_03 B20140408_SF107_03 TB498317.[MT7]-C[CAM]TY[MT7]LPALEPFLYDAPPNILK[MT7].4y6_1.heavy 692.633 / 825.531 13152.0 38.448699951171875 36 11 9 10 6 1.045222924718271 62.710542650640335 0.0 6 0.8768595848741474 3.4801766862062338 13152.0 7.2813840830449825 2.0 - - - - - - - 241.33333333333334 40 3 SPAG6 sperm associated antigen 6 631 80 B20140408_SF107_03 B20140408_SF107_03 TB498317.[MT7]-C[CAM]TY[MT7]LPALEPFLYDAPPNILK[MT7].4b3_1.heavy 692.633 / 713.353 2746.0 38.448699951171875 36 11 9 10 6 1.045222924718271 62.710542650640335 0.0 6 0.8768595848741474 3.4801766862062338 2746.0 1.5836216839677046 1.0 - - - - - - - 409.8333333333333 6 6 SPAG6 sperm associated antigen 6 633 81 B20140408_SF107_03 B20140408_SF107_03 TB498134.[MT7]-DNTLEPPVELYFPAQLR.3y7_1.heavy 716.048 / 894.483 41785.0 38.3140983581543 45 15 10 10 10 3.8490390522951747 25.98051062650824 0.0 3 0.9555564611375246 5.832252519572875 41785.0 38.64835539604114 0.0 - - - - - - - 291.0 83 3 C6orf142 chromosome 6 open reading frame 142 635 81 B20140408_SF107_03 B20140408_SF107_03 TB498134.[MT7]-DNTLEPPVELYFPAQLR.3y6_1.heavy 716.048 / 731.42 74543.0 38.3140983581543 45 15 10 10 10 3.8490390522951747 25.98051062650824 0.0 3 0.9555564611375246 5.832252519572875 74543.0 33.64351804955853 0.0 - - - - - - - 291.0 149 1 C6orf142 chromosome 6 open reading frame 142 637 81 B20140408_SF107_03 B20140408_SF107_03 TB498134.[MT7]-DNTLEPPVELYFPAQLR.3y8_1.heavy 716.048 / 1007.57 15287.0 38.3140983581543 45 15 10 10 10 3.8490390522951747 25.98051062650824 0.0 3 0.9555564611375246 5.832252519572875 15287.0 25.571246252500202 0.0 - - - - - - - 267.1666666666667 30 6 C6orf142 chromosome 6 open reading frame 142 639 81 B20140408_SF107_03 B20140408_SF107_03 TB498134.[MT7]-DNTLEPPVELYFPAQLR.3y9_1.heavy 716.048 / 1136.61 11211.0 38.3140983581543 45 15 10 10 10 3.8490390522951747 25.98051062650824 0.0 3 0.9555564611375246 5.832252519572875 11211.0 48.75759851481643 0.0 - - - - - - - 769.7142857142857 22 7 C6orf142 chromosome 6 open reading frame 142 641 82 B20140408_SF107_03 B20140408_SF107_03 TB240119.[MT7]-GINTLVTYDMVPEPK[MT7].2b4_1.heavy 983.034 / 530.305 8812.0 33.88159942626953 37 12 10 5 10 1.2080083431222128 55.18725681509806 0.0431976318359375 3 0.8964986340677583 3.8025095431340605 8812.0 19.901189403689404 0.0 - - - - - - - 207.6 17 5 COX5A cytochrome c oxidase subunit Va 643 82 B20140408_SF107_03 B20140408_SF107_03 TB240119.[MT7]-GINTLVTYDMVPEPK[MT7].2b6_1.heavy 983.034 / 742.458 16414.0 33.88159942626953 37 12 10 5 10 1.2080083431222128 55.18725681509806 0.0431976318359375 3 0.8964986340677583 3.8025095431340605 16414.0 49.73982471824729 0.0 - - - - - - - 230.66666666666666 32 6 COX5A cytochrome c oxidase subunit Va 645 82 B20140408_SF107_03 B20140408_SF107_03 TB240119.[MT7]-GINTLVTYDMVPEPK[MT7].2b5_1.heavy 983.034 / 643.39 13650.0 33.88159942626953 37 12 10 5 10 1.2080083431222128 55.18725681509806 0.0431976318359375 3 0.8964986340677583 3.8025095431340605 13650.0 25.143710489660343 0.0 - - - - - - - 288.3333333333333 27 6 COX5A cytochrome c oxidase subunit Va 647 82 B20140408_SF107_03 B20140408_SF107_03 TB240119.[MT7]-GINTLVTYDMVPEPK[MT7].2b9_1.heavy 983.034 / 1121.6 3456.0 33.88159942626953 37 12 10 5 10 1.2080083431222128 55.18725681509806 0.0431976318359375 3 0.8964986340677583 3.8025095431340605 3456.0 9.089248554913295 1.0 - - - - - - - 237.875 6 8 COX5A cytochrome c oxidase subunit Va 649 83 B20140408_SF107_03 B20140408_SF107_03 TB498242.[MT7]-AFAAIPTNTLLLEQK[MT7].3b4_1.heavy 640.047 / 505.289 384895.0 35.119998931884766 44 14 10 10 10 2.7417738609462488 36.47273811469182 0.0 3 0.9469606557907834 5.3348817285794645 384895.0 73.55243806637233 0.0 - - - - - - - 845.0 769 2 C6orf142 chromosome 6 open reading frame 142 651 83 B20140408_SF107_03 B20140408_SF107_03 TB498242.[MT7]-AFAAIPTNTLLLEQK[MT7].3b5_1.heavy 640.047 / 618.373 347892.0 35.119998931884766 44 14 10 10 10 2.7417738609462488 36.47273811469182 0.0 3 0.9469606557907834 5.3348817285794645 347892.0 177.57017406051952 0.0 - - - - - - - 845.0 695 1 C6orf142 chromosome 6 open reading frame 142 653 83 B20140408_SF107_03 B20140408_SF107_03 TB498242.[MT7]-AFAAIPTNTLLLEQK[MT7].3y4_1.heavy 640.047 / 661.4 218129.0 35.119998931884766 44 14 10 10 10 2.7417738609462488 36.47273811469182 0.0 3 0.9469606557907834 5.3348817285794645 218129.0 102.82219901890087 0.0 - - - - - - - 591.5 436 2 C6orf142 chromosome 6 open reading frame 142 655 83 B20140408_SF107_03 B20140408_SF107_03 TB498242.[MT7]-AFAAIPTNTLLLEQK[MT7].3y5_1.heavy 640.047 / 774.484 143279.0 35.119998931884766 44 14 10 10 10 2.7417738609462488 36.47273811469182 0.0 3 0.9469606557907834 5.3348817285794645 143279.0 120.03428310932233 0.0 - - - - - - - 169.0 286 1 C6orf142 chromosome 6 open reading frame 142 657 84 B20140408_SF107_03 B20140408_SF107_03 TB240017.[MT7]-MWGLAEFHC[CAM]PK[MT7].3y3_1.heavy 555.282 / 548.298 40036.0 32.30830001831055 34 12 6 10 6 2.612045133477381 38.28417768067864 0.0 5 0.8816427202128351 3.5512830463323852 40036.0 27.48225481844036 0.0 - - - - - - - 965.0 80 1 C19orf66 chromosome 19 open reading frame 66 659 84 B20140408_SF107_03 B20140408_SF107_03 TB240017.[MT7]-MWGLAEFHC[CAM]PK[MT7].3b4_1.heavy 555.282 / 632.335 17204.0 32.30830001831055 34 12 6 10 6 2.612045133477381 38.28417768067864 0.0 5 0.8816427202128351 3.5512830463323852 17204.0 12.96853628974502 1.0 - - - - - - - 402.0 39 2 C19orf66 chromosome 19 open reading frame 66 661 84 B20140408_SF107_03 B20140408_SF107_03 TB240017.[MT7]-MWGLAEFHC[CAM]PK[MT7].3b5_1.heavy 555.282 / 703.372 15918.0 32.30830001831055 34 12 6 10 6 2.612045133477381 38.28417768067864 0.0 5 0.8816427202128351 3.5512830463323852 15918.0 18.56687402799378 2.0 - - - - - - - 804.0 116 3 C19orf66 chromosome 19 open reading frame 66 663 84 B20140408_SF107_03 B20140408_SF107_03 TB240017.[MT7]-MWGLAEFHC[CAM]PK[MT7].3b3_1.heavy 555.282 / 519.251 13184.0 32.30830001831055 34 12 6 10 6 2.612045133477381 38.28417768067864 0.0 5 0.8816427202128351 3.5512830463323852 13184.0 8.925311854413778 0.0 - - - - - - - 1768.5 26 2 C19orf66 chromosome 19 open reading frame 66 665 85 B20140408_SF107_03 B20140408_SF107_03 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 2067920.0 33.257598876953125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2067920.0 173.16513767357085 0.0 - - - - - - - 170.0 4135 1 667 85 B20140408_SF107_03 B20140408_SF107_03 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 1015970.0 33.257598876953125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1015970.0 110.73272384014513 0.0 - - - - - - - 272.0 2031 5 669 85 B20140408_SF107_03 B20140408_SF107_03 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1476650.0 33.257598876953125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1476650.0 183.70188418797557 0.0 - - - - - - - 646.0 2953 5 671 86 B20140408_SF107_03 B20140408_SF107_03 TB377480.[MT7]-QIRVDHAGK[MT7].3b5_1.heavy 437.929 / 756.448 10394.0 19.61709976196289 45 15 10 10 10 4.630895151775519 21.594097193424748 0.0 3 0.954792762215043 5.7824055507751995 10394.0 46.70235379983578 0.0 - - - - - - - 200.3 20 20 RBM3 RNA binding motif (RNP1, RRM) protein 3 673 86 B20140408_SF107_03 B20140408_SF107_03 TB377480.[MT7]-QIRVDHAGK[MT7].3b5_2.heavy 437.929 / 378.728 213306.0 19.61709976196289 45 15 10 10 10 4.630895151775519 21.594097193424748 0.0 3 0.954792762215043 5.7824055507751995 213306.0 46.392425659449096 0.0 - - - - - - - 2194.714285714286 426 7 RBM3 RNA binding motif (RNP1, RRM) protein 3 675 86 B20140408_SF107_03 B20140408_SF107_03 TB377480.[MT7]-QIRVDHAGK[MT7].3y4_1.heavy 437.929 / 556.332 92321.0 19.61709976196289 45 15 10 10 10 4.630895151775519 21.594097193424748 0.0 3 0.954792762215043 5.7824055507751995 92321.0 84.01531742001015 0.0 - - - - - - - 1329.8 184 10 RBM3 RNA binding motif (RNP1, RRM) protein 3 677 86 B20140408_SF107_03 B20140408_SF107_03 TB377480.[MT7]-QIRVDHAGK[MT7].3y8_2.heavy 437.929 / 520.31 25307.0 19.61709976196289 45 15 10 10 10 4.630895151775519 21.594097193424748 0.0 3 0.954792762215043 5.7824055507751995 25307.0 11.788926759279786 0.0 - - - - - - - 1226.75 50 8 RBM3 RNA binding motif (RNP1, RRM) protein 3 679 87 B20140408_SF107_03 B20140408_SF107_03 TB239867.[MT7]-DGQQIPVFK[MT7].3y3_1.heavy 440.59 / 537.352 45243.0 28.97369956970215 47 17 10 10 10 2.58180063295341 30.8810786896587 0.0 3 0.9766156910922514 8.054714323271751 45243.0 38.46218715953616 1.0 - - - - - - - 799.0 240 3 C7orf44 chromosome 7 open reading frame 44 681 87 B20140408_SF107_03 B20140408_SF107_03 TB239867.[MT7]-DGQQIPVFK[MT7].3b4_1.heavy 440.59 / 573.275 198802.0 28.97369956970215 47 17 10 10 10 2.58180063295341 30.8810786896587 0.0 3 0.9766156910922514 8.054714323271751 198802.0 116.82043945510168 0.0 - - - - - - - 899.0 397 1 C7orf44 chromosome 7 open reading frame 44 683 87 B20140408_SF107_03 B20140408_SF107_03 TB239867.[MT7]-DGQQIPVFK[MT7].3y4_1.heavy 440.59 / 634.404 178277.0 28.97369956970215 47 17 10 10 10 2.58180063295341 30.8810786896587 0.0 3 0.9766156910922514 8.054714323271751 178277.0 251.92392479490587 0.0 - - - - - - - 1273.5 356 8 C7orf44 chromosome 7 open reading frame 44 685 87 B20140408_SF107_03 B20140408_SF107_03 TB239867.[MT7]-DGQQIPVFK[MT7].3b3_1.heavy 440.59 / 445.216 100375.0 28.97369956970215 47 17 10 10 10 2.58180063295341 30.8810786896587 0.0 3 0.9766156910922514 8.054714323271751 100375.0 72.27510229821608 0.0 - - - - - - - 674.0 200 2 C7orf44 chromosome 7 open reading frame 44 687 88 B20140408_SF107_03 B20140408_SF107_03 TB239864.[MT7]-HVMTNLGEK[MT7].3y3_1.heavy 439.579 / 477.279 346951.0 23.0403995513916 48 18 10 10 10 5.776585915059341 17.311263343163265 0.0 3 0.9823726561982883 9.281729460631139 346951.0 133.64246679491075 0.0 - - - - - - - 1494.0 693 1 CALM1;CALM2;CALM3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta) 689 88 B20140408_SF107_03 B20140408_SF107_03 TB239864.[MT7]-HVMTNLGEK[MT7].3b5_1.heavy 439.579 / 727.368 82579.0 23.0403995513916 48 18 10 10 10 5.776585915059341 17.311263343163265 0.0 3 0.9823726561982883 9.281729460631139 82579.0 122.2749928194585 0.0 - - - - - - - 759.625 165 8 CALM1;CALM2;CALM3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta) 691 88 B20140408_SF107_03 B20140408_SF107_03 TB239864.[MT7]-HVMTNLGEK[MT7].3y4_1.heavy 439.579 / 590.363 40443.0 23.0403995513916 48 18 10 10 10 5.776585915059341 17.311263343163265 0.0 3 0.9823726561982883 9.281729460631139 40443.0 42.67596793719654 0.0 - - - - - - - 299.0 80 1 CALM1;CALM2;CALM3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta) 693 88 B20140408_SF107_03 B20140408_SF107_03 TB239864.[MT7]-HVMTNLGEK[MT7].3b3_1.heavy 439.579 / 512.277 52795.0 23.0403995513916 48 18 10 10 10 5.776585915059341 17.311263343163265 0.0 3 0.9823726561982883 9.281729460631139 52795.0 35.20047679187866 0.0 - - - - - - - 1842.875 105 8 CALM1;CALM2;CALM3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta) 695 89 B20140408_SF107_03 B20140408_SF107_03 TB497927.[MT7]-LMTSLVR.2y4_1.heavy 482.293 / 474.303 41298.0 30.901500701904297 48 20 8 10 10 18.679572251927816 5.353441644772115 0.0 3 0.9983099728725594 30.016105890959796 41298.0 38.419480339924085 0.0 - - - - - - - 751.5 82 4 STAG3L4 stromal antigen 3-like 4 697 89 B20140408_SF107_03 B20140408_SF107_03 TB497927.[MT7]-LMTSLVR.2y5_1.heavy 482.293 / 575.351 84810.0 30.901500701904297 48 20 8 10 10 18.679572251927816 5.353441644772115 0.0 3 0.9983099728725594 30.016105890959796 84810.0 60.0042483717707 0.0 - - - - - - - 475.0 169 1 STAG3L4 stromal antigen 3-like 4 699 89 B20140408_SF107_03 B20140408_SF107_03 TB497927.[MT7]-LMTSLVR.2b4_1.heavy 482.293 / 577.314 31171.0 30.901500701904297 48 20 8 10 10 18.679572251927816 5.353441644772115 0.0 3 0.9983099728725594 30.016105890959796 31171.0 38.42584882731802 1.0 - - - - - - - 422.0 663 3 STAG3L4 stromal antigen 3-like 4 701 89 B20140408_SF107_03 B20140408_SF107_03 TB497927.[MT7]-LMTSLVR.2y6_1.heavy 482.293 / 706.392 251425.0 30.901500701904297 48 20 8 10 10 18.679572251927816 5.353441644772115 0.0 3 0.9983099728725594 30.016105890959796 251425.0 181.08190871135184 0.0 - - - - - - - 263.6666666666667 502 3 STAG3L4 stromal antigen 3-like 4 703 90 B20140408_SF107_03 B20140408_SF107_03 TB498246.[MT7]-QAQDQWLDEQLSIAR.3y7_1.heavy 649.001 / 816.457 42894.0 33.496299743652344 44 14 10 10 10 1.7260952183604716 50.09663216706038 0.0 3 0.9372568024525462 4.900966257362907 42894.0 36.685651748748256 0.0 - - - - - - - 172.0 85 1 CPPED1 calcineurin-like phosphoesterase domain containing 1 705 90 B20140408_SF107_03 B20140408_SF107_03 TB498246.[MT7]-QAQDQWLDEQLSIAR.3b4_1.heavy 649.001 / 587.291 74464.0 33.496299743652344 44 14 10 10 10 1.7260952183604716 50.09663216706038 0.0 3 0.9372568024525462 4.900966257362907 74464.0 43.6349424659778 0.0 - - - - - - - 743.3333333333334 148 3 CPPED1 calcineurin-like phosphoesterase domain containing 1 707 90 B20140408_SF107_03 B20140408_SF107_03 TB498246.[MT7]-QAQDQWLDEQLSIAR.3b5_1.heavy 649.001 / 715.349 192679.0 33.496299743652344 44 14 10 10 10 1.7260952183604716 50.09663216706038 0.0 3 0.9372568024525462 4.900966257362907 192679.0 115.62363630669981 0.0 - - - - - - - 257.5 385 2 CPPED1 calcineurin-like phosphoesterase domain containing 1 709 90 B20140408_SF107_03 B20140408_SF107_03 TB498246.[MT7]-QAQDQWLDEQLSIAR.3y8_1.heavy 649.001 / 931.484 124564.0 33.496299743652344 44 14 10 10 10 1.7260952183604716 50.09663216706038 0.0 3 0.9372568024525462 4.900966257362907 124564.0 191.2794388612844 0.0 - - - - - - - 686.4 249 10 CPPED1 calcineurin-like phosphoesterase domain containing 1 711 91 B20140408_SF107_03 B20140408_SF107_03 TB498245.[MT7]-LIDRENFVDIVDAK[MT7].4b7_2.heavy 484.525 / 516.783 165463.0 33.11289978027344 45 15 10 10 10 0.838357529765389 70.01463098629196 0.0 3 0.9582514437854217 6.018926073977411 165463.0 103.22607135079326 0.0 - - - - - - - 338.0 330 2 C7orf44 chromosome 7 open reading frame 44 713 91 B20140408_SF107_03 B20140408_SF107_03 TB498245.[MT7]-LIDRENFVDIVDAK[MT7].4b9_1.heavy 484.525 / 1246.65 N/A 33.11289978027344 45 15 10 10 10 0.838357529765389 70.01463098629196 0.0 3 0.9582514437854217 6.018926073977411 507.0 4.5 0.0 - - - - - - - 0.0 1 0 C7orf44 chromosome 7 open reading frame 44 715 91 B20140408_SF107_03 B20140408_SF107_03 TB498245.[MT7]-LIDRENFVDIVDAK[MT7].4b6_1.heavy 484.525 / 885.491 11650.0 33.11289978027344 45 15 10 10 10 0.838357529765389 70.01463098629196 0.0 3 0.9582514437854217 6.018926073977411 11650.0 81.71289064212141 0.0 - - - - - - - 217.28571428571428 23 7 C7orf44 chromosome 7 open reading frame 44 717 91 B20140408_SF107_03 B20140408_SF107_03 TB498245.[MT7]-LIDRENFVDIVDAK[MT7].4b9_2.heavy 484.525 / 623.831 1090440.0 33.11289978027344 45 15 10 10 10 0.838357529765389 70.01463098629196 0.0 3 0.9582514437854217 6.018926073977411 1090440.0 118.963533397536 0.0 - - - - - - - 1576.0 2180 3 C7orf44 chromosome 7 open reading frame 44 719 92 B20140408_SF107_03 B20140408_SF107_03 TB498342.[MT7]-LFVGGLNFNTDEQALEDHFSSFGPISEVVVVK[MT7].4b8_1.heavy 946.493 / 992.569 6913.0 40.891300201416016 38 8 10 10 10 0.9085179079228325 72.39700755809395 0.0 3 0.7856138004012306 2.6162588913642733 6913.0 27.77173781618574 0.0 - - - - - - - 712.4285714285714 13 7 RBM3 RNA binding motif (RNP1, RRM) protein 3 721 92 B20140408_SF107_03 B20140408_SF107_03 TB498342.[MT7]-LFVGGLNFNTDEQALEDHFSSFGPISEVVVVK[MT7].4y4_1.heavy 946.493 / 588.42 55308.0 40.891300201416016 38 8 10 10 10 0.9085179079228325 72.39700755809395 0.0 3 0.7856138004012306 2.6162588913642733 55308.0 40.713781011817815 0.0 - - - - - - - 793.3333333333334 110 3 RBM3 RNA binding motif (RNP1, RRM) protein 3 723 92 B20140408_SF107_03 B20140408_SF107_03 TB498342.[MT7]-LFVGGLNFNTDEQALEDHFSSFGPISEVVVVK[MT7].4b7_1.heavy 946.493 / 845.5 12240.0 40.891300201416016 38 8 10 10 10 0.9085179079228325 72.39700755809395 0.0 3 0.7856138004012306 2.6162588913642733 12240.0 9.763313456612059 1.0 - - - - - - - 793.3333333333334 27 9 RBM3 RNA binding motif (RNP1, RRM) protein 3 725 92 B20140408_SF107_03 B20140408_SF107_03 TB498342.[MT7]-LFVGGLNFNTDEQALEDHFSSFGPISEVVVVK[MT7].4b5_1.heavy 946.493 / 618.373 14620.0 40.891300201416016 38 8 10 10 10 0.9085179079228325 72.39700755809395 0.0 3 0.7856138004012306 2.6162588913642733 14620.0 20.535536187113856 0.0 - - - - - - - 841.8571428571429 29 7 RBM3 RNA binding motif (RNP1, RRM) protein 3 727 93 B20140408_SF107_03 B20140408_SF107_03 TB239911.[MT7]-FLLQEEISK[MT7].3y3_1.heavy 465.609 / 491.331 187308.0 32.65919876098633 47 17 10 10 10 2.6155826450366235 32.91378549988067 0.0 3 0.9750364889299887 7.7947450103738705 187308.0 125.97469179109623 0.0 - - - - - - - 490.0 374 1 CASP8 caspase 8, apoptosis-related cysteine peptidase 729 93 B20140408_SF107_03 B20140408_SF107_03 TB239911.[MT7]-FLLQEEISK[MT7].3b4_1.heavy 465.609 / 646.404 74694.0 32.65919876098633 47 17 10 10 10 2.6155826450366235 32.91378549988067 0.0 3 0.9750364889299887 7.7947450103738705 74694.0 79.72068186874304 0.0 - - - - - - - 817.2857142857143 149 7 CASP8 caspase 8, apoptosis-related cysteine peptidase 731 93 B20140408_SF107_03 B20140408_SF107_03 TB239911.[MT7]-FLLQEEISK[MT7].3b5_1.heavy 465.609 / 775.447 64888.0 32.65919876098633 47 17 10 10 10 2.6155826450366235 32.91378549988067 0.0 3 0.9750364889299887 7.7947450103738705 64888.0 103.71589944564846 0.0 - - - - - - - 245.0 129 8 CASP8 caspase 8, apoptosis-related cysteine peptidase 733 93 B20140408_SF107_03 B20140408_SF107_03 TB239911.[MT7]-FLLQEEISK[MT7].3b3_1.heavy 465.609 / 518.346 174559.0 32.65919876098633 47 17 10 10 10 2.6155826450366235 32.91378549988067 0.0 3 0.9750364889299887 7.7947450103738705 174559.0 140.77041614380724 0.0 - - - - - - - 245.0 349 2 CASP8 caspase 8, apoptosis-related cysteine peptidase 735 94 B20140408_SF107_03 B20140408_SF107_03 TB239722.[MT7]-TRLQLDAR.3b4_1.heavy 372.892 / 643.401 31368.0 23.537599563598633 39 11 10 10 8 0.7564390416231727 75.89286300092814 0.0 4 0.8668816375799687 3.34428734126162 31368.0 109.78434558926327 0.0 - - - - - - - 680.4285714285714 62 7 SLC25A36 solute carrier family 25, member 36 737 94 B20140408_SF107_03 B20140408_SF107_03 TB239722.[MT7]-TRLQLDAR.3y4_1.heavy 372.892 / 474.267 99384.0 23.537599563598633 39 11 10 10 8 0.7564390416231727 75.89286300092814 0.0 4 0.8668816375799687 3.34428734126162 99384.0 47.81750443805731 0.0 - - - - - - - 932.0 198 2 SLC25A36 solute carrier family 25, member 36 739 94 B20140408_SF107_03 B20140408_SF107_03 TB239722.[MT7]-TRLQLDAR.3b3_1.heavy 372.892 / 515.342 68430.0 23.537599563598633 39 11 10 10 8 0.7564390416231727 75.89286300092814 0.0 4 0.8668816375799687 3.34428734126162 68430.0 93.56437323685854 0.0 - - - - - - - 724.6666666666666 136 3 SLC25A36 solute carrier family 25, member 36 741 94 B20140408_SF107_03 B20140408_SF107_03 TB239722.[MT7]-TRLQLDAR.3y5_1.heavy 372.892 / 602.326 40168.0 23.537599563598633 39 11 10 10 8 0.7564390416231727 75.89286300092814 0.0 4 0.8668816375799687 3.34428734126162 40168.0 47.640275844147595 1.0 - - - - - - - 1293.875 212 8 SLC25A36 solute carrier family 25, member 36 743 95 B20140408_SF107_03 B20140408_SF107_03 TB240115.[MT7]-AALC[CAM]HFC[CAM]IDMLNAK[MT7].3b9_2.heavy 651.331 / 616.787 78182.0 33.01250076293945 38 8 10 10 10 0.6443063123491789 82.87518735630223 0.0 3 0.772450746553796 2.536427971211086 78182.0 41.39282358960468 0.0 - - - - - - - 340.0 156 1 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 745 95 B20140408_SF107_03 B20140408_SF107_03 TB240115.[MT7]-AALC[CAM]HFC[CAM]IDMLNAK[MT7].3b4_1.heavy 651.331 / 560.298 32803.0 33.01250076293945 38 8 10 10 10 0.6443063123491789 82.87518735630223 0.0 3 0.772450746553796 2.536427971211086 32803.0 15.03114269405335 0.0 - - - - - - - 2694.714285714286 65 7 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 747 95 B20140408_SF107_03 B20140408_SF107_03 TB240115.[MT7]-AALC[CAM]HFC[CAM]IDMLNAK[MT7].3b5_1.heavy 651.331 / 697.357 20055.0 33.01250076293945 38 8 10 10 10 0.6443063123491789 82.87518735630223 0.0 3 0.772450746553796 2.536427971211086 20055.0 12.148672378640205 0.0 - - - - - - - 680.0 40 4 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 749 95 B20140408_SF107_03 B20140408_SF107_03 TB240115.[MT7]-AALC[CAM]HFC[CAM]IDMLNAK[MT7].3y5_1.heavy 651.331 / 720.419 24814.0 33.01250076293945 38 8 10 10 10 0.6443063123491789 82.87518735630223 0.0 3 0.772450746553796 2.536427971211086 24814.0 32.35818210140078 0.0 - - - - - - - 283.3333333333333 49 3 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 751 96 B20140408_SF107_03 B20140408_SF107_03 TB377488.[MT7]-DGQQIPVFK[MT7].2y4_1.heavy 660.382 / 634.404 49658.0 28.97369956970215 43 13 10 10 10 0.9323210232217704 70.35159658498068 0.0 3 0.9138155884715536 4.173288449843686 49658.0 15.899030433692156 0.0 - - - - - - - 1208.0 99 1 C7orf44 chromosome 7 open reading frame 44 753 96 B20140408_SF107_03 B20140408_SF107_03 TB377488.[MT7]-DGQQIPVFK[MT7].2b4_1.heavy 660.382 / 573.275 25961.0 28.97369956970215 43 13 10 10 10 0.9323210232217704 70.35159658498068 0.0 3 0.9138155884715536 4.173288449843686 25961.0 14.571152291018898 0.0 - - - - - - - 453.0 51 1 C7orf44 chromosome 7 open reading frame 44 755 96 B20140408_SF107_03 B20140408_SF107_03 TB377488.[MT7]-DGQQIPVFK[MT7].2y3_1.heavy 660.382 / 537.352 3321.0 28.97369956970215 43 13 10 10 10 0.9323210232217704 70.35159658498068 0.0 3 0.9138155884715536 4.173288449843686 3321.0 2.19948644266851 4.0 - - - - - - - 647.1428571428571 9 7 C7orf44 chromosome 7 open reading frame 44 757 96 B20140408_SF107_03 B20140408_SF107_03 TB377488.[MT7]-DGQQIPVFK[MT7].2b5_1.heavy 660.382 / 686.359 33055.0 28.97369956970215 43 13 10 10 10 0.9323210232217704 70.35159658498068 0.0 3 0.9138155884715536 4.173288449843686 33055.0 49.0934731757701 0.0 - - - - - - - 323.57142857142856 66 7 C7orf44 chromosome 7 open reading frame 44 759 97 B20140408_SF107_03 B20140408_SF107_03 TB498034.[MT7]-GTQC[CAM]VEQIQELVLR.3y6_1.heavy 606.328 / 757.457 64471.0 34.6775016784668 50 20 10 10 10 6.489006237199363 15.41068020966485 0.0 3 0.9928050235885475 14.54075454791369 64471.0 123.03984067054293 0.0 - - - - - - - 697.0 128 7 BCCIP BRCA2 and CDKN1A interacting protein 761 97 B20140408_SF107_03 B20140408_SF107_03 TB498034.[MT7]-GTQC[CAM]VEQIQELVLR.3b4_1.heavy 606.328 / 591.268 45478.0 34.6775016784668 50 20 10 10 10 6.489006237199363 15.41068020966485 0.0 3 0.9928050235885475 14.54075454791369 45478.0 33.80755668716588 0.0 - - - - - - - 290.0 90 3 BCCIP BRCA2 and CDKN1A interacting protein 763 97 B20140408_SF107_03 B20140408_SF107_03 TB498034.[MT7]-GTQC[CAM]VEQIQELVLR.3y4_1.heavy 606.328 / 500.355 55933.0 34.6775016784668 50 20 10 10 10 6.489006237199363 15.41068020966485 0.0 3 0.9928050235885475 14.54075454791369 55933.0 76.03731819304984 0.0 - - - - - - - 174.0 111 1 BCCIP BRCA2 and CDKN1A interacting protein 765 97 B20140408_SF107_03 B20140408_SF107_03 TB498034.[MT7]-GTQC[CAM]VEQIQELVLR.3y5_1.heavy 606.328 / 629.398 34675.0 34.6775016784668 50 20 10 10 10 6.489006237199363 15.41068020966485 0.0 3 0.9928050235885475 14.54075454791369 34675.0 42.63319672131148 0.0 - - - - - - - 1176.125 69 8 BCCIP BRCA2 and CDKN1A interacting protein 767 98 B20140408_SF107_03 B20140408_SF107_03 TB240114.[MT7]-FQGSFC[CAM]EFVGTLVC[CAM]R.2y8_1.heavy 975.97 / 951.508 5398.0 39.28200149536133 44 14 10 10 10 1.4819272518633761 39.89597299539622 0.0 3 0.938072938623429 4.933498837964136 5398.0 26.230281481481484 0.0 - - - - - - - 648.0 10 10 STAG3L4 stromal antigen 3-like 4 769 98 B20140408_SF107_03 B20140408_SF107_03 TB240114.[MT7]-FQGSFC[CAM]EFVGTLVC[CAM]R.2y6_1.heavy 975.97 / 705.371 7287.0 39.28200149536133 44 14 10 10 10 1.4819272518633761 39.89597299539622 0.0 3 0.938072938623429 4.933498837964136 7287.0 16.656000000000002 0.0 - - - - - - - 675.0 14 7 STAG3L4 stromal antigen 3-like 4 771 98 B20140408_SF107_03 B20140408_SF107_03 TB240114.[MT7]-FQGSFC[CAM]EFVGTLVC[CAM]R.2b7_1.heavy 975.97 / 1000.43 2429.0 39.28200149536133 44 14 10 10 10 1.4819272518633761 39.89597299539622 0.0 3 0.938072938623429 4.933498837964136 2429.0 7.017111111111111 0.0 - - - - - - - 225.0 4 9 STAG3L4 stromal antigen 3-like 4 773 98 B20140408_SF107_03 B20140408_SF107_03 TB240114.[MT7]-FQGSFC[CAM]EFVGTLVC[CAM]R.2y10_1.heavy 975.97 / 1240.58 3509.0 39.28200149536133 44 14 10 10 10 1.4819272518633761 39.89597299539622 0.0 3 0.938072938623429 4.933498837964136 3509.0 13.862716049382716 0.0 - - - - - - - 229.5 7 10 STAG3L4 stromal antigen 3-like 4 775 99 B20140408_SF107_03 B20140408_SF107_03 TB498341.[MT7]-AALMFANAEEEFFYEEQGK[MT7]PEVLGGPDTR.4b7_1.heavy 884.184 / 863.457 4139.0 37.96160125732422 45 15 10 10 10 1.8261289148039408 39.57645802957311 0.0 3 0.9570941471813917 5.936615542875799 4139.0 3.6544960313241908 0.0 - - - - - - - 306.6666666666667 8 6 BCCIP BRCA2 and CDKN1A interacting protein 777 99 B20140408_SF107_03 B20140408_SF107_03 TB498341.[MT7]-AALMFANAEEEFFYEEQGK[MT7]PEVLGGPDTR.4y10_1.heavy 884.184 / 1040.54 7052.0 37.96160125732422 45 15 10 10 10 1.8261289148039408 39.57645802957311 0.0 3 0.9570941471813917 5.936615542875799 7052.0 12.033141880160166 0.0 - - - - - - - 783.7777777777778 14 9 BCCIP BRCA2 and CDKN1A interacting protein 779 99 B20140408_SF107_03 B20140408_SF107_03 TB498341.[MT7]-AALMFANAEEEFFYEEQGK[MT7]PEVLGGPDTR.4b4_1.heavy 884.184 / 531.308 7359.0 37.96160125732422 45 15 10 10 10 1.8261289148039408 39.57645802957311 0.0 3 0.9570941471813917 5.936615542875799 7359.0 16.771273206040604 0.0 - - - - - - - 357.8333333333333 14 6 BCCIP BRCA2 and CDKN1A interacting protein 781 99 B20140408_SF107_03 B20140408_SF107_03 TB498341.[MT7]-AALMFANAEEEFFYEEQGK[MT7]PEVLGGPDTR.4b5_1.heavy 884.184 / 678.377 9352.0 37.96160125732422 45 15 10 10 10 1.8261289148039408 39.57645802957311 0.0 3 0.9570941471813917 5.936615542875799 9352.0 16.638972091529205 0.0 - - - - - - - 345.125 18 8 BCCIP BRCA2 and CDKN1A interacting protein 783 100 B20140408_SF107_03 B20140408_SF107_03 TB377485.[MT7]-DSPQPVEEK[MT7].2y8_1.heavy 658.85 / 1057.56 11149.0 20.607200622558594 44 14 10 10 10 3.856026605159202 25.9334310261771 0.0 3 0.944160070838592 5.198140489130826 11149.0 164.35615023474176 0.0 - - - - - - - 207.92857142857142 22 14 UQCC ubiquinol-cytochrome c reductase complex chaperone 785 100 B20140408_SF107_03 B20140408_SF107_03 TB377485.[MT7]-DSPQPVEEK[MT7].2y5_1.heavy 658.85 / 745.421 37922.0 20.607200622558594 44 14 10 10 10 3.856026605159202 25.9334310261771 0.0 3 0.944160070838592 5.198140489130826 37922.0 135.66461971830986 0.0 - - - - - - - 253.57142857142858 75 14 UQCC ubiquinol-cytochrome c reductase complex chaperone 787 100 B20140408_SF107_03 B20140408_SF107_03 TB377485.[MT7]-DSPQPVEEK[MT7].2b4_1.heavy 658.85 / 572.28 29400.0 20.607200622558594 44 14 10 10 10 3.856026605159202 25.9334310261771 0.0 3 0.944160070838592 5.198140489130826 29400.0 63.161331626120365 0.0 - - - - - - - 745.5 58 8 UQCC ubiquinol-cytochrome c reductase complex chaperone 789 100 B20140408_SF107_03 B20140408_SF107_03 TB377485.[MT7]-DSPQPVEEK[MT7].2y3_1.heavy 658.85 / 549.3 7954.0 20.607200622558594 44 14 10 10 10 3.856026605159202 25.9334310261771 0.0 3 0.944160070838592 5.198140489130826 7954.0 20.877976952624838 0.0 - - - - - - - 740.4285714285714 15 7 UQCC ubiquinol-cytochrome c reductase complex chaperone 791 101 B20140408_SF107_03 B20140408_SF107_03 TB377207.[MT7]-VGGGGGSK[MT7].2y4_1.heavy 453.766 / 492.29 2002.0 17.5757999420166 50 20 10 10 10 20.39954768563743 4.902069474334782 0.0 3 0.998430517550558 31.147795890985734 2002.0 4.1685194174757285 1.0 - - - - - - - 242.35294117647058 5 17 AP1AR adaptor-related protein complex 1 associated regulatory protein 793 101 B20140408_SF107_03 B20140408_SF107_03 TB377207.[MT7]-VGGGGGSK[MT7].2y5_1.heavy 453.766 / 549.311 2963.0 17.5757999420166 50 20 10 10 10 20.39954768563743 4.902069474334782 0.0 3 0.998430517550558 31.147795890985734 2963.0 33.08683333333333 0.0 - - - - - - - 164.7058823529412 5 17 AP1AR adaptor-related protein complex 1 associated regulatory protein 795 101 B20140408_SF107_03 B20140408_SF107_03 TB377207.[MT7]-VGGGGGSK[MT7].2y6_1.heavy 453.766 / 606.333 2883.0 17.5757999420166 50 20 10 10 10 20.39954768563743 4.902069474334782 0.0 3 0.998430517550558 31.147795890985734 2883.0 32.1935 2.0 - - - - - - - 184.0 5 15 AP1AR adaptor-related protein complex 1 associated regulatory protein 797 101 B20140408_SF107_03 B20140408_SF107_03 TB377207.[MT7]-VGGGGGSK[MT7].2y7_1.heavy 453.766 / 663.354 31347.0 17.5757999420166 50 20 10 10 10 20.39954768563743 4.902069474334782 0.0 3 0.998430517550558 31.147795890985734 31347.0 412.67934205963934 0.0 - - - - - - - 640.6666666666666 62 9 AP1AR adaptor-related protein complex 1 associated regulatory protein 799 102 B20140408_SF107_03 B20140408_SF107_03 TB498340.[MT7]-HNAELSQAVVDAGAVPLLVLC[CAM]IQEPEIALK[MT7].3b8_1.heavy 1162.65 / 995.503 2138.0 40.933799743652344 38 8 10 10 10 1.836889483061017 54.439856573928814 0.0 3 0.7638667867824169 2.4879509433879807 2138.0 9.313120539796316 0.0 - - - - - - - 174.1818181818182 4 11 SPAG6 sperm associated antigen 6 801 102 B20140408_SF107_03 B20140408_SF107_03 TB498340.[MT7]-HNAELSQAVVDAGAVPLLVLC[CAM]IQEPEIALK[MT7].3y6_1.heavy 1162.65 / 814.516 9788.0 40.933799743652344 38 8 10 10 10 1.836889483061017 54.439856573928814 0.0 3 0.7638667867824169 2.4879509433879807 9788.0 60.90311111111111 0.0 - - - - - - - 273.57142857142856 19 7 SPAG6 sperm associated antigen 6 803 102 B20140408_SF107_03 B20140408_SF107_03 TB498340.[MT7]-HNAELSQAVVDAGAVPLLVLC[CAM]IQEPEIALK[MT7].3b4_1.heavy 1162.65 / 596.291 1238.0 40.933799743652344 38 8 10 10 10 1.836889483061017 54.439856573928814 0.0 3 0.7638667867824169 2.4879509433879807 1238.0 4.731911111111112 0.0 - - - - - - - 307.09090909090907 2 11 SPAG6 sperm associated antigen 6 805 102 B20140408_SF107_03 B20140408_SF107_03 TB498340.[MT7]-HNAELSQAVVDAGAVPLLVLC[CAM]IQEPEIALK[MT7].3b10_1.heavy 1162.65 / 1193.64 1463.0 40.933799743652344 38 8 10 10 10 1.836889483061017 54.439856573928814 0.0 3 0.7638667867824169 2.4879509433879807 1463.0 14.811448443133399 0.0 - - - - - - - 187.83333333333334 2 6 SPAG6 sperm associated antigen 6 807 103 B20140408_SF107_03 B20140408_SF107_03 TB240116.[MT7]-AALC[CAM]HFC[CAM]IDMLNAK[MT7].4b7_2.heavy 488.75 / 502.732 60656.0 33.01250076293945 31 3 10 10 8 0.36945750444558545 120.96416202614897 0.0 4 0.5895306668410556 1.8561040476114998 60656.0 33.066340140466274 0.0 - - - - - - - 225.66666666666666 121 3 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 809 103 B20140408_SF107_03 B20140408_SF107_03 TB240116.[MT7]-AALC[CAM]HFC[CAM]IDMLNAK[MT7].4b4_1.heavy 488.75 / 560.298 14910.0 33.01250076293945 31 3 10 10 8 0.36945750444558545 120.96416202614897 0.0 4 0.5895306668410556 1.8561040476114998 14910.0 14.307955068080776 1.0 - - - - - - - 254.0 41 2 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 811 103 B20140408_SF107_03 B20140408_SF107_03 TB240116.[MT7]-AALC[CAM]HFC[CAM]IDMLNAK[MT7].4b5_1.heavy 488.75 / 697.357 21009.0 33.01250076293945 31 3 10 10 8 0.36945750444558545 120.96416202614897 0.0 4 0.5895306668410556 1.8561040476114998 21009.0 35.769502870304066 0.0 - - - - - - - 677.7142857142857 42 7 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 813 103 B20140408_SF107_03 B20140408_SF107_03 TB240116.[MT7]-AALC[CAM]HFC[CAM]IDMLNAK[MT7].4b9_2.heavy 488.75 / 616.787 N/A 33.01250076293945 31 3 10 10 8 0.36945750444558545 120.96416202614897 0.0 4 0.5895306668410556 1.8561040476114998 297183.0 24.084938772816507 0.0 - - - - - - - 6269.0 594 1 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 815 104 B20140408_SF107_03 B20140408_SF107_03 TB239916.[MT7]-K[MT7]PNFEVGSSR.3y7_1.heavy 470.264 / 781.384 12009.0 23.38943354288737 46 20 10 6 10 6.96125350671135 14.365228892122651 0.03999900817871094 3 0.995809165825587 19.057254920526095 12009.0 13.970426677489177 0.0 - - - - - - - 655.7777777777778 24 9 CIAPIN1 cytokine induced apoptosis inhibitor 1 817 104 B20140408_SF107_03 B20140408_SF107_03 TB239916.[MT7]-K[MT7]PNFEVGSSR.3y6_1.heavy 470.264 / 634.315 20187.0 23.38943354288737 46 20 10 6 10 6.96125350671135 14.365228892122651 0.03999900817871094 3 0.995809165825587 19.057254920526095 20187.0 15.742154199546302 0.0 - - - - - - - 248.6 40 5 CIAPIN1 cytokine induced apoptosis inhibitor 1 819 104 B20140408_SF107_03 B20140408_SF107_03 TB239916.[MT7]-K[MT7]PNFEVGSSR.3y5_1.heavy 470.264 / 505.273 40168.0 23.38943354288737 46 20 10 6 10 6.96125350671135 14.365228892122651 0.03999900817871094 3 0.995809165825587 19.057254920526095 40168.0 24.95896950794358 0.0 - - - - - - - 311.0 80 1 CIAPIN1 cytokine induced apoptosis inhibitor 1 821 104 B20140408_SF107_03 B20140408_SF107_03 TB239916.[MT7]-K[MT7]PNFEVGSSR.3y9_1.heavy 470.264 / 992.48 N/A 23.38943354288737 46 20 10 6 10 6.96125350671135 14.365228892122651 0.03999900817871094 3 0.995809165825587 19.057254920526095 207.0 2.450093062082612 2.0 - - - - - - - 0.0 0 0 CIAPIN1 cytokine induced apoptosis inhibitor 1 823 105 B20140408_SF107_03 B20140408_SF107_03 TB239917.[MT7]-GLPVPQAEGEK[MT7].3y6_1.heavy 471.604 / 805.417 20850.0 26.140600204467773 50 20 10 10 10 17.833190731309205 5.607521475359593 0.0 3 0.9986094844012957 33.09208261883367 20850.0 36.14733259593295 0.0 - - - - - - - 315.0 41 8 MAGEF1 melanoma antigen family F, 1 825 105 B20140408_SF107_03 B20140408_SF107_03 TB239917.[MT7]-GLPVPQAEGEK[MT7].3y3_1.heavy 471.604 / 477.279 258730.0 26.140600204467773 50 20 10 10 10 17.833190731309205 5.607521475359593 0.0 3 0.9986094844012957 33.09208261883367 258730.0 119.02218554165154 0.0 - - - - - - - 1679.0 517 1 MAGEF1 melanoma antigen family F, 1 827 105 B20140408_SF107_03 B20140408_SF107_03 TB239917.[MT7]-GLPVPQAEGEK[MT7].3b4_1.heavy 471.604 / 511.336 557780.0 26.140600204467773 50 20 10 10 10 17.833190731309205 5.607521475359593 0.0 3 0.9986094844012957 33.09208261883367 557780.0 191.3016419427342 0.0 - - - - - - - 1819.0 1115 2 MAGEF1 melanoma antigen family F, 1 829 105 B20140408_SF107_03 B20140408_SF107_03 TB239917.[MT7]-GLPVPQAEGEK[MT7].3y5_1.heavy 471.604 / 677.359 179250.0 26.140600204467773 50 20 10 10 10 17.833190731309205 5.607521475359593 0.0 3 0.9986094844012957 33.09208261883367 179250.0 204.65838364685726 1.0 - - - - - - - 280.0 360 2 MAGEF1 melanoma antigen family F, 1 831 106 B20140408_SF107_03 B20140408_SF107_03 TB377201.[MT7]-GLLHSAR.2b3_1.heavy 449.273 / 428.299 34152.0 21.74570083618164 50 20 10 10 10 5.990642368735666 16.69270068964326 0.0 3 0.9930012446883033 14.743423669407253 34152.0 7.908151295670368 1.0 - - - - - - - 2725.0 68 2 COX5A cytochrome c oxidase subunit Va 833 106 B20140408_SF107_03 B20140408_SF107_03 TB377201.[MT7]-GLLHSAR.2y4_1.heavy 449.273 / 470.247 45778.0 21.74570083618164 50 20 10 10 10 5.990642368735666 16.69270068964326 0.0 3 0.9930012446883033 14.743423669407253 45778.0 35.657358760613434 0.0 - - - - - - - 1850.625 91 8 COX5A cytochrome c oxidase subunit Va 835 106 B20140408_SF107_03 B20140408_SF107_03 TB377201.