Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 B20140410_SF109_01 B20140410_SF109_01 TB375820.[MT7]-VIDVYR.2y4_1.heavy 454.77 / 552.278 59931.0 28.24530029296875 48 18 10 10 10 8.055203482568135 12.414335679589598 0.0 3 0.9885629109082529 11.52895183897765 59931.0 23.75497194205534 0.0 - - - - - - - 1668.6666666666667 119 3 ADAT1 adenosine deaminase, tRNA-specific 1 3 1 B20140410_SF109_01 B20140410_SF109_01 TB375820.[MT7]-VIDVYR.2b3_1.heavy 454.77 / 472.289 190725.0 28.24530029296875 48 18 10 10 10 8.055203482568135 12.414335679589598 0.0 3 0.9885629109082529 11.52895183897765 190725.0 107.66967039146601 0.0 - - - - - - - 790.0 381 1 ADAT1 adenosine deaminase, tRNA-specific 1 5 1 B20140410_SF109_01 B20140410_SF109_01 TB375820.[MT7]-VIDVYR.2y5_1.heavy 454.77 / 665.362 233796.0 28.24530029296875 48 18 10 10 10 8.055203482568135 12.414335679589598 0.0 3 0.9885629109082529 11.52895183897765 233796.0 140.73537935493658 0.0 - - - - - - - 263.5 467 2 ADAT1 adenosine deaminase, tRNA-specific 1 7 1 B20140410_SF109_01 B20140410_SF109_01 TB375820.[MT7]-VIDVYR.2b4_1.heavy 454.77 / 571.357 70205.0 28.24530029296875 48 18 10 10 10 8.055203482568135 12.414335679589598 0.0 3 0.9885629109082529 11.52895183897765 70205.0 72.52338362759366 0.0 - - - - - - - 263.0 140 3 ADAT1 adenosine deaminase, tRNA-specific 1 9 2 B20140410_SF109_01 B20140410_SF109_01 TB496968.[MT7]-EVAHSR.2b3_1