[MT7]-GLLHSAR.2y5_1.heavy 449.273 / 583.331 31881.0 21.74570083618164 50 20 10 10 10 5.990642368735666 16.69270068964326 0.0 3 0.9930012446883033 14.743423669407253 31881.0 20.07201277743495 3.0 - - - - - - - 757.0 63 3 COX5A cytochrome c oxidase subunit Va 837 106 B20140408_SF107_03 B20140408_SF107_03 TB377201.[MT7]-GLLHSAR.2y6_1.heavy 449.273 / 696.415 22980.0 21.74570083618164 50 20 10 10 10 5.990642368735666 16.69270068964326 0.0 3 0.9930012446883033 14.743423669407253 22980.0 34.5045045045045 0.0 - - - - - - - 804.4285714285714 45 7 COX5A cytochrome c oxidase subunit Va 839 107 B20140408_SF107_03 B20140408_SF107_03 TB498248.[MT7]-SLAISSSLVSDVVRPK[MT7].3y7_1.heavy 649.389 / 944.565 34723.0 32.633798599243164 37 14 10 3 10 1.436498919946113 54.88584091482238 0.050800323486328125 3 0.9394096978200351 4.988192451903268 34723.0 76.62162783260233 0.0 - - - - - - - 390.875 69 8 C6orf142 chromosome 6 open reading frame 142 841 107 B20140408_SF107_03 B20140408_SF107_03 TB498248.[MT7]-SLAISSSLVSDVVRPK[MT7].3b4_1.heavy 649.389 / 529.347 26660.0 32.633798599243164 37 14 10 3 10 1.436498919946113 54.88584091482238 0.050800323486328125 3 0.9394096978200351 4.988192451903268 26660.0 10.052780031429652 0.0 - - - - - - - 658.0 53 1 C6orf142 chromosome 6 open reading frame 142 843 107 B20140408_SF107_03 B20140408_SF107_03 TB498248.[MT7]-SLAISSSLVSDVVRPK[MT7].3y8_1.heavy 649.389 / 1043.63 13659.0 32.633798599243164 37 14 10 3 10 1.436498919946113 54.88584091482238 0.050800323486328125 3 0.9394096978200351 4.988192451903268 13659.0 29.427811734862463 0.0 - - - - - - - 329.3333333333333 27 9 C6orf142 chromosome 6 open reading frame 142 845 107 B20140408_SF107_03 B20140408_SF107_03 TB498248.[MT7]-SLAISSSLVSDVVRPK[MT7].3y5_1.heavy 649.389 / 742.506 9380.0 32.633798599243164 37 14 10 3 10 1.436498919946113 54.88584091482238 0.050800323486328125 3 0.9394096978200351 4.988192451903268 9380.0 6.1414345461714035 1.0 - - - - - - - 329.0 18 2 C6orf142 chromosome 6 open reading frame 142 847 108 B20140408_SF107_03 B20140408_SF107_03 TB498249.[MT7]-FQGSFC[CAM]EFVGTLVC[CAM]R.3y7_1.heavy 650.982 / 804.44 49291.0 39.28200149536133 48 18 10 10 10 7.392423805483614 13.527362963933584 0.0 3 0.9803060248637618 8.779713433009693 49291.0 114.63023255813954 0.0 - - - - - - - 204.0 98 6 STAG3L4 stromal antigen 3-like 4 849 108 B20140408_SF107_03 B20140408_SF107_03 TB498249.[MT7]-FQGSFC[CAM]EFVGTLVC[CAM]R.3y6_1.heavy 650.982 / 705.371 179736.0 39.28200149536133 48 18 10 10 10 7.392423805483614 13.527362963933584 0.0 3 0.9803060248637618 8.779713433009693 179736.0 205.46951297775564 0.0 - - - - - - - 340.0 359 2 STAG3L4 stromal antigen 3-like 4 851 108 B20140408_SF107_03 B20140408_SF107_03 TB498249.[MT7]-FQGSFC[CAM]EFVGTLVC[CAM]R.3b4_1.heavy 650.982 / 564.29 38807.0 39.28200149536133 48 18 10 10 10 7.392423805483614 13.527362963933584 0.0 3 0.9803060248637618 8.779713433009693 38807.0 64.83666462668299 0.0 - - - - - - - 272.0 77 3 STAG3L4 stromal antigen 3-like 4 853 108 B20140408_SF107_03 B20140408_SF107_03 TB498249.[MT7]-FQGSFC[CAM]EFVGTLVC[CAM]R.3b7_1.heavy 650.982 / 1000.43 51470.0 39.28200149536133 48 18 10 10 10 7.392423805483614 13.527362963933584 0.0 3 0.9803060248637618 8.779713433009693 51470.0 89.68367811508776 0.0 - - - - - - - 241.77777777777777 102 9 STAG3L4 stromal antigen 3-like 4 855 109 B20140408_SF107_03 B20140408_SF107_03 TB377349.[MT7]-TRLQLDAR.2b3_1.heavy 558.834 / 515.342 4003.0 22.851450443267822 30 8 10 6 6 1.3164646682981205 75.96102076121535 0.03700065612792969 5 0.7692941798788822 2.51829218604306 4003.0 1.7880325518688651 23.0 - - - - - - - 1717.625 17 8 SLC25A36 solute carrier family 25, member 36 857 109 B20140408_SF107_03 B20140408_SF107_03 TB377349.[MT7]-TRLQLDAR.2y5_1.heavy 558.834 / 602.326 5085.0 22.851450443267822 30 8 10 6 6 1.3164646682981205 75.96102076121535 0.03700065612792969 5 0.7692941798788822 2.51829218604306 5085.0 4.279040830857973 2.0 - - - - - - - 757.5 23 8 SLC25A36 solute carrier family 25, member 36 859 109 B20140408_SF107_03 B20140408_SF107_03 TB377349.[MT7]-TRLQLDAR.2y6_1.heavy 558.834 / 715.41 79417.0 22.851450443267822 30 8 10 6 6 1.3164646682981205 75.96102076121535 0.03700065612792969 5 0.7692941798788822 2.51829218604306 79417.0 98.22253786734605 0.0 - - - - - - - 680.1428571428571 158 7 SLC25A36 solute carrier family 25, member 36 861 109 B20140408_SF107_03 B20140408_SF107_03 TB377349.[MT7]-TRLQLDAR.2b5_1.heavy 558.834 / 756.485 16987.0 22.851450443267822 30 8 10 6 6 1.3164646682981205 75.96102076121535 0.03700065612792969 5 0.7692941798788822 2.51829218604306 16987.0 4.400335869751965 3.0 - - - - - - - 1154.0 98 3 SLC25A36 solute carrier family 25, member 36 863 110 B20140408_SF107_03 B20140408_SF107_03 TB498231.[MT7]-INRLDLLITYLNTR.3y7_1.heavy 621.371 / 880.489 13625.0 38.269100189208984 41 11 10 10 10 5.632201676760147 17.755046026250206 0.0 3 0.8645324221842745 3.3144802155871558 13625.0 41.625626043405674 0.0 - - - - - - - 311.75 27 12 CASP8 caspase 8, apoptosis-related cysteine peptidase 865 110 B20140408_SF107_03 B20140408_SF107_03 TB498231.[MT7]-INRLDLLITYLNTR.3y6_1.heavy 621.371 / 767.405 37881.0 38.269100189208984 41 11 10 10 10 5.632201676760147 17.755046026250206 0.0 3 0.8645324221842745 3.3144802155871558 37881.0 53.030879732739415 0.0 - - - - - - - 340.09090909090907 75 11 CASP8 caspase 8, apoptosis-related cysteine peptidase 867 110 B20140408_SF107_03 B20140408_SF107_03 TB498231.[MT7]-INRLDLLITYLNTR.3b5_1.heavy 621.371 / 756.448 7187.0 38.269100189208984 41 11 10 10 10 5.632201676760147 17.755046026250206 0.0 3 0.8645324221842745 3.3144802155871558 7187.0 23.631388408527545 0.0 - - - - - - - 705.8571428571429 14 7 CASP8 caspase 8, apoptosis-related cysteine peptidase 869 110 B20140408_SF107_03 B20140408_SF107_03 TB498231.[MT7]-INRLDLLITYLNTR.3b7_1.heavy 621.371 / 982.617 11080.0 38.269100189208984 41 11 10 10 10 5.632201676760147 17.755046026250206 0.0 3 0.8645324221842745 3.3144802155871558 11080.0 15.45140723038938 0.0 - - - - - - - 209.6 22 5 CASP8 caspase 8, apoptosis-related cysteine peptidase 871 111 B20140408_SF107_03 B20140408_SF107_03 TB498230.[MT7]-GLVDK[MT7]LQALTGNEGR.3y6_1.heavy 620.358 / 633.295 62668.0 33.40290069580078 47 17 10 10 10 2.5349578197232776 31.506910623667768 0.0 3 0.9718737281734277 7.341470723154439 62668.0 80.22836129941619 0.0 - - - - - - - 171.0 125 1 CIAPIN1 cytokine induced apoptosis inhibitor 1 873 111 B20140408_SF107_03 B20140408_SF107_03 TB498230.[MT7]-GLVDK[MT7]LQALTGNEGR.3b4_1.heavy 620.358 / 529.31 62839.0 33.40290069580078 47 17 10 10 10 2.5349578197232776 31.506910623667768 0.0 3 0.9718737281734277 7.341470723154439 62839.0 24.534504636408002 0.0 - - - - - - - 342.0 125 1 CIAPIN1 cytokine induced apoptosis inhibitor 1 875 111 B20140408_SF107_03 B20140408_SF107_03 TB498230.[MT7]-GLVDK[MT7]LQALTGNEGR.3y8_1.heavy 620.358 / 817.416 41153.0 33.40290069580078 47 17 10 10 10 2.5349578197232776 31.506910623667768 0.0 3 0.9718737281734277 7.341470723154439 41153.0 65.08717154811715 0.0 - - - - - - - 307.8 82 5 CIAPIN1 cytokine induced apoptosis inhibitor 1 877 111 B20140408_SF107_03 B20140408_SF107_03 TB498230.[MT7]-GLVDK[MT7]LQALTGNEGR.3y9_1.heavy 620.358 / 945.475 28517.0 33.40290069580078 47 17 10 10 10 2.5349578197232776 31.506910623667768 0.0 3 0.9718737281734277 7.341470723154439 28517.0 132.96337879203216 0.0 - - - - - - - 307.8 57 5 CIAPIN1 cytokine induced apoptosis inhibitor 1 879 112 B20140408_SF107_03 B20140408_SF107_03 TB377691.[MT7]-YYDSRPGGYGYGYGR.3b3_1.heavy 625.624 / 586.263 70830.0 25.674699783325195 38 8 10 10 10 0.645790635551466 91.59956326572731 0.0 3 0.7605129190955336 2.469711250667343 70830.0 53.16907896240291 0.0 - - - - - - - 1830.5555555555557 141 9 RBM3 RNA binding motif (RNP1, RRM) protein 3 881 112 B20140408_SF107_03 B20140408_SF107_03 TB377691.[MT7]-YYDSRPGGYGYGYGR.3y12_2.heavy 625.624 / 645.305 136600.0 25.674699783325195 38 8 10 10 10 0.645790635551466 91.59956326572731 0.0 3 0.7605129190955336 2.469711250667343 136600.0 86.28062531717642 0.0 - - - - - - - 259.0 273 2 RBM3 RNA binding motif (RNP1, RRM) protein 3 883 112 B20140408_SF107_03 B20140408_SF107_03 TB377691.[MT7]-YYDSRPGGYGYGYGR.3y10_1.heavy 625.624 / 1046.47 28669.0 25.674699783325195 38 8 10 10 10 0.645790635551466 91.59956326572731 0.0 3 0.7605129190955336 2.469711250667343 28669.0 86.17271676300578 0.0 - - - - - - - 611.5714285714286 57 7 RBM3 RNA binding motif (RNP1, RRM) protein 3 885 112 B20140408_SF107_03 B20140408_SF107_03 TB377691.[MT7]-YYDSRPGGYGYGYGR.3y9_1.heavy 625.624 / 949.416 4411.0 25.674699783325195 38 8 10 10 10 0.645790635551466 91.59956326572731 0.0 3 0.7605129190955336 2.469711250667343 4411.0 19.916691970420786 0.0 - - - - - - - 259.2857142857143 8 14 RBM3 RNA binding motif (RNP1, RRM) protein 3 887 113 B20140408_SF107_03 B20140408_SF107_03 TB377333.[MT7]-YVIGDLK[MT7].2y4_1.heavy 548.336 / 576.347 77816.0 30.1875 43 13 10 10 10 0.7693088587723178 66.52090927550438 0.0 3 0.9121013251070708 4.131782998663717 77816.0 19.23812621074811 1.0 - - - - - - - 314.0 163 3 MAGEF1 melanoma antigen family F, 1 889 113 B20140408_SF107_03 B20140408_SF107_03 TB377333.[MT7]-YVIGDLK[MT7].2y5_1.heavy 548.336 / 689.431 82837.0 30.1875 43 13 10 10 10 0.7693088587723178 66.52090927550438 0.0 3 0.9121013251070708 4.131782998663717 82837.0 31.404782040489664 0.0 - - - - - - - 862.5 165 2 MAGEF1 melanoma antigen family F, 1 891 113 B20140408_SF107_03 B20140408_SF107_03 TB377333.[MT7]-YVIGDLK[MT7].2y6_1.heavy 548.336 / 788.5 68403.0 30.1875 43 13 10 10 10 0.7693088587723178 66.52090927550438 0.0 3 0.9121013251070708 4.131782998663717 68403.0 54.32703654945555 0.0 - - - - - - - 732.1666666666666 136 6 MAGEF1 melanoma antigen family F, 1 893 113 B20140408_SF107_03 B20140408_SF107_03 TB377333.[MT7]-YVIGDLK[MT7].2b5_1.heavy 548.336 / 692.374 92877.0 30.1875 43 13 10 10 10 0.7693088587723178 66.52090927550438 0.0 3 0.9121013251070708 4.131782998663717 92877.0 43.85419172377405 0.0 - - - - - - - 471.0 185 1 MAGEF1 melanoma antigen family F, 1 895 114 B20140408_SF107_03 B20140408_SF107_03 TB497938.[MT7]-SREQMSSQPK[MT7].3b4_1.heavy 489.261 / 645.344 4208.0 18.11949920654297 35 13 6 10 6 1.3173569047886124 53.30448257291507 0.0 5 0.9111972325185633 4.110376439494748 4208.0 13.45051954346678 1.0 - - - - - - - 264.53846153846155 9 13 CIAPIN1 cytokine induced apoptosis inhibitor 1 897 114 B20140408_SF107_03 B20140408_SF107_03 TB497938.[MT7]-SREQMSSQPK[MT7].3b3_1.heavy 489.261 / 517.285 4208.0 18.11949920654297 35 13 6 10 6 1.3173569047886124 53.30448257291507 0.0 5 0.9111972325185633 4.110376439494748 4208.0 10.855067624128397 0.0 - - - - - - - 284.6470588235294 8 17 CIAPIN1 cytokine induced apoptosis inhibitor 1 899 114 B20140408_SF107_03 B20140408_SF107_03 TB497938.[MT7]-SREQMSSQPK[MT7].3b7_1.heavy 489.261 / 950.448 1946.0 18.11949920654297 35 13 6 10 6 1.3173569047886124 53.30448257291507 0.0 5 0.9111972325185633 4.110376439494748 1946.0 29.350157522123894 0.0 - - - - - - - 118.5 3 8 CIAPIN1 cytokine induced apoptosis inhibitor 1 901 114 B20140408_SF107_03 B20140408_SF107_03 TB497938.[MT7]-SREQMSSQPK[MT7].3y5_1.heavy 489.261 / 690.39 7013.0 18.11949920654297 35 13 6 10 6 1.3173569047886124 53.30448257291507 0.0 5 0.9111972325185633 4.110376439494748 7013.0 33.429266352139805 1.0 - - - - - - - 187.38095238095238 22 21 CIAPIN1 cytokine induced apoptosis inhibitor 1 903 115 B20140408_SF107_03 B20140408_SF107_03 TB497936.[MT7]-IRSLLAR.2y4_1.heavy 486.825 / 472.324 41771.0 33.55427646636963 31 18 2 5 6 8.352130447606038 11.972993073720836 0.046298980712890625 6 0.9896272353459047 12.107068198001148 41771.0 29.838210589077583 1.0 - - - - - - - 344.0 147 2 AQP10 aquaporin 10 905 115 B20140408_SF107_03 B20140408_SF107_03 TB497936.[MT7]-IRSLLAR.2b3_1.heavy 486.825 / 501.327 7392.0 33.55427646636963 31 18 2 5 6 8.352130447606038 11.972993073720836 0.046298980712890625 6 0.9896272353459047 12.107068198001148 7392.0 7.434917129209559 1.0 - - - - - - - 785.5714285714286 24 7 AQP10 aquaporin 10 907 115 B20140408_SF107_03 B20140408_SF107_03 TB497936.[MT7]-IRSLLAR.2b4_1.heavy 486.825 / 614.411 5157.0 33.55427646636963 31 18 2 5 6 8.352130447606038 11.972993073720836 0.046298980712890625 6 0.9896272353459047 12.107068198001148 5157.0 8.27780331316345 2.0 - - - - - - - 229.33333333333334 16 3 AQP10 aquaporin 10 909 115 B20140408_SF107_03 B20140408_SF107_03 TB497936.[MT7]-IRSLLAR.2y6_1.heavy 486.825 / 715.457 2750.0 33.55427646636963 31 18 2 5 6 8.352130447606038 11.972993073720836 0.046298980712890625 6 0.9896272353459047 12.107068198001148 2750.0 0.5230486701867605 13.0 - - - - - - - 344.0 216 2 AQP10 aquaporin 10 911 116 B20140408_SF107_03 B20140408_SF107_03 TB498140.[MT7]-GRTLAAFPAEK[MT7].3y3_1.heavy 483.62 / 491.295 284739.0 26.052600860595703 43 13 10 10 10 3.003613288669905 33.29323397829391 0.0 3 0.9179341508668508 4.27824202486909 284739.0 231.71733741554056 0.0 - - - - - - - 698.0 569 1 CPPED1 calcineurin-like phosphoesterase domain containing 1 913 116 B20140408_SF107_03 B20140408_SF107_03 TB498140.[MT7]-GRTLAAFPAEK[MT7].3b6_1.heavy 483.62 / 714.438 254715.0 26.052600860595703 43 13 10 10 10 3.003613288669905 33.29323397829391 0.0 3 0.9179341508668508 4.27824202486909 254715.0 392.17523499178935 0.0 - - - - - - - 326.0 509 3 CPPED1 calcineurin-like phosphoesterase domain containing 1 915 116 B20140408_SF107_03 B20140408_SF107_03 TB498140.[MT7]-GRTLAAFPAEK[MT7].3b5_1.heavy 483.62 / 643.401 60607.0 26.052600860595703 43 13 10 10 10 3.003613288669905 33.29323397829391 0.0 3 0.9179341508668508 4.27824202486909 60607.0 42.43938712720035 1.0 - - - - - - - 791.6666666666666 121 3 CPPED1 calcineurin-like phosphoesterase domain containing 1 917 116 B20140408_SF107_03 B20140408_SF107_03 TB498140.[MT7]-GRTLAAFPAEK[MT7].3y4_1.heavy 483.62 / 588.347 518012.0 26.052600860595703 43 13 10 10 10 3.003613288669905 33.29323397829391 0.0 3 0.9179341508668508 4.27824202486909 518012.0 485.1207933475352 0.0 - - - - - - - 838.0 1036 2 CPPED1 calcineurin-like phosphoesterase domain containing 1 919 117 B20140408_SF107_03 B20140408_SF107_03 TB497937.[MT7]-EAGRLQR.2b4_1.heavy 487.287 / 558.312 4716.0 18.458799362182617 44 14 10 10 10 7.69407854734785 12.99700794378685 0.0 3 0.9433968950195198 5.1626432032978 4716.0 3.135010721944246 0.0 - - - - - - - 709.8 9 10 AP1AR adaptor-related protein complex 1 associated regulatory protein 921 117 B20140408_SF107_03 B20140408_SF107_03 TB497937.[MT7]-EAGRLQR.2b6_1.heavy 487.287 / 799.454 13162.0 18.458799362182617 44 14 10 10 10 7.69407854734785 12.99700794378685 0.0 3 0.9433968950195198 5.1626432032978 13162.0 40.843437272461536 0.0 - - - - - - - 259.0 26 16 AP1AR adaptor-related protein complex 1 associated regulatory protein 923 117 B20140408_SF107_03 B20140408_SF107_03 TB497937.[MT7]-EAGRLQR.2y6_1.heavy 487.287 / 700.421 4664.0 18.458799362182617 44 14 10 10 10 7.69407854734785 12.99700794378685 0.0 3 0.9433968950195198 5.1626432032978 4664.0 13.201397998225307 0.0 - - - - - - - 599.7142857142857 9 7 AP1AR adaptor-related protein complex 1 associated regulatory protein 925 117 B20140408_SF107_03 B20140408_SF107_03 TB497937.[MT7]-EAGRLQR.2b5_1.heavy 487.287 / 671.396 1866.0 18.458799362182617 44 14 10 10 10 7.69407854734785 12.99700794378685 0.0 3 0.9433968950195198 5.1626432032978 1866.0 11.574566653711619 1.0 - - - - - - - 214.3181818181818 6 22 AP1AR adaptor-related protein complex 1 associated regulatory protein 927 118 B20140408_SF107_03 B20140408_SF107_03 TB498334.[MT7]-AVAVTNTLPVLLSLY[MT7]MSTESSEDLQVK[MT7].4b8_1.heavy 835.963 / 914.543 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPAG6 sperm associated antigen 6 929 118 B20140408_SF107_03 B20140408_SF107_03 TB498334.[MT7]-AVAVTNTLPVLLSLY[MT7]MSTESSEDLQVK[MT7].4b7_1.heavy 835.963 / 801.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPAG6 sperm associated antigen 6 931 118 B20140408_SF107_03 B20140408_SF107_03 TB498334.[MT7]-AVAVTNTLPVLLSLY[MT7]MSTESSEDLQVK[MT7].4b5_1.heavy 835.963 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPAG6 sperm associated antigen 6 933 118 B20140408_SF107_03 B20140408_SF107_03 TB498334.[MT7]-AVAVTNTLPVLLSLY[MT7]MSTESSEDLQVK[MT7].4b6_1.heavy 835.963 / 700.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPAG6 sperm associated antigen 6 935 119 B20140408_SF107_03 B20140408_SF107_03 TB239732.[MT7]-VVVVTAEK[MT7].3y3_1.heavy 378.244 / 491.295 335498.0 25.586700439453125 50 20 10 10 10 16.797432383385942 5.953290819548607 0.0 3 0.9978596468383729 26.671175561167217 335498.0 245.39182373914923 0.0 - - - - - - - 732.5714285714286 670 7 CPPED1 calcineurin-like phosphoesterase domain containing 1 937 119 B20140408_SF107_03 B20140408_SF107_03 TB239732.[MT7]-VVVVTAEK[MT7].3b4_1.heavy 378.244 / 541.383 145006.0 25.586700439453125 50 20 10 10 10 16.797432383385942 5.953290819548607 0.0 3 0.9978596468383729 26.671175561167217 145006.0 165.45447630193095 0.0 - - - - - - - 263.0 290 1 CPPED1 calcineurin-like phosphoesterase domain containing 1 939 119 B20140408_SF107_03 B20140408_SF107_03 TB239732.[MT7]-VVVVTAEK[MT7].3y4_1.heavy 378.244 / 592.342 148292.0 25.586700439453125 50 20 10 10 10 16.797432383385942 5.953290819548607 0.0 3 0.9978596468383729 26.671175561167217 148292.0 254.1901596335215 0.0 - - - - - - - 218.83333333333334 296 6 CPPED1 calcineurin-like phosphoesterase domain containing 1 941 119 B20140408_SF107_03 B20140408_SF107_03 TB239732.[MT7]-VVVVTAEK[MT7].3b3_1.heavy 378.244 / 442.315 574822.0 25.586700439453125 50 20 10 10 10 16.797432383385942 5.953290819548607 0.0 3 0.9978596468383729 26.671175561167217 574822.0 226.07270772805145 0.0 - - - - - - - 657.3333333333334 1149 3 CPPED1 calcineurin-like phosphoesterase domain containing 1 943 120 B20140408_SF107_03 B20140408_SF107_03 TB377598.[MT7]-ADPQEAINC[CAM]LMR.2y8_1.heavy 781.383 / 1006.48 2564.0 32.78499984741211 43 20 10 3 10 5.895705003945037 16.961499928013062 0.0500030517578125 3 0.9915859933935527 13.44485000756359 2564.0 2.7168000064395907 2.0 - - - - - - - 239.4 5 5 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 945 120 B20140408_SF107_03 B20140408_SF107_03 TB377598.[MT7]-ADPQEAINC[CAM]LMR.2y10_1.heavy 781.383 / 1231.59 33161.0 32.78499984741211 43 20 10 3 10 5.895705003945037 16.961499928013062 0.0500030517578125 3 0.9915859933935527 13.44485000756359 33161.0 190.0454970760234 0.0 - - - - - - - 285.0 66 6 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 947 120 B20140408_SF107_03 B20140408_SF107_03 TB377598.[MT7]-ADPQEAINC[CAM]LMR.2y5_1.heavy 781.383 / 693.317 6154.0 32.78499984741211 43 20 10 3 10 5.895705003945037 16.961499928013062 0.0500030517578125 3 0.9915859933935527 13.44485000756359 6154.0 3.693397666275535 0.0 - - - - - - - 342.0 12 1 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 949 120 B20140408_SF107_03 B20140408_SF107_03 TB377598.[MT7]-ADPQEAINC[CAM]LMR.2y7_1.heavy 781.383 / 877.438 7521.0 32.78499984741211 43 20 10 3 10 5.895705003945037 16.961499928013062 0.0500030517578125 3 0.9915859933935527 13.44485000756359 7521.0 13.266251217943452 0.0 - - - - - - - 273.6 15 5 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 951 121 B20140408_SF107_03 B20140408_SF107_03 TB498048.[MT7]-HSDTDQQTR.2y4_1.heavy 616.293 / 532.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP1AR adaptor-related protein complex 1 associated regulatory protein 953 121 B20140408_SF107_03 B20140408_SF107_03 TB498048.[MT7]-HSDTDQQTR.2y8_1.heavy 616.293 / 950.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP1AR adaptor-related protein complex 1 associated regulatory protein 955 121 B20140408_SF107_03 B20140408_SF107_03 TB498048.[MT7]-HSDTDQQTR.2y6_1.heavy 616.293 / 748.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP1AR adaptor-related protein complex 1 associated regulatory protein 957 121 B20140408_SF107_03 B20140408_SF107_03 TB498048.[MT7]-HSDTDQQTR.2b5_1.heavy 616.293 / 700.302 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP1AR adaptor-related protein complex 1 associated regulatory protein 959 122 B20140408_SF107_03 B20140408_SF107_03 TB497931.[MT7]-C[CAM]VTC[CAM]QR.2b3_1.heavy 484.232 / 505.256 6143.0 18.23390007019043 50 20 10 10 10 4.990254117555598 20.039059663956255 0.0 3 0.9943481146337193 16.408199831426277 6143.0 11.444902794466525 0.0 - - - - - - - 665.0 12 7 EDA2R ectodysplasin A2 receptor 961 122 B20140408_SF107_03 B20140408_SF107_03 TB497931.[MT7]-C[CAM]VTC[CAM]QR.2y4_1.heavy 484.232 / 564.256 18709.0 18.23390007019043 50 20 10 10 10 4.990254117555598 20.039059663956255 0.0 3 0.9943481146337193 16.408199831426277 18709.0 54.88358915731669 0.0 - - - - - - - 771.6666666666666 37 12 EDA2R ectodysplasin A2 receptor 963 122 B20140408_SF107_03 B20140408_SF107_03 TB497931.[MT7]-C[CAM]VTC[CAM]QR.2y5_1.heavy 484.232 / 663.324 32856.0 18.23390007019043 50 20 10 10 10 4.990254117555598 20.039059663956255 0.0 3 0.9943481146337193 16.408199831426277 32856.0 67.81353048312883 0.0 - - - - - - - 190.08333333333334 65 12 EDA2R ectodysplasin A2 receptor 965 122 B20140408_SF107_03 B20140408_SF107_03 TB497931.[MT7]-C[CAM]VTC[CAM]QR.2b4_1.heavy 484.232 / 665.287 4933.0 18.23390007019043 50 20 10 10 10 4.990254117555598 20.039059663956255 0.0 3 0.9943481146337193 16.408199831426277 4933.0 25.11462239583333 0.0 - - - - - - - 175.88888888888889 9 18 EDA2R ectodysplasin A2 receptor 967 123 B20140408_SF107_03 B20140408_SF107_03 TB498046.[MT7]-VLFPWIFR.2b3_1.heavy 611.367 / 504.33 142449.0 42.83489990234375 48 18 10 10 10 5.839707674590241 17.124144832646397 0.0 3 0.984351931898294 9.852899473163868 142449.0 408.80765129722107 0.0 - - - - - - - 211.5 284 8 SPAG6 sperm associated antigen 6 969 123 B20140408_SF107_03 B20140408_SF107_03 TB498046.[MT7]-VLFPWIFR.2y5_1.heavy 611.367 / 718.404 307103.0 42.83489990234375 48 18 10 10 10 5.839707674590241 17.124144832646397 0.0 3 0.984351931898294 9.852899473163868 307103.0 858.328738256551 0.0 - - - - - - - 263.2 614 5 SPAG6 sperm associated antigen 6 971 123 B20140408_SF107_03 B20140408_SF107_03 TB498046.[MT7]-VLFPWIFR.2y6_1.heavy 611.367 / 865.472 148847.0 42.83489990234375 48 18 10 10 10 5.839707674590241 17.124144832646397 0.0 3 0.984351931898294 9.852899473163868 148847.0 604.625836007634 0.0 - - - - - - - 272.6 297 10 SPAG6 sperm associated antigen 6 973 123 B20140408_SF107_03 B20140408_SF107_03 TB498046.[MT7]-VLFPWIFR.2y7_1.heavy 611.367 / 978.556 220542.0 42.83489990234375 48 18 10 10 10 5.839707674590241 17.124144832646397 0.0 3 0.984351931898294 9.852899473163868 220542.0 833.8991715489773 0.0 - - - - - - - 219.33333333333334 441 6 SPAG6 sperm associated antigen 6 975 124 B20140408_SF107_03 B20140408_SF107_03 TB377593.[MT7]-GIEDDLMDLIK[MT7].2b8_1.heavy 775.423 / 1033.46 10806.0 39.377201080322266 43 13 10 10 10 0.9252010287481657 64.36669028349144 0.0 3 0.9025363345289097 3.9205671380643445 10806.0 18.819024410345094 0.0 - - - - - - - 266.14285714285717 21 7 CPPED1 calcineurin-like phosphoesterase domain containing 1 977 124 B20140408_SF107_03 B20140408_SF107_03 TB377593.[MT7]-GIEDDLMDLIK[MT7].2b4_1.heavy 775.423 / 559.284 23600.0 39.377201080322266 43 13 10 10 10 0.9252010287481657 64.36669028349144 0.0 3 0.9025363345289097 3.9205671380643445 23600.0 29.80771391287064 0.0 - - - - - - - 372.6666666666667 47 3 CPPED1 calcineurin-like phosphoesterase domain containing 1 979 124 B20140408_SF107_03 B20140408_SF107_03 TB377593.[MT7]-GIEDDLMDLIK[MT7].2b6_1.heavy 775.423 / 787.395 7329.0 39.377201080322266 43 13 10 10 10 0.9252010287481657 64.36669028349144 0.0 3 0.9025363345289097 3.9205671380643445 7329.0 11.801932367149757 0.0 - - - - - - - 745.1111111111111 14 9 CPPED1 calcineurin-like phosphoesterase domain containing 1 981 124 B20140408_SF107_03 B20140408_SF107_03 TB377593.[MT7]-GIEDDLMDLIK[MT7].2b5_1.heavy 775.423 / 674.311 18259.0 39.377201080322266 43 13 10 10 10 0.9252010287481657 64.36669028349144 0.0 3 0.9025363345289097 3.9205671380643445 18259.0 13.721578161583832 0.0 - - - - - - - 372.5 36 2 CPPED1 calcineurin-like phosphoesterase domain containing 1 983 125 B20140408_SF107_03 B20140408_SF107_03 TB240126.[MT7]-VFFIQAC[CAM]QGDNYQK[MT7].3y6_1.heavy 669.34 / 868.428 59179.0 32.2588996887207 48 18 10 10 10 6.463931211562163 15.470461662885274 0.0 3 0.9887871931295734 11.643902413320967 59179.0 60.19038942047705 0.0 - - - - - - - 480.0 118 2 CASP8 caspase 8, apoptosis-related cysteine peptidase 985 125 B20140408_SF107_03 B20140408_SF107_03 TB240126.[MT7]-VFFIQAC[CAM]QGDNYQK[MT7].3b4_1.heavy 669.34 / 651.399 81092.0 32.2588996887207 48 18 10 10 10 6.463931211562163 15.470461662885274 0.0 3 0.9887871931295734 11.643902413320967 81092.0 29.126148942815576 0.0 - - - - - - - 3199.0 162 2 CASP8 caspase 8, apoptosis-related cysteine peptidase 987 125 B20140408_SF107_03 B20140408_SF107_03 TB240126.[MT7]-VFFIQAC[CAM]QGDNYQK[MT7].3b5_1.heavy 669.34 / 779.457 44624.0 32.2588996887207 48 18 10 10 10 6.463931211562163 15.470461662885274 0.0 3 0.9887871931295734 11.643902413320967 44624.0 28.194225128417173 0.0 - - - - - - - 400.0 89 2 CASP8 caspase 8, apoptosis-related cysteine peptidase 989 125 B20140408_SF107_03 B20140408_SF107_03 TB240126.[MT7]-VFFIQAC[CAM]QGDNYQK[MT7].3b3_1.heavy 669.34 / 538.315 150187.0 32.2588996887207 48 18 10 10 10 6.463931211562163 15.470461662885274 0.0 3 0.9887871931295734 11.643902413320967 150187.0 83.56528564307379 0.0 - - - - - - - 1279.6666666666667 300 3 CASP8 caspase 8, apoptosis-related cysteine peptidase 991 126 B20140408_SF107_03 B20140408_SF107_03 TB239870.[MT7]-RLNDFASTVR.3y6_1.heavy 441.581 / 680.373 139329.0 26.010000228881836 47 17 10 10 10 7.709638570592075 12.97077665630703 0.0 3 0.9720144188423063 7.3599885009121495 139329.0 97.66407023552975 0.0 - - - - - - - 830.75 278 4 COX5A cytochrome c oxidase subunit Va 993 126 B20140408_SF107_03 B20140408_SF107_03 TB239870.[MT7]-RLNDFASTVR.3b4_1.heavy 441.581 / 643.364 133374.0 26.010000228881836 47 17 10 10 10 7.709638570592075 12.97077665630703 0.0 3 0.9720144188423063 7.3599885009121495 133374.0 76.26824670836082 0.0 - - - - - - - 877.0 266 3 COX5A cytochrome c oxidase subunit Va 995 126 B20140408_SF107_03 B20140408_SF107_03 TB239870.[MT7]-RLNDFASTVR.3y4_1.heavy 441.581 / 462.267 391397.0 26.010000228881836 47 17 10 10 10 7.709638570592075 12.97077665630703 0.0 3 0.9720144188423063 7.3599885009121495 391397.0 75.67115245444691 0.0 - - - - - - - 1892.6666666666667 782 3 COX5A cytochrome c oxidase subunit Va 997 126 B20140408_SF107_03 B20140408_SF107_03 TB239870.[MT7]-RLNDFASTVR.3y5_1.heavy 441.581 / 533.304 311068.0 26.010000228881836 47 17 10 10 10 7.709638570592075 12.97077665630703 0.0 3 0.9720144188423063 7.3599885009121495 311068.0 69.81287832121025 0.0 - - - - - - - 1523.0 622 1 COX5A cytochrome c oxidase subunit Va 999 127 B20140408_SF107_03 B20140408_SF107_03 TB239905.[MT7]-SK[MT7]TEEDILR.3b6_2.heavy 460.264 / 489.753 434239.0 24.171199798583984 47 17 10 10 10 11.83784817758496 8.447481206031231 0.0 3 0.9726034972695269 7.439063669430241 434239.0 282.13124441323885 0.0 - - - - - - - 340.0 868 2 AP1AR adaptor-related protein complex 1 associated regulatory protein 1001 127 B20140408_SF107_03 B20140408_SF107_03 TB239905.[MT7]-SK[MT7]TEEDILR.3b6_1.heavy 460.264 / 978.498 227.0 24.171199798583984 47 17 10 10 10 11.83784817758496 8.447481206031231 0.0 3 0.9726034972695269 7.439063669430241 227.0 2.9888495575221237 1.0 - - - - - - - 0.0 0 0 AP1AR adaptor-related protein complex 1 associated regulatory protein 1003 127 B20140408_SF107_03 B20140408_SF107_03 TB239905.[MT7]-SK[MT7]TEEDILR.3y4_1.heavy 460.264 / 516.314 75564.0 24.171199798583984 47 17 10 10 10 11.83784817758496 8.447481206031231 0.0 3 0.9726034972695269 7.439063669430241 75564.0 26.01887179294894 0.0 - - - - - - - 1359.0 151 1 AP1AR adaptor-related protein complex 1 associated regulatory protein 1005 127 B20140408_SF107_03 B20140408_SF107_03 TB239905.[MT7]-SK[MT7]TEEDILR.3y5_1.heavy 460.264 / 645.357 74658.0 24.171199798583984 47 17 10 10 10 11.83784817758496 8.447481206031231 0.0 3 0.9726034972695269 7.439063669430241 74658.0 134.55851505995656 0.0 - - - - - - - 396.5 149 2 AP1AR adaptor-related protein complex 1 associated regulatory protein 1007 128 B20140408_SF107_03 B20140408_SF107_03 TB239904.[MT7]-SK[MT7]TEEDILR.2b8_1.heavy 689.893 / 1204.67 2271.0 24.171199798583984 46 18 10 10 8 4.130565584924707 24.20975964283662 0.0 4 0.98031877443663 8.782566137577767 2271.0 6.662757890113297 3.0 - - - - - - - 236.75 14 12 AP1AR adaptor-related protein complex 1 associated regulatory protein 1009 128 B20140408_SF107_03 B20140408_SF107_03 TB239904.[MT7]-SK[MT7]TEEDILR.2y5_1.heavy 689.893 / 645.357 2725.0 24.171199798583984 46 18 10 10 8 4.130565584924707 24.20975964283662 0.0 4 0.98031877443663 8.782566137577767 2725.0 3.400593011558393 4.0 - - - - - - - 1211.3333333333333 5 9 AP1AR adaptor-related protein complex 1 associated regulatory protein 1011 128 B20140408_SF107_03 B20140408_SF107_03 TB239904.[MT7]-SK[MT7]TEEDILR.2b6_1.heavy 689.893 / 978.498 7154.0 24.171199798583984 46 18 10 10 8 4.130565584924707 24.20975964283662 0.0 4 0.98031877443663 8.782566137577767 7154.0 8.622700223833176 1.0 - - - - - - - 202.11111111111111 14 9 AP1AR adaptor-related protein complex 1 associated regulatory protein 1013 128 B20140408_SF107_03 B20140408_SF107_03 TB239904.[MT7]-SK[MT7]TEEDILR.2y7_1.heavy 689.893 / 875.447 2385.0 24.171199798583984 46 18 10 10 8 4.130565584924707 24.20975964283662 0.0 4 0.98031877443663 8.782566137577767 2385.0 14.97191629955947 0.0 - - - - - - - 237.54545454545453 4 11 AP1AR adaptor-related protein complex 1 associated regulatory protein 1015 129 B20140408_SF107_03 B20140408_SF107_03 TB239902.[MT7]-ILEVVK[MT7]DK[MT7].3y3_1.heavy 459.301 / 678.439 4611.0 28.459299087524414 42 12 10 10 10 2.0005301193855014 49.98675052726364 0.0 3 0.8864976601439123 3.62797194844561 4611.0 10.411791353312626 3.0 - - - - - - - 280.77777777777777 9 9 COX5A cytochrome c oxidase subunit Va 1017 129 B20140408_SF107_03 B20140408_SF107_03 TB239902.[MT7]-ILEVVK[MT7]DK[MT7].3y7_2.heavy 459.301 / 559.855 32576.0 28.459299087524414 42 12 10 10 10 2.0005301193855014 49.98675052726364 0.0 3 0.8864976601439123 3.62797194844561 32576.0 13.661323729491794 0.0 - - - - - - - 446.0 65 1 COX5A cytochrome c oxidase subunit Va 1019 129 B20140408_SF107_03 B20140408_SF107_03 TB239902.[MT7]-ILEVVK[MT7]DK[MT7].3y4_1.heavy 459.301 / 777.507 4611.0 28.459299087524414 42 12 10 10 10 2.0005301193855014 49.98675052726364 0.0 3 0.8864976601439123 3.62797194844561 4611.0 28.411212121212124 0.0 - - - - - - - 282.5 9 10 COX5A cytochrome c oxidase subunit Va 1021 129 B20140408_SF107_03 B20140408_SF107_03 TB239902.[MT7]-ILEVVK[MT7]DK[MT7].3b3_1.heavy 459.301 / 500.32 7140.0 28.459299087524414 42 12 10 10 10 2.0005301193855014 49.98675052726364 0.0 3 0.8864976601439123 3.62797194844561 7140.0 2.8402510085163604 2.0 - - - - - - - 446.0 14 1 COX5A cytochrome c oxidase subunit Va 1023 130 B20140408_SF107_03 B20140408_SF107_03 TB240020.[MT7]-RVDIDEFDENK[MT7].3b6_1.heavy 556.621 / 872.459 32974.0 27.04640007019043 39 9 10 10 10 0.6863805211981744 77.51707890115979 0.0 3 0.8173733840918022 2.842743729690647 32974.0 20.536789775660246 0.0 - - - - - - - 436.0 65 2 ARPC5L actin related protein 2/3 complex, subunit 5-like 1025 130 B20140408_SF107_03 B20140408_SF107_03 TB240020.[MT7]-RVDIDEFDENK[MT7].3b5_1.heavy 556.621 / 743.417 39220.0 27.04640007019043 39 9 10 10 10 0.6863805211981744 77.51707890115979 0.0 3 0.8173733840918022 2.842743729690647 39220.0 31.57889027951606 0.0 - - - - - - - 726.0 78 1 ARPC5L actin related protein 2/3 complex, subunit 5-like 1027 130 B20140408_SF107_03 B20140408_SF107_03 TB240020.[MT7]-RVDIDEFDENK[MT7].3y4_1.heavy 556.621 / 649.327 80038.0 27.04640007019043 39 9 10 10 10 0.6863805211981744 77.51707890115979 0.0 3 0.8173733840918022 2.842743729690647 80038.0 43.084138554216864 0.0 - - - - - - - 1235.0 160 2 ARPC5L actin related protein 2/3 complex, subunit 5-like 1029 130 B20140408_SF107_03 B20140408_SF107_03 TB240020.[MT7]-RVDIDEFDENK[MT7].3b3_1.heavy 556.621 / 515.306 23823.0 27.04640007019043 39 9 10 10 10 0.6863805211981744 77.51707890115979 0.0 3 0.8173733840918022 2.842743729690647 23823.0 6.696957150253735 1.0 - - - - - - - 872.0 117 1 ARPC5L actin related protein 2/3 complex, subunit 5-like 1031 131 B20140408_SF107_03 B20140408_SF107_03 TB240021.[MT7]-FLSLDYIPQRK[MT7].3y7_1.heavy 556.662 / 1063.6 3890.0 32.45880126953125 46 16 10 10 10 2.723529354504515 36.717063406938294 0.0 3 0.9663232911874315 6.706117407161365 3890.0 30.255555555555553 0.0 - - - - - - - 252.0 7 9 CASP8 caspase 8, apoptosis-related cysteine peptidase 1033 131 B20140408_SF107_03 B20140408_SF107_03 TB240021.[MT7]-FLSLDYIPQRK[MT7].3y6_1.heavy 556.662 / 948.575 5673.0 32.45880126953125 46 16 10 10 10 2.723529354504515 36.717063406938294 0.0 3 0.9663232911874315 6.706117407161365 5673.0 24.68805555555555 0.0 - - - - - - - 294.54545454545456 11 11 CASP8 caspase 8, apoptosis-related cysteine peptidase 1035 131 B20140408_SF107_03 B20140408_SF107_03 TB240021.[MT7]-FLSLDYIPQRK[MT7].3b5_1.heavy 556.662 / 720.405 43599.0 32.45880126953125 46 16 10 10 10 2.723529354504515 36.717063406938294 0.0 3 0.9663232911874315 6.706117407161365 43599.0 50.04088000394148 0.0 - - - - - - - 364.5 87 4 CASP8 caspase 8, apoptosis-related cysteine peptidase 1037 131 B20140408_SF107_03 B20140408_SF107_03 TB240021.[MT7]-FLSLDYIPQRK[MT7].3y4_1.heavy 556.662 / 672.427 46192.0 32.45880126953125 46 16 10 10 10 2.723529354504515 36.717063406938294 0.0 3 0.9663232911874315 6.706117407161365 46192.0 53.37328565045506 0.0 - - - - - - - 1250.7142857142858 92 7 CASP8 caspase 8, apoptosis-related cysteine peptidase 1039 132 B20140408_SF107_03 B20140408_SF107_03 TB498239.[MT7]-RVILGEGK[MT7]LDILK[MT7].4y9_2.heavy 472.31 / 630.892 147156.0 30.271799087524414 43 13 10 10 10 1.6045157354538917 49.537347047626696 0.0 3 0.9220840076067407 4.392259837936748 147156.0 948.7120445168869 0.0 - - - - - - - 235.125 294 8 CASP8 caspase 8, apoptosis-related cysteine peptidase 1041 132 B20140408_SF107_03 B20140408_SF107_03 TB498239.[MT7]-RVILGEGK[MT7]LDILK[MT7].4y3_1.heavy 472.31 / 517.383 180223.0 30.271799087524414 43 13 10 10 10 1.6045157354538917 49.537347047626696 0.0 3 0.9220840076067407 4.392259837936748 180223.0 100.64032680924808 0.0 - - - - - - - 1332.0 360 2 CASP8 caspase 8, apoptosis-related cysteine peptidase 1043 132 B20140408_SF107_03 B20140408_SF107_03 TB498239.[MT7]-RVILGEGK[MT7]LDILK[MT7].4b3_1.heavy 472.31 / 513.363 51089.0 30.271799087524414 43 13 10 10 10 1.6045157354538917 49.537347047626696 0.0 3 0.9220840076067407 4.392259837936748 51089.0 44.00166947961888 0.0 - - - - - - - 470.0 102 2 CASP8 caspase 8, apoptosis-related cysteine peptidase 1045 132 B20140408_SF107_03 B20140408_SF107_03 TB498239.[MT7]-RVILGEGK[MT7]LDILK[MT7].4b10_2.heavy 472.31 / 685.424 79925.0 30.271799087524414 43 13 10 10 10 1.6045157354538917 49.537347047626696 0.0 3 0.9220840076067407 4.392259837936748 79925.0 27.584013578475712 2.0 - - - - - - - 783.7 176 10 CASP8 caspase 8, apoptosis-related cysteine peptidase 1047 133 B20140408_SF107_03 B20140408_SF107_03 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1084360.0 31.221399307250977 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1084360.0 160.58596026444047 0.0 - - - - - - - 3323.0 2168 1 1049 133 B20140408_SF107_03 B20140408_SF107_03 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 293197.0 31.221399307250977 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 293197.0 88.35108659375166 0.0 - - - - - - - 1899.0 586 1 1051 133 B20140408_SF107_03 B20140408_SF107_03 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 426267.0 31.221399307250977 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 426267.0 68.3664077444628 0.0 - - - - - - - 3481.0 852 1 1053 134 B20140408_SF107_03 B20140408_SF107_03 TB377360.[MT7]-EALADEADR.2y8_1.heavy 567.281 / 860.411 44969.0 22.339924812316895 42 16 10 6 10 3.4383148772281045 29.084014574202655 0.035900115966796875 3 0.9693289359459708 7.028807194582089 44969.0 74.86958582025623 0.0 - - - - - - - 294.0 89 4 MAGEF1 melanoma antigen family F, 1 1055 134 B20140408_SF107_03 B20140408_SF107_03 TB377360.[MT7]-EALADEADR.2y6_1.heavy 567.281 / 676.29 29225.0 22.339924812316895 42 16 10 6 10 3.4383148772281045 29.084014574202655 0.035900115966796875 3 0.9693289359459708 7.028807194582089 29225.0 71.27187741195377 0.0 - - - - - - - 307.2 58 5 MAGEF1 melanoma antigen family F, 1 1057 134 B20140408_SF107_03 B20140408_SF107_03 TB377360.[MT7]-EALADEADR.2b5_1.heavy 567.281 / 644.337 39540.0 22.339924812316895 42 16 10 6 10 3.4383148772281045 29.084014574202655 0.035900115966796875 3 0.9693289359459708 7.028807194582089 39540.0 40.36507154335791 0.0 - - - - - - - 836.75 79 4 MAGEF1 melanoma antigen family F, 1 1059 134 B20140408_SF107_03 B20140408_SF107_03 TB377360.[MT7]-EALADEADR.2y7_1.heavy 567.281 / 789.374 17825.0 22.339924812316895 42 16 10 6 10 3.4383148772281045 29.084014574202655 0.035900115966796875 3 0.9693289359459708 7.028807194582089 17825.0 10.601654230627679 0.0 - - - - - - - 723.8571428571429 35 7 MAGEF1 melanoma antigen family F, 1 1061 135 B20140408_SF107_03 B20140408_SF107_03 TB239841.[MT7]-ERAQGVVLK[MT7].2b8_1.heavy 644.403 / 997.591 6599.0 22.87012529373169 41 18 9 6 8 17.91707093619722 5.581269413739584 0.03769874572753906 4 0.9883733480902842 11.43439925034528 6599.0 18.011998036327935 1.0 - - - - - - - 164.15384615384616 15 13 ARPC5L actin related protein 2/3 complex, subunit 5-like 1063 135 B20140408_SF107_03 B20140408_SF107_03 TB239841.[MT7]-ERAQGVVLK[MT7].2b6_1.heavy 644.403 / 785.439 1650.0 22.87012529373169 41 18 9 6 8 17.91707093619722 5.581269413739584 0.03769874572753906 4 0.9883733480902842 11.43439925034528 1650.0 6.406904950719383 1.0 - - - - - - - 262.47058823529414 3 17 ARPC5L actin related protein 2/3 complex, subunit 5-like 1065 135 B20140408_SF107_03 B20140408_SF107_03 TB239841.[MT7]-ERAQGVVLK[MT7].2y3_1.heavy 644.403 / 503.367 3493.0 22.87012529373169 41 18 9 6 8 17.91707093619722 5.581269413739584 0.03769874572753906 4 0.9883733480902842 11.43439925034528 3493.0 4.039880225067636 0.0 - - - - - - - 703.25 6 8 ARPC5L actin related protein 2/3 complex, subunit 5-like 1067 135 B20140408_SF107_03 B20140408_SF107_03 TB239841.[MT7]-ERAQGVVLK[MT7].2b7_1.heavy 644.403 / 884.507 4464.0 22.87012529373169 41 18 9 6 8 17.91707093619722 5.581269413739584 0.03769874572753906 4 0.9883733480902842 11.43439925034528 4464.0 6.442886597938143 2.0 - - - - - - - 291.0 8 16 ARPC5L actin related protein 2/3 complex, subunit 5-like 1069 136 B20140408_SF107_03 B20140408_SF107_03 TB498157.[MT7]-LTEQAVQAINK[MT7].3y3_1.heavy 501.631 / 518.342 571922.0 27.851600646972656 44 14 10 10 10 2.120394602488852 47.161033084418904 0.0 3 0.9463955251195872 5.306430542838457 571922.0 218.05847786650625 0.0 - - - - - - - 807.5 1143 2 CPPED1 calcineurin-like phosphoesterase domain containing 1 1071 136 B20140408_SF107_03 B20140408_SF107_03 TB498157.[MT7]-LTEQAVQAINK[MT7].3b4_1.heavy 501.631 / 616.342 658035.0 27.851600646972656 44 14 10 10 10 2.120394602488852 47.161033084418904 0.0 3 0.9463955251195872 5.306430542838457 658035.0 217.01072461003463 0.0 - - - - - - - 2422.5 1316 2 CPPED1 calcineurin-like phosphoesterase domain containing 1 1073 136 B20140408_SF107_03 B20140408_SF107_03 TB498157.[MT7]-LTEQAVQAINK[MT7].3b5_1.heavy 501.631 / 687.379 1258970.0 27.851600646972656 44 14 10 10 10 2.120394602488852 47.161033084418904 0.0 3 0.9463955251195872 5.306430542838457 1258970.0 438.13377411069143 0.0 - - - - - - - 881.0 2517 1 CPPED1 calcineurin-like phosphoesterase domain containing 1 1075 136 B20140408_SF107_03 B20140408_SF107_03 TB498157.[MT7]-LTEQAVQAINK[MT7].3y4_1.heavy 501.631 / 589.379 654245.0 27.851600646972656 44 14 10 10 10 2.120394602488852 47.161033084418904 0.0 3 0.9463955251195872 5.306430542838457 654245.0 382.8902338914677 0.0 - - - - - - - 881.0 1308 2 CPPED1 calcineurin-like phosphoesterase domain containing 1 1077 137 B20140408_SF107_03 B20140408_SF107_03 TB377466.[MT7]-ERAQGVVLK[MT7].3b6_1.heavy 429.938 / 785.439 116067.0 22.898399353027344 42 12 10 10 10 1.6083328676718038 49.21480792748121 0.0 3 0.8890912277598313 3.6709738715049642 116067.0 575.5631701373065 0.0 - - - - - - - 218.125 232 8 ARPC5L actin related protein 2/3 complex, subunit 5-like 1079 137 B20140408_SF107_03 B20140408_SF107_03 TB377466.[MT7]-ERAQGVVLK[MT7].3y3_1.heavy 429.938 / 503.367 346457.0 22.898399353027344 42 12 10 10 10 1.6083328676718038 49.21480792748121 0.0 3 0.8890912277598313 3.6709738715049642 346457.0 151.50111203603134 0.0 - - - - - - - 1300.0 692 3 ARPC5L actin related protein 2/3 complex, subunit 5-like 1081 137 B20140408_SF107_03 B20140408_SF107_03 TB377466.[MT7]-ERAQGVVLK[MT7].3b5_1.heavy 429.938 / 686.37 152191.0 22.898399353027344 42 12 10 10 10 1.6083328676718038 49.21480792748121 0.0 3 0.8890912277598313 3.6709738715049642 152191.0 224.51476239244994 0.0 - - - - - - - 718.375 304 8 ARPC5L actin related protein 2/3 complex, subunit 5-like 1083 137 B20140408_SF107_03 B20140408_SF107_03 TB377466.[MT7]-ERAQGVVLK[MT7].3b7_1.heavy 429.938 / 884.507 205.0 22.898399353027344 42 12 10 10 10 1.6083328676718038 49.21480792748121 0.0 3 0.8890912277598313 3.6709738715049642 205.0 2.573394906064809 6.0 - - - - - - - 0.0 0 0 ARPC5L actin related protein 2/3 complex, subunit 5-like 1085 138 B20140408_SF107_03 B20140408_SF107_03 TB498014.[MT7]-K[MT7]AAAFVLR.2b3_1.heavy 582.379 / 559.381 N/A 26.864900588989258 37 11 10 10 6 0.9762470654204991 64.35896362283758 0.0 6 0.8711064936891905 3.3999123303027297 2899.0 -0.013826598394640316 36.0 - - - - - - - 1305.0 13 3 SPAG6 sperm associated antigen 6 1087 138 B20140408_SF107_03 B20140408_SF107_03 TB498014.[MT7]-K[MT7]AAAFVLR.2b4_1.heavy 582.379 / 630.418 2754.0 26.864900588989258 37 11 10 10 6 0.9762470654204991 64.35896362283758 0.0 6 0.8711064936891905 3.3999123303027297 2754.0 1.9942758620689656 16.0 - - - - - - - 1215.7692307692307 6 13 SPAG6 sperm associated antigen 6 1089 138 B20140408_SF107_03 B20140408_SF107_03 TB498014.[MT7]-K[MT7]AAAFVLR.2b5_1.heavy 582.379 / 777.486 3334.0 26.864900588989258 37 11 10 10 6 0.9762470654204991 64.35896362283758 0.0 6 0.8711064936891905 3.3999123303027297 3334.0 1.4811571125265393 1.0 - - - - - - - 308.125 6 8 SPAG6 sperm associated antigen 6 1091 138 B20140408_SF107_03 B20140408_SF107_03 TB498014.[MT7]-K[MT7]AAAFVLR.2y7_1.heavy 582.379 / 747.451 8118.0 26.864900588989258 37 11 10 10 6 0.9762470654204991 64.35896362283758 0.0 6 0.8711064936891905 3.3999123303027297 8118.0 6.312202518795799 0.0 - - - - - - - 797.5 16 8 SPAG6 sperm associated antigen 6 1093 139 B20140408_SF107_03 B20140408_SF107_03 TB497943.[MT7]-ILEVVK[MT7].2y4_1.heavy 494.836 / 618.394 169957.0 29.94300079345703 50 20 10 10 10 7.423353141731 13.471001323895216 0.0 3 0.9934650973416971 15.258295396084446 169957.0 108.70194060841322 0.0 - - - - - - - 780.0 339 1 COX5A cytochrome c oxidase subunit Va 1095 139 B20140408_SF107_03 B20140408_SF107_03 TB497943.[MT7]-ILEVVK[MT7].2b3_1.heavy 494.836 / 500.32 152961.0 29.94300079345703 50 20 10 10 10 7.423353141731 13.471001323895216 0.0 3 0.9934650973416971 15.258295396084446 152961.0 100.77407457480558 0.0 - - - - - - - 780.0 305 4 COX5A cytochrome c oxidase subunit Va 1097 139 B20140408_SF107_03 B20140408_SF107_03 TB497943.[MT7]-ILEVVK[MT7].2y5_1.heavy 494.836 / 731.478 354258.0 29.94300079345703 50 20 10 10 10 7.423353141731 13.471001323895216 0.0 3 0.9934650973416971 15.258295396084446 354258.0 150.4435288093706 0.0 - - - - - - - 1559.0 708 3 COX5A cytochrome c oxidase subunit Va 1099 139 B20140408_SF107_03 B20140408_SF107_03 TB497943.[MT7]-ILEVVK[MT7].2b4_1.heavy 494.836 / 599.388 88253.0 29.94300079345703 50 20 10 10 10 7.423353141731 13.471001323895216 0.0 3 0.9934650973416971 15.258295396084446 88253.0 68.00472321258238 0.0 - - - - - - - 728.0 176 3 COX5A cytochrome c oxidase subunit Va 1101 140 B20140408_SF107_03 B20140408_SF107_03 TB377584.[MT7]-YYSLDELSEK[MT7].3b6_1.heavy 512.267 / 915.422 75116.0 30.85740089416504 47 17 10 10 10 4.681045645747234 21.362748319032264 0.0 3 0.9769916836893807 8.120517684174658 75116.0 462.7232167104614 0.0 - - - - - - - 284.4 150 5 CPPED1 calcineurin-like phosphoesterase domain containing 1 1103 140 B20140408_SF107_03 B20140408_SF107_03 TB377584.[MT7]-YYSLDELSEK[MT7].3y3_1.heavy 512.267 / 507.289 365936.0 30.85740089416504 47 17 10 10 10 4.681045645747234 21.362748319032264 0.0 3 0.9769916836893807 8.120517684174658 365936.0 159.15838173513663 0.0 - - - - - - - 1107.0 731 1 CPPED1 calcineurin-like phosphoesterase domain containing 1 1105 140 B20140408_SF107_03 B20140408_SF107_03 TB377584.[MT7]-YYSLDELSEK[MT7].3b4_1.heavy 512.267 / 671.352 25302.0 30.85740089416504 47 17 10 10 10 4.681045645747234 21.362748319032264 0.0 3 0.9769916836893807 8.120517684174658 25302.0 53.368418657658026 0.0 - - - - - - - 421.3333333333333 50 3 CPPED1 calcineurin-like phosphoesterase domain containing 1 1107 140 B20140408_SF107_03 B20140408_SF107_03 TB377584.[MT7]-YYSLDELSEK[MT7].3b5_1.heavy 512.267 / 786.379 119237.0 30.85740089416504 47 17 10 10 10 4.681045645747234 21.362748319032264 0.0 3 0.9769916836893807 8.120517684174658 119237.0 229.5742459231859 0.0 - - - - - - - 221.2 238 5 CPPED1 calcineurin-like phosphoesterase domain containing 1 1109 141 B20140408_SF107_03 B20140408_SF107_03 TB239744.[MT7]-EFMLMNAR.2b3_1.heavy 578.292 / 552.261 26995.0 32.02410125732422 50 20 10 10 10 12.676753875656782 7.888454803246623 0.0 3 0.9959818178841376 19.462652632510075 26995.0 16.946238182518258 0.0 - - - - - - - 794.0 53 1 C9orf46 chromosome 9 open reading frame 46 1111 141 B20140408_SF107_03 B20140408_SF107_03 TB239744.[MT7]-EFMLMNAR.2y5_1.heavy 578.292 / 604.323 31758.0 32.02410125732422 50 20 10 10 10 12.676753875656782 7.888454803246623 0.0 3 0.9959818178841376 19.462652632510075 31758.0 19.240034068031363 0.0 - - - - - - - 794.0 63 1 C9orf46 chromosome 9 open reading frame 46 1113 141 B20140408_SF107_03 B20140408_SF107_03 TB239744.[MT7]-EFMLMNAR.2y6_1.heavy 578.292 / 735.364 30806.0 32.02410125732422 50 20 10 10 10 12.676753875656782 7.888454803246623 0.0 3 0.9959818178841376 19.462652632510075 30806.0 15.839412990470024 1.0 - - - - - - - 1724.2857142857142 61 7 C9orf46 chromosome 9 open reading frame 46 1115 141 B20140408_SF107_03 B20140408_SF107_03 TB239744.[MT7]-EFMLMNAR.2y7_1.heavy 578.292 / 882.432 67645.0 32.02410125732422 50 20 10 10 10 12.676753875656782 7.888454803246623 0.0 3 0.9959818178841376 19.462652632510075 67645.0 82.2267981812412 0.0 - - - - - - - 396.875 135 8 C9orf46 chromosome 9 open reading frame 46 1117 142 B20140408_SF107_03 B20140408_SF107_03 TB239749.[MT7]-LNDFASTVR.2y8_1.heavy 583.818 / 909.443 37990.0 28.789199829101562 50 20 10 10 10 18.846505701482176 5.306023386188535 0.0 3 0.9976669594629246 25.545638119969603 37990.0 66.65506301404133 0.0 - - - - - - - 286.8333333333333 75 12 COX5A cytochrome c oxidase subunit Va 1119 142 B20140408_SF107_03 B20140408_SF107_03 TB239749.[MT7]-LNDFASTVR.2b4_1.heavy 583.818 / 634.332 7628.0 28.789199829101562 50 20 10 10 10 18.846505701482176 5.306023386188535 0.0 3 0.9976669594629246 25.545638119969603 7628.0 9.19360413178811 0.0 - - - - - - - 1271.7 15 10 COX5A cytochrome c oxidase subunit Va 1121 142 B20140408_SF107_03 B20140408_SF107_03 TB239749.[MT7]-LNDFASTVR.2y6_1.heavy 583.818 / 680.373 43674.0 28.789199829101562 50 20 10 10 10 18.846505701482176 5.306023386188535 0.0 3 0.9976669594629246 25.545638119969603 43674.0 30.17843494147405 0.0 - - - - - - - 1309.0 87 8 COX5A cytochrome c oxidase subunit Va 1123 142 B20140408_SF107_03 B20140408_SF107_03 TB239749.[MT7]-LNDFASTVR.2y7_1.heavy 583.818 / 795.399 10769.0 28.789199829101562 50 20 10 10 10 18.846505701482176 5.306023386188535 0.0 3 0.9976669594629246 25.545638119969603 10769.0 20.422204003794885 0.0 - - - - - - - 299.5 21 4 COX5A cytochrome c oxidase subunit Va 1125 143 B20140408_SF107_03 B20140408_SF107_03 TB239747.[MT7]-K[MT7]AAAFVLR.3y7_1.heavy 388.588 / 747.451 17455.0 26.864900588989258 46 16 10 10 10 4.258485849973532 23.482524898050688 0.0 3 0.9639540844825965 6.4806875967889335 17455.0 80.37698745974689 0.0 - - - - - - - 312.8333333333333 34 6 SPAG6 sperm associated antigen 6 1127 143 B20140408_SF107_03 B20140408_SF107_03 TB239747.[MT7]-K[MT7]AAAFVLR.3b4_1.heavy 388.588 / 630.418 24523.0 26.864900588989258 46 16 10 10 10 4.258485849973532 23.482524898050688 0.0 3 0.9639540844825965 6.4806875967889335 24523.0 32.902408459512706 0.0 - - - - - - - 385.0 49 3 SPAG6 sperm associated antigen 6 1129 143 B20140408_SF107_03 B20140408_SF107_03 TB239747.[MT7]-K[MT7]AAAFVLR.3y4_1.heavy 388.588 / 534.34 59000.0 26.864900588989258 46 16 10 10 10 4.258485849973532 23.482524898050688 0.0 3 0.9639540844825965 6.4806875967889335 59000.0 176.26180978374975 0.0 - - - - - - - 288.8 118 10 SPAG6 sperm associated antigen 6 1131 143 B20140408_SF107_03 B20140408_SF107_03 TB239747.[MT7]-K[MT7]AAAFVLR.3y5_1.heavy 388.588 / 605.377 59577.0 26.864900588989258 46 16 10 10 10 4.258485849973532 23.482524898050688 0.0 3 0.9639540844825965 6.4806875967889335 59577.0 80.02110051993067 0.0 - - - - - - - 757.375 119 8 SPAG6 sperm associated antigen 6 1133 144 B20140408_SF107_03 B20140408_SF107_03 TB377588.[MT7]-GILPPILAETPK[MT7].2y8_1.heavy 768.984 / 1012.62 14773.0 35.82040023803711 46 16 10 10 10 4.065472162067139 24.597388941203274 0.0 3 0.9680644557888319 6.887515608529678 14773.0 22.03649695628113 0.0 - - - - - - - 298.125 29 8 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 1135 144 B20140408_SF107_03 B20140408_SF107_03 TB377588.[MT7]-GILPPILAETPK[MT7].2y9_1.heavy 768.984 / 1109.67 100395.0 35.82040023803711 46 16 10 10 10 4.065472162067139 24.597388941203274 0.0 3 0.9680644557888319 6.887515608529678 100395.0 377.94127322868303 0.0 - - - - - - - 272.57142857142856 200 7 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 1137 144 B20140408_SF107_03 B20140408_SF107_03 TB377588.[MT7]-GILPPILAETPK[MT7].2y9_2.heavy 768.984 / 555.338 69101.0 35.82040023803711 46 16 10 10 10 4.065472162067139 24.597388941203274 0.0 3 0.9680644557888319 6.887515608529678 69101.0 46.178985353058444 0.0 - - - - - - - 397.5 138 2 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 1139 144 B20140408_SF107_03 B20140408_SF107_03 TB377588.[MT7]-GILPPILAETPK[MT7].2y7_1.heavy 768.984 / 915.563 2065.0 35.82040023803711 46 16 10 10 10 4.065472162067139 24.597388941203274 0.0 3 0.9680644557888319 6.887515608529678 2065.0 2.6229049805002576 2.0 - - - - - - - 703.1428571428571 7 7 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 1141 145 B20140408_SF107_03 B20140408_SF107_03 TB498019.[MT7]-TIPSNLLDELQLPR.3y7_1.heavy 585.004 / 870.468 81812.0 38.2234001159668 50 20 10 10 10 15.472418636368062 6.463113644362561 0.0 3 0.99702152915716 22.607775916334745 81812.0 202.53492564802184 0.0 - - - - - - - 330.0 163 4 SLC22A14 solute carrier family 22, member 14 1143 145 B20140408_SF107_03 B20140408_SF107_03 TB498019.[MT7]-TIPSNLLDELQLPR.3y6_1.heavy 585.004 / 755.441 27124.0 38.2234001159668 50 20 10 10 10 15.472418636368062 6.463113644362561 0.0 3 0.99702152915716 22.607775916334745 27124.0 33.84106169367912 0.0 - - - - - - - 268.8333333333333 54 6 SLC22A14 solute carrier family 22, member 14 1145 145 B20140408_SF107_03 B20140408_SF107_03 TB498019.[MT7]-TIPSNLLDELQLPR.3b6_1.heavy 585.004 / 770.453 40319.0 38.2234001159668 50 20 10 10 10 15.472418636368062 6.463113644362561 0.0 3 0.99702152915716 22.607775916334745 40319.0 53.006993292053664 0.0 - - - - - - - 659.5 80 8 SLC22A14 solute carrier family 22, member 14 1147 145 B20140408_SF107_03 B20140408_SF107_03 TB498019.[MT7]-TIPSNLLDELQLPR.3b5_1.heavy 585.004 / 657.369 87823.0 38.2234001159668 50 20 10 10 10 15.472418636368062 6.463113644362561 0.0 3 0.99702152915716 22.607775916334745 87823.0 119.69210378787878 0.0 - - - - - - - 293.5 175 2 SLC22A14 solute carrier family 22, member 14 1149 146 B20140408_SF107_03 B20140408_SF107_03 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 966055.0 23.456100463867188 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 966055.0 385.41569270833327 0.0 - - - - - - - 722.6 1932 10 1151 146 B20140408_SF107_03 B20140408_SF107_03 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 1622360.0 23.456100463867188 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1622360.0 745.01813125 0.0 - - - - - - - 593.375 3244 8 1153 146 B20140408_SF107_03 B20140408_SF107_03 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 4758290.0 23.456100463867188 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 4758290.0 675.3441330710217 0.0 - - - - - - - 539.0 9516 9 1155 147 B20140408_SF107_03 B20140408_SF107_03 TB498226.[MT7]-EAEAMALLAEAERK[MT7].4b4_1.heavy 455.751 / 545.269 330312.0 33.355201721191406 45 15 10 10 10 2.4386179624434052 41.00683318997769 0.0 3 0.9595971997960123 6.119042329678758 330312.0 410.46598825831705 0.0 - - - - - - - 255.5 660 2 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1157 147 B20140408_SF107_03 B20140408_SF107_03 TB498226.[MT7]-EAEAMALLAEAERK[MT7].4b5_1.heavy 455.751 / 676.309 134408.0 33.355201721191406 45 15 10 10 10 2.4386179624434052 41.00683318997769 0.0 3 0.9595971997960123 6.119042329678758 134408.0 270.59916613838277 0.0 - - - - - - - 227.0 268 6 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1159 147 B20140408_SF107_03 B20140408_SF107_03 TB498226.[MT7]-EAEAMALLAEAERK[MT7].4y6_1.heavy 455.751 / 847.475 36966.0 33.355201721191406 45 15 10 10 10 2.4386179624434052 41.00683318997769 0.0 3 0.9595971997960123 6.119042329678758 36966.0 240.59176631748588 0.0 - - - - - - - 218.85714285714286 73 7 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1161 147 B20140408_SF107_03 B20140408_SF107_03 TB498226.[MT7]-EAEAMALLAEAERK[MT7].4b3_1.heavy 455.751 / 474.232 140200.0 33.355201721191406 45 15 10 10 10 2.4386179624434052 41.00683318997769 0.0 3 0.9595971997960123 6.119042329678758 140200.0 172.84931506849315 0.0 - - - - - - - 341.0 280 1 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1163 148 B20140408_SF107_03 B20140408_SF107_03 TB498165.[MT7]-LAVQK[MT7]YEELFPAFSDSR.3y7_1.heavy 763.41 / 779.368 79820.0 36.52149963378906 46 16 10 10 10 3.562257320520125 28.072087724813493 0.0 3 0.9608176473156882 6.214250564884962 79820.0 102.6109819121447 0.0 - - - - - - - 323.0 159 2 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1165 148 B20140408_SF107_03 B20140408_SF107_03 TB498165.[MT7]-LAVQK[MT7]YEELFPAFSDSR.3y8_1.heavy 763.41 / 926.437 13061.0 36.52149963378906 46 16 10 10 10 3.562257320520125 28.072087724813493 0.0 3 0.9608176473156882 6.214250564884962 13061.0 36.78064183179732 0.0 - - - - - - - 423.625 26 8 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1167 148 B20140408_SF107_03 B20140408_SF107_03 TB498165.[MT7]-LAVQK[MT7]YEELFPAFSDSR.3y5_1.heavy 763.41 / 611.278 18544.0 36.52149963378906 46 16 10 10 10 3.562257320520125 28.072087724813493 0.0 3 0.9608176473156882 6.214250564884962 18544.0 14.818443412857853 0.0 - - - - - - - 322.55555555555554 37 9 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1169 148 B20140408_SF107_03 B20140408_SF107_03 TB498165.[MT7]-LAVQK[MT7]YEELFPAFSDSR.3b8_2.heavy 763.41 / 625.355 65630.0 36.52149963378906 46 16 10 10 10 3.562257320520125 28.072087724813493 0.0 3 0.9608176473156882 6.214250564884962 65630.0 81.81117989614907 0.0 - - - - - - - 323.0 131 1 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1171 149 B20140408_SF107_03 B20140408_SF107_03 TB497958.[MT7]-ARAEASMR.2b4_1.heavy 518.278 / 572.327 3599.0 18.271400451660156 44 14 10 10 10 1.3980772185518069 42.243514482373534 0.0 3 0.9410994686175159 5.05996697306019 3599.0 8.57008581957696 0.0 - - - - - - - 242.68421052631578 7 19 MAGEF1 melanoma antigen family F, 1 1173 149 B20140408_SF107_03 B20140408_SF107_03 TB497958.[MT7]-ARAEASMR.2b6_1.heavy 518.278 / 730.396 1926.0 18.271400451660156 44 14 10 10 10 1.3980772185518069 42.243514482373534 0.0 3 0.9410994686175159 5.05996697306019 1926.0 11.709800362976406 3.0 - - - - - - - 148.9375 9 16 MAGEF1 melanoma antigen family F, 1 1175 149 B20140408_SF107_03 B20140408_SF107_03 TB497958.[MT7]-ARAEASMR.2y6_1.heavy 518.278 / 664.308 4612.0 18.271400451660156 44 14 10 10 10 1.3980772185518069 42.243514482373534 0.0 3 0.9410994686175159 5.05996697306019 4612.0 15.174798570500323 0.0 - - - - - - - 169.8 9 20 MAGEF1 melanoma antigen family F, 1 1177 149 B20140408_SF107_03 B20140408_SF107_03 TB497958.[MT7]-ARAEASMR.2b7_1.heavy 518.278 / 861.437 4663.0 18.271400451660156 44 14 10 10 10 1.3980772185518069 42.243514482373534 0.0 3 0.9410994686175159 5.05996697306019 4663.0 10.303617537188776 1.0 - - - - - - - 173.0 9 17 MAGEF1 melanoma antigen family F, 1 1179 150 B20140408_SF107_03 B20140408_SF107_03 TB377351.[MT7]-NLETDNK[MT7].2b3_1.heavy 561.306 / 501.279 N/A 19.994600296020508 44 14 10 10 10 1.5147402885158028 44.714852349149595 0.0 3 0.9310920161005277 4.674138936214137 6463.0 3.580087463556851 1.0 - - - - - - - 799.5 12 8 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 1181 150 B20140408_SF107_03 B20140408_SF107_03 TB377351.[MT7]-NLETDNK[MT7].2y4_1.heavy 561.306 / 621.332 6661.0 19.994600296020508 44 14 10 10 10 1.5147402885158028 44.714852349149595 0.0 3 0.9310920161005277 4.674138936214137 6661.0 25.03882395382395 0.0 - - - - - - - 242.0 13 18 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 1183 150 B20140408_SF107_03 B20140408_SF107_03 TB377351.[MT7]-NLETDNK[MT7].2y6_1.heavy 561.306 / 863.459 6595.0 19.994600296020508 44 14 10 10 10 1.5147402885158028 44.714852349149595 0.0 3 0.9310920161005277 4.674138936214137 6595.0 112.9714935064935 0.0 - - - - - - - 187.57894736842104 13 19 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 1185 150 B20140408_SF107_03 B20140408_SF107_03 TB377351.[MT7]-NLETDNK[MT7].2b5_1.heavy 561.306 / 717.354 11608.0 19.994600296020508 44 14 10 10 10 1.5147402885158028 44.714852349149595 0.0 3 0.9310920161005277 4.674138936214137 11608.0 73.86909090909091 0.0 - - - - - - - 257.7142857142857 23 21 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 1187 151 B20140408_SF107_03 B20140408_SF107_03 TB377353.[MT7]-FLEGLQK[MT7].2y4_1.heavy 561.842 / 589.379 21515.0 30.684999465942383 37 17 2 10 8 3.3131111096215964 23.88702293030401 0.0 4 0.9780446067822148 8.313692361413448 21515.0 19.494076112051715 0.0 - - - - - - - 1248.0 43 9 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 1189 151 B20140408_SF107_03 B20140408_SF107_03 TB377353.[MT7]-FLEGLQK[MT7].2y5_1.heavy 561.842 / 718.422 13921.0 30.684999465942383 37 17 2 10 8 3.3131111096215964 23.88702293030401 0.0 4 0.9780446067822148 8.313692361413448 13921.0 11.701065252486117 0.0 - - - - - - - 1311.0 27 7 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 1191 151 B20140408_SF107_03 B20140408_SF107_03 TB377353.[MT7]-FLEGLQK[MT7].2y3_1.heavy 561.842 / 532.357 7752.0 30.684999465942383 37 17 2 10 8 3.3131111096215964 23.88702293030401 0.0 4 0.9780446067822148 8.313692361413448 7752.0 2.809405815423515 0.0 - - - - - - - 1107.0 15 2 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 1193 151 B20140408_SF107_03 B20140408_SF107_03 TB377353.[MT7]-FLEGLQK[MT7].2y6_1.heavy 561.842 / 831.506 19775.0 30.684999465942383 37 17 2 10 8 3.3131111096215964 23.88702293030401 0.0 4 0.9780446067822148 8.313692361413448 19775.0 16.332542908762424 1.0 - - - - - - - 158.0 119 4 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 1195 152 B20140408_SF107_03 B20140408_SF107_03 TB498168.[MT7]-NLYDIGEQLDSEDLASLK[MT7].3b6_1.heavy 771.068 / 820.432 6937.0 36.32720184326172 44 14 10 10 10 2.341484460151215 42.7079494661869 0.0 3 0.9383211720272784 4.943521220008052 6937.0 2.2250922077981095 1.0 - - - - - - - 807.0 13 1 CASP8 caspase 8, apoptosis-related cysteine peptidase 1197 152 B20140408_SF107_03 B20140408_SF107_03 TB498168.[MT7]-NLYDIGEQLDSEDLASLK[MT7].3b4_1.heavy 771.068 / 650.327 23230.0 36.32720184326172 44 14 10 10 10 2.341484460151215 42.7079494661869 0.0 3 0.9383211720272784 4.943521220008052 23230.0 5.049658572937557 0.0 - - - - - - - 1775.0 46 1 CASP8 caspase 8, apoptosis-related cysteine peptidase 1199 152 B20140408_SF107_03 B20140408_SF107_03 TB498168.[MT7]-NLYDIGEQLDSEDLASLK[MT7].3y4_1.heavy 771.068 / 562.368 16777.0 36.32720184326172 44 14 10 10 10 2.341484460151215 42.7079494661869 0.0 3 0.9383211720272784 4.943521220008052 16777.0 6.40385801775364 0.0 - - - - - - - 1936.0 33 1 CASP8 caspase 8, apoptosis-related cysteine peptidase 1201 152 B20140408_SF107_03 B20140408_SF107_03 TB498168.[MT7]-NLYDIGEQLDSEDLASLK[MT7].3b7_1.heavy 771.068 / 949.475 5001.0 36.32720184326172 44 14 10 10 10 2.341484460151215 42.7079494661869 0.0 3 0.9383211720272784 4.943521220008052 5001.0 4.318329700792901 0.0 - - - - - - - 871.2 10 5 CASP8 caspase 8, apoptosis-related cysteine peptidase 1203 153 B20140408_SF107_03 B20140408_SF107_03 TB498166.[MT7]-LDQWLTTMLLR.3y6_1.heavy 511.957 / 734.423 97551.0 43.112300872802734 48 18 10 10 10 3.5444014391217813 28.213508463301388 0.0 3 0.985431423768225 10.21233719493954 97551.0 1093.0030036557653 0.0 - - - - - - - 196.25 195 8 NAPB;NAPA N-ethylmaleimide-sensitive factor attachment protein, beta;N-ethylmaleimide-sensitive factor attachment protein, alpha 1205 153 B20140408_SF107_03 B20140408_SF107_03 TB498166.[MT7]-LDQWLTTMLLR.3b4_1.heavy 511.957 / 687.358 80536.0 43.112300872802734 48 18 10 10 10 3.5444014391217813 28.213508463301388 0.0 3 0.985431423768225 10.21233719493954 80536.0 704.5936464617195 0.0 - - - - - - - 274.2857142857143 161 7 NAPB;NAPA N-ethylmaleimide-sensitive factor attachment protein, beta;N-ethylmaleimide-sensitive factor attachment protein, alpha 1207 153 B20140408_SF107_03 B20140408_SF107_03 TB498166.[MT7]-LDQWLTTMLLR.3b3_1.heavy 511.957 / 501.279 116834.0 43.112300872802734 48 18 10 10 10 3.5444014391217813 28.213508463301388 0.0 3 0.985431423768225 10.21233719493954 116834.0 328.0382108778626 0.0 - - - - - - - 320.0 233 9 NAPB;NAPA N-ethylmaleimide-sensitive factor attachment protein, beta;N-ethylmaleimide-sensitive factor attachment protein, alpha 1209 153 B20140408_SF107_03 B20140408_SF107_03 TB498166.[MT7]-LDQWLTTMLLR.3y5_1.heavy 511.957 / 633.375 70415.0 43.112300872802734 48 18 10 10 10 3.5444014391217813 28.213508463301388 0.0 3 0.985431423768225 10.21233719493954 70415.0 136.4290625 0.0 - - - - - - - 752.625 140 8 NAPB;NAPA N-ethylmaleimide-sensitive factor attachment protein, beta;N-ethylmaleimide-sensitive factor attachment protein, alpha 1211 154 B20140408_SF107_03 B20140408_SF107_03 TB377455.[MT7]-VNIIPIIAK[MT7].3y3_1.heavy 423.623 / 475.336 836529.0 34.63169860839844 47 17 10 10 10 3.2536422238915907 24.15558794675987 0.0 3 0.9777955663369274 8.266765582021272 836529.0 878.7133474849081 0.0 - - - - - - - 165.0 1673 1 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 1213 154 B20140408_SF107_03 B20140408_SF107_03 TB377455.[MT7]-VNIIPIIAK[MT7].3b4_1.heavy 423.623 / 584.389 445772.0 34.63169860839844 47 17 10 10 10 3.2536422238915907 24.15558794675987 0.0 3 0.9777955663369274 8.266765582021272 445772.0 942.7170478696517 0.0 - - - - - - - 302.3333333333333 891 6 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 1215 154 B20140408_SF107_03 B20140408_SF107_03 TB377455.[MT7]-VNIIPIIAK[MT7].3b3_1.heavy 423.623 / 471.305 771349.0 34.63169860839844 47 17 10 10 10 3.2536422238915907 24.15558794675987 0.0 3 0.9777955663369274 8.266765582021272 771349.0 1225.004973114512 0.0 - - - - - - - 165.0 1542 5 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 1217 154 B20140408_SF107_03 B20140408_SF107_03 TB377455.[MT7]-VNIIPIIAK[MT7].3y5_1.heavy 423.623 / 685.473 319044.0 34.63169860839844 47 17 10 10 10 3.2536422238915907 24.15558794675987 0.0 3 0.9777955663369274 8.266765582021272 319044.0 1027.2447100322397 0.0 - - - - - - - 247.5 638 2 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 1219 155 B20140408_SF107_03 B20140408_SF107_03 TB497956.[MT7]-EAAAWALR.2y5_1.heavy 516.291 / 616.357 23704.0 29.55940055847168 47 17 10 10 10 2.4525223879864724 32.554769897616175 0.0 3 0.9770152167175352 8.124689795714403 23704.0 13.209337428696795 0.0 - - - - - - - 760.0 47 1 SPAG6 sperm associated antigen 6 1221 155 B20140408_SF107_03 B20140408_SF107_03 TB497956.[MT7]-EAAAWALR.2b6_1.heavy 516.291 / 744.38 43609.0 29.55940055847168 47 17 10 10 10 2.4525223879864724 32.554769897616175 0.0 3 0.9770152167175352 8.124689795714403 43609.0 42.02887085911126 0.0 - - - - - - - 722.0 87 4 SPAG6 sperm associated antigen 6 1223 155 B20140408_SF107_03 B20140408_SF107_03 TB497956.[MT7]-EAAAWALR.2y6_1.heavy 516.291 / 687.394 29782.0 29.55940055847168 47 17 10 10 10 2.4525223879864724 32.554769897616175 0.0 3 0.9770152167175352 8.124689795714403 29782.0 22.863551502399496 0.0 - - - - - - - 456.0 59 1 SPAG6 sperm associated antigen 6 1225 155 B20140408_SF107_03 B20140408_SF107_03 TB497956.[MT7]-EAAAWALR.2y7_1.heavy 516.291 / 758.431 98463.0 29.55940055847168 47 17 10 10 10 2.4525223879864724 32.554769897616175 0.0 3 0.9770152167175352 8.124689795714403 98463.0 72.31280871415731 0.0 - - - - - - - 456.0 196 1 SPAG6 sperm associated antigen 6 1227 156 B20140408_SF107_03 B20140408_SF107_03 TB377573.[MT7]-C[CAM]YFYLLISK[MT7].2b3_1.heavy 747.917 / 615.272 3970.0 37.96160125732422 48 18 10 10 10 4.215171808795558 19.290262452427058 0.0 3 0.9894550246182793 12.007627570703866 3970.0 8.349869680144652 0.0 - - - - - - - 769.8571428571429 7 14 BCCIP BRCA2 and CDKN1A interacting protein 1229 156 B20140408_SF107_03 B20140408_SF107_03 TB377573.[MT7]-C[CAM]YFYLLISK[MT7].2y4_1.heavy 747.917 / 604.415 5814.0 37.96160125732422 48 18 10 10 10 4.215171808795558 19.290262452427058 0.0 3 0.9894550246182793 12.007627570703866 5814.0 7.128106321171276 1.0 - - - - - - - 839.1666666666666 11 12 BCCIP BRCA2 and CDKN1A interacting protein 1231 156 B20140408_SF107_03 B20140408_SF107_03 TB377573.[MT7]-C[CAM]YFYLLISK[MT7].2b4_1.heavy 747.917 / 778.335 2694.0 37.96160125732422 48 18 10 10 10 4.215171808795558 19.290262452427058 0.0 3 0.9894550246182793 12.007627570703866 2694.0 3.292314923619271 1.0 - - - - - - - 749.5714285714286 5 7 BCCIP BRCA2 and CDKN1A interacting protein 1233 156 B20140408_SF107_03 B20140408_SF107_03 TB377573.[MT7]-C[CAM]YFYLLISK[MT7].2b5_1.heavy 747.917 / 891.419 4112.0 37.96160125732422 48 18 10 10 10 4.215171808795558 19.290262452427058 0.0 3 0.9894550246182793 12.007627570703866 4112.0 5.148394879184131 0.0 - - - - - - - 833.25 8 8 BCCIP BRCA2 and CDKN1A interacting protein 1235 157 B20140408_SF107_03 B20140408_SF107_03 TB239754.[MT7]-GGGFGAHGRGR.3y3_1.heavy 391.543 / 388.241 N/A 17.832799275716145 31 20 2 3 6 4.827961744679744 20.712674475972545 0.07530021667480469 6 0.9924693690112417 14.212607629015578 8162.0 6.796291454763521 6.0 - - - - - - - 1805.5714285714287 47 7 RBM3 RNA binding motif (RNP1, RRM) protein 3 1237 157 B20140408_SF107_03 B20140408_SF107_03 TB239754.[MT7]-GGGFGAHGRGR.3b6_1.heavy 391.543 / 591.301 2932.0 17.832799275716145 31 20 2 3 6 4.827961744679744 20.712674475972545 0.07530021667480469 6 0.9924693690112417 14.212607629015578 2932.0 8.623529411764705 1.0 - - - - - - - 247.5625 5 16 RBM3 RNA binding motif (RNP1, RRM) protein 3 1239 157 B20140408_SF107_03 B20140408_SF107_03 TB239754.[MT7]-GGGFGAHGRGR.3b4_1.heavy 391.543 / 463.242 1783.0 17.832799275716145 31 20 2 3 6 4.827961744679744 20.712674475972545 0.07530021667480469 6 0.9924693690112417 14.212607629015578 1783.0 2.5310725552050473 5.0 - - - - - - - 789.1666666666666 6 12 RBM3 RNA binding motif (RNP1, RRM) protein 3 1241 157 B20140408_SF107_03 B20140408_SF107_03 TB239754.[MT7]-GGGFGAHGRGR.3b5_1.heavy 391.543 / 520.264 5745.0 17.832799275716145 31 20 2 3 6 4.827961744679744 20.712674475972545 0.07530021667480469 6 0.9924693690112417 14.212607629015578 5745.0 7.80873786407767 1.0 - - - - - - - 680.7272727272727 11 11 RBM3 RNA binding motif (RNP1, RRM) protein 3 1243 158 B20140408_SF107_03 B20140408_SF107_03 TB239755.[MT7]-K[MT7]QEPIK[MT7].3y3_1.heavy 392.255 / 501.352 273826.0 19.252099990844727 42 12 10 10 10 1.3850204018184855 45.43695418114611 0.0 3 0.8922695130544542 3.7257592322684276 273826.0 138.2959595959596 0.0 - - - - - - - 885.5 547 6 CASP8 caspase 8, apoptosis-related cysteine peptidase 1245 158 B20140408_SF107_03 B20140408_SF107_03 TB239755.[MT7]-K[MT7]QEPIK[MT7].3b3_2.heavy 392.255 / 337.707 356170.0 19.252099990844727 42 12 10 10 10 1.3850204018184855 45.43695418114611 0.0 3 0.8922695130544542 3.7257592322684276 356170.0 266.88308534134603 0.0 - - - - - - - 1234.25 712 8 CASP8 caspase 8, apoptosis-related cysteine peptidase 1247 158 B20140408_SF107_03 B20140408_SF107_03 TB239755.[MT7]-K[MT7]QEPIK[MT7].3b3_1.heavy 392.255 / 674.407 19056.0 19.252099990844727 42 12 10 10 10 1.3850204018184855 45.43695418114611 0.0 3 0.8922695130544542 3.7257592322684276 19056.0 72.77725001137863 0.0 - - - - - - - 236.7 38 20 CASP8 caspase 8, apoptosis-related cysteine peptidase 1249 158 B20140408_SF107_03 B20140408_SF107_03 TB239755.[MT7]-K[MT7]QEPIK[MT7].3b4_2.heavy 392.255 / 386.234 157181.0 19.252099990844727 42 12 10 10 10 1.3850204018184855 45.43695418114611 0.0 3 0.8922695130544542 3.7257592322684276 157181.0 20.421806164837125 1.0 - - - - - - - 3753.0 314 1 CASP8 caspase 8, apoptosis-related cysteine peptidase 1251 159 B20140408_SF107_03 B20140408_SF107_03 TB240143.[MT7]-AIEIYTDMGRFTIAAK[MT7].3b4_1.heavy 696.718 / 571.357 31755.0 34.81890106201172 44 14 10 10 10 7.504710217545632 13.324964868890614 0.0 3 0.9348653951150453 4.809174244925669 31755.0 34.19873519052194 0.0 - - - - - - - 1140.2857142857142 63 7 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1253 159 B20140408_SF107_03 B20140408_SF107_03 TB240143.[MT7]-AIEIYTDMGRFTIAAK[MT7].3y14_2.heavy 696.718 / 880.462 36787.0 34.81890106201172 44 14 10 10 10 7.504710217545632 13.324964868890614 0.0 3 0.9348653951150453 4.809174244925669 36787.0 36.038112041386384 0.0 - - - - - - - 694.4285714285714 73 7 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1255 159 B20140408_SF107_03 B20140408_SF107_03 TB240143.[MT7]-AIEIYTDMGRFTIAAK[MT7].3y12_2.heavy 696.718 / 759.399 43555.0 34.81890106201172 44 14 10 10 10 7.504710217545632 13.324964868890614 0.0 3 0.9348653951150453 4.809174244925669 43555.0 48.95230547550432 0.0 - - - - - - - 260.5 87 4 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1257 159 B20140408_SF107_03 B20140408_SF107_03 TB240143.[MT7]-AIEIYTDMGRFTIAAK[MT7].3y13_2.heavy 696.718 / 815.941 34011.0 34.81890106201172 44 14 10 10 10 7.504710217545632 13.324964868890614 0.0 3 0.9348653951150453 4.809174244925669 34011.0 36.67432981107909 0.0 - - - - - - - 231.66666666666666 68 6 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1259 160 B20140408_SF107_03 B20140408_SF107_03 TB377773.[MT7]-YFGTFFGLAAISLTAGAIK[MT7].3y6_1.heavy 746.092 / 704.442 48710.0 45.32709884643555 39 9 10 10 10 0.9272050574024706 71.28654056662282 0.0 3 0.8129564572069183 2.8078687140193317 48710.0 244.44548072123402 0.0 - - - - - - - 1704.5 97 8 C9orf46 chromosome 9 open reading frame 46 1261 160 B20140408_SF107_03 B20140408_SF107_03 TB377773.[MT7]-YFGTFFGLAAISLTAGAIK[MT7].3b5_1.heavy 746.092 / 760.379 19894.0 45.32709884643555 39 9 10 10 10 0.9272050574024706 71.28654056662282 0.0 3 0.8129564572069183 2.8078687140193317 19894.0 97.98497271140725 0.0 - - - - - - - 701.7 39 20 C9orf46 chromosome 9 open reading frame 46 1263 160 B20140408_SF107_03 B20140408_SF107_03 TB377773.[MT7]-YFGTFFGLAAISLTAGAIK[MT7].3y4_1.heavy 746.092 / 532.357 80411.0 45.32709884643555 39 9 10 10 10 0.9272050574024706 71.28654056662282 0.0 3 0.8129564572069183 2.8078687140193317 80411.0 311.3929674133681 0.0 - - - - - - - 2198.6 160 10 C9orf46 chromosome 9 open reading frame 46 1265 160 B20140408_SF107_03 B20140408_SF107_03 TB377773.[MT7]-YFGTFFGLAAISLTAGAIK[MT7].3b7_1.heavy 746.092 / 964.469 56464.0 45.32709884643555 39 9 10 10 10 0.9272050574024706 71.28654056662282 0.0 3 0.8129564572069183 2.8078687140193317 56464.0 215.81601756883944 0.0 - - - - - - - 1788.9 112 10 C9orf46 chromosome 9 open reading frame 46 1267 161 B20140408_SF107_03 B20140408_SF107_03 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 1100840.0 29.55940055847168 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1100840.0 543.8080259276954 0.0 - - - - - - - 1964.0 2201 1 1269 161 B20140408_SF107_03 B20140408_SF107_03 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 1140830.0 29.55940055847168 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1140830.0 399.54768838392215 0.0 - - - - - - - 1662.0 2281 2 1271 161 B20140408_SF107_03 B20140408_SF107_03 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1983900.0 29.55940055847168 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1983900.0 703.727054036776 0.0 - - - - - - - 3927.0 3967 1 1273 162 B20140408_SF107_03 B20140408_SF107_03 TB377357.[MT7]-SK[MT7]LQLPR.3y3_1.heavy 377.248 / 385.256 79914.0 27.45240020751953 35 7 10 10 8 0.9063616134476872 72.2569856129335 0.0 4 0.7374781269276961 2.3538844731129362 79914.0 -0.787551738701957 0.0 - - - - - - - 127.0 159 1 C9orf46 chromosome 9 open reading frame 46 1275 162 B20140408_SF107_03 B20140408_SF107_03 TB377357.[MT7]-SK[MT7]LQLPR.3y4_1.heavy 377.248 / 513.314 507.0 27.45240020751953 35 7 10 10 8 0.9063616134476872 72.2569856129335 0.0 4 0.7374781269276961 2.3538844731129362 507.0 -0.044454135608276504 35.0 - - - - - - - 381.0 28 1 C9orf46 chromosome 9 open reading frame 46 1277 162 B20140408_SF107_03 B20140408_SF107_03 TB377357.[MT7]-SK[MT7]LQLPR.3b4_2.heavy 377.248 / 373.244 42494.0 27.45240020751953 35 7 10 10 8 0.9063616134476872 72.2569856129335 0.0 4 0.7374781269276961 2.3538844731129362 42494.0 -1.116584084084085 1.0 - - - - - - - 1733.6666666666667 113 3 C9orf46 chromosome 9 open reading frame 46 1279 162 B20140408_SF107_03 B20140408_SF107_03 TB377357.[MT7]-SK[MT7]LQLPR.3y5_1.heavy 377.248 / 626.398 30063.0 27.45240020751953 35 7 10 10 8 0.9063616134476872 72.2569856129335 0.0 4 0.7374781269276961 2.3538844731129362 30063.0 -0.7899436936936937 0.0 - - - - - - - 235.85714285714286 60 7 C9orf46 chromosome 9 open reading frame 46 1281 163 B20140408_SF107_03 B20140408_SF107_03 TB498219.[MT7]-TC[CAM]ATTIAY[MT7]PHVVR.4y4_1.heavy 444.997 / 510.315 20763.0 24.3617000579834 48 18 10 10 10 3.8400145929438105 20.48448771343574 0.0 3 0.9864123153226672 10.575396409880526 20763.0 18.1132851445663 0.0 - - - - - - - 472.0 41 1 SLC25A36 solute carrier family 25, member 36 1283 163 B20140408_SF107_03 B20140408_SF107_03 TB498219.[MT7]-TC[CAM]ATTIAY[MT7]PHVVR.4y5_1.heavy 444.997 / 607.367 72435.0 24.3617000579834 48 18 10 10 10 3.8400145929438105 20.48448771343574 0.0 3 0.9864123153226672 10.575396409880526 72435.0 77.60892857142858 0.0 - - - - - - - 354.0 144 4 SLC25A36 solute carrier family 25, member 36 1285 163 B20140408_SF107_03 B20140408_SF107_03 TB498219.[MT7]-TC[CAM]ATTIAY[MT7]PHVVR.4y3_1.heavy 444.997 / 373.256 31381.0 24.3617000579834 48 18 10 10 10 3.8400145929438105 20.48448771343574 0.0 3 0.9864123153226672 10.575396409880526 31381.0 8.308837024633723 2.0 - - - - - - - 2123.5 62 2 SLC25A36 solute carrier family 25, member 36 1287 163 B20140408_SF107_03 B20140408_SF107_03 TB498219.[MT7]-TC[CAM]ATTIAY[MT7]PHVVR.4b3_1.heavy 444.997 / 477.225 46481.0 24.3617000579834 48 18 10 10 10 3.8400145929438105 20.48448771343574 0.0 3 0.9864123153226672 10.575396409880526 46481.0 5.308081348860545 0.0 - - - - - - - 944.0 92 1 SLC25A36 solute carrier family 25, member 36 1289 164 B20140408_SF107_03 B20140408_SF107_03 TB239599.[MT7]-NASTLIR.2y5_1.heavy 459.778 / 589.367 34086.0 24.50079917907715 37 17 0 10 10 2.545737394684985 30.718261666449926 0.0 3 0.9751588389185326 7.813997537341431 34086.0 28.94290526718744 0.0 - - - - - - - 321.0 68 8 SPAG6 sperm associated antigen 6 1291 164 B20140408_SF107_03 B20140408_SF107_03 TB239599.[MT7]-NASTLIR.2b4_1.heavy 459.778 / 518.269 N/A 24.50079917907715 37 17 0 10 10 2.545737394684985 30.718261666449926 0.0 3 0.9751588389185326 7.813997537341431 34786.0 8.92904655863376 2.0 - - - - - - - 1167.6666666666667 1990 3 SPAG6 sperm associated antigen 6 1293 164 B20140408_SF107_03 B20140408_SF107_03 TB239599.[MT7]-NASTLIR.2y6_1.heavy 459.778 / 660.404 86265.0 24.50079917907715 37 17 0 10 10 2.545737394684985 30.718261666449926 0.0 3 0.9751588389185326 7.813997537341431 86265.0 73.23862075698683 0.0 - - - - - - - 1617.7142857142858 172 7 SPAG6 sperm associated antigen 6 1295 164 B20140408_SF107_03 B20140408_SF107_03 TB239599.[MT7]-NASTLIR.2b5_1.heavy 459.778 / 631.353 55331.0 24.50079917907715 37 17 0 10 10 2.545737394684985 30.718261666449926 0.0 3 0.9751588389185326 7.813997537341431 55331.0 27.39224209060545 0.0 - - - - - - - 467.0 110 1 SPAG6 sperm associated antigen 6 1297 165 B20140408_SF107_03 B20140408_SF107_03 TB239596.[MT7]-IIDAALR.2b3_1.heavy 458.291 / 486.304 220561.0 29.47089958190918 50 20 10 10 10 68.27733582553056 1.464614850461221 0.0 3 0.9910263171289178 13.01822300845618 220561.0 124.00052522278565 0.0 - - - - - - - 754.0 441 1 COX5A cytochrome c oxidase subunit Va 1299 165 B20140408_SF107_03 B20140408_SF107_03 TB239596.[MT7]-IIDAALR.2y5_1.heavy 458.291 / 545.304 153578.0 29.47089958190918 50 20 10 10 10 68.27733582553056 1.464614850461221 0.0 3 0.9910263171289178 13.01822300845618 153578.0 109.9386913104587 0.0 - - - - - - - 678.5 307 2 COX5A cytochrome c oxidase subunit Va 1301 165 B20140408_SF107_03 B20140408_SF107_03 TB239596.[MT7]-IIDAALR.2b4_1.heavy 458.291 / 557.341 76035.0 29.47089958190918 50 20 10 10 10 68.27733582553056 1.464614850461221 0.0 3 0.9910263171289178 13.01822300845618 76035.0 40.11389815135179 0.0 - - - - - - - 1509.0 152 1 COX5A cytochrome c oxidase subunit Va 1303 165 B20140408_SF107_03 B20140408_SF107_03 TB239596.[MT7]-IIDAALR.2y6_1.heavy 458.291 / 658.388 394355.0 29.47089958190918 50 20 10 10 10 68.27733582553056 1.464614850461221 0.0 3 0.9910263171289178 13.01822300845618 394355.0 143.42661956800907 0.0 - - - - - - - 1207.0 788 3 COX5A cytochrome c oxidase subunit Va 1305 166 B20140408_SF107_03 B20140408_SF107_03 TB239594.[MT7]-VDHAGK[MT7].2b3_1.heavy 457.769 / 496.264 2927.0 17.176000595092773 42 16 6 10 10 2.652789676562283 37.69616599593706 0.0 3 0.967511103278422 6.8282908057486305 2927.0 15.433989629178544 0.0 - - - - - - - 233.78947368421052 5 19 RBM3 RNA binding motif (RNP1, RRM) protein 3 1307 166 B20140408_SF107_03 B20140408_SF107_03 TB239594.[MT7]-VDHAGK[MT7].2y4_1.heavy 457.769 / 556.332 N/A 17.176000595092773 42 16 6 10 10 2.652789676562283 37.69616599593706 0.0 3 0.967511103278422 6.8282908057486305 10469.0 4.4434506513390355 0.0 - - - - - - - 326.5 31 6 RBM3 RNA binding motif (RNP1, RRM) protein 3 1309 166 B20140408_SF107_03 B20140408_SF107_03 TB239594.[MT7]-VDHAGK[MT7].2y5_1.heavy 457.769 / 671.359 6500.0 17.176000595092773 42 16 6 10 10 2.652789676562283 37.69616599593706 0.0 3 0.967511103278422 6.8282908057486305 6500.0 15.262527094224147 0.0 - - - - - - - 147.07142857142858 13 14 RBM3 RNA binding motif (RNP1, RRM) protein 3 1311 166 B20140408_SF107_03 B20140408_SF107_03 TB239594.[MT7]-VDHAGK[MT7].2b4_1.heavy 457.769 / 567.301 2778.0 17.176000595092773 42 16 6 10 10 2.652789676562283 37.69616599593706 0.0 3 0.967511103278422 6.8282908057486305 2778.0 17.298901098901098 0.0 - - - - - - - 184.33333333333334 5 21 RBM3 RNA binding motif (RNP1, RRM) protein 3 1313 167 B20140408_SF107_03 B20140408_SF107_03 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 1103450.0 26.010000228881836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1103450.0 1003.8394614175321 0.0 - - - - - - - 7832.0 2206 1 1315 167 B20140408_SF107_03 B20140408_SF107_03 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 1435570.0 26.010000228881836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1435570.0 1407.8026073696053 0.0 - - - - - - - 8794.0 2871 2 1317 167 B20140408_SF107_03 B20140408_SF107_03 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 1705560.0 26.010000228881836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1705560.0 1708.362676039023 0.0 - - - - - - - 9481.0 3411 1 1319 168 B20140408_SF107_03 B20140408_SF107_03 TB239659.[MT7]-RSLLNK[MT7].2b3_1.heavy 509.834 / 501.327 N/A 21.498300552368164 37 13 10 10 4 1.9026868047325416 47.197900757389476 0.0 8 0.9054823718875963 3.98221209514019 9182.0 0.0 27.0 - - - - - - - 5739.0 164 8 RSL1D1;C6orf142 ribosomal L1 domain containing 1;chromosome 6 open reading frame 142 1321 168 B20140408_SF107_03 B20140408_SF107_03 TB239659.[MT7]-RSLLNK[MT7].2y4_1.heavy 509.834 / 631.426 170638.0 21.498300552368164 37 13 10 10 4 1.9026868047325416 47.197900757389476 0.0 8 0.9054823718875963 3.98221209514019 170638.0 94.76629063991308 0.0 - - - - - - - 1435.0 341 1 RSL1D1;C6orf142 ribosomal L1 domain containing 1;chromosome 6 open reading frame 142 1323 168 B20140408_SF107_03 B20140408_SF107_03 TB239659.[MT7]-RSLLNK[MT7].2y5_1.heavy 509.834 / 718.458 8130.0 21.498300552368164 37 13 10 10 4 1.9026868047325416 47.197900757389476 0.0 8 0.9054823718875963 3.98221209514019 8130.0 14.028235294117646 2.0 - - - - - - - 741.375 26 8 RSL1D1;C6orf142 ribosomal L1 domain containing 1;chromosome 6 open reading frame 142 1325 168 B20140408_SF107_03 B20140408_SF107_03 TB239659.[MT7]-RSLLNK[MT7].2y3_1.heavy 509.834 / 518.342 8417.0 21.498300552368164 37 13 10 10 4 1.9026868047325416 47.197900757389476 0.0 8 0.9054823718875963 3.98221209514019 8417.0 3.5199163617354943 3.0 - - - - - - - 1254.0 31 9 RSL1D1;C6orf142 ribosomal L1 domain containing 1;chromosome 6 open reading frame 142 1327 169 B20140408_SF107_03 B20140408_SF107_03 TB377182.[MT7]-LQLDAR.2b3_1.heavy 430.26 / 499.336 8802.0 26.09670066833496 40 17 9 10 4 4.589289689776767 21.789864392906566 0.0 7 0.9737961340265561 7.6072334912787944 8802.0 2.410035926212707 5.0 - - - - - - - 852.0 141 1 SLC25A36 solute carrier family 25, member 36 1329 169 B20140408_SF107_03 B20140408_SF107_03 TB377182.[MT7]-LQLDAR.2y4_1.heavy 430.26 / 474.267 4827.0 26.09670066833496 40 17 9 10 4 4.589289689776767 21.789864392906566 0.0 7 0.9737961340265561 7.6072334912787944 4827.0 1.5890271958362623 17.0 - - - - - - - 710.0 191 1 SLC25A36 solute carrier family 25, member 36 1331 169 B20140408_SF107_03 B20140408_SF107_03 TB377182.[MT7]-LQLDAR.2y5_1.heavy 430.26 / 602.326 23567.0 26.09670066833496 40 17 9 10 4 4.589289689776767 21.789864392906566 0.0 7 0.9737961340265561 7.6072334912787944 23567.0 14.796071894880129 2.0 - - - - - - - 426.0 92 1 SLC25A36 solute carrier family 25, member 36 1333 169 B20140408_SF107_03 B20140408_SF107_03 TB377182.[MT7]-LQLDAR.2b4_1.heavy 430.26 / 614.363 76807.0 26.09670066833496 40 17 9 10 4 4.589289689776767 21.789864392906566 0.0 7 0.9737961340265561 7.6072334912787944 76807.0 35.880708608713974 1.0 - - - - - - - 757.3333333333334 154 3 SLC25A36 solute carrier family 25, member 36 1335 170 B20140408_SF107_03 B20140408_SF107_03 TB239590.[MT7]-VGAFTK[MT7].2y4_1.heavy 455.784 / 610.368 32919.0 25.103700637817383 37 17 2 10 8 1.3240485071550492 45.84685736834343 0.0 4 0.9719344210317602 7.349442096816243 32919.0 14.974972439498952 1.0 - - - - - - - 499.0 65 3 UQCC ubiquinol-cytochrome c reductase complex chaperone 1337 170 B20140408_SF107_03 B20140408_SF107_03 TB239590.[MT7]-VGAFTK[MT7].2y5_1.heavy 455.784 / 667.39 79803.0 25.103700637817383 37 17 2 10 8 1.3240485071550492 45.84685736834343 0.0 4 0.9719344210317602 7.349442096816243 79803.0 130.55149781707385 0.0 - - - - - - - 794.875 159 8 UQCC ubiquinol-cytochrome c reductase complex chaperone 1339 170 B20140408_SF107_03 B20140408_SF107_03 TB239590.[MT7]-VGAFTK[MT7].2b4_1.heavy 455.784 / 519.305 11596.0 25.103700637817383 37 17 2 10 8 1.3240485071550492 45.84685736834343 0.0 4 0.9719344210317602 7.349442096816243 11596.0 4.830377355417664 4.0 - - - - - - - 810.5 49 2 UQCC ubiquinol-cytochrome c reductase complex chaperone 1341 170 B20140408_SF107_03 B20140408_SF107_03 TB239590.[MT7]-VGAFTK[MT7].2y3_1.heavy 455.784 / 539.331 26684.0 25.103700637817383 37 17 2 10 8 1.3240485071550492 45.84685736834343 0.0 4 0.9719344210317602 7.349442096816243 26684.0 16.664598045294827 1.0 - - - - - - - 499.0 494 1 UQCC ubiquinol-cytochrome c reductase complex chaperone 1343 171 B20140408_SF107_03 B20140408_SF107_03 TB377752.[MT7]-TMATVYQEEGILALYK[MT7].3b4_1.heavy 706.718 / 549.282 16330.0 36.52149963378906 44 14 10 10 10 2.6539193699372428 30.073916951950814 0.0 3 0.9472102098719017 5.3475901142244116 16330.0 19.415711252653928 0.0 - - - - - - - 819.8888888888889 32 9 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 1345 171 B20140408_SF107_03 B20140408_SF107_03 TB377752.[MT7]-TMATVYQEEGILALYK[MT7].3b5_1.heavy 706.718 / 648.351 46634.0 36.52149963378906 44 14 10 10 10 2.6539193699372428 30.073916951950814 0.0 3 0.9472102098719017 5.3475901142244116 46634.0 56.93110403397027 0.0 - - - - - - - 196.25 93 4 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 1347 171 B20140408_SF107_03 B20140408_SF107_03 TB377752.[MT7]-TMATVYQEEGILALYK[MT7].3y4_1.heavy 706.718 / 638.399 48832.0 36.52149963378906 44 14 10 10 10 2.6539193699372428 30.073916951950814 0.0 3 0.9472102098719017 5.3475901142244116 48832.0 63.095031847133754 0.0 - - - - - - - 471.0 97 2 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 1349 171 B20140408_SF107_03 B20140408_SF107_03 TB377752.[MT7]-TMATVYQEEGILALYK[MT7].3y5_1.heavy 706.718 / 751.483 32188.0 36.52149963378906 44 14 10 10 10 2.6539193699372428 30.073916951950814 0.0 3 0.9472102098719017 5.3475901142244116 32188.0 63.55592356687899 0.0 - - - - - - - 392.5 64 8 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 1351 172 B20140408_SF107_03 B20140408_SF107_03 TB239956.[MT7]-LIPVSPTQGQGDR.2y8_1.heavy 756.419 / 858.406 28593.0 28.318300247192383 50 20 10 10 10 12.813641928994413 7.804182491920764 0.0 3 0.9988394590750098 36.22347655659736 28593.0 38.071109178860695 0.0 - - - - - - - 294.5 57 2 UQCC ubiquinol-cytochrome c reductase complex chaperone 1353 172 B20140408_SF107_03 B20140408_SF107_03 TB239956.[MT7]-LIPVSPTQGQGDR.2y9_1.heavy 756.419 / 945.438 29330.0 28.318300247192383 50 20 10 10 10 12.813641928994413 7.804182491920764 0.0 3 0.9988394590750098 36.22347655659736 29330.0 236.92816178846027 0.0 - - - - - - - 294.75 58 8 UQCC ubiquinol-cytochrome c reductase complex chaperone 1355 172 B20140408_SF107_03 B20140408_SF107_03 TB239956.[MT7]-LIPVSPTQGQGDR.2y10_1.heavy 756.419 / 1044.51 12086.0 28.318300247192383 50 20 10 10 10 12.813641928994413 7.804182491920764 0.0 3 0.9988394590750098 36.22347655659736 12086.0 40.68043849039459 0.0 - - - - - - - 279.8 24 10 UQCC ubiquinol-cytochrome c reductase complex chaperone 1357 172 B20140408_SF107_03 B20140408_SF107_03 TB239956.[MT7]-LIPVSPTQGQGDR.2y11_1.heavy 756.419 / 1141.56 233458.0 28.318300247192383 50 20 10 10 10 12.813641928994413 7.804182491920764 0.0 3 0.9988394590750098 36.22347655659736 233458.0 1631.4775265572202 0.0 - - - - - - - 368.5 466 2 UQCC ubiquinol-cytochrome c reductase complex chaperone 1359 173 B20140408_SF107_03 B20140408_SF107_03 TB239952.[MT7]-LTEQAVQAINK[MT7].2y4_1.heavy 751.943 / 589.379 38719.0 27.851600646972656 47 17 10 10 10 2.3090689287115898 34.529776774143755 0.0 3 0.9772422303259634 8.165267773181874 38719.0 37.648834932485244 0.0 - - - - - - - 314.14285714285717 77 7 CPPED1 calcineurin-like phosphoesterase domain containing 1 1361 173 B20140408_SF107_03 B20140408_SF107_03 TB239952.[MT7]-LTEQAVQAINK[MT7].2b4_1.heavy 751.943 / 616.342 48986.0 27.851600646972656 47 17 10 10 10 2.3090689287115898 34.529776774143755 0.0 3 0.9772422303259634 8.165267773181874 48986.0 133.5913516452872 0.0 - - - - - - - 335.14285714285717 97 7 CPPED1 calcineurin-like phosphoesterase domain containing 1 1363 173 B20140408_SF107_03 B20140408_SF107_03 TB239952.[MT7]-LTEQAVQAINK[MT7].2b6_1.heavy 751.943 / 786.448 50453.0 27.851600646972656 47 17 10 10 10 2.3090689287115898 34.529776774143755 0.0 3 0.9772422303259634 8.165267773181874 50453.0 145.3233451011107 0.0 - - - - - - - 293.25 100 8 CPPED1 calcineurin-like phosphoesterase domain containing 1 1365 173 B20140408_SF107_03 B20140408_SF107_03 TB239952.[MT7]-LTEQAVQAINK[MT7].2b5_1.heavy 751.943 / 687.379 61306.0 27.851600646972656 47 17 10 10 10 2.3090689287115898 34.529776774143755 0.0 3 0.9772422303259634 8.165267773181874 61306.0 60.95767045454546 0.0 - - - - - - - 1173.25 122 8 CPPED1 calcineurin-like phosphoesterase domain containing 1 1367 174 B20140408_SF107_03 B20140408_SF107_03 TB377753.[MT7]-AVAVTNTLPVLLSLYMSTESSEDLQVK[MT7].3b8_1.heavy 1066.25 / 914.543 6639.0 43.77090072631836 43 13 10 10 10 2.282769512282681 43.8064375145802 0.0 3 0.9185086100402206 4.293506810423092 6639.0 19.653971878380002 0.0 - - - - - - - 287.36842105263156 13 19 SPAG6 sperm associated antigen 6 1369 174 B20140408_SF107_03 B20140408_SF107_03 TB377753.[MT7]-AVAVTNTLPVLLSLYMSTESSEDLQVK[MT7].3b6_1.heavy 1066.25 / 700.411 989.0 43.77090072631836 43 13 10 10 10 2.282769512282681 43.8064375145802 0.0 3 0.9185086100402206 4.293506810423092 989.0 0.6028588684454605 1.0 - - - - - - - 0.0 1 0 SPAG6 sperm associated antigen 6 1371 174 B20140408_SF107_03 B20140408_SF107_03 TB377753.[MT7]-AVAVTNTLPVLLSLYMSTESSEDLQVK[MT7].3b7_1.heavy 1066.25 / 801.459 3108.0 43.77090072631836 43 13 10 10 10 2.282769512282681 43.8064375145802 0.0 3 0.9185086100402206 4.293506810423092 3108.0 16.060872920183265 0.0 - - - - - - - 221.625 6 24 SPAG6 sperm associated antigen 6 1373 174 B20140408_SF107_03 B20140408_SF107_03 TB377753.[MT7]-AVAVTNTLPVLLSLYMSTESSEDLQVK[MT7].3b10_1.heavy 1066.25 / 1110.66 1742.0 43.77090072631836 43 13 10 10 10 2.282769512282681 43.8064375145802 0.0 3 0.9185086100402206 4.293506810423092 1742.0 17.296453900709217 0.0 - - - - - - - 126.04 3 25 SPAG6 sperm associated antigen 6 1375 175 B20140408_SF107_03 B20140408_SF107_03 TB239657.[MT7]-VLTNFK[MT7].2y4_1.heavy 505.318 / 653.374 148143.0 28.50670051574707 46 16 10 10 10 4.012737409350574 24.920643889375285 0.0 3 0.9674166177179248 6.818328915490441 148143.0 87.26885194071761 0.0 - - - - - - - 1139.3333333333333 296 3 ARPC5L actin related protein 2/3 complex, subunit 5-like 1377 175 B20140408_SF107_03 B20140408_SF107_03 TB239657.[MT7]-VLTNFK[MT7].2y5_1.heavy 505.318 / 766.458 263449.0 28.50670051574707 46 16 10 10 10 4.012737409350574 24.920643889375285 0.0 3 0.9674166177179248 6.818328915490441 263449.0 73.87659620941324 0.0 - - - - - - - 446.0 526 1 ARPC5L actin related protein 2/3 complex, subunit 5-like 1379 175 B20140408_SF107_03 B20140408_SF107_03 TB239657.[MT7]-VLTNFK[MT7].2b4_1.heavy 505.318 / 572.352 30758.0 28.50670051574707 46 16 10 10 10 4.012737409350574 24.920643889375285 0.0 3 0.9674166177179248 6.818328915490441 30758.0 6.102261478842438 0.0 - - - - - - - 1337.0 61 1 ARPC5L actin related protein 2/3 complex, subunit 5-like 1381 175 B20140408_SF107_03 B20140408_SF107_03 TB239657.[MT7]-VLTNFK[MT7].2y3_1.heavy 505.318 / 552.326 85885.0 28.50670051574707 46 16 10 10 10 4.012737409350574 24.920643889375285 0.0 3 0.9674166177179248 6.818328915490441 85885.0 30.66596086504057 0.0 - - - - - - - 1189.0 171 1 ARPC5L actin related protein 2/3 complex, subunit 5-like 1383 176 B20140408_SF107_03 B20140408_SF107_03 TB498282.[MT7]-LDDDMNLLDIFIEMEK[MT7].3b9_1.heavy 748.046 / 1189.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP8 caspase 8, apoptosis-related cysteine peptidase 1385 176 B20140408_SF107_03 B20140408_SF107_03 TB498282.[MT7]-LDDDMNLLDIFIEMEK[MT7].3y6_1.heavy 748.046 / 940.493 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP8 caspase 8, apoptosis-related cysteine peptidase 1387 176 B20140408_SF107_03 B20140408_SF107_03 TB498282.[MT7]-LDDDMNLLDIFIEMEK[MT7].3y3_1.heavy 748.046 / 551.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP8 caspase 8, apoptosis-related cysteine peptidase 1389 176 B20140408_SF107_03 B20140408_SF107_03 TB498282.[MT7]-LDDDMNLLDIFIEMEK[MT7].3b4_1.heavy 748.046 / 603.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP8 caspase 8, apoptosis-related cysteine peptidase 1391 177 B20140408_SF107_03 B20140408_SF107_03 TB498285.[MT7]-LAVQK[MT7]YEELFPAFSDSR.4y5_1.heavy 572.81 / 611.278 66356.0 36.52149963378906 44 14 10 10 10 1.9449671658264729 40.9706895509283 0.0 3 0.9401491950106917 5.019230396311289 66356.0 111.97799158639077 0.0 - - - - - - - 354.8 132 5 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1393 177 B20140408_SF107_03 B20140408_SF107_03 TB498285.[MT7]-LAVQK[MT7]YEELFPAFSDSR.4b8_2.heavy 572.81 / 625.355 124962.0 36.52149963378906 44 14 10 10 10 1.9449671658264729 40.9706895509283 0.0 3 0.9401491950106917 5.019230396311289 124962.0 100.52023270098151 0.0 - - - - - - - 376.3333333333333 249 3 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1395 177 B20140408_SF107_03 B20140408_SF107_03 TB498285.[MT7]-LAVQK[MT7]YEELFPAFSDSR.4y7_1.heavy 572.81 / 779.368 59898.0 36.52149963378906 44 14 10 10 10 1.9449671658264729 40.9706895509283 0.0 3 0.9401491950106917 5.019230396311289 59898.0 49.89455838691062 0.0 - - - - - - - 322.75 119 4 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1397 177 B20140408_SF107_03 B20140408_SF107_03 TB498285.[MT7]-LAVQK[MT7]YEELFPAFSDSR.4y6_1.heavy 572.81 / 682.315 94125.0 36.52149963378906 44 14 10 10 10 1.9449671658264729 40.9706895509283 0.0 3 0.9401491950106917 5.019230396311289 94125.0 64.80737704918033 0.0 - - - - - - - 161.0 188 1 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1399 178 B20140408_SF107_03 B20140408_SF107_03 TB498286.[MT7]-NLYDIGEQLDSEDLASLK[MT7].4y4_1.heavy 578.553 / 562.368 8054.0 36.32720184326172 45 15 10 10 10 3.678806343288853 27.182730121803584 0.0 3 0.9583965637368412 6.0294885109759795 8054.0 5.125556849049282 0.0 - - - - - - - 483.0 16 1 CASP8 caspase 8, apoptosis-related cysteine peptidase 1401 178 B20140408_SF107_03 B20140408_SF107_03 TB498286.[MT7]-NLYDIGEQLDSEDLASLK[MT7].4b4_1.heavy 578.553 / 650.327 12725.0 36.32720184326172 45 15 10 10 10 3.678806343288853 27.182730121803584 0.0 3 0.9583965637368412 6.0294885109759795 12725.0 2.8943627412916357 0.0 - - - - - - - 751.3333333333334 25 3 CASP8 caspase 8, apoptosis-related cysteine peptidase 1403 178 B20140408_SF107_03 B20140408_SF107_03 TB498286.[MT7]-NLYDIGEQLDSEDLASLK[MT7].4b6_1.heavy 578.553 / 820.432 4832.0 36.32720184326172 45 15 10 10 10 3.678806343288853 27.182730121803584 0.0 3 0.9583965637368412 6.0294885109759795 4832.0 7.796312056737589 0.0 - - - - - - - 782.0 9 7 CASP8 caspase 8, apoptosis-related cysteine peptidase 1405 178 B20140408_SF107_03 B20140408_SF107_03 TB498286.[MT7]-NLYDIGEQLDSEDLASLK[MT7].4b3_1.heavy 578.553 / 535.3 4832.0 36.32720184326172 45 15 10 10 10 3.678806343288853 27.182730121803584 0.0 3 0.9583965637368412 6.0294885109759795 4832.0 3.3651006917011186 1.0 - - - - - - - 885.5 9 4 CASP8 caspase 8, apoptosis-related cysteine peptidase 1407 179 B20140408_SF107_03 B20140408_SF107_03 TB239796.[MT7]-TLAAFPAEK[MT7].3y3_1.heavy 412.579 / 491.295 682250.0 28.740800857543945 45 15 10 10 10 1.686062685876651 42.12555025147416 0.0 3 0.9561125796589285 5.869364315384757 682250.0 369.4869126499144 0.0 - - - - - - - 895.0 1364 2 CPPED1 calcineurin-like phosphoesterase domain containing 1 1409 179 B20140408_SF107_03 B20140408_SF107_03 TB239796.[MT7]-TLAAFPAEK[MT7].3b4_1.heavy 412.579 / 501.315 1026210.0 28.740800857543945 45 15 10 10 10 1.686062685876651 42.12555025147416 0.0 3 0.9561125796589285 5.869364315384757 1026210.0 397.58072434673477 0.0 - - - - - - - 1342.0 2052 1 CPPED1 calcineurin-like phosphoesterase domain containing 1 1411 179 B20140408_SF107_03 B20140408_SF107_03 TB239796.[MT7]-TLAAFPAEK[MT7].3y4_1.heavy 412.579 / 588.347 483103.0 28.740800857543945 45 15 10 10 10 1.686062685876651 42.12555025147416 0.0 3 0.9561125796589285 5.869364315384757 483103.0 267.12218972553654 0.0 - - - - - - - 447.0 966 3 CPPED1 calcineurin-like phosphoesterase domain containing 1 1413 179 B20140408_SF107_03 B20140408_SF107_03 TB239796.[MT7]-TLAAFPAEK[MT7].3b3_1.heavy 412.579 / 430.278 517886.0 28.740800857543945 45 15 10 10 10 1.686062685876651 42.12555025147416 0.0 3 0.9561125796589285 5.869364315384757 517886.0 307.8979679645321 0.0 - - - - - - - 447.0 1035 1 CPPED1 calcineurin-like phosphoesterase domain containing 1 1415 180 B20140408_SF107_03 B20140408_SF107_03 TB377854.[MT7]-FVDEQEEAAAAAAEPGPDPSEVDGLLR.3b5_1.heavy 976.472 / 763.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARPC5L actin related protein 2/3 complex, subunit 5-like 1417 180 B20140408_SF107_03 B20140408_SF107_03 TB377854.[MT7]-FVDEQEEAAAAAAEPGPDPSEVDGLLR.3b3_1.heavy 976.472 / 506.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARPC5L actin related protein 2/3 complex, subunit 5-like 1419 180 B20140408_SF107_03 B20140408_SF107_03 TB377854.[MT7]-FVDEQEEAAAAAAEPGPDPSEVDGLLR.3b7_1.heavy 976.472 / 1021.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARPC5L actin related protein 2/3 complex, subunit 5-like 1421 180 B20140408_SF107_03 B20140408_SF107_03 TB377854.[MT7]-FVDEQEEAAAAAAEPGPDPSEVDGLLR.3y9_1.heavy 976.472 / 985.531 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARPC5L actin related protein 2/3 complex, subunit 5-like 1423 181 B20140408_SF107_03 B20140408_SF107_03 TB377852.[MT7]-HSVDLAEMVVEAEIFPVVLTC[CAM]LK[MT7].4y4_1.heavy 722.644 / 665.377 15520.0 44.311500549316406 43 13 10 10 10 1.3721618718028756 57.65890429263899 0.0 3 0.9112070520560909 4.110607192138877 15520.0 55.2228641389601 0.0 - - - - - - - 694.6 31 10 SPAG6 sperm associated antigen 6 1425 181 B20140408_SF107_03 B20140408_SF107_03 TB377852.[MT7]-HSVDLAEMVVEAEIFPVVLTC[CAM]LK[MT7].4b7_1.heavy 722.644 / 896.459 16832.0 44.311500549316406 43 13 10 10 10 1.3721618718028756 57.65890429263899 0.0 3 0.9112070520560909 4.110607192138877 16832.0 143.5140666114333 0.0 - - - - - - - 263.03846153846155 33 26 SPAG6 sperm associated antigen 6 1427 181 B20140408_SF107_03 B20140408_SF107_03 TB377852.[MT7]-HSVDLAEMVVEAEIFPVVLTC[CAM]LK[MT7].4b4_1.heavy 722.644 / 583.296 6449.0 44.311500549316406 43 13 10 10 10 1.3721618718028756 57.65890429263899 0.0 3 0.9112070520560909 4.110607192138877 6449.0 48.36402295990312 0.0 - - - - - - - 225.74074074074073 12 27 SPAG6 sperm associated antigen 6 1429 181 B20140408_SF107_03 B20140408_SF107_03 TB377852.[MT7]-HSVDLAEMVVEAEIFPVVLTC[CAM]LK[MT7].4b5_1.heavy 722.644 / 696.38 5173.0 44.311500549316406 43 13 10 10 10 1.3721618718028756 57.65890429263899 0.0 3 0.9112070520560909 4.110607192138877 5173.0 21.753128205128206 0.0 - - - - - - - 274.57142857142856 10 28 SPAG6 sperm associated antigen 6 1431 182 B20140408_SF107_03 B20140408_SF107_03 TB239585.[MT7]-ELAGAHR.2y4_1.heavy 449.255 / 440.236 N/A 18.72130012512207 40 18 4 10 8 3.4247790601615193 29.198963858206902 0.0 4 0.9893963142755422 11.974280782427249 10643.0 3.0248513922764544 11.0 - - - - - - - 4153.5 41 2 BCCIP BRCA2 and CDKN1A interacting protein 1433 182 B20140408_SF107_03 B20140408_SF107_03 TB239585.[MT7]-ELAGAHR.2b3_1.heavy 449.255 / 458.273 2907.0 18.72130012512207 40 18 4 10 8 3.4247790601615193 29.198963858206902 0.0 4 0.9893963142755422 11.974280782427249 2907.0 6.176465763957115 0.0 - - - - - - - 698.9230769230769 5 13 BCCIP BRCA2 and CDKN1A interacting protein 1435 182 B20140408_SF107_03 B20140408_SF107_03 TB239585.[MT7]-ELAGAHR.2y6_1.heavy 449.255 / 624.358 8619.0 18.72130012512207 40 18 4 10 8 3.4247790601615193 29.198963858206902 0.0 4 0.9893963142755422 11.974280782427249 8619.0 20.354283418079532 0.0 - - - - - - - 688.0 17 8 BCCIP BRCA2 and CDKN1A interacting protein 1437 182 B20140408_SF107_03 B20140408_SF107_03 TB239585.[MT7]-ELAGAHR.2b5_1.heavy 449.255 / 586.332 3219.0 18.72130012512207 40 18 4 10 8 3.4247790601615193 29.198963858206902 0.0 4 0.9893963142755422 11.974280782427249 3219.0 6.150045463401961 1.0 - - - - - - - 664.5333333333333 6 15 BCCIP BRCA2 and CDKN1A interacting protein 1439 183 B20140408_SF107_03 B20140408_SF107_03 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 428062.0 32.810001373291016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 428062.0 84.31689705696363 0.0 - - - - - - - 329.6666666666667 856 3 1441 183 B20140408_SF107_03 B20140408_SF107_03 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 934710.0 32.810001373291016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 934710.0 160.03557383969317 0.0 - - - - - - - 824.0 1869 7 1443 183 B20140408_SF107_03 B20140408_SF107_03 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 883689.0 32.810001373291016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 883689.0 97.92395327150193 0.0 - - - - - - - 384.6666666666667 1767 3 1445 184 B20140408_SF107_03 B20140408_SF107_03 TB498005.[MT7]-VVVVTAEK[MT7].2y4_1.heavy 566.863 / 592.342 131557.0 25.586700439453125 48 20 10 10 8 9.43269109986987 10.601428472663496 0.0 4 0.9954314274644464 18.251838892322912 131557.0 60.354233715715985 0.0 - - - - - - - 913.3333333333334 263 3 CPPED1 calcineurin-like phosphoesterase domain containing 1 1447 184 B20140408_SF107_03 B20140408_SF107_03 TB498005.[MT7]-VVVVTAEK[MT7].2y5_1.heavy 566.863 / 691.411 96749.0 25.586700439453125 48 20 10 10 8 9.43269109986987 10.601428472663496 0.0 4 0.9954314274644464 18.251838892322912 96749.0 42.44313396950427 0.0 - - - - - - - 274.0 193 1 CPPED1 calcineurin-like phosphoesterase domain containing 1 1449 184 B20140408_SF107_03 B20140408_SF107_03 TB498005.[MT7]-VVVVTAEK[MT7].2y6_1.heavy 566.863 / 790.479 72219.0 25.586700439453125 48 20 10 10 8 9.43269109986987 10.601428472663496 0.0 4 0.9954314274644464 18.251838892322912 72219.0 66.82712608840639 0.0 - - - - - - - 1213.4285714285713 144 7 CPPED1 calcineurin-like phosphoesterase domain containing 1 1451 184 B20140408_SF107_03 B20140408_SF107_03 TB498005.[MT7]-VVVVTAEK[MT7].2y7_1.heavy 566.863 / 889.547 76604.0 25.586700439453125 48 20 10 10 8 9.43269109986987 10.601428472663496 0.0 4 0.9954314274644464 18.251838892322912 76604.0 72.67542238253478 1.0 - - - - - - - 743.7142857142857 221 7 CPPED1 calcineurin-like phosphoesterase domain containing 1 1453 185 B20140408_SF107_03 B20140408_SF107_03 TB239583.[MT7]-AAAFVLR.2y5_1.heavy 446.28 / 605.377 72205.0 29.689300537109375 46 16 10 10 10 2.169296693000121 46.09788984728537 0.0 3 0.9648047337092631 6.559008343033401 72205.0 46.33366148408065 0.0 - - - - - - - 453.0 144 1 SPAG6 sperm associated antigen 6 1455 185 B20140408_SF107_03 B20140408_SF107_03 TB239583.[MT7]-AAAFVLR.2b4_1.heavy 446.28 / 505.289 123565.0 29.689300537109375 46 16 10 10 10 2.169296693000121 46.09788984728537 0.0 3 0.9648047337092631 6.559008343033401 123565.0 92.23052574609781 0.0 - - - - - - - 151.0 247 1 SPAG6 sperm associated antigen 6 1457 185 B20140408_SF107_03 B20140408_SF107_03 TB239583.[MT7]-AAAFVLR.2y6_1.heavy 446.28 / 676.414 211026.0 29.689300537109375 46 16 10 10 10 2.169296693000121 46.09788984728537 0.0 3 0.9648047337092631 6.559008343033401 211026.0 203.75648496007923 0.0 - - - - - - - 201.33333333333334 422 3 SPAG6 sperm associated antigen 6 1459 185 B20140408_SF107_03 B20140408_SF107_03 TB239583.[MT7]-AAAFVLR.2b5_1.heavy 446.28 / 604.357 122054.0 29.689300537109375 46 16 10 10 10 2.169296693000121 46.09788984728537 0.0 3 0.9648047337092631 6.559008343033401 122054.0 102.97921970862613 0.0 - - - - - - - 226.5 244 2 SPAG6 sperm associated antigen 6 1461 186 B20140408_SF107_03 B20140408_SF107_03 TB498008.[MT7]-DALMLFQR.2y5_1.heavy 569.314 / 694.37 83159.0 34.964500427246094 44 14 10 10 10 1.4292763422057846 46.64365084486098 0.0 3 0.9443287763530326 5.206085449806192 83159.0 92.19975335249042 0.0 - - - - - - - 174.0 166 1 CASP8 caspase 8, apoptosis-related cysteine peptidase 1463 186 B20140408_SF107_03 B20140408_SF107_03 TB498008.[MT7]-DALMLFQR.2b4_1.heavy 569.314 / 575.298 62282.0 34.964500427246094 44 14 10 10 10 1.4292763422057846 46.64365084486098 0.0 3 0.9443287763530326 5.206085449806192 62282.0 64.38897988505747 0.0 - - - - - - - 591.6 124 5 CASP8 caspase 8, apoptosis-related cysteine peptidase 1465 186 B20140408_SF107_03 B20140408_SF107_03 TB498008.[MT7]-DALMLFQR.2y6_1.heavy 569.314 / 807.455 37578.0 34.964500427246094 44 14 10 10 10 1.4292763422057846 46.64365084486098 0.0 3 0.9443287763530326 5.206085449806192 37578.0 71.86852490421455 0.0 - - - - - - - 348.0 75 4 CASP8 caspase 8, apoptosis-related cysteine peptidase 1467 186 B20140408_SF107_03 B20140408_SF107_03 TB498008.[MT7]-DALMLFQR.2y7_1.heavy 569.314 / 878.492 56889.0 34.964500427246094 44 14 10 10 10 1.4292763422057846 46.64365084486098 0.0 3 0.9443287763530326 5.206085449806192 56889.0 103.69164568965518 0.0 - - - - - - - 290.0 113 6 CASP8 caspase 8, apoptosis-related cysteine peptidase 1469 187 B20140408_SF107_03 B20140408_SF107_03 TB239946.[MT7]-C[CAM]YFYLLISK[MT7].3b4_1.heavy 498.947 / 778.335 25864.0 37.96160125732422 42 12 10 10 10 1.4906069337816967 53.15082768075141 0.0 3 0.8949342061371126 3.773582062932066 25864.0 147.67509677419355 0.0 - - - - - - - 258.3333333333333 51 9 BCCIP BRCA2 and CDKN1A interacting protein 1471 187 B20140408_SF107_03 B20140408_SF107_03 TB239946.[MT7]-C[CAM]YFYLLISK[MT7].3b5_1.heavy 498.947 / 891.419 8208.0 37.96160125732422 42 12 10 10 10 1.4906069337816967 53.15082768075141 0.0 3 0.8949342061371126 3.773582062932066 8208.0 59.012403285323174 0.0 - - - - - - - 310.0 16 4 BCCIP BRCA2 and CDKN1A interacting protein 1473 187 B20140408_SF107_03 B20140408_SF107_03 TB239946.[MT7]-C[CAM]YFYLLISK[MT7].3y4_1.heavy 498.947 / 604.415 11306.0 37.96160125732422 42 12 10 10 10 1.4906069337816967 53.15082768075141 0.0 3 0.8949342061371126 3.773582062932066 11306.0 16.972687651331718 0.0 - - - - - - - 287.85714285714283 22 7 BCCIP BRCA2 and CDKN1A interacting protein 1475 187 B20140408_SF107_03 B20140408_SF107_03 TB239946.[MT7]-C[CAM]YFYLLISK[MT7].3b3_1.heavy 498.947 / 615.272 12235.0 37.96160125732422 42 12 10 10 10 1.4906069337816967 53.15082768075141 0.0 3 0.8949342061371126 3.773582062932066 12235.0 88.43324613059566 0.0 - - - - - - - 217.0 24 10 BCCIP BRCA2 and CDKN1A interacting protein 1477 188 B20140408_SF107_03 B20140408_SF107_03 TB239945.[MT7]-LTDEEVDEMIR.2y4_1.heavy 747.367 / 548.286 19369.0 31.78065013885498 41 16 10 5 10 2.669304536691889 30.55001132515568 0.04469871520996094 3 0.9695137869615097 7.050194165440735 19369.0 33.12538091071949 0.0 - - - - - - - 370.6666666666667 38 3 CALM1;CALM2;CALM3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta) 1479 188 B20140408_SF107_03 B20140408_SF107_03 TB239945.[MT7]-LTDEEVDEMIR.2y8_1.heavy 747.367 / 1020.47 9684.0 31.78065013885498 41 16 10 5 10 2.669304536691889 30.55001132515568 0.04469871520996094 3 0.9695137869615097 7.050194165440735 9684.0 9.66013333611813 0.0 - - - - - - - 423.3333333333333 19 3 CALM1;CALM2;CALM3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta) 1481 188 B20140408_SF107_03 B20140408_SF107_03 TB239945.[MT7]-LTDEEVDEMIR.2y10_1.heavy 747.367 / 1236.54 14130.0 31.78065013885498 41 16 10 5 10 2.669304536691889 30.55001132515568 0.04469871520996094 3 0.9695137869615097 7.050194165440735 14130.0 11.452925886364163 0.0 - - - - - - - 212.0 28 3 CALM1;CALM2;CALM3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta) 1483 188 B20140408_SF107_03 B20140408_SF107_03 TB239945.[MT7]-LTDEEVDEMIR.2b5_1.heavy 747.367 / 732.353 8732.0 31.78065013885498 41 16 10 5 10 2.669304536691889 30.55001132515568 0.04469871520996094 3 0.9695137869615097 7.050194165440735 8732.0 2.5424287410821638 1.0 - - - - - - - 2630.8571428571427 17 7 CALM1;CALM2;CALM3 calmodulin 1 (phosphorylase kinase, delta);calmodulin 2 (phosphorylase kinase, delta);calmodulin 3 (phosphorylase kinase, delta) 1485 189 B20140408_SF107_03 B20140408_SF107_03 TB239947.[MT7]-VVSPGPLHC[CAM]LK[MT7].3y3_1.heavy 498.962 / 564.33 122529.0 27.36240005493164 50 20 10 10 10 9.225270033153235 10.839791099948929 0.0 3 0.9947632357913557 17.04673276164809 122529.0 82.09646917585363 0.0 - - - - - - - 292.0 245 2 SLC25A36 solute carrier family 25, member 36 1487 189 B20140408_SF107_03 B20140408_SF107_03 TB239947.[MT7]-VVSPGPLHC[CAM]LK[MT7].3b5_1.heavy 498.962 / 584.352 97702.0 27.36240005493164 50 20 10 10 10 9.225270033153235 10.839791099948929 0.0 3 0.9947632357913557 17.04673276164809 97702.0 71.51602662767431 0.0 - - - - - - - 438.0 195 1 SLC25A36 solute carrier family 25, member 36 1489 189 B20140408_SF107_03 B20140408_SF107_03 TB239947.[MT7]-VVSPGPLHC[CAM]LK[MT7].3y4_1.heavy 498.962 / 701.388 49946.0 27.36240005493164 50 20 10 10 10 9.225270033153235 10.839791099948929 0.0 3 0.9947632357913557 17.04673276164809 49946.0 54.45933275956872 0.0 - - - - - - - 146.0 99 1 SLC25A36 solute carrier family 25, member 36 1491 189 B20140408_SF107_03 B20140408_SF107_03 TB239947.[MT7]-VVSPGPLHC[CAM]LK[MT7].3b7_1.heavy 498.962 / 794.489 25849.0 27.36240005493164 50 20 10 10 10 9.225270033153235 10.839791099948929 0.0 3 0.9947632357913557 17.04673276164809 25849.0 40.204637557077625 0.0 - - - - - - - 389.3333333333333 51 3 SLC25A36 solute carrier family 25, member 36 1493 190 B20140408_SF107_03 B20140408_SF107_03 TB497976.[MT7]-SQYEVFR.2b3_1.heavy 536.781 / 523.263 24104.0 27.407800674438477 47 17 10 10 10 3.4299473041670265 29.154966864508523 0.0 3 0.970972253411846 7.2260260543216575 24104.0 10.427792679230665 1.0 - - - - - - - 438.0 53 1 AP1AR adaptor-related protein complex 1 associated regulatory protein 1495 190 B20140408_SF107_03 B20140408_SF107_03 TB497976.[MT7]-SQYEVFR.2y5_1.heavy 536.781 / 713.362 39589.0 27.407800674438477 47 17 10 10 10 3.4299473041670265 29.154966864508523 0.0 3 0.970972253411846 7.2260260543216575 39589.0 32.60506567069826 0.0 - - - - - - - 1315.0 79 8 AP1AR adaptor-related protein complex 1 associated regulatory protein 1497 190 B20140408_SF107_03 B20140408_SF107_03 TB497976.[MT7]-SQYEVFR.2b4_1.heavy 536.781 / 652.306 63401.0 27.407800674438477 47 17 10 10 10 3.4299473041670265 29.154966864508523 0.0 3 0.970972253411846 7.2260260543216575 63401.0 31.28986738781814 0.0 - - - - - - - 730.3333333333334 126 3 AP1AR adaptor-related protein complex 1 associated regulatory protein 1499 190 B20140408_SF107_03 B20140408_SF107_03 TB497976.[MT7]-SQYEVFR.2y6_1.heavy 536.781 / 841.42 61064.0 27.407800674438477 47 17 10 10 10 3.4299473041670265 29.154966864508523 0.0 3 0.970972253411846 7.2260260543216575 61064.0 68.26971159235934 0.0 - - - - - - - 292.0 122 6 AP1AR adaptor-related protein complex 1 associated regulatory protein 1501 191 B20140408_SF107_03 B20140408_SF107_03 TB498003.[MT7]-LNPK[MT7]PK[MT7].2y4_1.heavy 564.877 / 757.517 20599.0 20.264299392700195 48 18 10 10 10 4.519560026088167 22.126047540639345 0.0 3 0.9882046788238226 11.352190524118063 20599.0 63.92245831472924 0.0 - - - - - - - 239.94444444444446 41 18 CPPED1 calcineurin-like phosphoesterase domain containing 1 1503 191 B20140408_SF107_03 B20140408_SF107_03 TB498003.[MT7]-LNPK[MT7]PK[MT7].2y5_1.heavy 564.877 / 871.56 10335.0 20.264299392700195 48 18 10 10 10 4.519560026088167 22.126047540639345 0.0 3 0.9882046788238226 11.352190524118063 10335.0 65.06552419354838 0.0 - - - - - - - 224.22222222222223 20 18 CPPED1 calcineurin-like phosphoesterase domain containing 1 1505 191 B20140408_SF107_03 B20140408_SF107_03 TB498003.[MT7]-LNPK[MT7]PK[MT7].2b4_1.heavy 564.877 / 741.486 5238.0 20.264299392700195 48 18 10 10 10 4.519560026088167 22.126047540639345 0.0 3 0.9882046788238226 11.352190524118063 5238.0 27.21843440100308 0.0 - - - - - - - 205.0 10 19 CPPED1 calcineurin-like phosphoesterase domain containing 1 1507 191 B20140408_SF107_03 B20140408_SF107_03 TB498003.[MT7]-LNPK[MT7]PK[MT7].2y3_1.heavy 564.877 / 660.465 2194.0 20.264299392700195 48 18 10 10 10 4.519560026088167 22.126047540639345 0.0 3 0.9882046788238226 11.352190524118063 2194.0 2.410989010989011 9.0 - - - - - - - 619.25 9 8 CPPED1 calcineurin-like phosphoesterase domain containing 1 1509 192 B20140408_SF107_03 B20140408_SF107_03 TB239646.[MT7]-C[CAM]AVAATTR.2y5_1.heavy 497.267 / 519.289 51494.0 19.356599807739258 48 18 10 10 10 126.16436980991791 0.7926168073495097 0.0 3 0.9800957648382692 8.733063564862688 51494.0 72.33793848110147 0.0 - - - - - - - 1202.375 102 8 COX5A cytochrome c oxidase subunit Va 1511 192 B20140408_SF107_03 B20140408_SF107_03 TB239646.[MT7]-C[CAM]AVAATTR.2b4_1.heavy 497.267 / 546.283 27130.0 19.356599807739258 48 18 10 10 10 126.16436980991791 0.7926168073495097 0.0 3 0.9800957648382692 8.733063564862688 27130.0 28.885397915997 0.0 - - - - - - - 715.1666666666666 54 12 COX5A cytochrome c oxidase subunit Va 1513 192 B20140408_SF107_03 B20140408_SF107_03 TB239646.[MT7]-C[CAM]AVAATTR.2y6_1.heavy 497.267 / 618.357 41990.0 19.356599807739258 48 18 10 10 10 126.16436980991791 0.7926168073495097 0.0 3 0.9800957648382692 8.733063564862688 41990.0 85.45086422187171 0.0 - - - - - - - 710.4444444444445 83 9 COX5A cytochrome c oxidase subunit Va 1515 192 B20140408_SF107_03 B20140408_SF107_03 TB239646.[MT7]-C[CAM]AVAATTR.2y7_1.heavy 497.267 / 689.394 100685.0 19.356599807739258 48 18 10 10 10 126.16436980991791 0.7926168073495097 0.0 3 0.9800957648382692 8.733063564862688 100685.0 193.55142800668423 0.0 - - - - - - - 283.85714285714283 201 14 COX5A cytochrome c oxidase subunit Va 1517 193 B20140408_SF107_03 B20140408_SF107_03 TB498273.[MT7]-DSGDYPLTAPGLSWK[MT7]K[MT7].4y4_1.heavy 542.549 / 836.523 17346.0 30.603099822998047 38 8 10 10 10 0.6116612366427241 86.3077726672015 0.0 3 0.7790035802219054 2.575290846956699 17346.0 24.005153818388074 0.0 - - - - - - - 328.4166666666667 34 12 STAG3L4 stromal antigen 3-like 4 1519 193 B20140408_SF107_03 B20140408_SF107_03 TB498273.[MT7]-DSGDYPLTAPGLSWK[MT7]K[MT7].4b4_1.heavy 542.549 / 519.217 171405.0 30.603099822998047 38 8 10 10 10 0.6116612366427241 86.3077726672015 0.0 3 0.7790035802219054 2.575290846956699 171405.0 49.96980393327941 0.0 - - - - - - - 1419.0 342 1 STAG3L4 stromal antigen 3-like 4 1521 193 B20140408_SF107_03 B20140408_SF107_03 TB498273.[MT7]-DSGDYPLTAPGLSWK[MT7]K[MT7].4b5_1.heavy 542.549 / 682.28 187962.0 30.603099822998047 38 8 10 10 10 0.6116612366427241 86.3077726672015 0.0 3 0.7790035802219054 2.575290846956699 187962.0 128.0735248801114 0.0 - - - - - - - 158.0 375 1 STAG3L4 stromal antigen 3-like 4 1523 193 B20140408_SF107_03 B20140408_SF107_03 TB498273.[MT7]-DSGDYPLTAPGLSWK[MT7]K[MT7].4y7_2.heavy 542.549 / 552.344 287463.0 30.603099822998047 38 8 10 10 10 0.6116612366427241 86.3077726672015 0.0 3 0.7790035802219054 2.575290846956699 287463.0 90.04107247394919 0.0 - - - - - - - 788.0 574 1 STAG3L4 stromal antigen 3-like 4 1525 194 B20140408_SF107_03 B20140408_SF107_03 TB498101.[MT7]-TPGPAVAIQSVR.3y6_1.heavy 447.265 / 673.399 278402.0 27.67259979248047 48 18 10 10 10 2.704040889592584 29.56709363662734 0.0 3 0.9830838534675608 9.475399446211432 278402.0 95.96251760429865 0.0 - - - - - - - 1209.5 556 4 COX5A cytochrome c oxidase subunit Va 1527 194 B20140408_SF107_03 B20140408_SF107_03 TB498101.[MT7]-TPGPAVAIQSVR.3b5_1.heavy 447.265 / 568.321 437175.0 27.67259979248047 48 18 10 10 10 2.704040889592584 29.56709363662734 0.0 3 0.9830838534675608 9.475399446211432 437175.0 169.28018305190486 0.0 - - - - - - - 880.0 874 1 COX5A cytochrome c oxidase subunit Va 1529 194 B20140408_SF107_03 B20140408_SF107_03 TB498101.[MT7]-TPGPAVAIQSVR.3y4_1.heavy 447.265 / 489.278 429258.0 27.67259979248047 48 18 10 10 10 2.704040889592584 29.56709363662734 0.0 3 0.9830838534675608 9.475399446211432 429258.0 111.3815029854184 0.0 - - - - - - - 2345.3333333333335 858 3 COX5A cytochrome c oxidase subunit Va 1531 194 B20140408_SF107_03 B20140408_SF107_03 TB498101.[MT7]-TPGPAVAIQSVR.3y5_1.heavy 447.265 / 602.362 257438.0 27.67259979248047 48 18 10 10 10 2.704040889592584 29.56709363662734 0.0 3 0.9830838534675608 9.475399446211432 257438.0 113.99359993024868 0.0 - - - - - - - 440.0 514 1 COX5A cytochrome c oxidase subunit Va 1533 195 B20140408_SF107_03 B20140408_SF107_03 TB377375.[MT7]-RVILGEGK[MT7].3y3_1.heavy 387.252 / 477.279 32169.0 23.30802583694458 42 16 10 6 10 3.220647224969567 31.0496595916198 0.03849983215332031 3 0.9614137219253306 6.262380556374431 32169.0 14.715189905148623 0.0 - - - - - - - 962.0 64 1 CASP8 caspase 8, apoptosis-related cysteine peptidase 1535 195 B20140408_SF107_03 B20140408_SF107_03 TB377375.[MT7]-RVILGEGK[MT7].3b5_1.heavy 387.252 / 683.469 17955.0 23.30802583694458 42 16 10 6 10 3.220647224969567 31.0496595916198 0.03849983215332031 3 0.9614137219253306 6.262380556374431 17955.0 28.002185222544036 0.0 - - - - - - - 788.125 35 8 CASP8 caspase 8, apoptosis-related cysteine peptidase 1537 195 B20140408_SF107_03 B20140408_SF107_03 TB377375.[MT7]-RVILGEGK[MT7].3b3_1.heavy 387.252 / 513.363 45528.0 23.30802583694458 42 16 10 6 10 3.220647224969567 31.0496595916198 0.03849983215332031 3 0.9614137219253306 6.262380556374431 45528.0 32.45266590994825 0.0 - - - - - - - 819.3333333333334 91 3 CASP8 caspase 8, apoptosis-related cysteine peptidase 1539 195 B20140408_SF107_03 B20140408_SF107_03 TB377375.[MT7]-RVILGEGK[MT7].3y4_1.heavy 387.252 / 534.3 118308.0 23.30802583694458 42 16 10 6 10 3.220647224969567 31.0496595916198 0.03849983215332031 3 0.9614137219253306 6.262380556374431 118308.0 60.79436605378663 0.0 - - - - - - - 305.2857142857143 236 7 CASP8 caspase 8, apoptosis-related cysteine peptidase 1541 196 B20140408_SF107_03 B20140408_SF107_03 TB498275.[MT7]-GPFYFILGADPQFGLIK[MT7].3b6_1.heavy 724.41 / 869.468 18244.0 43.569732666015625 30 17 0 3 10 2.1233857190534553 37.46143745320875 0.06850051879882812 3 0.9726110378014383 7.440092356369061 18244.0 64.43336239347602 0.0 - - - - - - - 250.0 36 9 CPPED1 calcineurin-like phosphoesterase domain containing 1 1543 196 B20140408_SF107_03 B20140408_SF107_03 TB498275.[MT7]-GPFYFILGADPQFGLIK[MT7].3b4_1.heavy 724.41 / 609.315 15241.0 43.569732666015625 30 17 0 3 10 2.1233857190534553 37.46143745320875 0.06850051879882812 3 0.9726110378014383 7.440092356369061 15241.0 45.23858854546912 0.0 - - - - - - - 751.0 30 8 CPPED1 calcineurin-like phosphoesterase domain containing 1 1545 196 B20140408_SF107_03 B20140408_SF107_03 TB498275.[MT7]-GPFYFILGADPQFGLIK[MT7].3b5_1.heavy 724.41 / 756.384 25076.0 43.569732666015625 30 17 0 3 10 2.1233857190534553 37.46143745320875 0.06850051879882812 3 0.9726110378014383 7.440092356369061 25076.0 52.00389346536635 0.0 - - - - - - - 736.0 50 10 CPPED1 calcineurin-like phosphoesterase domain containing 1 1547 196 B20140408_SF107_03 B20140408_SF107_03 TB498275.[MT7]-GPFYFILGADPQFGLIK[MT7].3y5_1.heavy 724.41 / 721.473 N/A 43.569732666015625 30 17 0 3 10 2.1233857190534553 37.46143745320875 0.06850051879882812 3 0.9726110378014383 7.440092356369061 13214.0 0.0 4.0 - - - - - - - 734.3333333333334 263 9 CPPED1 calcineurin-like phosphoesterase domain containing 1 1549 197 B20140408_SF107_03 B20140408_SF107_03 TB377371.[MT7]-GGGDQGYGSGR.2y10_1.heavy 577.769 / 953.407 2306.0 17.922399520874023 45 15 10 10 10 1.2639486424166928 48.946451618291576 0.0 3 0.9521882000430649 5.621459492784629 2306.0 32.18139836205843 0.0 - - - - - - - 83.6923076923077 4 13 RBM3 RNA binding motif (RNP1, RRM) protein 3 1551 197 B20140408_SF107_03 B20140408_SF107_03 TB377371.[MT7]-GGGDQGYGSGR.2b5_1.heavy 577.769 / 559.259 N/A 17.922399520874023 45 15 10 10 10 1.2639486424166928 48.946451618291576 0.0 3 0.9521882000430649 5.621459492784629 2063.0 0.7556776556776557 1.0 - - - - - - - 740.3 6 10 RBM3 RNA binding motif (RNP1, RRM) protein 3 1553 197 B20140408_SF107_03 B20140408_SF107_03 TB377371.[MT7]-GGGDQGYGSGR.2b6_1.heavy 577.769 / 616.281 1578.0 17.922399520874023 45 15 10 10 10 1.2639486424166928 48.946451618291576 0.0 3 0.9521882000430649 5.621459492784629 1578.0 49.866756198347105 0.0 - - - - - - - 107.61904761904762 3 21 RBM3 RNA binding motif (RNP1, RRM) protein 3 1555 197 B20140408_SF107_03 B20140408_SF107_03 TB377371.[MT7]-GGGDQGYGSGR.2y7_1.heavy 577.769 / 724.337 8496.0 17.922399520874023 45 15 10 10 10 1.2639486424166928 48.946451618291576 0.0 3 0.9521882000430649 5.621459492784629 8496.0 61.83070278759324 0.0 - - - - - - - 134.72222222222223 16 18 RBM3 RNA binding motif (RNP1, RRM) protein 3 1557 198 B20140408_SF107_03 B20140408_SF107_03 TB377865.[MT7]-HSPELAQTVVDAGAVAHLAQMILNPDAK[MT7].4y4_1.heavy 796.931 / 574.332 52179.0 41.51530075073242 37 7 10 10 10 0.503785402667625 90.68917880893102 0.0 3 0.7129325697484383 2.2458798697171805 52179.0 74.65080704328687 0.0 - - - - - - - 324.3333333333333 104 3 SPAG6 sperm associated antigen 6 1559 198 B20140408_SF107_03 B20140408_SF107_03 TB377865.[MT7]-HSPELAQTVVDAGAVAHLAQMILNPDAK[MT7].4b4_1.heavy 796.931 / 595.296 9151.0 41.51530075073242 37 7 10 10 10 0.503785402667625 90.68917880893102 0.0 3 0.7129325697484383 2.2458798697171805 9151.0 18.328612035539063 0.0 - - - - - - - 713.6666666666666 18 9 SPAG6 sperm associated antigen 6 1561 198 B20140408_SF107_03 B20140408_SF107_03 TB377865.[MT7]-HSPELAQTVVDAGAVAHLAQMILNPDAK[MT7].4b5_1.heavy 796.931 / 708.38 11585.0 41.51530075073242 37 7 10 10 10 0.503785402667625 90.68917880893102 0.0 3 0.7129325697484383 2.2458798697171805 11585.0 28.220793057184203 0.0 - - - - - - - 806.4285714285714 23 7 SPAG6 sperm associated antigen 6 1563 198 B20140408_SF107_03 B20140408_SF107_03 TB377865.[MT7]-HSPELAQTVVDAGAVAHLAQMILNPDAK[MT7].4y6_1.heavy 796.931 / 801.459 16744.0 41.51530075073242 37 7 10 10 10 0.503785402667625 90.68917880893102 0.0 3 0.7129325697484383 2.2458798697171805 16744.0 23.415735256383726 0.0 - - - - - - - 316.25 33 4 SPAG6 sperm associated antigen 6 1565 199 B20140408_SF107_03 B20140408_SF107_03 TB498118.[MT7]-GLGPNLVGVAPSR.2y6_1.heavy 690.908 / 586.331 35483.0 29.77630043029785 43 13 10 10 10 1.8698047627897645 35.98601908685484 0.0 3 0.9182570019980565 4.286801261801405 35483.0 40.047633099488266 0.0 - - - - - - - 363.0 70 3 SLC25A36;SLC25A33 solute carrier family 25, member 36;solute carrier family 25, member 33 1567 199 B20140408_SF107_03 B20140408_SF107_03 TB498118.[MT7]-GLGPNLVGVAPSR.2y10_1.heavy 690.908 / 1009.58 21632.0 29.77630043029785 43 13 10 10 10 1.8698047627897645 35.98601908685484 0.0 3 0.9182570019980565 4.286801261801405 21632.0 64.02744774665177 0.0 - - - - - - - 233.6 43 10 SLC25A36;SLC25A33 solute carrier family 25, member 36;solute carrier family 25, member 33 1569 199 B20140408_SF107_03 B20140408_SF107_03 TB498118.[MT7]-GLGPNLVGVAPSR.2b5_1.heavy 690.908 / 583.332 10427.0 29.77630043029785 43 13 10 10 10 1.8698047627897645 35.98601908685484 0.0 3 0.9182570019980565 4.286801261801405 10427.0 11.50145229078018 0.0 - - - - - - - 657.4444444444445 20 9 SLC25A36;SLC25A33 solute carrier family 25, member 36;solute carrier family 25, member 33 1571 199 B20140408_SF107_03 B20140408_SF107_03 TB498118.[MT7]-GLGPNLVGVAPSR.2y11_1.heavy 690.908 / 1066.6 27702.0 29.77630043029785 43 13 10 10 10 1.8698047627897645 35.98601908685484 0.0 3 0.9182570019980565 4.286801261801405 27702.0 28.300888394081348 1.0 - - - - - - - 311.1818181818182 60 11 SLC25A36;SLC25A33 solute carrier family 25, member 36;solute carrier family 25, member 33 1573 200 B20140408_SF107_03 B20140408_SF107_03 TB498116.[MT7]-C[CAM]DILPQLVYSLAEQNR.3b6_1.heavy 688.362 / 871.446 33106.0 39.42539978027344 48 18 10 10 10 2.5569037763354054 30.621998462841596 0.0 3 0.9831558740963684 9.495692223454046 33106.0 54.380601925680764 0.0 - - - - - - - 744.4444444444445 66 9 SPAG6 sperm associated antigen 6 1575 200 B20140408_SF107_03 B20140408_SF107_03 TB498116.[MT7]-C[CAM]DILPQLVYSLAEQNR.3b4_1.heavy 688.362 / 646.335 97479.0 39.42539978027344 48 18 10 10 10 2.5569037763354054 30.621998462841596 0.0 3 0.9831558740963684 9.495692223454046 97479.0 91.29781376549639 0.0 - - - - - - - 755.25 194 4 SPAG6 sperm associated antigen 6 1577 200 B20140408_SF107_03 B20140408_SF107_03 TB498116.[MT7]-C[CAM]DILPQLVYSLAEQNR.3b3_1.heavy 688.362 / 533.251 39806.0 39.42539978027344 48 18 10 10 10 2.5569037763354054 30.621998462841596 0.0 3 0.9831558740963684 9.495692223454046 39806.0 75.7728426395939 0.0 - - - - - - - 769.4285714285714 79 7 SPAG6 sperm associated antigen 6 1579 200 B20140408_SF107_03 B20140408_SF107_03 TB498116.[MT7]-C[CAM]DILPQLVYSLAEQNR.3y5_1.heavy 688.362 / 617.3 43353.0 39.42539978027344 48 18 10 10 10 2.5569037763354054 30.621998462841596 0.0 3 0.9831558740963684 9.495692223454046 43353.0 50.96176469459293 0.0 - - - - - - - 350.3333333333333 86 3 SPAG6 sperm associated antigen 6 1581 201 B20140408_SF107_03 B20140408_SF107_03 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 608996.0 34.81890106201172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 608996.0 179.51388170285364 0.0 - - - - - - - 261.5 1217 2 1583 201 B20140408_SF107_03 B20140408_SF107_03 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 1215670.0 34.81890106201172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1215670.0 180.44138052263511 0.0 - - - - - - - 872.0 2431 1 1585 201 B20140408_SF107_03 B20140408_SF107_03 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 1508020.0 34.81890106201172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1508020.0 373.1267089853304 0.0 - - - - - - - 697.4 3016 5 1587 202 B20140408_SF107_03 B20140408_SF107_03 TB239771.[MT7]-LQALTGNEGR.2y8_1.heavy 601.834 / 817.416 N/A 26.688499450683594 40 20 0 10 10 11.58745600542358 8.630021978352659 0.0 3 0.9977628577620221 26.087626794820885 54865.0 5.669161144081057 1.0 - - - - - - - 13214.0 2598 1 CIAPIN1 cytokine induced apoptosis inhibitor 1 1589 202 B20140408_SF107_03 B20140408_SF107_03 TB239771.[MT7]-LQALTGNEGR.2y9_1.heavy 601.834 / 945.475 52567.0 26.688499450683594 40 20 0 10 10 11.58745600542358 8.630021978352659 0.0 3 0.9977628577620221 26.087626794820885 52567.0 28.161706065213934 2.0 - - - - - - - 239.5 107 6 CIAPIN1 cytokine induced apoptosis inhibitor 1 1591 202 B20140408_SF107_03 B20140408_SF107_03 TB239771.[MT7]-LQALTGNEGR.2y6_1.heavy 601.834 / 633.295 36624.0 26.688499450683594 40 20 0 10 10 11.58745600542358 8.630021978352659 0.0 3 0.9977628577620221 26.087626794820885 36624.0 27.423805112656176 0.0 - - - - - - - 718.375 73 8 CIAPIN1 cytokine induced apoptosis inhibitor 1 1593 202 B20140408_SF107_03 B20140408_SF107_03 TB239771.[MT7]-LQALTGNEGR.2y7_1.heavy 601.834 / 746.379 30592.0 26.688499450683594 40 20 0 10 10 11.58745600542358 8.630021978352659 0.0 3 0.9977628577620221 26.087626794820885 30592.0 46.09565561902916 1.0 - - - - - - - 335.0 61 3 CIAPIN1 cytokine induced apoptosis inhibitor 1 1595 203 B20140408_SF107_03 B20140408_SF107_03 TB497987.[MT7]-TRFQIQR.2y5_1.heavy 546.823 / 691.389 6092.0 23.260499954223633 37 11 10 10 6 1.5487487550067198 51.88539859605821 0.0 6 0.8609541344361832 3.2705264089428097 6092.0 8.46111111111111 1.0 - - - - - - - 784.0 12 15 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 1597 203 B20140408_SF107_03 B20140408_SF107_03 TB497987.[MT7]-TRFQIQR.2b4_1.heavy 546.823 / 677.385 2311.0 23.260499954223633 37 11 10 10 6 1.5487487550067198 51.88539859605821 0.0 6 0.8609541344361832 3.2705264089428097 2311.0 2.8245555555555555 5.0 - - - - - - - 743.75 10 12 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 1599 203 B20140408_SF107_03 B20140408_SF107_03 TB497987.[MT7]-TRFQIQR.2b6_1.heavy 546.823 / 918.528 10188.0 23.260499954223633 37 11 10 10 6 1.5487487550067198 51.88539859605821 0.0 6 0.8609541344361832 3.2705264089428097 10188.0 15.22809523809524 0.0 - - - - - - - 658.6363636363636 20 11 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 1601 203 B20140408_SF107_03 B20140408_SF107_03 TB497987.[MT7]-TRFQIQR.2b5_1.heavy 546.823 / 790.469 2521.0 23.260499954223633 37 11 10 10 6 1.5487487550067198 51.88539859605821 0.0 6 0.8609541344361832 3.2705264089428097 2521.0 3.2393801965230535 5.0 - - - - - - - 724.5 6 10 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 1603 204 B20140408_SF107_03 B20140408_SF107_03 TB498267.[MT7]-K[MT7]SSPSVK[MT7]PAVDPAAAK[MT7].4y5_1.heavy 533.075 / 601.379 66441.0 22.202499389648438 46 16 10 10 10 2.4858360951374077 40.227913737197696 0.0 3 0.964314553379 6.513535262039491 66441.0 103.47676935222398 0.0 - - - - - - - 719.125 132 8 CIAPIN1 cytokine induced apoptosis inhibitor 1 1605 204 B20140408_SF107_03 B20140408_SF107_03 TB498267.[MT7]-K[MT7]SSPSVK[MT7]PAVDPAAAK[MT7].4b11_2.heavy 533.075 / 764.957 77855.0 22.202499389648438 46 16 10 10 10 2.4858360951374077 40.227913737197696 0.0 3 0.964314553379 6.513535262039491 77855.0 131.4677245508982 0.0 - - - - - - - 278.375 155 8 CIAPIN1 cytokine induced apoptosis inhibitor 1 1607 204 B20140408_SF107_03 B20140408_SF107_03 TB498267.[MT7]-K[MT7]SSPSVK[MT7]PAVDPAAAK[MT7].4b7_2.heavy 533.075 / 573.864 33221.0 22.202499389648438 46 16 10 10 10 2.4858360951374077 40.227913737197696 0.0 3 0.964314553379 6.513535262039491 33221.0 55.30202395209581 0.0 - - - - - - - 770.2 66 10 CIAPIN1 cytokine induced apoptosis inhibitor 1 1609 204 B20140408_SF107_03 B20140408_SF107_03 TB498267.[MT7]-K[MT7]SSPSVK[MT7]PAVDPAAAK[MT7].4b9_2.heavy 533.075 / 657.909 15311.0 22.202499389648438 46 16 10 10 10 2.4858360951374077 40.227913737197696 0.0 3 0.964314553379 6.513535262039491 15311.0 37.70272040534316 0.0 - - - - - - - 286.1666666666667 30 12 CIAPIN1 cytokine induced apoptosis inhibitor 1 1611 205 B20140408_SF107_03 B20140408_SF107_03 TB377877.[MT7]-HSPQLAQAIVDC[CAM]GALDTLVIC[CAM]LEDFDPGVK[MT7].3b9_1.heavy 1190.61 / 1090.61 1259.0 43.41580009460449 43 17 10 6 10 3.3008175741757184 25.445447271797107 0.034198760986328125 3 0.9732777682134157 7.532759874574965 1259.0 8.393333333333334 1.0 - - - - - - - 120.0 2 18 SPAG6 sperm associated antigen 6 1613 205 B20140408_SF107_03 B20140408_SF107_03 TB377877.[MT7]-HSPQLAQAIVDC[CAM]GALDTLVIC[CAM]LEDFDPGVK[MT7].3b8_1.heavy 1190.61 / 977.529 1379.0 43.41580009460449 43 17 10 6 10 3.3008175741757184 25.445447271797107 0.034198760986328125 3 0.9732777682134157 7.532759874574965 1379.0 2.2983333333333333 0.0 - - - - - - - 164.21052631578948 2 19 SPAG6 sperm associated antigen 6 1615 205 B20140408_SF107_03 B20140408_SF107_03 TB377877.[MT7]-HSPQLAQAIVDC[CAM]GALDTLVIC[CAM]LEDFDPGVK[MT7].3b7_1.heavy 1190.61 / 906.491 1798.0 43.41580009460449 43 17 10 6 10 3.3008175741757184 25.445447271797107 0.034198760986328125 3 0.9732777682134157 7.532759874574965 1798.0 15.497047619047619 0.0 - - - - - - - 150.0 3 20 SPAG6 sperm associated antigen 6 1617 205 B20140408_SF107_03 B20140408_SF107_03 TB377877.[MT7]-HSPQLAQAIVDC[CAM]GALDTLVIC[CAM]LEDFDPGVK[MT7].3y4_1.heavy 1190.61 / 544.357 21041.0 43.41580009460449 43 17 10 6 10 3.3008175741757184 25.445447271797107 0.034198760986328125 3 0.9732777682134157 7.532759874574965 21041.0 72.39482311789492 0.0 - - - - - - - 264.0 42 15 SPAG6 sperm associated antigen 6 1619 206 B20140408_SF107_03 B20140408_SF107_03 TB498268.[MT7]-VLGGEVDALLEEYAQEK[MT7].3b5_1.heavy 717.719 / 600.347 40983.0 39.03860092163086 43 13 10 10 10 1.0782333980082197 61.66108736985611 0.0 3 0.922456415946642 4.402934930895628 40983.0 29.281313967382832 0.0 - - - - - - - 1650.2857142857142 81 7 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 1621 206 B20140408_SF107_03 B20140408_SF107_03 TB498268.[MT7]-VLGGEVDALLEEYAQEK[MT7].3y4_1.heavy 717.719 / 619.353 64087.0 39.03860092163086 43 13 10 10 10 1.0782333980082197 61.66108736985611 0.0 3 0.922456415946642 4.402934930895628 64087.0 26.371923165045217 0.0 - - - - - - - 1650.25 128 4 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 1623 206 B20140408_SF107_03 B20140408_SF107_03 TB498268.[MT7]-VLGGEVDALLEEYAQEK[MT7].3b8_1.heavy 717.719 / 885.48 84579.0 39.03860092163086 43 13 10 10 10 1.0782333980082197 61.66108736985611 0.0 3 0.922456415946642 4.402934930895628 84579.0 66.8239486874522 0.0 - - - - - - - 275.0 169 1 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 1625 206 B20140408_SF107_03 B20140408_SF107_03 TB498268.[MT7]-VLGGEVDALLEEYAQEK[MT7].3b7_1.heavy 717.719 / 814.443 49785.0 39.03860092163086 43 13 10 10 10 1.0782333980082197 61.66108736985611 0.0 3 0.922456415946642 4.402934930895628 49785.0 39.93703497939233 0.0 - - - - - - - 413.0 99 1 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 1627 207 B20140408_SF107_03 B20140408_SF107_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 641648.0 31.221399307250977 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 641648.0 543.7552173745939 0.0 - - - - - - - 1265.0 1283 1 1629 207 B20140408_SF107_03 B20140408_SF107_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 107877.0 31.221399307250977 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 107877.0 117.90524228719107 1.0 - - - - - - - 316.0 522 1 1631 207 B20140408_SF107_03 B20140408_SF107_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 75134.0 31.221399307250977 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 75134.0 47.184246056636695 0.0 - - - - - - - 909.5 150 4 1633 208 B20140408_SF107_03 B20140408_SF107_03 TB498266.[MT7]-ESSFDIILSGLVPGSTTLHSAEILAEIAR.3b6_1.heavy 1057.57 / 823.395 26745.0 43.25007438659668 42 16 10 6 10 2.711976193507122 36.873480025162095 0.03530120849609375 3 0.9656784258460466 6.6424568313320655 26745.0 83.51323958572556 0.0 - - - - - - - 260.38461538461536 53 13 CIAPIN1 cytokine induced apoptosis inhibitor 1 1635 208 B20140408_SF107_03 B20140408_SF107_03 TB498266.[MT7]-ESSFDIILSGLVPGSTTLHSAEILAEIAR.3b5_1.heavy 1057.57 / 710.311 30129.0 43.25007438659668 42 16 10 6 10 2.711976193507122 36.873480025162095 0.03530120849609375 3 0.9656784258460466 6.6424568313320655 30129.0 83.59004012459744 0.0 - - - - - - - 684.75 60 8 CIAPIN1 cytokine induced apoptosis inhibitor 1 1637 208 B20140408_SF107_03 B20140408_SF107_03 TB498266.[MT7]-ESSFDIILSGLVPGSTTLHSAEILAEIAR.3b7_1.heavy 1057.57 / 936.479 19656.0 43.25007438659668 42 16 10 6 10 2.711976193507122 36.873480025162095 0.03530120849609375 3 0.9656784258460466 6.6424568313320655 19656.0 120.41179418821648 0.0 - - - - - - - 245.94736842105263 39 19 CIAPIN1 cytokine induced apoptosis inhibitor 1 1639 208 B20140408_SF107_03 B20140408_SF107_03 TB498266.[MT7]-ESSFDIILSGLVPGSTTLHSAEILAEIAR.3y10_1.heavy 1057.57 / 1072.6 9425.0 43.25007438659668 42 16 10 6 10 2.711976193507122 36.873480025162095 0.03530120849609375 3 0.9656784258460466 6.6424568313320655 9425.0 70.63871635610766 0.0 - - - - - - - 246.6875 18 16 CIAPIN1 cytokine induced apoptosis inhibitor 1 1641 209 B20140408_SF107_03 B20140408_SF107_03 TB377874.[MT7]-HNAELSQAVVDAGAVPLLVLC[CAM]IQEPEIALK[MT7].4b8_1.heavy 872.237 / 995.503 16579.0 40.933799743652344 42 12 10 10 10 0.9196906457575518 58.36429200248994 0.0 3 0.8914787328906626 3.7119050847197363 16579.0 52.70873004774157 0.0 - - - - - - - 276.53846153846155 33 13 SPAG6 sperm associated antigen 6 1643 209 B20140408_SF107_03 B20140408_SF107_03 TB377874.[MT7]-HNAELSQAVVDAGAVPLLVLC[CAM]IQEPEIALK[MT7].4b4_1.heavy 872.237 / 596.291 18776.0 40.933799743652344 42 12 10 10 10 0.9196906457575518 58.36429200248994 0.0 3 0.8914787328906626 3.7119050847197363 18776.0 91.42564140233722 0.0 - - - - - - - 299.6 37 10 SPAG6 sperm associated antigen 6 1645 209 B20140408_SF107_03 B20140408_SF107_03 TB377874.[MT7]-HNAELSQAVVDAGAVPLLVLC[CAM]IQEPEIALK[MT7].4b5_1.heavy 872.237 / 709.375 19175.0 40.933799743652344 42 12 10 10 10 0.9196906457575518 58.36429200248994 0.0 3 0.8914787328906626 3.7119050847197363 19175.0 47.10940991074547 0.0 - - - - - - - 756.1428571428571 38 7 SPAG6 sperm associated antigen 6 1647 209 B20140408_SF107_03 B20140408_SF107_03 TB377874.[MT7]-HNAELSQAVVDAGAVPLLVLC[CAM]IQEPEIALK[MT7].4y6_1.heavy 872.237 / 814.516 59124.0 40.933799743652344 42 12 10 10 10 0.9196906457575518 58.36429200248994 0.0 3 0.8914787328906626 3.7119050847197363 59124.0 101.03626564795178 0.0 - - - - - - - 333.0 118 3 SPAG6 sperm associated antigen 6 1649 210 B20140408_SF107_03 B20140408_SF107_03 TB498263.[MT7]-FLNDTTK[MT7]PVGLLLSER.3y7_1.heavy 697.74 / 787.467 23192.0 34.53889846801758 41 11 10 10 10 1.5065198472071444 60.6917309280622 0.0 3 0.8707506686243509 3.395123395732034 23192.0 33.238763761467894 0.0 - - - - - - - 349.0 46 1 BCCIP BRCA2 and CDKN1A interacting protein 1651 210 B20140408_SF107_03 B20140408_SF107_03 TB498263.[MT7]-FLNDTTK[MT7]PVGLLLSER.3b4_1.heavy 697.74 / 634.332 35224.0 34.53889846801758 41 11 10 10 10 1.5065198472071444 60.6917309280622 0.0 3 0.8707506686243509 3.395123395732034 35224.0 43.10072043744979 0.0 - - - - - - - 349.0 70 1 BCCIP BRCA2 and CDKN1A interacting protein 1653 210 B20140408_SF107_03 B20140408_SF107_03 TB498263.[MT7]-FLNDTTK[MT7]PVGLLLSER.3y12_2.heavy 697.74 / 729.444 38537.0 34.53889846801758 41 11 10 10 10 1.5065198472071444 60.6917309280622 0.0 3 0.8707506686243509 3.395123395732034 38537.0 18.02838910536817 0.0 - - - - - - - 349.0 77 1 BCCIP BRCA2 and CDKN1A interacting protein 1655 210 B20140408_SF107_03 B20140408_SF107_03 TB498263.[MT7]-FLNDTTK[MT7]PVGLLLSER.3y9_1.heavy 697.74 / 983.588 50918.0 34.53889846801758 41 11 10 10 10 1.5065198472071444 60.6917309280622 0.0 3 0.8707506686243509 3.395123395732034 50918.0 101.73596288175136 0.0 - - - - - - - 232.33333333333334 101 3 BCCIP BRCA2 and CDKN1A interacting protein 1657 211 B20140408_SF107_03 B20140408_SF107_03 TB239779.[MT7]-QLLQSAHK[MT7].3b4_1.heavy 404.915 / 627.395 57878.0 22.56719970703125 50 20 10 10 10 8.612723742585843 7.740485897281431 0.0 2 0.9908882756678851 12.91908534326901 57878.0 118.40264741275573 0.0 - - - - - - - 352.54545454545456 115 11 CIAPIN1 cytokine induced apoptosis inhibitor 1 1659 211 B20140408_SF107_03 B20140408_SF107_03 TB239779.[MT7]-QLLQSAHK[MT7].3y6_1.heavy 404.915 / 827.486 N/A 22.56719970703125 50 20 10 10 10 8.612723742585843 7.740485897281431 0.0 2 0.9908882756678851 12.91908534326901 185.0 2.8304347826086955 9.0 - - - - - - - 0.0 0 0 CIAPIN1 cytokine induced apoptosis inhibitor 1 1661 211 B20140408_SF107_03 B20140408_SF107_03 TB239779.[MT7]-QLLQSAHK[MT7].3y4_1.heavy 404.915 / 586.343 72370.0 22.56719970703125 50 20 10 10 10 8.612723742585843 7.740485897281431 0.0 2 0.9908882756678851 12.91908534326901 72370.0 93.16229793550814 0.0 - - - - - - - 674.5384615384615 144 13 CIAPIN1 cytokine induced apoptosis inhibitor 1 1663 212 B20140408_SF107_03 B20140408_SF107_03 TB239777.[MT7]-VYQTDGLK[MT7].2y4_1.heavy 606.347 / 576.347 12590.0 24.822399139404297 43 13 10 10 10 0.9073839571912993 64.8255021981872 0.0 3 0.9063162166064364 4.000182864291874 12590.0 7.064625895099297 3.0 - - - - - - - 726.0 25 1 SLC25A36 solute carrier family 25, member 36 1665 212 B20140408_SF107_03 B20140408_SF107_03 TB239777.[MT7]-VYQTDGLK[MT7].2y5_1.heavy 606.347 / 677.395 16464.0 24.822399139404297 43 13 10 10 10 0.9073839571912993 64.8255021981872 0.0 3 0.9063162166064364 4.000182864291874 16464.0 35.41487603305785 0.0 - - - - - - - 387.2 32 10 SLC25A36 solute carrier family 25, member 36 1667 212 B20140408_SF107_03 B20140408_SF107_03 TB239777.[MT7]-VYQTDGLK[MT7].2b5_1.heavy 606.347 / 751.374 21548.0 24.822399139404297 43 13 10 10 10 0.9073839571912993 64.8255021981872 0.0 3 0.9063162166064364 4.000182864291874 21548.0 35.298524203069654 0.0 - - - - - - - 738.1 43 10 SLC25A36 solute carrier family 25, member 36 1669 212 B20140408_SF107_03 B20140408_SF107_03 TB239777.[MT7]-VYQTDGLK[MT7].2y7_1.heavy 606.347 / 968.517 19490.0 24.822399139404297 43 13 10 10 10 0.9073839571912993 64.8255021981872 0.0 3 0.9063162166064364 4.000182864291874 19490.0 53.691460055096414 0.0 - - - - - - - 314.6 38 10 SLC25A36 solute carrier family 25, member 36 1671 213 B20140408_SF107_03 B20140408_SF107_03 TB498262.[MT7]-DIQAVATSLLPLTEANLR.3b4_1.heavy 690.396 / 572.316 34915.0 39.91709899902344 43 13 10 10 10 2.39915905181986 41.6812715789501 0.0 3 0.9248667791673741 4.47392762702076 34915.0 39.209358288770055 0.0 - - - - - - - 803.5555555555555 69 9 C19orf66 chromosome 19 open reading frame 66 1673 213 B20140408_SF107_03 B20140408_SF107_03 TB498262.[MT7]-DIQAVATSLLPLTEANLR.3b5_1.heavy 690.396 / 671.385 31424.0 39.91709899902344 43 13 10 10 10 2.39915905181986 41.6812715789501 0.0 3 0.9248667791673741 4.47392762702076 31424.0 88.7057091723554 0.0 - - - - - - - 374.0 62 7 C19orf66 chromosome 19 open reading frame 66 1675 213 B20140408_SF107_03 B20140408_SF107_03 TB498262.[MT7]-DIQAVATSLLPLTEANLR.3b3_1.heavy 690.396 / 501.279 14465.0 39.91709899902344 43 13 10 10 10 2.39915905181986 41.6812715789501 0.0 3 0.9248667791673741 4.47392762702076 14465.0 23.362714776632302 0.0 - - - - - - - 794.875 28 8 C19orf66 chromosome 19 open reading frame 66 1677 213 B20140408_SF107_03 B20140408_SF107_03 TB498262.[MT7]-DIQAVATSLLPLTEANLR.3y8_1.heavy 690.396 / 913.51 92525.0 39.91709899902344 43 13 10 10 10 2.39915905181986 41.6812715789501 0.0 3 0.9248667791673741 4.47392762702076 92525.0 102.12807536178555 0.0 - - - - - - - 457.3333333333333 185 3 C19orf66 chromosome 19 open reading frame 66 1679 214 B20140408_SF107_03 B20140408_SF107_03 TB498112.[MT7]-LK[MT7]IPVSGSK[MT7].3y6_1.heavy 454.301 / 718.422 113751.0 26.052600860595703 50 20 10 10 10 6.331433396202294 15.794211790963761 0.0 3 0.9933337349731344 15.10704512135468 113751.0 189.3720157964494 0.0 - - - - - - - 774.1 227 10 C7orf44 chromosome 7 open reading frame 44 1681 214 B20140408_SF107_03 B20140408_SF107_03 TB498112.[MT7]-LK[MT7]IPVSGSK[MT7].3b3_1.heavy 454.301 / 643.474 49132.0 26.052600860595703 50 20 10 10 10 6.331433396202294 15.794211790963761 0.0 3 0.9933337349731344 15.10704512135468 49132.0 38.41686784911298 0.0 - - - - - - - 764.1428571428571 98 7 C7orf44 chromosome 7 open reading frame 44 1683 214 B20140408_SF107_03 B20140408_SF107_03 TB498112.[MT7]-LK[MT7]IPVSGSK[MT7].3y4_1.heavy 454.301 / 522.3 297188.0 26.052600860595703 50 20 10 10 10 6.331433396202294 15.794211790963761 0.0 3 0.9933337349731344 15.10704512135468 297188.0 151.29040055565972 0.0 - - - - - - - 704.0 594 2 C7orf44 chromosome 7 open reading frame 44 1685 214 B20140408_SF107_03 B20140408_SF107_03 TB498112.[MT7]-LK[MT7]IPVSGSK[MT7].3y5_1.heavy 454.301 / 621.369 49414.0 26.052600860595703 50 20 10 10 10 6.331433396202294 15.794211790963761 0.0 3 0.9933337349731344 15.10704512135468 49414.0 56.642781371172305 0.0 - - - - - - - 703.7777777777778 98 9 C7orf44 chromosome 7 open reading frame 44 1687 215 B20140408_SF107_03 B20140408_SF107_03 TB377878.[MT7]-EIYPYVIQELRPTLNELGISTPEELGLDK[MT7].4y4_1.heavy 905.244 / 576.347 49774.0 41.42169952392578 48 18 10 10 10 17.316620513219362 5.774798836970576 0.0 3 0.9894682933421797 12.015202633002335 49774.0 53.71767827130852 0.0 - - - - - - - 196.0 99 1 COX5A cytochrome c oxidase subunit Va 1689 215 B20140408_SF107_03 B20140408_SF107_03 TB377878.[MT7]-EIYPYVIQELRPTLNELGISTPEELGLDK[MT7].4y8_1.heavy 905.244 / 1044.57 48010.0 41.42169952392578 48 18 10 10 10 17.316620513219362 5.774798836970576 0.0 3 0.9894682933421797 12.015202633002335 48010.0 60.61515225137674 0.0 - - - - - - - 367.5 96 4 COX5A cytochrome c oxidase subunit Va 1691 215 B20140408_SF107_03 B20140408_SF107_03 TB377878.[MT7]-EIYPYVIQELRPTLNELGISTPEELGLDK[MT7].4b6_1.heavy 905.244 / 909.484 15873.0 41.42169952392578 48 18 10 10 10 17.316620513219362 5.774798836970576 0.0 3 0.9894682933421797 12.015202633002335 15873.0 22.015384086157596 1.0 - - - - - - - 310.3333333333333 32 6 COX5A cytochrome c oxidase subunit Va 1693 215 B20140408_SF107_03 B20140408_SF107_03 TB377878.[MT7]-EIYPYVIQELRPTLNELGISTPEELGLDK[MT7].4b3_1.heavy 905.244 / 550.299 58494.0 41.42169952392578 48 18 10 10 10 17.316620513219362 5.774798836970576 0.0 3 0.9894682933421797 12.015202633002335 58494.0 117.39163011424665 0.0 - - - - - - - 196.0 116 1 COX5A cytochrome c oxidase subunit Va 1695 216 B20140408_SF107_03 B20140408_SF107_03 TB498127.[MT7]-IEEAC[CAM]EIYAR.2b3_1.heavy 699.346 / 516.279 29716.0 27.694799423217773 45 20 10 5 10 5.783919883479445 17.28931278692657 0.044399261474609375 3 0.992250460612139 14.010175006952565 29716.0 72.34251951155755 0.0 - - - - - - - 243.83333333333334 59 6 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1697 216 B20140408_SF107_03 B20140408_SF107_03 TB498127.[MT7]-IEEAC[CAM]EIYAR.2y8_1.heavy 699.346 / 1011.46 24299.0 27.694799423217773 45 20 10 5 10 5.783919883479445 17.28931278692657 0.044399261474609375 3 0.992250460612139 14.010175006952565 24299.0 195.63887210869078 0.0 - - - - - - - 317.1666666666667 48 6 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1699 216 B20140408_SF107_03 B20140408_SF107_03 TB498127.[MT7]-IEEAC[CAM]EIYAR.2y9_1.heavy 699.346 / 1140.5 58114.0 27.694799423217773 45 20 10 5 10 5.783919883479445 17.28931278692657 0.044399261474609375 3 0.992250460612139 14.010175006952565 58114.0 257.8436860068259 0.0 - - - - - - - 231.58333333333334 116 12 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1701 216 B20140408_SF107_03 B20140408_SF107_03 TB498127.[MT7]-IEEAC[CAM]EIYAR.2y7_1.heavy 699.346 / 882.414 29130.0 27.694799423217773 45 20 10 5 10 5.783919883479445 17.28931278692657 0.044399261474609375 3 0.992250460612139 14.010175006952565 29130.0 45.010888645375815 0.0 - - - - - - - 292.7 58 10 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1703 217 B20140408_SF107_03 B20140408_SF107_03 TB498126.[MT7]-FLSLDYIPQR.2y8_1.heavy 698.391 / 991.521 46384.0 35.17340087890625 48 18 10 10 10 5.183800621639691 19.290865389874686 0.0 3 0.9849779710378295 10.056639989758125 46384.0 47.224648187633264 0.0 - - - - - - - 239.0 92 5 CASP8 caspase 8, apoptosis-related cysteine peptidase 1705 217 B20140408_SF107_03 B20140408_SF107_03 TB498126.[MT7]-FLSLDYIPQR.2y5_1.heavy 698.391 / 676.378 71110.0 35.17340087890625 48 18 10 10 10 5.183800621639691 19.290865389874686 0.0 3 0.9849779710378295 10.056639989758125 71110.0 56.02981798332707 0.0 - - - - - - - 341.0 142 1 CASP8 caspase 8, apoptosis-related cysteine peptidase 1707 217 B20140408_SF107_03 B20140408_SF107_03 TB498126.[MT7]-FLSLDYIPQR.2y9_1.heavy 698.391 / 1104.6 35811.0 35.17340087890625 48 18 10 10 10 5.183800621639691 19.290865389874686 0.0 3 0.9849779710378295 10.056639989758125 35811.0 87.58417336789273 0.0 - - - - - - - 633.5714285714286 71 7 CASP8 caspase 8, apoptosis-related cysteine peptidase 1709 217 B20140408_SF107_03 B20140408_SF107_03 TB498126.[MT7]-FLSLDYIPQR.2b5_1.heavy 698.391 / 720.405 55081.0 35.17340087890625 48 18 10 10 10 5.183800621639691 19.290865389874686 0.0 3 0.9849779710378295 10.056639989758125 55081.0 53.713342138620646 0.0 - - - - - - - 1169.2857142857142 110 7 CASP8 caspase 8, apoptosis-related cysteine peptidase 1711 218 B20140408_SF107_03 B20140408_SF107_03 TB498129.[MT7]-GLPVPQAEGEK[MT7].2y5_1.heavy 706.903 / 677.359 5703.0 26.184499740600586 41 11 10 10 10 1.1243103255874498 59.126203826414155 0.0 3 0.8534328269301816 3.1833983612803327 5703.0 0.1276912766666881 2.0 - - - - - - - 855.375 15 8 MAGEF1 melanoma antigen family F, 1 1713 218 B20140408_SF107_03 B20140408_SF107_03 TB498129.[MT7]-GLPVPQAEGEK[MT7].2y9_1.heavy 706.903 / 1098.59 30085.0 26.184499740600586 41 11 10 10 10 1.1243103255874498 59.126203826414155 0.0 3 0.8534328269301816 3.1833983612803327 30085.0 173.9198114444991 0.0 - - - - - - - 285.2857142857143 60 7 MAGEF1 melanoma antigen family F, 1 1715 218 B20140408_SF107_03 B20140408_SF107_03 TB498129.[MT7]-GLPVPQAEGEK[MT7].2b4_1.heavy 706.903 / 511.336 70578.0 26.184499740600586 41 11 10 10 10 1.1243103255874498 59.126203826414155 0.0 3 0.8534328269301816 3.1833983612803327 70578.0 216.8640234422993 0.0 - - - - - - - 285.22222222222223 141 9 MAGEF1 melanoma antigen family F, 1 1717 218 B20140408_SF107_03 B20140408_SF107_03 TB498129.[MT7]-GLPVPQAEGEK[MT7].2y7_1.heavy 706.903 / 902.47 68154.0 26.184499740600586 41 11 10 10 10 1.1243103255874498 59.126203826414155 0.0 3 0.8534328269301816 3.1833983612803327 68154.0 265.1305241006945 0.0 - - - - - - - 253.66666666666666 136 9 MAGEF1 melanoma antigen family F, 1 1719 219 B20140408_SF107_03 B20140408_SF107_03 TB377881.[MT7]-K[MT7]K[MT7]PAFLVPIVPLSFILTYQYDLGYGTLLER.4b7_1.heavy 972.567 / 1216.81 2901.0 45.05057430267334 33 7 10 6 10 0.7427147685436608 71.03917949562464 0.038097381591796875 3 0.742173782972179 2.37625188421933 2901.0 19.2333413259801 0.0 - - - - - - - 139.24444444444444 5 45 C9orf46 chromosome 9 open reading frame 46 1721 219 B20140408_SF107_03 B20140408_SF107_03 TB377881.[MT7]-K[MT7]K[MT7]PAFLVPIVPLSFILTYQYDLGYGTLLER.4b7_2.heavy 972.567 / 608.911 13577.0 45.05057430267334 33 7 10 6 10 0.7427147685436608 71.03917949562464 0.038097381591796875 3 0.742173782972179 2.37625188421933 13577.0 56.391832585693514 1.0 - - - - - - - 792.25 27 8 C9orf46 chromosome 9 open reading frame 46 1723 219 B20140408_SF107_03 B20140408_SF107_03 TB377881.[MT7]-K[MT7]K[MT7]PAFLVPIVPLSFILTYQYDLGYGTLLER.4b10_2.heavy 972.567 / 763.513 19183.0 45.05057430267334 33 7 10 6 10 0.7427147685436608 71.03917949562464 0.038097381591796875 3 0.742173782972179 2.37625188421933 19183.0 50.292903364605834 0.0 - - - - - - - 625.6666666666666 38 9 C9orf46 chromosome 9 open reading frame 46 1725 219 B20140408_SF107_03 B20140408_SF107_03 TB377881.[MT7]-K[MT7]K[MT7]PAFLVPIVPLSFILTYQYDLGYGTLLER.4b6_2.heavy 972.567 / 559.377 4729.0 45.05057430267334 33 7 10 6 10 0.7427147685436608 71.03917949562464 0.038097381591796875 3 0.742173782972179 2.37625188421933 4729.0 -0.213210099188458 1.0 - - - - - - - 731.2857142857143 9 7 C9orf46 chromosome 9 open reading frame 46 1727 220 B20140408_SF107_03 B20140408_SF107_03 TB377299.[MT7]-NSPVNTK[MT7].2y4_1.heavy 524.305 / 605.374 6546.0 19.11009979248047 47 17 10 10 10 3.6406078232638293 27.46794075456041 0.0 3 0.9711866394167868 7.252989850131375 6546.0 20.032485875706215 0.0 - - - - - - - 635.8888888888889 13 9 ARPC5L actin related protein 2/3 complex, subunit 5-like 1729 220 B20140408_SF107_03 B20140408_SF107_03 TB377299.[MT7]-NSPVNTK[MT7].2y5_1.heavy 524.305 / 702.427 53725.0 19.11009979248047 47 17 10 10 10 3.6406078232638293 27.46794075456041 0.0 3 0.9711866394167868 7.252989850131375 53725.0 64.35074587635174 0.0 - - - - - - - 331.875 107 8 ARPC5L actin related protein 2/3 complex, subunit 5-like 1731 220 B20140408_SF107_03 B20140408_SF107_03 TB377299.[MT7]-NSPVNTK[MT7].2y3_1.heavy 524.305 / 506.306 N/A 19.11009979248047 47 17 10 10 10 3.6406078232638293 27.46794075456041 0.0 3 0.9711866394167868 7.252989850131375 19285.0 6.002559415517537 0.0 - - - - - - - 2477.0 38 2 ARPC5L actin related protein 2/3 complex, subunit 5-like 1733 220 B20140408_SF107_03 B20140408_SF107_03 TB377299.[MT7]-NSPVNTK[MT7].2y6_1.heavy 524.305 / 789.459 42167.0 19.11009979248047 47 17 10 10 10 3.6406078232638293 27.46794075456041 0.0 3 0.9711866394167868 7.252989850131375 42167.0 99.1982687221051 0.0 - - - - - - - 334.3333333333333 84 12 ARPC5L actin related protein 2/3 complex, subunit 5-like 1735 221 B20140408_SF107_03 B20140408_SF107_03 TB377741.[MT7]-K[MT7]GTQC[CAM]VEQIQELVLR.3y7_1.heavy 697.061 / 870.541 12692.0 32.35850143432617 45 15 10 10 10 3.522120216542062 28.3919894415693 0.0 3 0.9575298217032788 5.967207923523394 12692.0 23.13968242017951 0.0 - - - - - - - 309.125 25 8 BCCIP BRCA2 and CDKN1A interacting protein 1737 221 B20140408_SF107_03 B20140408_SF107_03 TB377741.[MT7]-K[MT7]GTQC[CAM]VEQIQELVLR.3y6_1.heavy 697.061 / 757.457 25713.0 32.35850143432617 45 15 10 10 10 3.522120216542062 28.3919894415693 0.0 3 0.9575298217032788 5.967207923523394 25713.0 37.44138367920917 0.0 - - - - - - - 750.6666666666666 51 9 BCCIP BRCA2 and CDKN1A interacting protein 1739 221 B20140408_SF107_03 B20140408_SF107_03 TB377741.[MT7]-K[MT7]GTQC[CAM]VEQIQELVLR.3b4_1.heavy 697.061 / 703.434 4945.0 32.35850143432617 45 15 10 10 10 3.522120216542062 28.3919894415693 0.0 3 0.9575298217032788 5.967207923523394 4945.0 4.523252455228192 1.0 - - - - - - - 384.5 9 6 BCCIP BRCA2 and CDKN1A interacting protein 1741 221 B20140408_SF107_03 B20140408_SF107_03 TB377741.[MT7]-K[MT7]GTQC[CAM]VEQIQELVLR.3y9_1.heavy 697.061 / 1127.64 7747.0 32.35850143432617 45 15 10 10 10 3.522120216542062 28.3919894415693 0.0 3 0.9575298217032788 5.967207923523394 7747.0 55.36609276257723 0.0 - - - - - - - 230.8 15 5 BCCIP BRCA2 and CDKN1A interacting protein 1743 222 B20140408_SF107_03 B20140408_SF107_03 TB377294.[MT7]-TFVEAGK[MT7].2y4_1.heavy 520.305 / 548.316 29432.0 24.122400283813477 47 17 10 10 10 2.6243355412925515 38.10488347490332 0.0 3 0.9732672275363684 7.531267971366463 29432.0 27.02424986357002 0.0 - - - - - - - 386.6666666666667 58 3 BCCIP BRCA2 and CDKN1A interacting protein 1745 222 B20140408_SF107_03 B20140408_SF107_03 TB377294.[MT7]-TFVEAGK[MT7].2y5_1.heavy 520.305 / 647.385 12051.0 24.122400283813477 47 17 10 10 10 2.6243355412925515 38.10488347490332 0.0 3 0.9732672275363684 7.531267971366463 12051.0 30.390854048204098 0.0 - - - - - - - 669.2222222222222 24 9 BCCIP BRCA2 and CDKN1A interacting protein 1747 222 B20140408_SF107_03 B20140408_SF107_03 TB377294.[MT7]-TFVEAGK[MT7].2b4_1.heavy 520.305 / 621.336 14484.0 24.122400283813477 47 17 10 10 10 2.6243355412925515 38.10488347490332 0.0 3 0.9732672275363684 7.531267971366463 14484.0 17.308950047901025 0.0 - - - - - - - 753.0 28 8 BCCIP BRCA2 and CDKN1A interacting protein 1749 222 B20140408_SF107_03 B20140408_SF107_03 TB377294.[MT7]-TFVEAGK[MT7].2y6_1.heavy 520.305 / 794.453 18308.0 24.122400283813477 47 17 10 10 10 2.6243355412925515 38.10488347490332 0.0 3 0.9732672275363684 7.531267971366463 18308.0 74.20009534456051 0.0 - - - - - - - 246.5 36 8 BCCIP BRCA2 and CDKN1A interacting protein 1751 223 B20140408_SF107_03 B20140408_SF107_03 TB240103.[MT7]-AFAAIPTNTLLLEQK[MT7].2y4_1.heavy 959.566 / 661.4 7543.0 35.119998931884766 50 20 10 10 10 4.0837245601935885 19.69770311053364 0.0 3 0.992206751548108 13.970780130932825 7543.0 10.288409919766593 0.0 - - - - - - - 214.0 15 4 C6orf142 chromosome 6 open reading frame 142 1753 223 B20140408_SF107_03 B20140408_SF107_03 TB240103.[MT7]-AFAAIPTNTLLLEQK[MT7].2y8_1.heavy 959.566 / 1102.66 4286.0 35.119998931884766 50 20 10 10 10 4.0837245601935885 19.69770311053364 0.0 3 0.992206751548108 13.970780130932825 4286.0 28.807169624742127 0.0 - - - - - - - 228.33333333333334 8 6 C6orf142 chromosome 6 open reading frame 142 1755 223 B20140408_SF107_03 B20140408_SF107_03 TB240103.[MT7]-AFAAIPTNTLLLEQK[MT7].2b4_1.heavy 959.566 / 505.289 129089.0 35.119998931884766 50 20 10 10 10 4.0837245601935885 19.69770311053364 0.0 3 0.992206751548108 13.970780130932825 129089.0 422.7976654416194 0.0 - - - - - - - 308.6 258 5 C6orf142 chromosome 6 open reading frame 142 1757 223 B20140408_SF107_03 B20140408_SF107_03 TB240103.[MT7]-AFAAIPTNTLLLEQK[MT7].2y3_1.heavy 959.566 / 548.316 9772.0 35.119998931884766 50 20 10 10 10 4.0837245601935885 19.69770311053364 0.0 3 0.992206751548108 13.970780130932825 9772.0 63.33084619883041 0.0 - - - - - - - 257.0 19 10 C6orf142 chromosome 6 open reading frame 142 1759 224 B20140408_SF107_03 B20140408_SF107_03 TB240105.[MT7]-MK[MT7]GEAEDILETEK[MT7].3y3_1.heavy 642.347 / 521.305 35260.0 28.50670051574707 45 15 10 10 10 6.43662641425239 15.536088870805614 0.0 3 0.9549726377431834 5.794032143843243 35260.0 24.028307203325724 0.0 - - - - - - - 896.0 70 1 C9orf46 chromosome 9 open reading frame 46 1761 224 B20140408_SF107_03 B20140408_SF107_03 TB240105.[MT7]-MK[MT7]GEAEDILETEK[MT7].3y4_1.heavy 642.347 / 650.348 43179.0 28.50670051574707 45 15 10 10 10 6.43662641425239 15.536088870805614 0.0 3 0.9549726377431834 5.794032143843243 43179.0 28.81535674983398 0.0 - - - - - - - 821.5 86 2 C9orf46 chromosome 9 open reading frame 46 1763 224 B20140408_SF107_03 B20140408_SF107_03 TB240105.[MT7]-MK[MT7]GEAEDILETEK[MT7].3b7_1.heavy 642.347 / 1049.52 15090.0 28.50670051574707 45 15 10 10 10 6.43662641425239 15.536088870805614 0.0 3 0.9549726377431834 5.794032143843243 15090.0 43.51096919808816 0.0 - - - - - - - 331.8888888888889 30 9 C9orf46 chromosome 9 open reading frame 46 1765 224 B20140408_SF107_03 B20140408_SF107_03 TB240105.[MT7]-MK[MT7]GEAEDILETEK[MT7].3b7_2.heavy 642.347 / 525.262 112354.0 28.50670051574707 45 15 10 10 10 6.43662641425239 15.536088870805614 0.0 3 0.9549726377431834 5.794032143843243 112354.0 46.27345619104603 0.0 - - - - - - - 2689.3333333333335 224 3 C9orf46 chromosome 9 open reading frame 46 1767 225 B20140408_SF107_03 B20140408_SF107_03 TB377495.[MT7]-AAAAWALGQIGR.2y8_1.heavy 664.881 / 900.505 132287.0 33.355201721191406 48 18 10 10 10 5.369599020488562 18.623364541455338 0.0 3 0.9819728764506892 9.177926212506623 132287.0 217.2333460893843 0.0 - - - - - - - 346.0 264 4 SPAG6 sperm associated antigen 6 1769 225 B20140408_SF107_03 B20140408_SF107_03 TB377495.[MT7]-AAAAWALGQIGR.2y9_1.heavy 664.881 / 971.542 88537.0 33.355201721191406 48 18 10 10 10 5.369599020488562 18.623364541455338 0.0 3 0.9819728764506892 9.177926212506623 88537.0 180.4858304431599 0.0 - - - - - - - 741.4285714285714 177 7 SPAG6 sperm associated antigen 6 1771 225 B20140408_SF107_03 B20140408_SF107_03 TB377495.[MT7]-AAAAWALGQIGR.2y11_1.heavy 664.881 / 1113.62 63982.0 33.355201721191406 48 18 10 10 10 5.369599020488562 18.623364541455338 0.0 3 0.9819728764506892 9.177926212506623 63982.0 177.03326995652796 0.0 - - - - - - - 281.125 127 8 SPAG6 sperm associated antigen 6 1773 225 B20140408_SF107_03 B20140408_SF107_03 TB377495.[MT7]-AAAAWALGQIGR.2y7_1.heavy 664.881 / 714.426 125370.0 33.355201721191406 48 18 10 10 10 5.369599020488562 18.623364541455338 0.0 3 0.9819728764506892 9.177926212506623 125370.0 90.37852737085582 0.0 - - - - - - - 173.0 250 1 SPAG6 sperm associated antigen 6 1775 226 B20140408_SF107_03 B20140408_SF107_03 TB239665.[MT7]-ALDEPAK[MT7].2y4_1.heavy 516.302 / 588.347 11480.0 22.077150344848633 43 17 10 6 10 6.09972266337243 16.394187985050415 0.03900146484375 3 0.9701525238306078 7.125615539656636 11480.0 19.307741788907 0.0 - - - - - - - 722.5 22 16 C6orf142 chromosome 6 open reading frame 142 1777 226 B20140408_SF107_03 B20140408_SF107_03 TB239665.[MT7]-ALDEPAK[MT7].2y5_1.heavy 516.302 / 703.374 4677.0 22.077150344848633 43 17 10 6 10 6.09972266337243 16.394187985050415 0.03900146484375 3 0.9701525238306078 7.125615539656636 4677.0 4.50192513368984 2.0 - - - - - - - 807.5 15 8 C6orf142 chromosome 6 open reading frame 142 1779 226 B20140408_SF107_03 B20140408_SF107_03 TB239665.[MT7]-ALDEPAK[MT7].2b4_1.heavy 516.302 / 573.3 14712.0 22.077150344848633 43 17 10 6 10 6.09972266337243 16.394187985050415 0.03900146484375 3 0.9701525238306078 7.125615539656636 14712.0 16.749574785064713 1.0 - - - - - - - 715.4166666666666 29 12 C6orf142 chromosome 6 open reading frame 142 1781 226 B20140408_SF107_03 B20140408_SF107_03 TB239665.[MT7]-ALDEPAK[MT7].2y6_1.heavy 516.302 / 816.458 7994.0 22.077150344848633 43 17 10 6 10 6.09972266337243 16.394187985050415 0.03900146484375 3 0.9701525238306078 7.125615539656636 7994.0 16.850098039215684 0.0 - - - - - - - 294.6666666666667 15 15 C6orf142 chromosome 6 open reading frame 142 1783 227 B20140408_SF107_03 B20140408_SF107_03 TB240102.[MT7]-EASDFVGMMLAAATSK[MT7].3b4_1.heavy 639.661 / 547.248 10340.0 41.1525993347168 43 13 10 10 10 2.5287807596152665 39.54474883588334 0.0 3 0.9159504486750099 4.226733116824972 10340.0 8.440430360657858 0.0 - - - - - - - 346.1111111111111 20 9 SLC25A36 solute carrier family 25, member 36 1785 227 B20140408_SF107_03 B20140408_SF107_03 TB240102.[MT7]-EASDFVGMMLAAATSK[MT7].3b5_1.heavy 639.661 / 694.316 14565.0 41.1525993347168 43 13 10 10 10 2.5287807596152665 39.54474883588334 0.0 3 0.9159504486750099 4.226733116824972 14565.0 24.74662154648993 0.0 - - - - - - - 254.0 29 7 SLC25A36 solute carrier family 25, member 36 1787 227 B20140408_SF107_03 B20140408_SF107_03 TB240102.[MT7]-EASDFVGMMLAAATSK[MT7].3b8_1.heavy 639.661 / 981.447 26017.0 41.1525993347168 43 13 10 10 10 2.5287807596152665 39.54474883588334 0.0 3 0.9159504486750099 4.226733116824972 26017.0 45.9178485848853 0.0 - - - - - - - 254.14285714285714 52 7 SLC25A36 solute carrier family 25, member 36 1789 227 B20140408_SF107_03 B20140408_SF107_03 TB240102.[MT7]-EASDFVGMMLAAATSK[MT7].3b7_1.heavy 639.661 / 850.406 30131.0 41.1525993347168 43 13 10 10 10 2.5287807596152665 39.54474883588334 0.0 3 0.9159504486750099 4.226733116824972 30131.0 72.93148261987258 0.0 - - - - - - - 278.0 60 8 SLC25A36 solute carrier family 25, member 36 1791 228 B20140408_SF107_03 B20140408_SF107_03 TB239660.[MT7]-VNMEDLR.2y5_1.heavy 510.767 / 663.313 21297.0 27.36240005493164 44 14 10 10 10 3.521669305588406 28.395624723001028 0.0 3 0.9362092050337312 4.860122457814231 21297.0 28.22904445097319 0.0 - - - - - - - 1229.5714285714287 42 7 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 1793 228 B20140408_SF107_03 B20140408_SF107_03 TB239660.[MT7]-VNMEDLR.2b4_1.heavy 510.767 / 618.304 45074.0 27.36240005493164 44 14 10 10 10 3.521669305588406 28.395624723001028 0.0 3 0.9362092050337312 4.860122457814231 45074.0 20.05596286033304 0.0 - - - - - - - 389.3333333333333 90 3 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 1795 228 B20140408_SF107_03 B20140408_SF107_03 TB239660.[MT7]-VNMEDLR.2y6_1.heavy 510.767 / 777.356 145431.0 27.36240005493164 44 14 10 10 10 3.521669305588406 28.395624723001028 0.0 3 0.9362092050337312 4.860122457814231 145431.0 139.59096963761021 0.0 - - - - - - - 389.3333333333333 290 3 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 1797 228 B20140408_SF107_03 B20140408_SF107_03 TB239660.[MT7]-VNMEDLR.2b5_1.heavy 510.767 / 733.331 566917.0 27.36240005493164 44 14 10 10 10 3.521669305588406 28.395624723001028 0.0 3 0.9362092050337312 4.860122457814231 566917.0 568.3787521938398 0.0 - - - - - - - 321.2 1133 5 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 1799 229 B20140408_SF107_03 B20140408_SF107_03 TB498257.[MT7]-ELQREPLTPEEVQSVR.3y7_1.heavy 685.371 / 846.432 28048.0 27.316999435424805 50 20 10 10 10 24.527606900482652 4.077038595968048 0.0 3 0.9953061225017109 18.006382472768735 28048.0 53.73618961132955 0.0 - - - - - - - 243.33333333333334 56 6 CIAPIN1 cytokine induced apoptosis inhibitor 1 1801 229 B20140408_SF107_03 B20140408_SF107_03 TB498257.[MT7]-ELQREPLTPEEVQSVR.3y6_1.heavy 685.371 / 717.389 38420.0 27.316999435424805 50 20 10 10 10 24.527606900482652 4.077038595968048 0.0 3 0.9953061225017109 18.006382472768735 38420.0 100.8032262674303 0.0 - - - - - - - 730.2857142857143 76 7 CIAPIN1 cytokine induced apoptosis inhibitor 1 1803 229 B20140408_SF107_03 B20140408_SF107_03 TB498257.[MT7]-ELQREPLTPEEVQSVR.3y8_1.heavy 685.371 / 943.484 113655.0 27.316999435424805 50 20 10 10 10 24.527606900482652 4.077038595968048 0.0 3 0.9953061225017109 18.006382472768735 113655.0 170.2664258555133 0.0 - - - - - - - 340.6666666666667 227 6 CIAPIN1 cytokine induced apoptosis inhibitor 1 1805 229 B20140408_SF107_03 B20140408_SF107_03 TB498257.[MT7]-ELQREPLTPEEVQSVR.3y5_1.heavy 685.371 / 588.346 34038.0 27.316999435424805 50 20 10 10 10 24.527606900482652 4.077038595968048 0.0 3 0.9953061225017109 18.006382472768735 34038.0 42.518651359212555 0.0 - - - - - - - 1210.7142857142858 68 7 CIAPIN1 cytokine induced apoptosis inhibitor 1 1807 230 B20140408_SF107_03 B20140408_SF107_03 TB377393.[MT7]-HVVGQFSK[MT7].3y3_1.heavy 397.236 / 525.315 256370.0 22.749799728393555 47 17 10 10 10 2.372201338332327 32.661282526318175 0.0 3 0.9742257660034591 7.670651400372318 256370.0 145.75444063231947 0.0 - - - - - - - 698.6 512 5 SPAG6 sperm associated antigen 6 1809 230 B20140408_SF107_03 B20140408_SF107_03 TB377393.[MT7]-HVVGQFSK[MT7].3b4_1.heavy 397.236 / 537.326 80134.0 22.749799728393555 47 17 10 10 10 2.372201338332327 32.661282526318175 0.0 3 0.9742257660034591 7.670651400372318 80134.0 55.03776153895706 0.0 - - - - - - - 823.375 160 8 SPAG6 sperm associated antigen 6 1811 230 B20140408_SF107_03 B20140408_SF107_03 TB377393.[MT7]-HVVGQFSK[MT7].3b5_1.heavy 397.236 / 665.385 75743.0 22.749799728393555 47 17 10 10 10 2.372201338332327 32.661282526318175 0.0 3 0.9742257660034591 7.670651400372318 75743.0 180.34047619047618 0.0 - - - - - - - 320.64285714285717 151 14 SPAG6 sperm associated antigen 6 1813 230 B20140408_SF107_03 B20140408_SF107_03 TB377393.[MT7]-HVVGQFSK[MT7].3b3_1.heavy 397.236 / 480.305 100891.0 22.749799728393555 47 17 10 10 10 2.372201338332327 32.661282526318175 0.0 3 0.9742257660034591 7.670651400372318 100891.0 86.74191834649692 0.0 - - - - - - - 1210.125 201 8 SPAG6 sperm associated antigen 6 1815 231 B20140408_SF107_03 B20140408_SF107_03 TB239766.[MT7]-SLDLVTMK[MT7].2y4_1.heavy 597.854 / 622.371 28801.0 30.85740089416504 44 14 10 10 10 1.2527313075743158 45.877569821668736 0.0 3 0.9379560900172581 4.92880185388104 28801.0 35.955554934100874 0.0 - - - - - - - 742.1428571428571 57 7 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 1817 231 B20140408_SF107_03 B20140408_SF107_03 TB239766.[MT7]-SLDLVTMK[MT7].2y5_1.heavy 597.854 / 735.456 54455.0 30.85740089416504 44 14 10 10 10 1.2527313075743158 45.877569821668736 0.0 3 0.9379560900172581 4.92880185388104 54455.0 31.972028359366348 0.0 - - - - - - - 472.0 108 2 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 1819 231 B20140408_SF107_03 B20140408_SF107_03 TB239766.[MT7]-SLDLVTMK[MT7].2b4_1.heavy 597.854 / 573.336 30375.0 30.85740089416504 44 14 10 10 10 1.2527313075743158 45.877569821668736 0.0 3 0.9379560900172581 4.92880185388104 30375.0 16.784265035826188 0.0 - - - - - - - 315.0 60 1 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 1821 231 B20140408_SF107_03 B20140408_SF107_03 TB239766.[MT7]-SLDLVTMK[MT7].2y3_1.heavy 597.854 / 523.303 48160.0 30.85740089416504 44 14 10 10 10 1.2527313075743158 45.877569821668736 0.0 3 0.9379560900172581 4.92880185388104 48160.0 24.47884368786641 0.0 - - - - - - - 682.3333333333334 96 3 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 1823 232 B20140408_SF107_03 B20140408_SF107_03 TB239765.[MT7]-SNFALLLK[MT7].2y5_1.heavy 597.378 / 701.504 10249.0 34.44609832763672 47 17 10 10 10 2.943854397685992 27.011818198164008 0.0 3 0.9722309670214486 7.388764776371169 10249.0 9.24660723366966 0.0 - - - - - - - 729.8 20 10 CYP20A1 cytochrome P450, family 20, subfamily A, polypeptide 1 1825 232 B20140408_SF107_03 B20140408_SF107_03 TB239765.[MT7]-SNFALLLK[MT7].2b4_1.heavy 597.378 / 564.29 12507.0 34.44609832763672 47 17 10 10 10 2.943854397685992 27.011818198164008 0.0 3 0.9722309670214486 7.388764776371169 12507.0 16.097153809880922 0.0 - - - - - - - 347.0 25 2 CYP20A1 cytochrome P450, family 20, subfamily A, polypeptide 1 1827 232 B20140408_SF107_03 B20140408_SF107_03 TB239765.[MT7]-SNFALLLK[MT7].2y3_1.heavy 597.378 / 517.383 8859.0 34.44609832763672 47 17 10 10 10 2.943854397685992 27.011818198164008 0.0 3 0.9722309670214486 7.388764776371169 8859.0 6.645164075993091 0.0 - - - - - - - 303.75 17 4 CYP20A1 cytochrome P450, family 20, subfamily A, polypeptide 1 1829 232 B20140408_SF107_03 B20140408_SF107_03 TB239765.[MT7]-SNFALLLK[MT7].2b5_1.heavy 597.378 / 677.374 15981.0 34.44609832763672 47 17 10 10 10 2.943854397685992 27.011818198164008 0.0 3 0.9722309670214486 7.388764776371169 15981.0 22.11243077093028 0.0 - - - - - - - 1265.7142857142858 31 7 CYP20A1 cytochrome P450, family 20, subfamily A, polypeptide 1 1831 233 B20140408_SF107_03 B20140408_SF107_03 TB240108.[MT7]-LIDRENFVDIVDAK[MT7].2b3_1.heavy 968.043 / 486.304 2210.0 33.11289978027344 40 10 10 10 10 0.6336427795663645 84.66449663925204 0.0 3 0.8428061186057583 3.071030099569257 2210.0 2.1666666666666665 0.0 - - - - - - - 204.0 4 5 C7orf44 chromosome 7 open reading frame 44 1833 233 B20140408_SF107_03 B20140408_SF107_03 TB240108.[MT7]-LIDRENFVDIVDAK[MT7].2y5_1.heavy 968.043 / 689.431 10538.0 33.11289978027344 40 10 10 10 10 0.6336427795663645 84.66449663925204 0.0 3 0.8428061186057583 3.071030099569257 10538.0 41.118862745098035 0.0 - - - - - - - 238.0 21 10 C7orf44 chromosome 7 open reading frame 44 1835 233 B20140408_SF107_03 B20140408_SF107_03 TB240108.[MT7]-LIDRENFVDIVDAK[MT7].2b9_2.heavy 968.043 / 623.831 680.0 33.11289978027344 40 10 10 10 10 0.6336427795663645 84.66449663925204 0.0 3 0.8428061186057583 3.071030099569257 680.0 5.6 11.0 - - - - - - - 0.0 1 0 C7orf44 chromosome 7 open reading frame 44 1837 233 B20140408_SF107_03 B20140408_SF107_03 TB240108.[MT7]-LIDRENFVDIVDAK[MT7].2b9_1.heavy 968.043 / 1246.65 9858.0 33.11289978027344 40 10 10 10 10 0.6336427795663645 84.66449663925204 0.0 3 0.8428061186057583 3.071030099569257 9858.0 33.92311764705882 0.0 - - - - - - - 283.3333333333333 19 3 C7orf44 chromosome 7 open reading frame 44 1839 234 B20140408_SF107_03 B20140408_SF107_03 TB239550.[MT7]-GGPFQR.2y4_1.heavy 403.225 / 547.299 8562.0 23.07670021057129 29 18 2 3 6 3.461217023210314 28.891571759129096 0.07290077209472656 5 0.9845820645454663 9.92635220034962 8562.0 4.970183770901261 1.0 - - - - - - - 312.75 51 4 C7orf44 chromosome 7 open reading frame 44 1841 234 B20140408_SF107_03 B20140408_SF107_03 TB239550.[MT7]-GGPFQR.2y5_1.heavy 403.225 / 604.32 20780.0 23.07670021057129 29 18 2 3 6 3.461217023210314 28.891571759129096 0.07290077209472656 5 0.9845820645454663 9.92635220034962 20780.0 7.569834633684875 3.0 - - - - - - - 748.2222222222222 41 9 C7orf44 chromosome 7 open reading frame 44 1843 234 B20140408_SF107_03 B20140408_SF107_03 TB239550.[MT7]-GGPFQR.2b4_1.heavy 403.225 / 503.273 N/A 23.07670021057129 29 18 2 3 6 3.461217023210314 28.891571759129096 0.07290077209472656 5 0.9845820645454663 9.92635220034962 26745.0 3.7333382833382833 3.0 - - - - - - - 866.0 107 1 C7orf44 chromosome 7 open reading frame 44 1845 234 B20140408_SF107_03 B20140408_SF107_03 TB239550.[MT7]-GGPFQR.2b5_1.heavy 403.225 / 631.332 16258.0 23.07670021057129 29 18 2 3 6 3.461217023210314 28.891571759129096 0.07290077209472656 5 0.9845820645454663 9.92635220034962 16258.0 9.625373073558757 0.0 - - - - - - - 417.0 32 3 C7orf44 chromosome 7 open reading frame 44 1847 235 B20140408_SF107_03 B20140408_SF107_03 TB377512.[MT7]-RYEPVPADK[MT7].3y3_1.heavy 454.926 / 477.279 145153.0 21.78219985961914 46 16 10 10 10 5.180228037813128 19.304169482510993 0.0 3 0.9632450006322785 6.417485510184667 145153.0 107.46904807692309 0.0 - - - - - - - 1852.25 290 8 C19orf66 chromosome 19 open reading frame 66 1849 235 B20140408_SF107_03 B20140408_SF107_03 TB377512.[MT7]-RYEPVPADK[MT7].3b5_1.heavy 454.926 / 789.438 66380.0 21.78219985961914 46 16 10 10 10 5.180228037813128 19.304169482510993 0.0 3 0.9632450006322785 6.417485510184667 66380.0 228.80742681535926 0.0 - - - - - - - 220.0 132 13 C19orf66 chromosome 19 open reading frame 66 1851 235 B20140408_SF107_03 B20140408_SF107_03 TB377512.[MT7]-RYEPVPADK[MT7].3b3_1.heavy 454.926 / 593.316 51302.0 21.78219985961914 46 16 10 10 10 5.180228037813128 19.304169482510993 0.0 3 0.9632450006322785 6.417485510184667 51302.0 66.39478858098423 0.0 - - - - - - - 693.4 102 10 C19orf66 chromosome 19 open reading frame 66 1853 235 B20140408_SF107_03 B20140408_SF107_03 TB377512.[MT7]-RYEPVPADK[MT7].3y4_1.heavy 454.926 / 574.332 331815.0 21.78219985961914 46 16 10 10 10 5.180228037813128 19.304169482510993 0.0 3 0.9632450006322785 6.417485510184667 331815.0 319.0528846153846 0.0 - - - - - - - 1770.2857142857142 663 7 C19orf66 chromosome 19 open reading frame 66 1855 236 B20140408_SF107_03 B20140408_SF107_03 TB377515.[MT7]-LK[MT7]DEEC[CAM]ER.3y6_1.heavy 456.234 / 837.304 10344.0 19.914499759674072 44 18 10 6 10 4.682855376086563 21.3544924984571 0.03520011901855469 3 0.9843783875426442 9.861260892301173 10344.0 29.838461538461537 0.0 - - - - - - - 238.33333333333334 20 18 RAB3IP;RAB3IL1 RAB3A interacting protein (rabin3);RAB3A interacting protein (rabin3)-like 1 1857 236 B20140408_SF107_03 B20140408_SF107_03 TB377515.[MT7]-LK[MT7]DEEC[CAM]ER.3y7_2.heavy 456.234 / 555.254 24462.0 19.914499759674072 44 18 10 6 10 4.682855376086563 21.3544924984571 0.03520011901855469 3 0.9843783875426442 9.861260892301173 24462.0 26.10771104847199 0.0 - - - - - - - 1260.375 48 8 RAB3IP;RAB3IL1 RAB3A interacting protein (rabin3);RAB3A interacting protein (rabin3)-like 1 1859 236 B20140408_SF107_03 B20140408_SF107_03 TB377515.[MT7]-LK[MT7]DEEC[CAM]ER.3y4_1.heavy 456.234 / 593.235 15744.0 19.914499759674072 44 18 10 6 10 4.682855376086563 21.3544924984571 0.03520011901855469 3 0.9843783875426442 9.861260892301173 15744.0 13.416412643129036 0.0 - - - - - - - 1210.0 31 10 RAB3IP;RAB3IL1 RAB3A interacting protein (rabin3);RAB3A interacting protein (rabin3)-like 1 1861 236 B20140408_SF107_03 B20140408_SF107_03 TB377515.[MT7]-LK[MT7]DEEC[CAM]ER.3y5_1.heavy 456.234 / 722.277 45997.0 19.914499759674072 44 18 10 6 10 4.682855376086563 21.3544924984571 0.03520011901855469 3 0.9843783875426442 9.861260892301173 45997.0 114.25046811651683 0.0 - - - - - - - 687.0 91 9 RAB3IP;RAB3IL1 RAB3A interacting protein (rabin3);RAB3A interacting protein (rabin3)-like 1 1863 237 B20140408_SF107_03 B20140408_SF107_03 TB240218.[MT7]-LTVSAGGSEAK[MT7]PLIFTFVPTVR.3y7_1.heavy 860.166 / 819.472 7304.0 37.7672004699707 42 17 10 5 10 6.403971334189992 15.61531037250474 0.0449981689453125 3 0.9741378598406366 7.657547288253866 7304.0 12.286885485976253 0.0 - - - - - - - 777.0 14 7 C6orf142 chromosome 6 open reading frame 142 1865 237 B20140408_SF107_03 B20140408_SF107_03 TB240218.[MT7]-LTVSAGGSEAK[MT7]PLIFTFVPTVR.3y6_1.heavy 860.166 / 718.425 4818.0 37.7672004699707 42 17 10 5 10 6.403971334189992 15.61531037250474 0.0449981689453125 3 0.9741378598406366 7.657547288253866 4818.0 8.83000978288311 0.0 - - - - - - - 690.8888888888889 9 9 C6orf142 chromosome 6 open reading frame 142 1867 237 B20140408_SF107_03 B20140408_SF107_03 TB240218.[MT7]-LTVSAGGSEAK[MT7]PLIFTFVPTVR.3y8_1.heavy 860.166 / 966.541 10412.0 37.7672004699707 42 17 10 5 10 6.403971334189992 15.61531037250474 0.0449981689453125 3 0.9741378598406366 7.657547288253866 10412.0 16.593221408735168 0.0 - - - - - - - 349.5 20 12 C6orf142 chromosome 6 open reading frame 142 1869 237 B20140408_SF107_03 B20140408_SF107_03 TB240218.[MT7]-LTVSAGGSEAK[MT7]PLIFTFVPTVR.3y9_1.heavy 860.166 / 1079.62 4507.0 37.7672004699707 42 17 10 5 10 6.403971334189992 15.61531037250474 0.0449981689453125 3 0.9741378598406366 7.657547288253866 4507.0 11.599788857761892 0.0 - - - - - - - 321.7142857142857 9 14 C6orf142 chromosome 6 open reading frame 142 1871 238 B20140408_SF107_03 B20140408_SF107_03 TB377614.[MT7]-YEELFPAFSDSR.2b3_1.heavy 802.889 / 566.258 13593.0 36.20145034790039 36 13 10 3 10 1.0490129574985119 63.55180476096382 0.05030059814453125 3 0.904944713887355 3.9707495495722993 13593.0 22.94190666041276 0.0 - - - - - - - 346.6666666666667 27 6 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1873 238 B20140408_SF107_03 B20140408_SF107_03 TB377614.[MT7]-YEELFPAFSDSR.2y8_1.heavy 802.889 / 926.437 12154.0 36.20145034790039 36 13 10 3 10 1.0490129574985119 63.55180476096382 0.05030059814453125 3 0.904944713887355 3.9707495495722993 12154.0 14.738340212632895 0.0 - - - - - - - 342.85714285714283 24 7 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1875 238 B20140408_SF107_03 B20140408_SF107_03 TB377614.[MT7]-YEELFPAFSDSR.2b4_1.heavy 802.889 / 679.342 22708.0 36.20145034790039 36 13 10 3 10 1.0490129574985119 63.55180476096382 0.05030059814453125 3 0.904944713887355 3.9707495495722993 22708.0 34.92376654177853 0.0 - - - - - - - 720.0 45 6 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1877 238 B20140408_SF107_03 B20140408_SF107_03 TB377614.[MT7]-YEELFPAFSDSR.2y7_1.heavy 802.889 / 779.368 22228.0 36.20145034790039 36 13 10 3 10 1.0490129574985119 63.55180476096382 0.05030059814453125 3 0.904944713887355 3.9707495495722993 22228.0 11.911968170048304 0.0 - - - - - - - 320.0 44 2 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1879 239 B20140408_SF107_03 B20140408_SF107_03 TB377282.[MT7]-TEEDILR.2y4_1.heavy 510.278 / 516.314 6653.0 26.184499740600586 47 17 10 10 10 4.58213955962048 21.823866056205976 0.0 3 0.9798361059191971 8.67646256978001 6653.0 4.676474891969936 4.0 - - - - - - - 920.0 22 2 AP1AR adaptor-related protein complex 1 associated regulatory protein 1881 239 B20140408_SF107_03 B20140408_SF107_03 TB377282.[MT7]-TEEDILR.2y5_1.heavy 510.278 / 645.357 7078.0 26.184499740600586 47 17 10 10 10 4.58213955962048 21.823866056205976 0.0 3 0.9798361059191971 8.67646256978001 7078.0 5.7804788827741564 0.0 - - - - - - - 1258.2222222222222 14 9 AP1AR adaptor-related protein complex 1 associated regulatory protein 1883 239 B20140408_SF107_03 B20140408_SF107_03 TB377282.[MT7]-TEEDILR.2b4_1.heavy 510.278 / 619.269 53368.0 26.184499740600586 47 17 10 10 10 4.58213955962048 21.823866056205976 0.0 3 0.9798361059191971 8.67646256978001 53368.0 42.51266743850616 0.0 - - - - - - - 1213.142857142857 106 7 AP1AR adaptor-related protein complex 1 associated regulatory protein 1885 239 B20140408_SF107_03 B20140408_SF107_03 TB377282.[MT7]-TEEDILR.2y6_1.heavy 510.278 / 774.399 23923.0 26.184499740600586 47 17 10 10 10 4.58213955962048 21.823866056205976 0.0 3 0.9798361059191971 8.67646256978001 23923.0 28.173432776209154 0.0 - - - - - - - 770.6666666666666 47 9 AP1AR adaptor-related protein complex 1 associated regulatory protein 1887 240 B20140408_SF107_03 B20140408_SF107_03 TB377717.[MT7]-GINTLVTYDMVPEPK[MT7].3b9_1.heavy 655.692 / 1121.6 42916.0 33.86000061035156 43 13 10 10 10 2.1059433318810465 39.30858404478009 0.0 3 0.9057501039184555 3.9879563207136455 42916.0 152.66536962750718 0.0 - - - - - - - 232.33333333333334 85 6 COX5A cytochrome c oxidase subunit Va 1889 240 B20140408_SF107_03 B20140408_SF107_03 TB377717.[MT7]-GINTLVTYDMVPEPK[MT7].3b6_1.heavy 655.692 / 742.458 112525.0 33.86000061035156 43 13 10 10 10 2.1059433318810465 39.30858404478009 0.0 3 0.9057501039184555 3.9879563207136455 112525.0 113.83856216040095 0.0 - - - - - - - 1769.7142857142858 225 7 COX5A cytochrome c oxidase subunit Va 1891 240 B20140408_SF107_03 B20140408_SF107_03 TB377717.[MT7]-GINTLVTYDMVPEPK[MT7].3b4_1.heavy 655.692 / 530.305 39602.0 33.86000061035156 43 13 10 10 10 2.1059433318810465 39.30858404478009 0.0 3 0.9057501039184555 3.9879563207136455 39602.0 10.087825218273563 1.0 - - - - - - - 174.0 87 1 COX5A cytochrome c oxidase subunit Va 1893 240 B20140408_SF107_03 B20140408_SF107_03 TB377717.[MT7]-GINTLVTYDMVPEPK[MT7].3b5_1.heavy 655.692 / 643.39 103279.0 33.86000061035156 43 13 10 10 10 2.1059433318810465 39.30858404478009 0.0 3 0.9057501039184555 3.9879563207136455 103279.0 50.73456723003362 0.0 - - - - - - - 697.5 206 2 COX5A cytochrome c oxidase subunit Va 1895 241 B20140408_SF107_03 B20140408_SF107_03 TB377810.[MT7]-SAYQTIDSAEAPADPFAVPEGR.3y11_1.heavy 812.732 / 1155.58 29230.0 32.6083984375 50 20 10 10 10 27.406757620251675 3.6487351545046325 0.0 3 0.9985998505807104 32.97801349142952 29230.0 96.01525899504163 0.0 - - - - - - - 244.28571428571428 58 7 AGTRAP angiotensin II receptor-associated protein 1897 241 B20140408_SF107_03 B20140408_SF107_03 TB377810.[MT7]-SAYQTIDSAEAPADPFAVPEGR.3b4_1.heavy 812.732 / 594.3 32648.0 32.6083984375 50 20 10 10 10 27.406757620251675 3.6487351545046325 0.0 3 0.9985998505807104 32.97801349142952 32648.0 36.684090477811495 0.0 - - - - - - - 256.5 65 2 AGTRAP angiotensin II receptor-associated protein 1899 241 B20140408_SF107_03 B20140408_SF107_03 TB377810.[MT7]-SAYQTIDSAEAPADPFAVPEGR.3b5_1.heavy 812.732 / 695.348 37776.0 32.6083984375 50 20 10 10 10 27.406757620251675 3.6487351545046325 0.0 3 0.9985998505807104 32.97801349142952 37776.0 57.695862523002035 0.0 - - - - - - - 256.5 75 2 AGTRAP angiotensin II receptor-associated protein 1901 241 B20140408_SF107_03 B20140408_SF107_03 TB377810.[MT7]-SAYQTIDSAEAPADPFAVPEGR.3y8_1.heavy 812.732 / 872.463 84270.0 32.6083984375 50 20 10 10 10 27.406757620251675 3.6487351545046325 0.0 3 0.9985998505807104 32.97801349142952 84270.0 120.81459170209646 0.0 - - - - - - - 718.2 168 5 AGTRAP angiotensin II receptor-associated protein 1903 242 B20140408_SF107_03 B20140408_SF107_03 TB239697.[MT7]-VSVENIK[MT7].2y4_1.heavy 538.831 / 647.385 36117.0 25.883699417114258 50 20 10 10 10 9.696081220535234 10.313444960445565 0.0 3 0.9913063894671351 13.226567258695892 36117.0 73.43841006046256 0.0 - - - - - - - 1260.75 72 8 CIAPIN1 cytokine induced apoptosis inhibitor 1 1905 242 B20140408_SF107_03 B20140408_SF107_03 TB239697.[MT7]-VSVENIK[MT7].2y3_1.heavy 538.831 / 518.342 35163.0 25.883699417114258 50 20 10 10 10 9.696081220535234 10.313444960445565 0.0 3 0.9913063894671351 13.226567258695892 35163.0 8.963044726602726 1.0 - - - - - - - 1771.5 70 2 CIAPIN1 cytokine induced apoptosis inhibitor 1 1907 242 B20140408_SF107_03 B20140408_SF107_03 TB239697.[MT7]-VSVENIK[MT7].2y6_1.heavy 538.831 / 833.485 96220.0 25.883699417114258 50 20 10 10 10 9.696081220535234 10.313444960445565 0.0 3 0.9913063894671351 13.226567258695892 96220.0 94.7388792765458 0.0 - - - - - - - 708.7 192 10 CIAPIN1 cytokine induced apoptosis inhibitor 1 1909 242 B20140408_SF107_03 B20140408_SF107_03 TB239697.[MT7]-VSVENIK[MT7].2b5_1.heavy 538.831 / 673.364 21943.0 25.883699417114258 50 20 10 10 10 9.696081220535234 10.313444960445565 0.0 3 0.9913063894671351 13.226567258695892 21943.0 10.174398359646606 1.0 - - - - - - - 1243.375 43 8 CIAPIN1 cytokine induced apoptosis inhibitor 1 1911 243 B20140408_SF107_03 B20140408_SF107_03 TB239696.[MT7]-LREMLIR.2y4_1.heavy 537.832 / 532.328 N/A 28.599899291992188 40 17 9 10 4 2.020949513380283 38.42872820653183 0.0 9 0.9785887799763384 8.41906194296786 12069.0 1.5662515527950311 12.0 - - - - - - - 3278.0 36 1 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 1913 243 B20140408_SF107_03 B20140408_SF107_03 TB239696.[MT7]-LREMLIR.2y5_1.heavy 537.832 / 661.37 8940.0 28.599899291992188 40 17 9 10 4 2.020949513380283 38.42872820653183 0.0 9 0.9785887799763384 8.41906194296786 8940.0 5.105042016806722 2.0 - - - - - - - 447.0 35 3 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 1915 243 B20140408_SF107_03 B20140408_SF107_03 TB239696.[MT7]-LREMLIR.2b4_1.heavy 537.832 / 674.378 4619.0 28.599899291992188 40 17 9 10 4 2.020949513380283 38.42872820653183 0.0 9 0.9785887799763384 8.41906194296786 4619.0 3.1134782608695657 11.0 - - - - - - - 745.0 26 1 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 1917 243 B20140408_SF107_03 B20140408_SF107_03 TB239696.[MT7]-LREMLIR.2b5_1.heavy 537.832 / 787.462 16242.0 28.599899291992188 40 17 9 10 4 2.020949513380283 38.42872820653183 0.0 9 0.9785887799763384 8.41906194296786 16242.0 22.792312385600976 0.0 - - - - - - - 707.75 32 8 SEPT6;SEPT8;SEPT11 septin 6;septin 8;septin 11 1919 244 B20140408_SF107_03 B20140408_SF107_03 TB377819.[MT7]-LIGEPDLVVSVIPNNSNENIPR.3b6_1.heavy 845.13 / 769.421 15596.0 36.30200004577637 40 17 10 3 10 21.052126379147257 4.75011398844028 0.050403594970703125 3 0.9777986429979065 8.267340502858909 15596.0 13.830284878973702 0.0 - - - - - - - 156.0 31 2 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 1921 244 B20140408_SF107_03 B20140408_SF107_03 TB377819.[MT7]-LIGEPDLVVSVIPNNSNENIPR.3b4_1.heavy 845.13 / 557.341 16843.0 36.30200004577637 40 17 10 3 10 21.052126379147257 4.75011398844028 0.050403594970703125 3 0.9777986429979065 8.267340502858909 16843.0 20.459504705597183 0.0 - - - - - - - 468.0 33 1 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 1923 244 B20140408_SF107_03 B20140408_SF107_03 TB377819.[MT7]-LIGEPDLVVSVIPNNSNENIPR.3b7_1.heavy 845.13 / 882.505 22614.0 36.30200004577637 40 17 10 3 10 21.052126379147257 4.75011398844028 0.050403594970703125 3 0.9777986429979065 8.267340502858909 22614.0 14.476773268909039 0.0 - - - - - - - 390.0 45 2 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 1925 244 B20140408_SF107_03 B20140408_SF107_03 TB377819.[MT7]-LIGEPDLVVSVIPNNSNENIPR.3y10_1.heavy 845.13 / 1154.55 31035.0 36.30200004577637 40 17 10 3 10 21.052126379147257 4.75011398844028 0.050403594970703125 3 0.9777986429979065 8.267340502858909 31035.0 59.24799848750834 0.0 - - - - - - - 289.7142857142857 62 7 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 1927 245 B20140408_SF107_03 B20140408_SF107_03 TB239994.[MT7]-HQILSALSQVSK[MT7].3b6_1.heavy 533.654 / 794.464 35795.0 29.2908992767334 33 13 2 10 8 1.6139861471395414 49.35902373438843 0.0 4 0.9206380171184405 4.351521969551267 35795.0 36.341498132485405 0.0 - - - - - - - 776.5714285714286 71 7 SPAG6 sperm associated antigen 6 1929 245 B20140408_SF107_03 B20140408_SF107_03 TB239994.[MT7]-HQILSALSQVSK[MT7].3b4_1.heavy 533.654 / 636.395 41534.0 29.2908992767334 33 13 2 10 8 1.6139861471395414 49.35902373438843 0.0 4 0.9206380171184405 4.351521969551267 41534.0 18.061086546130007 2.0 - - - - - - - 302.0 471 1 SPAG6 sperm associated antigen 6 1931 245 B20140408_SF107_03 B20140408_SF107_03 TB239994.[MT7]-HQILSALSQVSK[MT7].3b3_1.heavy 533.654 / 523.311 57846.0 29.2908992767334 33 13 2 10 8 1.6139861471395414 49.35902373438843 0.0 4 0.9206380171184405 4.351521969551267 57846.0 26.595904838175368 0.0 - - - - - - - 830.5 115 2 SPAG6 sperm associated antigen 6 1933 245 B20140408_SF107_03 B20140408_SF107_03 TB239994.[MT7]-HQILSALSQVSK[MT7].3y5_1.heavy 533.654 / 692.406 79293.0 29.2908992767334 33 13 2 10 8 1.6139861471395414 49.35902373438843 0.0 4 0.9206380171184405 4.351521969551267 79293.0 82.69916368058864 0.0 - - - - - - - 302.0 158 1 SPAG6 sperm associated antigen 6 1935 246 B20140408_SF107_03 B20140408_SF107_03 TB239992.[MT7]-VMLYQISEEVSR.2y8_1.heavy 799.422 / 947.479 8199.0 34.58530044555664 42 12 10 10 10 12.332136727680004 8.10889484995295 0.0 3 0.8834689424763934 3.5795712953667445 8199.0 25.761624811671698 0.0 - - - - - - - 600.6666666666666 16 9 CASP8 caspase 8, apoptosis-related cysteine peptidase 1937 246 B20140408_SF107_03 B20140408_SF107_03 TB239992.[MT7]-VMLYQISEEVSR.2y9_1.heavy 799.422 / 1110.54 3315.0 34.58530044555664 42 12 10 10 10 12.332136727680004 8.10889484995295 0.0 3 0.8834689424763934 3.5795712953667445 3315.0 15.013366515638783 0.0 - - - - - - - 244.0 6 10 CASP8 caspase 8, apoptosis-related cysteine peptidase 1939 246 B20140408_SF107_03 B20140408_SF107_03 TB239992.[MT7]-VMLYQISEEVSR.2y6_1.heavy 799.422 / 706.337 4536.0 34.58530044555664 42 12 10 10 10 12.332136727680004 8.10889484995295 0.0 3 0.8834689424763934 3.5795712953667445 4536.0 11.187028259687406 0.0 - - - - - - - 697.625 9 8 CASP8 caspase 8, apoptosis-related cysteine peptidase 1941 246 B20140408_SF107_03 B20140408_SF107_03 TB239992.[MT7]-VMLYQISEEVSR.2y7_1.heavy 799.422 / 819.421 5582.0 34.58530044555664 42 12 10 10 10 12.332136727680004 8.10889484995295 0.0 3 0.8834689424763934 3.5795712953667445 5582.0 8.639106490365657 0.0 - - - - - - - 654.125 11 8 CASP8 caspase 8, apoptosis-related cysteine peptidase 1943 247 B20140408_SF107_03 B20140408_SF107_03 TB377525.[MT7]-SEGLLYVHSSR.3y6_1.heavy 464.585 / 748.374 16922.0 26.140600204467773 43 13 10 10 10 1.1884585109247323 52.639630784815054 0.0 3 0.9129520716173488 4.15222866692974 16922.0 36.185087324253075 0.0 - - - - - - - 751.5714285714286 33 7 C7orf44 chromosome 7 open reading frame 44 1945 247 B20140408_SF107_03 B20140408_SF107_03 TB377525.[MT7]-SEGLLYVHSSR.3b4_1.heavy 464.585 / 531.289 76079.0 26.140600204467773 43 13 10 10 10 1.1884585109247323 52.639630784815054 0.0 3 0.9129520716173488 4.15222866692974 76079.0 31.430861428730964 0.0 - - - - - - - 1351.0 152 2 C7orf44 chromosome 7 open reading frame 44 1947 247 B20140408_SF107_03 B20140408_SF107_03 TB377525.[MT7]-SEGLLYVHSSR.3b5_1.heavy 464.585 / 644.374 70391.0 26.140600204467773 43 13 10 10 10 1.1884585109247323 52.639630784815054 0.0 3 0.9129520716173488 4.15222866692974 70391.0 73.09366951947236 0.0 - - - - - - - 873.2857142857143 140 7 C7orf44 chromosome 7 open reading frame 44 1949 247 B20140408_SF107_03 B20140408_SF107_03 TB377525.[MT7]-SEGLLYVHSSR.3y4_1.heavy 464.585 / 486.242 98832.0 26.140600204467773 43 13 10 10 10 1.1884585109247323 52.639630784815054 0.0 3 0.9129520716173488 4.15222866692974 98832.0 47.781122216988656 0.0 - - - - - - - 995.0 197 1 C7orf44 chromosome 7 open reading frame 44 1951 248 B20140408_SF107_03 B20140408_SF107_03 TB240194.[MT7]-LLEAHEEQNVDSYTESVK[MT7].4b8_2.heavy 595.553 / 547.784 25503.0 28.22410011291504 33 7 10 10 6 0.7936840542391481 82.42090909316042 0.0 5 0.7254342620067867 2.2991140640987937 25503.0 23.519295745259086 0.0 - - - - - - - 1165.0 51 7 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1953 248 B20140408_SF107_03 B20140408_SF107_03 TB240194.[MT7]-LLEAHEEQNVDSYTESVK[MT7].4b4_1.heavy 595.553 / 571.357 13938.0 28.22410011291504 33 7 10 10 6 0.7936840542391481 82.42090909316042 0.0 5 0.7254342620067867 2.2991140640987937 13938.0 4.88117859978947 2.0 - - - - - - - 445.0 35 1 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1955 248 B20140408_SF107_03 B20140408_SF107_03 TB240194.[MT7]-LLEAHEEQNVDSYTESVK[MT7].4b5_1.heavy 595.553 / 708.416 11417.0 28.22410011291504 33 7 10 10 6 0.7936840542391481 82.42090909316042 0.0 5 0.7254342620067867 2.2991140640987937 11417.0 7.932935397843455 0.0 - - - - - - - 445.0 22 1 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1957 248 B20140408_SF107_03 B20140408_SF107_03 TB240194.[MT7]-LLEAHEEQNVDSYTESVK[MT7].4b3_1.heavy 595.553 / 500.32 7710.0 28.22410011291504 33 7 10 10 6 0.7936840542391481 82.42090909316042 0.0 5 0.7254342620067867 2.2991140640987937 7710.0 5.17421203959583 2.0 - - - - - - - 741.5 21 2 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1959 249 B20140408_SF107_03 B20140408_SF107_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 820281.0 37.10340118408203 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 820281.0 441.6650761146601 0.0 - - - - - - - 317.5 1640 2 1961 249 B20140408_SF107_03 B20140408_SF107_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 1551980.0 37.10340118408203 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1551980.0 445.0062727127922 0.0 - - - - - - - 211.66666666666666 3103 3 1963 249 B20140408_SF107_03 B20140408_SF107_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 1385450.0 37.10340118408203 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1385450.0 649.4682771345636 0.0 - - - - - - - 238.0 2770 4 1965 250 B20140408_SF107_03 B20140408_SF107_03 TB239989.[MT7]-K[MT7]TIQGDEEDLR.3b9_2.heavy 531.289 / 652.832 68059.0 22.749799728393555 35 5 10 10 10 0.5011369734534187 91.34773232006275 0.0 3 0.6442155759463367 2.004284659470656 68059.0 49.42694694099574 0.0 - - - - - - - 1192.875 136 8 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1967 250 B20140408_SF107_03 B20140408_SF107_03 TB239989.[MT7]-K[MT7]TIQGDEEDLR.3y7_1.heavy 531.289 / 833.364 20341.0 22.749799728393555 35 5 10 10 10 0.5011369734534187 91.34773232006275 0.0 3 0.6442155759463367 2.004284659470656 20341.0 72.22549787302675 0.0 - - - - - - - 326.2307692307692 40 13 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1969 250 B20140408_SF107_03 B20140408_SF107_03 TB239989.[MT7]-K[MT7]TIQGDEEDLR.3y8_1.heavy 531.289 / 961.422 11568.0 22.749799728393555 35 5 10 10 10 0.5011369734534187 91.34773232006275 0.0 3 0.6442155759463367 2.004284659470656 11568.0 22.80155642023346 0.0 - - - - - - - 230.22222222222223 23 18 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1971 250 B20140408_SF107_03 B20140408_SF107_03 TB239989.[MT7]-K[MT7]TIQGDEEDLR.3y5_1.heavy 531.289 / 661.315 9640.0 22.749799728393555 35 5 10 10 10 0.5011369734534187 91.34773232006275 0.0 3 0.6442155759463367 2.004284659470656 9640.0 20.119904963883084 1.0 - - - - - - - 706.9166666666666 25 12 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1973 251 B20140408_SF107_03 B20140408_SF107_03 TB377402.[MT7]-ILFPDIIAR.2b3_1.heavy 601.375 / 518.346 229895.0 37.78969955444336 44 14 10 10 10 1.6893581719714506 53.35859955081776 0.0 3 0.9493920605717485 5.462660942641931 229895.0 144.5492327807432 0.0 - - - - - - - 887.6666666666666 459 3 MAGEF1 melanoma antigen family F, 1 1975 251 B20140408_SF107_03 B20140408_SF107_03 TB377402.[MT7]-ILFPDIIAR.2y8_1.heavy 601.375 / 944.556 307274.0 37.78969955444336 44 14 10 10 10 1.6893581719714506 53.35859955081776 0.0 3 0.9493920605717485 5.462660942641931 307274.0 619.7517410266017 0.0 - - - - - - - 350.5 614 2 MAGEF1 melanoma antigen family F, 1 1977 251 B20140408_SF107_03 B20140408_SF107_03 TB377402.[MT7]-ILFPDIIAR.2y6_1.heavy 601.375 / 684.404 393204.0 37.78969955444336 44 14 10 10 10 1.6893581719714506 53.35859955081776 0.0 3 0.9493920605717485 5.462660942641931 393204.0 297.435675612487 0.0 - - - - - - - 374.0 786 3 MAGEF1 melanoma antigen family F, 1 1979 251 B20140408_SF107_03 B20140408_SF107_03 TB377402.[MT7]-ILFPDIIAR.2y7_1.heavy 601.375 / 831.472 196532.0 37.78969955444336 44 14 10 10 10 1.6893581719714506 53.35859955081776 0.0 3 0.9493920605717485 5.462660942641931 196532.0 154.20146733886946 0.0 - - - - - - - 210.16666666666666 393 6 MAGEF1 melanoma antigen family F, 1 1981 252 B20140408_SF107_03 B20140408_SF107_03 TB377526.[MT7]-FLLQEEISK[MT7].2b3_1.heavy 697.91 / 518.346 27862.0 32.65919876098633 47 17 10 10 10 3.0615518430027477 26.15800022845449 0.0 3 0.9729151490317948 7.481936312991841 27862.0 26.041275151988128 0.0 - - - - - - - 757.2857142857143 55 7 CASP8 caspase 8, apoptosis-related cysteine peptidase 1983 252 B20140408_SF107_03 B20140408_SF107_03 TB377526.[MT7]-FLLQEEISK[MT7].2y5_1.heavy 697.91 / 749.416 18119.0 32.65919876098633 47 17 10 10 10 3.0615518430027477 26.15800022845449 0.0 3 0.9729151490317948 7.481936312991841 18119.0 21.18139571274542 0.0 - - - - - - - 684.0 36 7 CASP8 caspase 8, apoptosis-related cysteine peptidase 1985 252 B20140408_SF107_03 B20140408_SF107_03 TB377526.[MT7]-FLLQEEISK[MT7].2y6_1.heavy 697.91 / 877.475 20170.0 32.65919876098633 47 17 10 10 10 3.0615518430027477 26.15800022845449 0.0 3 0.9729151490317948 7.481936312991841 20170.0 23.631634108912944 0.0 - - - - - - - 703.0 40 9 CASP8 caspase 8, apoptosis-related cysteine peptidase 1987 252 B20140408_SF107_03 B20140408_SF107_03 TB377526.[MT7]-FLLQEEISK[MT7].2y7_1.heavy 697.91 / 990.559 18632.0 32.65919876098633 47 17 10 10 10 3.0615518430027477 26.15800022845449 0.0 3 0.9729151490317948 7.481936312991841 18632.0 76.81614035087719 0.0 - - - - - - - 266.0 37 9 CASP8 caspase 8, apoptosis-related cysteine peptidase 1989 253 B20140408_SF107_03 B20140408_SF107_03 TB240229.[MT7]-TRMQDFWSLLTFSSDLVDVK[MT7].4b8_2.heavy 669.854 / 598.786 37621.0 42.99449920654297 41 11 10 10 10 1.346282392113681 74.2786213247569 0.0 3 0.8519526503054691 3.1670314372901367 37621.0 95.04788499196901 0.0 - - - - - - - 733.2 75 10 STAG3L4 stromal antigen 3-like 4 1991 253 B20140408_SF107_03 B20140408_SF107_03 TB240229.[MT7]-TRMQDFWSLLTFSSDLVDVK[MT7].4b5_1.heavy 669.854 / 776.384 8136.0 42.99449920654297 41 11 10 10 10 1.346282392113681 74.2786213247569 0.0 3 0.8519526503054691 3.1670314372901367 8136.0 20.887453416149068 0.0 - - - - - - - 241.7058823529412 16 17 STAG3L4 stromal antigen 3-like 4 1993 253 B20140408_SF107_03 B20140408_SF107_03 TB240229.[MT7]-TRMQDFWSLLTFSSDLVDVK[MT7].4y3_1.heavy 669.854 / 505.31 81364.0 42.99449920654297 41 11 10 10 10 1.346282392113681 74.2786213247569 0.0 3 0.8519526503054691 3.1670314372901367 81364.0 107.88793638368486 0.0 - - - - - - - 333.7142857142857 162 7 STAG3L4 stromal antigen 3-like 4 1995 253 B20140408_SF107_03 B20140408_SF107_03 TB240229.[MT7]-TRMQDFWSLLTFSSDLVDVK[MT7].4b6_1.heavy 669.854 / 923.453 4914.0 42.99449920654297 41 11 10 10 10 1.346282392113681 74.2786213247569 0.0 3 0.8519526503054691 3.1670314372901367 4914.0 21.06 0.0 - - - - - - - 216.5625 9 16 STAG3L4 stromal antigen 3-like 4 1997 254 B20140408_SF107_03 B20140408_SF107_03 TB240190.[MT7]-AIDIYEQVGTNAMDSPLLK[MT7].4y4_1.heavy 592.318 / 614.436 51952.0 36.075401306152344 46 16 10 10 10 2.7809307556505294 28.92236526763983 0.0 3 0.9671982698061613 6.795472436976689 51952.0 63.864272013949424 0.0 - - - - - - - 772.5714285714286 103 7 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 1999 254 B20140408_SF107_03 B20140408_SF107_03 TB240190.[MT7]-AIDIYEQVGTNAMDSPLLK[MT7].4b4_1.heavy 592.318 / 557.341 57688.0 36.075401306152344 46 16 10 10 10 2.7809307556505294 28.92236526763983 0.0 3 0.9671982698061613 6.795472436976689 57688.0 39.58276229537587 0.0 - - - - - - - 328.0 115 1 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 2001 254 B20140408_SF107_03 B20140408_SF107_03 TB240190.[MT7]-AIDIYEQVGTNAMDSPLLK[MT7].4b5_1.heavy 592.318 / 720.405 32286.0 36.075401306152344 46 16 10 10 10 2.7809307556505294 28.92236526763983 0.0 3 0.9671982698061613 6.795472436976689 32286.0 32.50871656036342 0.0 - - - - - - - 492.0 64 2 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 2003 254 B20140408_SF107_03 B20140408_SF107_03 TB240190.[MT7]-AIDIYEQVGTNAMDSPLLK[MT7].4b6_1.heavy 592.318 / 849.447 14422.0 36.075401306152344 46 16 10 10 10 2.7809307556505294 28.92236526763983 0.0 3 0.9671982698061613 6.795472436976689 14422.0 34.01710480609384 0.0 - - - - - - - 313.09090909090907 28 11 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 2005 255 B20140408_SF107_03 B20140408_SF107_03 TB377626.[MT7]-TVAELVQFLLVK[MT7].2b4_1.heavy 824.518 / 545.305 68676.0 44.14059829711914 44 14 10 10 10 1.863824478852667 46.628331862613315 0.0 3 0.9355782774936099 4.8360041790806925 68676.0 297.8917622739018 0.0 - - - - - - - 321.89473684210526 137 19 MAGEF1 melanoma antigen family F, 1 2007 255 B20140408_SF107_03 B20140408_SF107_03 TB377626.[MT7]-TVAELVQFLLVK[MT7].2y6_1.heavy 824.518 / 891.578 42024.0 44.14059829711914 44 14 10 10 10 1.863824478852667 46.628331862613315 0.0 3 0.9355782774936099 4.8360041790806925 42024.0 87.6934538539148 0.0 - - - - - - - 719.0 84 7 MAGEF1 melanoma antigen family F, 1 2009 255 B20140408_SF107_03 B20140408_SF107_03 TB377626.[MT7]-TVAELVQFLLVK[MT7].2b5_1.heavy 824.518 / 658.389 71463.0 44.14059829711914 44 14 10 10 10 1.863824478852667 46.628331862613315 0.0 3 0.9355782774936099 4.8360041790806925 71463.0 89.0467550677788 0.0 - - - - - - - 735.3636363636364 142 11 MAGEF1 melanoma antigen family F, 1 2011 255 B20140408_SF107_03 B20140408_SF107_03 TB377626.[MT7]-TVAELVQFLLVK[MT7].2y7_1.heavy 824.518 / 990.647 33889.0 44.14059829711914 44 14 10 10 10 1.863824478852667 46.628331862613315 0.0 3 0.9355782774936099 4.8360041790806925 33889.0 102.87796886701615 0.0 - - - - - - - 332.75 67 20 MAGEF1 melanoma antigen family F, 1 2013 256 B20140408_SF107_03 B20140408_SF107_03 TB497876.[MT7]-NTLSSR.2b3_1.heavy 411.234 / 473.284 7498.0 18.693174839019775 40 18 10 6 6 4.132332236849063 24.199409502526063 0.03750038146972656 5 0.9894181620169922 11.98665763806074 7498.0 4.893913072797486 5.0 - - - - - - - 1290.2857142857142 14 7 ARPC5L actin related protein 2/3 complex, subunit 5-like 2015 256 B20140408_SF107_03 B20140408_SF107_03 TB497876.[MT7]-NTLSSR.2y4_1.heavy 411.234 / 462.267 8100.0 18.693174839019775 40 18 10 6 6 4.132332236849063 24.199409502526063 0.03750038146972656 5 0.9894181620169922 11.98665763806074 8100.0 5.096752368064952 5.0 - - - - - - - 1288.7272727272727 18 11 ARPC5L actin related protein 2/3 complex, subunit 5-like 2017 256 B20140408_SF107_03 B20140408_SF107_03 TB497876.[MT7]-NTLSSR.2y5_1.heavy 411.234 / 563.315 30046.0 18.693174839019775 40 18 10 6 6 4.132332236849063 24.199409502526063 0.03750038146972656 5 0.9894181620169922 11.98665763806074 30046.0 64.08414021753971 0.0 - - - - - - - 687.0 60 9 ARPC5L actin related protein 2/3 complex, subunit 5-like 2019 256 B20140408_SF107_03 B20140408_SF107_03 TB497876.[MT7]-NTLSSR.2b4_1.heavy 411.234 / 560.316 6622.0 18.693174839019775 40 18 10 6 6 4.132332236849063 24.199409502526063 0.03750038146972656 5 0.9894181620169922 11.98665763806074 6622.0 14.065457102672292 0.0 - - - - - - - 618.3 13 10 ARPC5L actin related protein 2/3 complex, subunit 5-like 2021 257 B20140408_SF107_03 B20140408_SF107_03 TB377270.[MT7]-AQGVVLK[MT7].2y5_1.heavy 501.831 / 659.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARPC5L actin related protein 2/3 complex, subunit 5-like 2023 257 B20140408_SF107_03 B20140408_SF107_03 TB377270.[MT7]-AQGVVLK[MT7].2b4_1.heavy 501.831 / 500.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARPC5L actin related protein 2/3 complex, subunit 5-like 2025 257 B20140408_SF107_03 B20140408_SF107_03 TB377270.[MT7]-AQGVVLK[MT7].2y6_1.heavy 501.831 / 787.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARPC5L actin related protein 2/3 complex, subunit 5-like 2027 257 B20140408_SF107_03 B20140408_SF107_03 TB377270.[MT7]-AQGVVLK[MT7].2b5_1.heavy 501.831 / 599.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARPC5L actin related protein 2/3 complex, subunit 5-like 2029 258 B20140408_SF107_03 B20140408_SF107_03 TB240095.[MT7]-DSGDYPLTAPGLSWK[MT7].3y3_1.heavy 632.331 / 564.326 43379.0 33.542701721191406 43 13 10 10 10 1.5167375386220316 54.93335385066992 0.0 3 0.9107658685387453 4.100277090878264 43379.0 26.957158512786002 0.0 - - - - - - - 171.0 86 1 STAG3L4 stromal antigen 3-like 4 2031 258 B20140408_SF107_03 B20140408_SF107_03 TB240095.[MT7]-DSGDYPLTAPGLSWK[MT7].3y6_1.heavy 632.331 / 831.484 52638.0 33.542701721191406 43 13 10 10 10 1.5167375386220316 54.93335385066992 0.0 3 0.9107658685387453 4.100277090878264 52638.0 43.29601554021953 0.0 - - - - - - - 642.75 105 8 STAG3L4 stromal antigen 3-like 4 2033 258 B20140408_SF107_03 B20140408_SF107_03 TB240095.[MT7]-DSGDYPLTAPGLSWK[MT7].3b4_1.heavy 632.331 / 519.217 52981.0 33.542701721191406 43 13 10 10 10 1.5167375386220316 54.93335385066992 0.0 3 0.9107658685387453 4.100277090878264 52981.0 15.971919934338011 0.0 - - - - - - - 1715.0 105 1 STAG3L4 stromal antigen 3-like 4 2035 258 B20140408_SF107_03 B20140408_SF107_03 TB240095.[MT7]-DSGDYPLTAPGLSWK[MT7].3b5_1.heavy 632.331 / 682.28 89159.0 33.542701721191406 43 13 10 10 10 1.5167375386220316 54.93335385066992 0.0 3 0.9107658685387453 4.100277090878264 89159.0 48.95250463550394 0.0 - - - - - - - 628.3333333333334 178 3 STAG3L4 stromal antigen 3-like 4 2037 259 B20140408_SF107_03 B20140408_SF107_03 TB240223.[MT7]-GFEK[MT7]PTENSSAVLLQWHEK[MT7].4b8_2.heavy 658.858 / 596.316 17149.0 29.94300079345703 42 12 10 10 10 1.5121063283894383 58.842014720894454 0.0 3 0.8903305557651925 3.692055105122624 17149.0 13.874595469255663 0.0 - - - - - - - 401.4 34 5 ARPC5L actin related protein 2/3 complex, subunit 5-like 2039 259 B20140408_SF107_03 B20140408_SF107_03 TB240223.[MT7]-GFEK[MT7]PTENSSAVLLQWHEK[MT7].4b11_2.heavy 658.858 / 718.867 111239.0 29.94300079345703 42 12 10 10 10 1.5121063283894383 58.842014720894454 0.0 3 0.8903305557651925 3.692055105122624 111239.0 56.85154735725682 0.0 - - - - - - - 308.5 222 4 ARPC5L actin related protein 2/3 complex, subunit 5-like 2041 259 B20140408_SF107_03 B20140408_SF107_03 TB240223.[MT7]-GFEK[MT7]PTENSSAVLLQWHEK[MT7].4b4_1.heavy 658.858 / 750.439 14986.0 29.94300079345703 42 12 10 10 10 1.5121063283894383 58.842014720894454 0.0 3 0.8903305557651925 3.692055105122624 14986.0 10.77079681744604 0.0 - - - - - - - 1633.142857142857 29 7 ARPC5L actin related protein 2/3 complex, subunit 5-like 2043 259 B20140408_SF107_03 B20140408_SF107_03 TB240223.[MT7]-GFEK[MT7]PTENSSAVLLQWHEK[MT7].4y3_1.heavy 658.858 / 557.316 101660.0 29.94300079345703 42 12 10 10 10 1.5121063283894383 58.842014720894454 0.0 3 0.8903305557651925 3.692055105122624 101660.0 24.606371907909462 0.0 - - - - - - - 772.0 203 1 ARPC5L actin related protein 2/3 complex, subunit 5-like 2045 260 B20140408_SF107_03 B20140408_SF107_03 TB377729.[MT7]-DTLVHLFAGGC[CAM]GGTVGAILTC[CAM]PLEVVK[MT7].3b6_1.heavy 1024.89 / 823.479 5232.0 39.819698333740234 45 15 10 10 10 1.1598367366558082 56.18870958475987 0.0 3 0.9537514907973202 5.71643587139879 5232.0 15.76268454715532 0.0 - - - - - - - 250.0 10 10 SLC25A36 solute carrier family 25, member 36 2047 260 B20140408_SF107_03 B20140408_SF107_03 TB377729.[MT7]-DTLVHLFAGGC[CAM]GGTVGAILTC[CAM]PLEVVK[MT7].3b4_1.heavy 1024.89 / 573.336 11828.0 39.819698333740234 45 15 10 10 10 1.1598367366558082 56.18870958475987 0.0 3 0.9537514907973202 5.71643587139879 11828.0 23.345170178067118 0.0 - - - - - - - 341.1111111111111 23 9 SLC25A36 solute carrier family 25, member 36 2049 260 B20140408_SF107_03 B20140408_SF107_03 TB377729.[MT7]-DTLVHLFAGGC[CAM]GGTVGAILTC[CAM]PLEVVK[MT7].3b5_1.heavy 1024.89 / 710.395 5800.0 39.819698333740234 45 15 10 10 10 1.1598367366558082 56.18870958475987 0.0 3 0.9537514907973202 5.71643587139879 5800.0 33.4342010412495 0.0 - - - - - - - 208.5 11 12 SLC25A36 solute carrier family 25, member 36 2051 260 B20140408_SF107_03 B20140408_SF107_03 TB377729.[MT7]-DTLVHLFAGGC[CAM]GGTVGAILTC[CAM]PLEVVK[MT7].3y8_1.heavy 1024.89 / 1089.61 6596.0 39.819698333740234 45 15 10 10 10 1.1598367366558082 56.18870958475987 0.0 3 0.9537514907973202 5.71643587139879 6596.0 8.912797793604247 1.0 - - - - - - - 227.36363636363637 14 11 SLC25A36 solute carrier family 25, member 36 2053 261 B20140408_SF107_03 B20140408_SF107_03 TB239980.[MT7]-IIEAMGFTGPLK[MT7].2y4_1.heavy 782.954 / 558.373 N/A 35.767398834228516 32 10 4 10 8 0.7605199259009878 69.87010712205219 0.0 4 0.8355723569222138 3.000793682095551 16399.0 1.888636923994491 1.0 - - - - - - - 167.0 36 1 UQCC ubiquinol-cytochrome c reductase complex chaperone 2055 261 B20140408_SF107_03 B20140408_SF107_03 TB239980.[MT7]-IIEAMGFTGPLK[MT7].2y8_1.heavy 782.954 / 994.551 12048.0 35.767398834228516 32 10 4 10 8 0.7605199259009878 69.87010712205219 0.0 4 0.8355723569222138 3.000793682095551 12048.0 25.11612266700603 0.0 - - - - - - - 645.4285714285714 24 7 UQCC ubiquinol-cytochrome c reductase complex chaperone 2057 261 B20140408_SF107_03 B20140408_SF107_03 TB239980.[MT7]-IIEAMGFTGPLK[MT7].2b4_1.heavy 782.954 / 571.357 28781.0 35.767398834228516 32 10 4 10 8 0.7605199259009878 69.87010712205219 0.0 4 0.8355723569222138 3.000793682095551 28781.0 22.612978956814977 0.0 - - - - - - - 648.25 57 8 UQCC ubiquinol-cytochrome c reductase complex chaperone 2059 261 B20140408_SF107_03 B20140408_SF107_03 TB239980.[MT7]-IIEAMGFTGPLK[MT7].2y3_1.heavy 782.954 / 501.352 10709.0 35.767398834228516 32 10 4 10 8 0.7605199259009878 69.87010712205219 0.0 4 0.8355723569222138 3.000793682095551 10709.0 6.286165610958304 2.0 - - - - - - - 251.0 99 4 UQCC ubiquinol-cytochrome c reductase complex chaperone 2061 262 B20140408_SF107_03 B20140408_SF107_03 TB498097.[MT7]-AAAAWALGQIGR.3b6_1.heavy 443.59 / 686.374 156243.0 33.355201721191406 50 20 10 10 10 9.894953889821386 10.106161293269565 0.0 3 0.996856548965182 22.006206754497413 156243.0 129.39666149419085 0.0 - - - - - - - 285.0 312 3 SPAG6 sperm associated antigen 6 2063 262 B20140408_SF107_03 B20140408_SF107_03 TB498097.[MT7]-AAAAWALGQIGR.3y6_1.heavy 443.59 / 643.389 208780.0 33.355201721191406 50 20 10 10 10 9.894953889821386 10.106161293269565 0.0 3 0.996856548965182 22.006206754497413 208780.0 230.68607228397286 0.0 - - - - - - - 171.0 417 1 SPAG6 sperm associated antigen 6 2065 262 B20140408_SF107_03 B20140408_SF107_03 TB498097.[MT7]-AAAAWALGQIGR.3b5_1.heavy 443.59 / 615.337 139472.0 33.355201721191406 50 20 10 10 10 9.894953889821386 10.106161293269565 0.0 3 0.996856548965182 22.006206754497413 139472.0 96.74822510583665 0.0 - - - - - - - 342.0 278 1 SPAG6 sperm associated antigen 6 2067 262 B20140408_SF107_03 B20140408_SF107_03 TB498097.[MT7]-AAAAWALGQIGR.3y5_1.heavy 443.59 / 530.305 494227.0 33.355201721191406 50 20 10 10 10 9.894953889821386 10.106161293269565 0.0 3 0.996856548965182 22.006206754497413 494227.0 335.3570167246509 0.0 - - - - - - - 641.75 988 4 SPAG6 sperm associated antigen 6 2069 263 B20140408_SF107_03 B20140408_SF107_03 TB239682.[MT7]-TQGTDLK[MT7].2y5_1.heavy 525.805 / 677.395 18826.0 20.37660026550293 44 16 10 10 8 3.653992959040162 27.367321481174447 0.0 4 0.968581297043695 6.944237341664441 18826.0 26.110089973125604 0.0 - - - - - - - 692.0909090909091 37 11 C6orf142 chromosome 6 open reading frame 142 2071 263 B20140408_SF107_03 B20140408_SF107_03 TB239682.[MT7]-TQGTDLK[MT7].2y3_1.heavy 525.805 / 519.326 8879.0 20.37660026550293 44 16 10 10 8 3.653992959040162 27.367321481174447 0.0 4 0.968581297043695 6.944237341664441 8879.0 2.938018112156043 2.0 - - - - - - - 1735.4285714285713 17 7 C6orf142 chromosome 6 open reading frame 142 2073 263 B20140408_SF107_03 B20140408_SF107_03 TB239682.[MT7]-TQGTDLK[MT7].2y6_1.heavy 525.805 / 805.454 14353.0 20.37660026550293 44 16 10 10 8 3.653992959040162 27.367321481174447 0.0 4 0.968581297043695 6.944237341664441 14353.0 37.250701973756314 1.0 - - - - - - - 648.5714285714286 31 7 C6orf142 chromosome 6 open reading frame 142 2075 263 B20140408_SF107_03 B20140408_SF107_03 TB239682.[MT7]-TQGTDLK[MT7].2b5_1.heavy 525.805 / 647.312 51403.0 20.37660026550293 44 16 10 10 8 3.653992959040162 27.367321481174447 0.0 4 0.968581297043695 6.944237341664441 51403.0 58.91521409159628 0.0 - - - - - - - 1315.2 102 10 C6orf142 chromosome 6 open reading frame 142 2077 264 B20140408_SF107_03 B20140408_SF107_03 TB377721.[MT7]-ESEWK[MT7]GPFYFILGADPQFGLIK[MT7].3b9_2.heavy 992.207 / 706.858 16071.0 42.320499420166016 40 10 10 10 10 0.8806379364264738 75.70269677137944 0.0 3 0.847139477088241 3.115448513739035 16071.0 41.61812749003984 0.0 - - - - - - - 345.625 32 8 CPPED1 calcineurin-like phosphoesterase domain containing 1 2079 264 B20140408_SF107_03 B20140408_SF107_03 TB377721.[MT7]-ESEWK[MT7]GPFYFILGADPQFGLIK[MT7].3y7_1.heavy 992.207 / 946.584 14815.0 42.320499420166016 40 10 10 10 10 0.8806379364264738 75.70269677137944 0.0 3 0.847139477088241 3.115448513739035 14815.0 56.3643385103124 0.0 - - - - - - - 237.16666666666666 29 6 CPPED1 calcineurin-like phosphoesterase domain containing 1 2081 264 B20140408_SF107_03 B20140408_SF107_03 TB377721.[MT7]-ESEWK[MT7]GPFYFILGADPQFGLIK[MT7].3b10_2.heavy 992.207 / 780.392 26115.0 42.320499420166016 40 10 10 10 10 0.8806379364264738 75.70269677137944 0.0 3 0.847139477088241 3.115448513739035 26115.0 51.42609998621774 0.0 - - - - - - - 251.25 52 4 CPPED1 calcineurin-like phosphoesterase domain containing 1 2083 264 B20140408_SF107_03 B20140408_SF107_03 TB377721.[MT7]-ESEWK[MT7]GPFYFILGADPQFGLIK[MT7].3y10_1.heavy 992.207 / 1189.67 3767.0 42.320499420166016 40 10 10 10 10 0.8806379364264738 75.70269677137944 0.0 3 0.847139477088241 3.115448513739035 3767.0 -0.34152982595947423 2.0 - - - - - - - 195.5 10 6 CPPED1 calcineurin-like phosphoesterase domain containing 1 2085 265 B20140408_SF107_03 B20140408_SF107_03 TB377828.[MT7]-WVTYFNK[MT7]PDIDAWELRK[MT7].4y8_1.heavy 654.11 / 1174.67 6282.0 34.17129898071289 33 3 10 10 10 0.4235729539402644 120.75698384863459 0.0 3 0.5135250512404791 1.6920164064096908 6282.0 44.53369400218102 0.0 - - - - - - - 262.0 12 6 COX5A cytochrome c oxidase subunit Va 2087 265 B20140408_SF107_03 B20140408_SF107_03 TB377828.[MT7]-WVTYFNK[MT7]PDIDAWELRK[MT7].4y10_2.heavy 654.11 / 693.878 105406.0 34.17129898071289 33 3 10 10 10 0.4235729539402644 120.75698384863459 0.0 3 0.5135250512404791 1.6920164064096908 105406.0 56.29336276719168 0.0 - - - - - - - 233.0 210 3 COX5A cytochrome c oxidase subunit Va 2089 265 B20140408_SF107_03 B20140408_SF107_03 TB377828.[MT7]-WVTYFNK[MT7]PDIDAWELRK[MT7].4y3_1.heavy 654.11 / 560.4 17626.0 34.17129898071289 33 3 10 10 10 0.4235729539402644 120.75698384863459 0.0 3 0.5135250512404791 1.6920164064096908 17626.0 16.413896848137536 0.0 - - - - - - - 349.0 35 2 COX5A cytochrome c oxidase subunit Va 2091 265 B20140408_SF107_03 B20140408_SF107_03 TB377828.[MT7]-WVTYFNK[MT7]PDIDAWELRK[MT7].4y6_1.heavy 654.11 / 946.559 15532.0 34.17129898071289 33 3 10 10 10 0.4235729539402644 120.75698384863459 0.0 3 0.5135250512404791 1.6920164064096908 15532.0 22.249316132844775 0.0 - - - - - - - 567.5 31 8 COX5A cytochrome c oxidase subunit Va 2093 266 B20140408_SF107_03 B20140408_SF107_03 TB377829.[MT7]-SSEIEQAVQSLDRNGVDLLMK[MT7].4b4_1.heavy 655.852 / 561.3 19655.0 37.53129959106445 50 20 10 10 10 8.067177479067356 12.39590925816113 0.0 3 0.996250542292077 20.148482818551713 19655.0 26.223328264299973 0.0 - - - - - - - 1271.0 39 7 ARPC5L actin related protein 2/3 complex, subunit 5-like 2095 266 B20140408_SF107_03 B20140408_SF107_03 TB377829.[MT7]-SSEIEQAVQSLDRNGVDLLMK[MT7].4b5_1.heavy 655.852 / 690.343 16999.0 37.53129959106445 50 20 10 10 10 8.067177479067356 12.39590925816113 0.0 3 0.996250542292077 20.148482818551713 16999.0 24.647300090392736 0.0 - - - - - - - 786.7692307692307 33 13 ARPC5L actin related protein 2/3 complex, subunit 5-like 2097 266 B20140408_SF107_03 B20140408_SF107_03 TB377829.[MT7]-SSEIEQAVQSLDRNGVDLLMK[MT7].4y3_1.heavy 655.852 / 535.339 12616.0 37.53129959106445 50 20 10 10 10 8.067177479067356 12.39590925816113 0.0 3 0.996250542292077 20.148482818551713 12616.0 5.008381556841515 1.0 - - - - - - - 723.1111111111111 29 9 ARPC5L actin related protein 2/3 complex, subunit 5-like 2099 266 B20140408_SF107_03 B20140408_SF107_03 TB377829.[MT7]-SSEIEQAVQSLDRNGVDLLMK[MT7].4b6_1.heavy 655.852 / 818.401 16468.0 37.53129959106445 50 20 10 10 10 8.067177479067356 12.39590925816113 0.0 3 0.996250542292077 20.148482818551713 16468.0 30.45001689259937 0.0 - - - - - - - 331.8333333333333 32 6 ARPC5L actin related protein 2/3 complex, subunit 5-like 2101 267 B20140408_SF107_03 B20140408_SF107_03 TB240199.[MT7]-EIYPYVIQELRPTLNELGISTPEELGLDK[MT7].3y5_1.heavy 1206.66 / 689.431 1687.0 41.388548851013184 33 8 10 5 10 1.4658852128599729 68.2181654625589 0.044200897216796875 3 0.7671638246113884 2.506258217696197 1687.0 11.713056872037914 0.0 - - - - - - - 240.85714285714286 3 7 COX5A cytochrome c oxidase subunit Va 2103 267 B20140408_SF107_03 B20140408_SF107_03 TB240199.[MT7]-EIYPYVIQELRPTLNELGISTPEELGLDK[MT7].3y10_1.heavy 1206.66 / 1232.65 1476.0 41.388548851013184 33 8 10 5 10 1.4658852128599729 68.2181654625589 0.044200897216796875 3 0.7671638246113884 2.506258217696197 1476.0 6.436436234790507 1.0 - - - - - - - 256.0 2 7 COX5A cytochrome c oxidase subunit Va 2105 267 B20140408_SF107_03 B20140408_SF107_03 TB240199.[MT7]-EIYPYVIQELRPTLNELGISTPEELGLDK[MT7].3b3_1.heavy 1206.66 / 550.299 14444.0 41.388548851013184 33 8 10 5 10 1.4658852128599729 68.2181654625589 0.044200897216796875 3 0.7671638246113884 2.506258217696197 14444.0 33.41138790035587 0.0 - - - - - - - 707.8571428571429 28 7 COX5A cytochrome c oxidase subunit Va 2107 267 B20140408_SF107_03 B20140408_SF107_03 TB240199.[MT7]-EIYPYVIQELRPTLNELGISTPEELGLDK[MT7].3y4_1.heavy 1206.66 / 576.347 3479.0 41.388548851013184 33 8 10 5 10 1.4658852128599729 68.2181654625589 0.044200897216796875 3 0.7671638246113884 2.506258217696197 3479.0 11.87522361214781 0.0 - - - - - - - 245.88888888888889 6 9 COX5A cytochrome c oxidase subunit Va 2109 268 B20140408_SF107_03 B20140408_SF107_03 TB377264.[MT7]-HTPEHAR.2y4_1.heavy 496.263 / 512.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPAG6 sperm associated antigen 6 2111 268 B20140408_SF107_03 B20140408_SF107_03 TB377264.[MT7]-HTPEHAR.2y6_1.heavy 496.263 / 710.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPAG6 sperm associated antigen 6 2113 268 B20140408_SF107_03 B20140408_SF107_03 TB377264.[MT7]-HTPEHAR.2b5_1.heavy 496.263 / 746.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPAG6 sperm associated antigen 6 2115 269 B20140408_SF107_03 B20140408_SF107_03 TB377635.[MT7]-FFTFEQYK[MT7]K[MT7].3y6_2.heavy 557.315 / 565.826 28475.0 31.310699462890625 41 11 10 10 10 6.002855585274137 16.658738258723783 0.0 3 0.8627171148107596 3.291968982608418 28475.0 69.32539078739504 0.0 - - - - - - - 316.4 56 5 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2117 269 B20140408_SF107_03 B20140408_SF107_03 TB377635.[MT7]-FFTFEQYK[MT7]K[MT7].3y3_1.heavy 557.315 / 726.475 22464.0 31.310699462890625 41 11 10 10 10 6.002855585274137 16.658738258723783 0.0 3 0.8627171148107596 3.291968982608418 22464.0 25.82205007085498 0.0 - - - - - - - 316.25 44 4 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2119 269 B20140408_SF107_03 B20140408_SF107_03 TB377635.[MT7]-FFTFEQYK[MT7]K[MT7].3y7_2.heavy 557.315 / 616.35 46826.0 31.310699462890625 41 11 10 10 10 6.002855585274137 16.658738258723783 0.0 3 0.8627171148107596 3.291968982608418 46826.0 21.14358819987959 0.0 - - - - - - - 316.0 93 1 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2121 269 B20140408_SF107_03 B20140408_SF107_03 TB377635.[MT7]-FFTFEQYK[MT7]K[MT7].3y8_2.heavy 557.315 / 689.884 83527.0 31.310699462890625 41 11 10 10 10 6.002855585274137 16.658738258723783 0.0 3 0.8627171148107596 3.291968982608418 83527.0 87.52031092793017 0.0 - - - - - - - 395.75 167 4 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2123 270 B20140408_SF107_03 B20140408_SF107_03 TB377637.[MT7]-NTFAEQPSTVGYAR.3y7_1.heavy 562.285 / 753.389 18486.0 26.274499893188477 44 14 10 10 10 2.2209425798032334 35.51925333092337 0.0 3 0.9486185434517055 5.421030340341929 18486.0 7.60451541267911 1.0 - - - - - - - 320.0 37 4 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2125 270 B20140408_SF107_03 B20140408_SF107_03 TB377637.[MT7]-NTFAEQPSTVGYAR.3b4_1.heavy 562.285 / 578.305 57450.0 26.274499893188477 44 14 10 10 10 2.2209425798032334 35.51925333092337 0.0 3 0.9486185434517055 5.421030340341929 57450.0 48.12311463527253 0.0 - - - - - - - 332.0 114 3 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2127 270 B20140408_SF107_03 B20140408_SF107_03 TB377637.[MT7]-NTFAEQPSTVGYAR.3b3_1.heavy 562.285 / 507.268 31285.0 26.274499893188477 44 14 10 10 10 2.2209425798032334 35.51925333092337 0.0 3 0.9486185434517055 5.421030340341929 31285.0 17.103247371781443 0.0 - - - - - - - 427.0 62 1 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2129 270 B20140408_SF107_03 B20140408_SF107_03 TB377637.[MT7]-NTFAEQPSTVGYAR.3y8_1.heavy 562.285 / 850.442 49060.0 26.274499893188477 44 14 10 10 10 2.2209425798032334 35.51925333092337 0.0 3 0.9486185434517055 5.421030340341929 49060.0 25.2006512636618 0.0 - - - - - - - 1665.7142857142858 98 7 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2131 271 B20140408_SF107_03 B20140408_SF107_03 TB377837.[MT7]-C[CAM]K[MT7]LDDDMNLLDIFIEMEK[MT7].4y4_1.heavy 669.343 / 680.341 4678.0 42.4552001953125 42 12 10 10 10 2.3692087922991156 33.37633773493024 0.0 3 0.891043345583483 3.7043413177980336 4678.0 8.64495817538868 0.0 - - - - - - - 728.75 9 8 CASP8 caspase 8, apoptosis-related cysteine peptidase 2133 271 B20140408_SF107_03 B20140408_SF107_03 TB377837.[MT7]-C[CAM]K[MT7]LDDDMNLLDIFIEMEK[MT7].4b8_2.heavy 669.343 / 640.796 8126.0 42.4552001953125 42 12 10 10 10 2.3692087922991156 33.37633773493024 0.0 3 0.891043345583483 3.7043413177980336 8126.0 5.6383155728285175 0.0 - - - - - - - 797.5714285714286 16 7 CASP8 caspase 8, apoptosis-related cysteine peptidase 2135 271 B20140408_SF107_03 B20140408_SF107_03 TB377837.[MT7]-C[CAM]K[MT7]LDDDMNLLDIFIEMEK[MT7].4b11_2.heavy 669.343 / 811.394 9275.0 42.4552001953125 42 12 10 10 10 2.3692087922991156 33.37633773493024 0.0 3 0.891043345583483 3.7043413177980336 9275.0 16.773879598662205 0.0 - - - - - - - 191.33333333333334 18 3 CASP8 caspase 8, apoptosis-related cysteine peptidase 2137 271 B20140408_SF107_03 B20140408_SF107_03 TB377837.[MT7]-C[CAM]K[MT7]LDDDMNLLDIFIEMEK[MT7].4b6_2.heavy 669.343 / 518.255 2052.0 42.4552001953125 42 12 10 10 10 2.3692087922991156 33.37633773493024 0.0 3 0.891043345583483 3.7043413177980336 2052.0 3.403341297501047 4.0 - - - - - - - 732.1666666666666 4 12 CASP8 caspase 8, apoptosis-related cysteine peptidase 2139 272 B20140408_SF107_03 B20140408_SF107_03 TB377502.[MT7]-ILIYGNISFR.2y8_1.heavy 670.396 / 969.515 7996.0 35.92449951171875 42 14 10 10 8 2.18584542262174 36.201106142395965 0.0 4 0.9486910880967279 5.42489475622453 7996.0 3.0193373961873022 1.0 - - - - - - - 240.0 29 2 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 2141 272 B20140408_SF107_03 B20140408_SF107_03 TB377502.[MT7]-ILIYGNISFR.2y9_1.heavy 670.396 / 1082.6 11194.0 35.92449951171875 42 14 10 10 8 2.18584542262174 36.201106142395965 0.0 4 0.9486910880967279 5.42489475622453 11194.0 8.353541869073354 1.0 - - - - - - - 320.0 29 2 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 2143 272 B20140408_SF107_03 B20140408_SF107_03 TB377502.[MT7]-ILIYGNISFR.2y6_1.heavy 670.396 / 693.368 9435.0 35.92449951171875 42 14 10 10 8 2.18584542262174 36.201106142395965 0.0 4 0.9486910880967279 5.42489475622453 9435.0 7.7878852037505855 0.0 - - - - - - - 352.0 18 5 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 2145 272 B20140408_SF107_03 B20140408_SF107_03 TB377502.[MT7]-ILIYGNISFR.2y7_1.heavy 670.396 / 856.431 14073.0 35.92449951171875 42 14 10 10 8 2.18584542262174 36.201106142395965 0.0 4 0.9486910880967279 5.42489475622453 14073.0 15.970071592186764 0.0 - - - - - - - 256.0 28 5 RMI1 RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) 2147 273 B20140408_SF107_03 B20140408_SF107_03 TB377250.[MT7]-SLVDSFR.2y4_1.heavy 484.27 / 524.246 41650.0 29.861099243164062 44 14 10 10 10 1.7438008463825208 48.224876268328735 0.0 3 0.9313916949474995 4.684456076964506 41650.0 55.61393323657475 0.0 - - - - - - - 459.0 83 4 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2149 273 B20140408_SF107_03 B20140408_SF107_03 TB377250.[MT7]-SLVDSFR.2y5_1.heavy 484.27 / 623.315 42416.0 29.861099243164062 44 14 10 10 10 1.7438008463825208 48.224876268328735 0.0 3 0.9313916949474995 4.684456076964506 42416.0 34.45039364544746 0.0 - - - - - - - 306.0 84 1 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2151 273 B20140408_SF107_03 B20140408_SF107_03 TB377250.[MT7]-SLVDSFR.2b4_1.heavy 484.27 / 559.321 148379.0 29.861099243164062 44 14 10 10 10 1.7438008463825208 48.224876268328735 0.0 3 0.9313916949474995 4.684456076964506 148379.0 64.94851478298446 0.0 - - - - - - - 1072.0 296 1 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2153 273 B20140408_SF107_03 B20140408_SF107_03 TB377250.[MT7]-SLVDSFR.2y6_1.heavy 484.27 / 736.399 78248.0 29.861099243164062 44 14 10 10 10 1.7438008463825208 48.224876268328735 0.0 3 0.9313916949474995 4.684456076964506 78248.0 68.61312962965172 0.0 - - - - - - - 218.57142857142858 156 7 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2155 274 B20140408_SF107_03 B20140408_SF107_03 TB240075.[MT7]-K[MT7]ADPQEAINC[CAM]LMR.3y7_1.heavy 611.99 / 877.438 56668.0 30.146299362182617 50 20 10 10 10 5.918495329093788 16.89618635135622 0.0 3 0.9939166758469978 15.815083222821142 56668.0 106.4791357607871 0.0 - - - - - - - 832.125 113 8 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 2157 274 B20140408_SF107_03 B20140408_SF107_03 TB240075.[MT7]-K[MT7]ADPQEAINC[CAM]LMR.3b3_1.heavy 611.99 / 603.37 191371.0 30.146299362182617 50 20 10 10 10 5.918495329093788 16.89618635135622 0.0 3 0.9939166758469978 15.815083222821142 191371.0 35.249111919440004 0.0 - - - - - - - 3251.0 382 1 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 2159 274 B20140408_SF107_03 B20140408_SF107_03 TB240075.[MT7]-K[MT7]ADPQEAINC[CAM]LMR.3y5_1.heavy 611.99 / 693.317 92279.0 30.146299362182617 50 20 10 10 10 5.918495329093788 16.89618635135622 0.0 3 0.9939166758469978 15.815083222821142 92279.0 82.70448878300031 0.0 - - - - - - - 670.6666666666666 184 3 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 2161 274 B20140408_SF107_03 B20140408_SF107_03 TB240075.[MT7]-K[MT7]ADPQEAINC[CAM]LMR.3y10_1.heavy 611.99 / 1231.59 N/A 30.146299362182617 50 20 10 10 10 5.918495329093788 16.89618635135622 0.0 3 0.9939166758469978 15.815083222821142 1703.0 14.143992769744159 0.0 - - - - - - - 193.625 3 8 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 2163 275 B20140408_SF107_03 B20140408_SF107_03 TB377644.[MT7]-LRLEEEALYAAQR.3b6_1.heavy 569.317 / 914.506 231356.0 30.48040008544922 43 13 10 10 10 2.022572245089855 43.419124222184514 0.0 3 0.929031992397881 4.604988597558703 231356.0 458.3649467013573 0.0 - - - - - - - 354.25 462 4 AP1AR adaptor-related protein complex 1 associated regulatory protein 2165 275 B20140408_SF107_03 B20140408_SF107_03 TB377644.[MT7]-LRLEEEALYAAQR.3b5_1.heavy 569.317 / 785.464 87663.0 30.48040008544922 43 13 10 10 10 2.022572245089855 43.419124222184514 0.0 3 0.929031992397881 4.604988597558703 87663.0 83.97388509019366 0.0 - - - - - - - 315.0 175 1 AP1AR adaptor-related protein complex 1 associated regulatory protein 2167 275 B20140408_SF107_03 B20140408_SF107_03 TB377644.[MT7]-LRLEEEALYAAQR.3b7_1.heavy 569.317 / 985.544 355375.0 30.48040008544922 43 13 10 10 10 2.022572245089855 43.419124222184514 0.0 3 0.929031992397881 4.604988597558703 355375.0 483.7123031966451 0.0 - - - - - - - 314.8 710 5 AP1AR adaptor-related protein complex 1 associated regulatory protein 2169 275 B20140408_SF107_03 B20140408_SF107_03 TB377644.[MT7]-LRLEEEALYAAQR.3y5_1.heavy 569.317 / 608.315 1483780.0 30.48040008544922 43 13 10 10 10 2.022572245089855 43.419124222184514 0.0 3 0.929031992397881 4.604988597558703 1483780.0 1061.4232182798066 0.0 - - - - - - - 315.0 2967 1 AP1AR adaptor-related protein complex 1 associated regulatory protein 2171 276 B20140408_SF107_03 B20140408_SF107_03 TB240076.[MT7]-NSQSFFSGLFGGSSK[MT7].3y6_1.heavy 613.316 / 726.39 39604.0 36.96329879760742 48 18 10 10 10 4.591595431012274 21.778922272765172 0.0 3 0.9861017819817763 10.456311914325516 39604.0 74.41213815772419 0.0 - - - - - - - 320.55555555555554 79 9 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 2173 276 B20140408_SF107_03 B20140408_SF107_03 TB240076.[MT7]-NSQSFFSGLFGGSSK[MT7].3b4_1.heavy 613.316 / 561.275 24692.0 36.96329879760742 48 18 10 10 10 4.591595431012274 21.778922272765172 0.0 3 0.9861017819817763 10.456311914325516 24692.0 34.223146223146216 0.0 - - - - - - - 785.6 49 10 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 2175 276 B20140408_SF107_03 B20140408_SF107_03 TB240076.[MT7]-NSQSFFSGLFGGSSK[MT7].3b5_1.heavy 613.316 / 708.343 22768.0 36.96329879760742 48 18 10 10 10 4.591595431012274 21.778922272765172 0.0 3 0.9861017819817763 10.456311914325516 22768.0 54.22304239401496 0.0 - - - - - - - 801.7142857142857 45 7 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 2177 276 B20140408_SF107_03 B20140408_SF107_03 TB240076.[MT7]-NSQSFFSGLFGGSSK[MT7].3y5_1.heavy 613.316 / 579.322 81453.0 36.96329879760742 48 18 10 10 10 4.591595431012274 21.778922272765172 0.0 3 0.9861017819817763 10.456311914325516 81453.0 82.95848631533025 0.0 - - - - - - - 847.5714285714286 162 7 NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha 2179 277 B20140408_SF107_03 B20140408_SF107_03 TB240074.[MT7]-LTC[CAM]PSEVSGTILQER.2b3_1.heavy 917.478 / 519.272 18273.0 30.664199829101562 32 7 10 5 10 0.6655171769453372 91.86984806008584 0.041599273681640625 3 0.7491125617105372 2.410426363926416 18273.0 61.526887747911005 0.0 - - - - - - - 332.8888888888889 36 9 C6orf142 chromosome 6 open reading frame 142 2181 277 B20140408_SF107_03 B20140408_SF107_03 TB240074.[MT7]-LTC[CAM]PSEVSGTILQER.2y8_1.heavy 917.478 / 903.489 8979.0 30.664199829101562 32 7 10 5 10 0.6655171769453372 91.86984806008584 0.041599273681640625 3 0.7491125617105372 2.410426363926416 8979.0 18.0472281041012 0.0 - - - - - - - 765.1428571428571 17 7 C6orf142 chromosome 6 open reading frame 142 2183 277 B20140408_SF107_03 B20140408_SF107_03 TB240074.[MT7]-LTC[CAM]PSEVSGTILQER.2y9_1.heavy 917.478 / 1002.56 3781.0 30.664199829101562 32 7 10 5 10 0.6655171769453372 91.86984806008584 0.041599273681640625 3 0.7491125617105372 2.410426363926416 3781.0 17.596197187825098 0.0 - - - - - - - 192.88888888888889 7 9 C6orf142 chromosome 6 open reading frame 142 2185 277 B20140408_SF107_03 B20140408_SF107_03 TB240074.[MT7]-LTC[CAM]PSEVSGTILQER.2y11_1.heavy 917.478 / 1218.63 2363.0 30.664199829101562 32 7 10 5 10 0.6655171769453372 91.86984806008584 0.041599273681640625 3 0.7491125617105372 2.410426363926416 2363.0 20.508295157725538 0.0 - - - - - - - 252.4 4 5 C6orf142 chromosome 6 open reading frame 142 2187 278 B20140408_SF107_03 B20140408_SF107_03 TB377647.[MT7]-WHLDEVFLELK[MT7].2y4_1.heavy 858.982 / 646.426 5413.0 37.70240020751953 42 12 10 10 10 0.8297456643825779 69.11038388825087 0.0 3 0.8843578114674701 3.5935799985825922 5413.0 7.177024586730857 0.0 - - - - - - - 731.5555555555555 10 9 C7orf44 chromosome 7 open reading frame 44 2189 278 B20140408_SF107_03 B20140408_SF107_03 TB377647.[MT7]-WHLDEVFLELK[MT7].2y8_1.heavy 858.982 / 1136.63 4828.0 37.70240020751953 42 12 10 10 10 0.8297456643825779 69.11038388825087 0.0 3 0.8843578114674701 3.5935799985825922 4828.0 6.067887976274516 1.0 - - - - - - - 227.44444444444446 14 9 C7orf44 chromosome 7 open reading frame 44 2191 278 B20140408_SF107_03 B20140408_SF107_03 TB377647.[MT7]-WHLDEVFLELK[MT7].2y5_1.heavy 858.982 / 793.494 7754.0 37.70240020751953 42 12 10 10 10 0.8297456643825779 69.11038388825087 0.0 3 0.8843578114674701 3.5935799985825922 7754.0 12.367028405661664 0.0 - - - - - - - 705.0909090909091 15 11 C7orf44 chromosome 7 open reading frame 44 2193 278 B20140408_SF107_03 B20140408_SF107_03 TB377647.[MT7]-WHLDEVFLELK[MT7].2b4_1.heavy 858.982 / 696.359 11558.0 37.70240020751953 42 12 10 10 10 0.8297456643825779 69.11038388825087 0.0 3 0.8843578114674701 3.5935799985825922 11558.0 16.783869962431694 0.0 - - - - - - - 804.875 23 8 C7orf44 chromosome 7 open reading frame 44 2195 279 B20140408_SF107_03 B20140408_SF107_03 TB377840.[MT7]-QIVAGGSAGLVEIC[CAM]LMHPLDVVK[MT7].3b9_1.heavy 898.836 / 885.491 11513.0 37.23540115356445 44 14 10 10 10 2.679216796146421 37.324340510193984 0.0 3 0.9466840902526734 5.320901848083421 11513.0 33.690482813852896 0.0 - - - - - - - 295.5 23 8 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2197 279 B20140408_SF107_03 B20140408_SF107_03 TB377840.[MT7]-QIVAGGSAGLVEIC[CAM]LMHPLDVVK[MT7].3y6_1.heavy 898.836 / 814.516 43837.0 37.23540115356445 44 14 10 10 10 2.679216796146421 37.324340510193984 0.0 3 0.9466840902526734 5.320901848083421 43837.0 53.796232237926574 0.0 - - - - - - - 246.33333333333334 87 3 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2199 279 B20140408_SF107_03 B20140408_SF107_03 TB377840.[MT7]-QIVAGGSAGLVEIC[CAM]LMHPLDVVK[MT7].3b10_1.heavy 898.836 / 998.575 9151.0 37.23540115356445 44 14 10 10 10 2.679216796146421 37.324340510193984 0.0 3 0.9466840902526734 5.320901848083421 9151.0 10.846176385700605 1.0 - - - - - - - 276.75 18 8 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2201 279 B20140408_SF107_03 B20140408_SF107_03 TB377840.[MT7]-QIVAGGSAGLVEIC[CAM]LMHPLDVVK[MT7].3y8_1.heavy 898.836 / 1082.61 4428.0 37.23540115356445 44 14 10 10 10 2.679216796146421 37.324340510193984 0.0 3 0.9466840902526734 5.320901848083421 4428.0 8.69864559819413 0.0 - - - - - - - 344.44444444444446 8 9 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2203 280 B20140408_SF107_03 B20140408_SF107_03 TB377843.[MT7]-APVNTAELTDLLIQQNHIGSVIK[MT7].4y5_1.heavy 691.397 / 647.421 48294.0 36.71580123901367 50 20 10 10 10 7.355398118027819 13.595457158859093 0.0 3 0.9906680171301624 12.765478199309047 48294.0 9.348819643361633 0.0 - - - - - - - 766.5 96 2 BCCIP BRCA2 and CDKN1A interacting protein 2205 280 B20140408_SF107_03 B20140408_SF107_03 TB377843.[MT7]-APVNTAELTDLLIQQNHIGSVIK[MT7].4b7_1.heavy 691.397 / 827.438 56113.0 36.71580123901367 50 20 10 10 10 7.355398118027819 13.595457158859093 0.0 3 0.9906680171301624 12.765478199309047 56113.0 18.580892218611385 0.0 - - - - - - - 307.0 112 3 BCCIP BRCA2 and CDKN1A interacting protein 2207 280 B20140408_SF107_03 B20140408_SF107_03 TB377843.[MT7]-APVNTAELTDLLIQQNHIGSVIK[MT7].4b4_1.heavy 691.397 / 526.311 31583.0 36.71580123901367 50 20 10 10 10 7.355398118027819 13.595457158859093 0.0 3 0.9906680171301624 12.765478199309047 31583.0 16.06663633321612 0.0 - - - - - - - 358.0 63 3 BCCIP BRCA2 and CDKN1A interacting protein 2209 280 B20140408_SF107_03 B20140408_SF107_03 TB377843.[MT7]-APVNTAELTDLLIQQNHIGSVIK[MT7].4b6_1.heavy 691.397 / 698.395 31123.0 36.71580123901367 50 20 10 10 10 7.355398118027819 13.595457158859093 0.0 3 0.9906680171301624 12.765478199309047 31123.0 19.811329223095214 0.0 - - - - - - - 460.0 62 1 BCCIP BRCA2 and CDKN1A interacting protein 2211 281 B20140408_SF107_03 B20140408_SF107_03 TB377844.[MT7]-GMSASYAGISETVIHFVIYESIK[MT7].4b8_1.heavy 698.371 / 869.394 6068.0 43.535499572753906 47 17 10 10 10 2.2019527911338654 31.20075182490322 0.0 3 0.9731045457346332 7.508353534202658 6068.0 57.417845291962934 0.0 - - - - - - - 243.76190476190476 12 21 SLC25A36 solute carrier family 25, member 36 2213 281 B20140408_SF107_03 B20140408_SF107_03 TB377844.[MT7]-GMSASYAGISETVIHFVIYESIK[MT7].4y5_1.heavy 698.371 / 783.437 3666.0 43.535499572753906 47 17 10 10 10 2.2019527911338654 31.20075182490322 0.0 3 0.9731045457346332 7.508353534202658 3666.0 20.96149732620321 0.0 - - - - - - - 219.42105263157896 7 19 SLC25A36 solute carrier family 25, member 36 2215 281 B20140408_SF107_03 B20140408_SF107_03 TB377844.[MT7]-GMSASYAGISETVIHFVIYESIK[MT7].4b5_1.heavy 698.371 / 578.273 4678.0 43.535499572753906 47 17 10 10 10 2.2019527911338654 31.20075182490322 0.0 3 0.9731045457346332 7.508353534202658 4678.0 18.490118577075098 0.0 - - - - - - - 214.16666666666666 9 18 SLC25A36 solute carrier family 25, member 36 2217 281 B20140408_SF107_03 B20140408_SF107_03 TB377844.[MT7]-GMSASYAGISETVIHFVIYESIK[MT7].4b6_1.heavy 698.371 / 741.336 2718.0 43.535499572753906 47 17 10 10 10 2.2019527911338654 31.20075182490322 0.0 3 0.9731045457346332 7.508353534202658 2718.0 17.18893280632411 0.0 - - - - - - - 192.89473684210526 5 19 SLC25A36 solute carrier family 25, member 36 2219 282 B20140408_SF107_03 B20140408_SF107_03 TB498297.[MT7]-NMIPVNK[MT7]DPILEFWRK[MT7].4b8_2.heavy 608.852 / 600.836 23883.0 35.083866119384766 35 12 10 3 10 0.8114935358932981 80.62609499098464 0.05419921875 3 0.8810342982896505 3.542002498599571 23883.0 22.73488674754477 0.0 - - - - - - - 230.66666666666666 47 3 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2221 282 B20140408_SF107_03 B20140408_SF107_03 TB498297.[MT7]-NMIPVNK[MT7]DPILEFWRK[MT7].4y8_1.heavy 608.852 / 1232.73 N/A 35.083866119384766 35 12 10 3 10 0.8114935358932981 80.62609499098464 0.05419921875 3 0.8810342982896505 3.542002498599571 0.0 0.0 10.0 - - - - - - - 0.0 0 0 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2223 282 B20140408_SF107_03 B20140408_SF107_03 TB498297.[MT7]-NMIPVNK[MT7]DPILEFWRK[MT7].4y6_1.heavy 608.852 / 1022.59 5711.0 35.083866119384766 35 12 10 3 10 0.8114935358932981 80.62609499098464 0.05419921875 3 0.8810342982896505 3.542002498599571 5711.0 21.734811560693643 0.0 - - - - - - - 259.5 11 12 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2225 282 B20140408_SF107_03 B20140408_SF107_03 TB498297.[MT7]-NMIPVNK[MT7]DPILEFWRK[MT7].4b3_1.heavy 608.852 / 503.277 30114.0 35.083866119384766 35 12 10 3 10 0.8114935358932981 80.62609499098464 0.05419921875 3 0.8810342982896505 3.542002498599571 30114.0 43.21710795647739 0.0 - - - - - - - 259.5 60 2 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2227 283 B20140408_SF107_03 B20140408_SF107_03 TB377642.[MT7]-QVLQVFEQYQK[MT7].3y3_1.heavy 566.654 / 582.337 493924.0 33.11289978027344 48 18 10 10 10 3.0303820382703464 26.18294964630725 0.0 3 0.982619689687729 9.347652914255129 493924.0 336.266948927198 0.0 - - - - - - - 646.25 987 4 SPAG6 sperm associated antigen 6 2229 283 B20140408_SF107_03 B20140408_SF107_03 TB377642.[MT7]-QVLQVFEQYQK[MT7].3b4_1.heavy 566.654 / 613.379 794179.0 33.11289978027344 48 18 10 10 10 3.0303820382703464 26.18294964630725 0.0 3 0.982619689687729 9.347652914255129 794179.0 503.9885600996057 0.0 - - - - - - - 862.0 1588 1 SPAG6 sperm associated antigen 6 2231 283 B20140408_SF107_03 B20140408_SF107_03 TB377642.[MT7]-QVLQVFEQYQK[MT7].3b5_1.heavy 566.654 / 712.447 493752.0 33.11289978027344 48 18 10 10 10 3.0303820382703464 26.18294964630725 0.0 3 0.982619689687729 9.347652914255129 493752.0 528.1951500235765 0.0 - - - - - - - 287.3333333333333 987 3 SPAG6 sperm associated antigen 6 2233 283 B20140408_SF107_03 B20140408_SF107_03 TB377642.[MT7]-QVLQVFEQYQK[MT7].3y4_1.heavy 566.654 / 710.395 170099.0 33.11289978027344 48 18 10 10 10 3.0303820382703464 26.18294964630725 0.0 3 0.982619689687729 9.347652914255129 170099.0 259.51840008167767 0.0 - - - - - - - 172.0 340 1 SPAG6 sperm associated antigen 6 2235 284 B20140408_SF107_03 B20140408_SF107_03 TB239962.[MT7]-LDQWLTTMLLR.2b3_1.heavy 767.433 / 501.279 38478.0 43.112300872802734 48 18 10 10 10 6.199334118085318 16.130764707175565 0.0 3 0.9826985928748958 9.369005683678365 38478.0 76.44416025554506 0.0 - - - - - - - 660.2857142857143 76 7 NAPB;NAPA N-ethylmaleimide-sensitive factor attachment protein, beta;N-ethylmaleimide-sensitive factor attachment protein, alpha 2237 284 B20140408_SF107_03 B20140408_SF107_03 TB239962.[MT7]-LDQWLTTMLLR.2y8_1.heavy 767.433 / 1033.59 25811.0 43.112300872802734 48 18 10 10 10 6.199334118085318 16.130764707175565 0.0 3 0.9826985928748958 9.369005683678365 25811.0 71.38326178330563 0.0 - - - - - - - 247.3684210526316 51 19 NAPB;NAPA N-ethylmaleimide-sensitive factor attachment protein, beta;N-ethylmaleimide-sensitive factor attachment protein, alpha 2239 284 B20140408_SF107_03 B20140408_SF107_03 TB239962.[MT7]-LDQWLTTMLLR.2y9_1.heavy 767.433 / 1161.64 25413.0 43.112300872802734 48 18 10 10 10 6.199334118085318 16.130764707175565 0.0 3 0.9826985928748958 9.369005683678365 25413.0 123.33409201871032 0.0 - - - - - - - 304.52941176470586 50 17 NAPB;NAPA N-ethylmaleimide-sensitive factor attachment protein, beta;N-ethylmaleimide-sensitive factor attachment protein, alpha 2241 284 B20140408_SF107_03 B20140408_SF107_03 TB239962.[MT7]-LDQWLTTMLLR.2y7_1.heavy 767.433 / 847.507 38000.0 43.112300872802734 48 18 10 10 10 6.199334118085318 16.130764707175565 0.0 3 0.9826985928748958 9.369005683678365 38000.0 63.88958594730238 0.0 - - - - - - - 257.38461538461536 76 13 NAPB;NAPA N-ethylmaleimide-sensitive factor attachment protein, beta;N-ethylmaleimide-sensitive factor attachment protein, alpha 2243 285 B20140408_SF107_03 B20140408_SF107_03 TB239961.[MT7]-LVVSLGTVDVLK[MT7].3y3_1.heavy 510.995 / 503.367 11061.0 36.32720184326172 48 18 10 10 10 3.555663477031494 28.124146350173355 0.0 3 0.9833870313538524 9.561712120402046 11061.0 5.855622968457867 1.0 - - - - - - - 433.6666666666667 22 3 CYP20A1 cytochrome P450, family 20, subfamily A, polypeptide 1 2245 285 B20140408_SF107_03 B20140408_SF107_03 TB239961.[MT7]-LVVSLGTVDVLK[MT7].3b6_1.heavy 510.995 / 713.468 6832.0 36.32720184326172 48 18 10 10 10 3.555663477031494 28.124146350173355 0.0 3 0.9833870313538524 9.561712120402046 6832.0 12.631168511685116 0.0 - - - - - - - 232.57142857142858 13 7 CYP20A1 cytochrome P450, family 20, subfamily A, polypeptide 1 2247 285 B20140408_SF107_03 B20140408_SF107_03 TB239961.[MT7]-LVVSLGTVDVLK[MT7].3b4_1.heavy 510.995 / 543.362 13013.0 36.32720184326172 48 18 10 10 10 3.555663477031494 28.124146350173355 0.0 3 0.9833870313538524 9.561712120402046 13013.0 25.011955314648333 0.0 - - - - - - - 309.0 26 10 CYP20A1 cytochrome P450, family 20, subfamily A, polypeptide 1 2249 285 B20140408_SF107_03 B20140408_SF107_03 TB239961.[MT7]-LVVSLGTVDVLK[MT7].3y4_1.heavy 510.995 / 618.394 17080.0 36.32720184326172 48 18 10 10 10 3.555663477031494 28.124146350173355 0.0 3 0.9833870313538524 9.561712120402046 17080.0 16.42589039665833 0.0 - - - - - - - 743.5714285714286 34 7 CYP20A1 cytochrome P450, family 20, subfamily A, polypeptide 1 2251 286 B20140408_SF107_03 B20140408_SF107_03 TB239963.[MT7]-YYSLDELSEK[MT7].2y8_1.heavy 767.898 / 1064.56 10247.0 30.85740089416504 50 20 10 10 10 10.965709028866614 9.119337357644234 0.0 3 0.9981988993142774 29.07556538056306 10247.0 42.54143892514705 0.0 - - - - - - - 327.38461538461536 20 13 CPPED1 calcineurin-like phosphoesterase domain containing 1 2253 286 B20140408_SF107_03 B20140408_SF107_03 TB239963.[MT7]-YYSLDELSEK[MT7].2y5_1.heavy 767.898 / 749.416 9774.0 30.85740089416504 50 20 10 10 10 10.965709028866614 9.119337357644234 0.0 3 0.9981988993142774 29.07556538056306 9774.0 21.797822641769447 0.0 - - - - - - - 858.4444444444445 19 9 CPPED1 calcineurin-like phosphoesterase domain containing 1 2255 286 B20140408_SF107_03 B20140408_SF107_03 TB239963.[MT7]-YYSLDELSEK[MT7].2y3_1.heavy 767.898 / 507.289 11351.0 30.85740089416504 50 20 10 10 10 10.965709028866614 9.119337357644234 0.0 3 0.9981988993142774 29.07556538056306 11351.0 30.357325581395347 0.0 - - - - - - - 878.4285714285714 22 7 CPPED1 calcineurin-like phosphoesterase domain containing 1 2257 286 B20140408_SF107_03 B20140408_SF107_03 TB239963.[MT7]-YYSLDELSEK[MT7].2b5_1.heavy 767.898 / 786.379 10563.0 30.85740089416504 50 20 10 10 10 10.965709028866614 9.119337357644234 0.0 3 0.9981988993142774 29.07556538056306 10563.0 20.03467320907449 0.0 - - - - - - - 315.25 21 8 CPPED1 calcineurin-like phosphoesterase domain containing 1 2259 287 B20140408_SF107_03 B20140408_SF107_03 TB377700.[MT7]-MIFQMEGLFGFYK[MT7].3b4_1.heavy 633.664 / 664.361 53993.0 42.58380126953125 43 13 10 10 10 1.8511448020431516 42.007178640993736 0.0 3 0.9177105097428594 4.272342395888089 53993.0 70.47811653356617 0.0 - - - - - - - 783.75 107 8 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2261 287 B20140408_SF107_03 B20140408_SF107_03 TB377700.[MT7]-MIFQMEGLFGFYK[MT7].3b3_1.heavy 633.664 / 536.302 22558.0 42.58380126953125 43 13 10 10 10 1.8511448020431516 42.007178640993736 0.0 3 0.9177105097428594 4.272342395888089 22558.0 79.81208845208845 0.0 - - - - - - - 275.46153846153845 45 13 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2263 287 B20140408_SF107_03 B20140408_SF107_03 TB377700.[MT7]-MIFQMEGLFGFYK[MT7].3y4_1.heavy 633.664 / 658.368 79890.0 42.58380126953125 43 13 10 10 10 1.8511448020431516 42.007178640993736 0.0 3 0.9177105097428594 4.272342395888089 79890.0 139.06047856458923 0.0 - - - - - - - 325.6666666666667 159 3 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2265 287 B20140408_SF107_03 B20140408_SF107_03 TB377700.[MT7]-MIFQMEGLFGFYK[MT7].3b7_1.heavy 633.664 / 981.465 34204.0 42.58380126953125 43 13 10 10 10 1.8511448020431516 42.007178640993736 0.0 3 0.9177105097428594 4.272342395888089 34204.0 265.3488227316758 0.0 - - - - - - - 289.6666666666667 68 9 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2267 288 B20140408_SF107_03 B20140408_SF107_03 TB239965.[MT7]-GILPPILAETPK[MT7].3b6_1.heavy 512.992 / 735.489 270244.0 35.82040023803711 48 18 10 10 10 4.023651386551364 24.85304774022908 0.0 3 0.9806942198643351 8.86783300551089 270244.0 228.06578867060495 0.0 - - - - - - - 167.0 540 1 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2269 288 B20140408_SF107_03 B20140408_SF107_03 TB239965.[MT7]-GILPPILAETPK[MT7].3b4_1.heavy 512.992 / 525.352 110440.0 35.82040023803711 48 18 10 10 10 4.023651386551364 24.85304774022908 0.0 3 0.9806942198643351 8.86783300551089 110440.0 110.08196160612425 0.0 - - - - - - - 335.0 220 1 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2271 288 B20140408_SF107_03 B20140408_SF107_03 TB239965.[MT7]-GILPPILAETPK[MT7].3b3_1.heavy 512.992 / 428.299 592595.0 35.82040023803711 48 18 10 10 10 4.023651386551364 24.85304774022908 0.0 3 0.9806942198643351 8.86783300551089 592595.0 263.82958175623077 0.0 - - - - - - - 1506.0 1185 1 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2273 288 B20140408_SF107_03 B20140408_SF107_03 TB239965.[MT7]-GILPPILAETPK[MT7].3y5_1.heavy 512.992 / 689.395 152608.0 35.82040023803711 48 18 10 10 10 4.023651386551364 24.85304774022908 0.0 3 0.9806942198643351 8.86783300551089 152608.0 152.35703102886362 0.0 - - - - - - - 335.0 305 2 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2275 289 B20140408_SF107_03 B20140408_SF107_03 TB377701.[MT7]-MIFQMEGLFGFYK[MT7].2b3_1.heavy 949.993 / 536.302 3303.0 42.60510063171387 39 14 10 5 10 6.417217140710678 15.583078740721163 0.042598724365234375 3 0.9379104421279222 4.9269705272565085 3303.0 8.0556177193119 0.0 - - - - - - - 236.07142857142858 6 14 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2277 289 B20140408_SF107_03 B20140408_SF107_03 TB377701.[MT7]-MIFQMEGLFGFYK[MT7].2y5_1.heavy 949.993 / 805.437 3061.0 42.60510063171387 39 14 10 5 10 6.417217140710678 15.583078740721163 0.042598724365234375 3 0.9379104421279222 4.9269705272565085 3061.0 25.328946152661572 0.0 - - - - - - - 205.1818181818182 6 11 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2279 289 B20140408_SF107_03 B20140408_SF107_03 TB377701.[MT7]-MIFQMEGLFGFYK[MT7].2y3_1.heavy 949.993 / 601.347 886.0 42.60510063171387 39 14 10 5 10 6.417217140710678 15.583078740721163 0.042598724365234375 3 0.9379104421279222 4.9269705272565085 886.0 -0.0610402596013265 14.0 - - - - - - - 236.6875 2 16 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 2281 289 B20140408_SF107_03 B20140408_SF107_03 TB377701.[MT7]-MIFQMEGLFGFYK[MT7].2y7_1.heavy 949.993 / 975.542 2739.0 42.60510063171387 39 14 10 5 10 6.417217140710678 15.583078740721163 0.042598724365234375 3 0.9379104421279222 4.9269705272565085 2739.0 15.629870129870131 0.0 - - - - - - - 231.06666666666666 5 15 SLC25A21 solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21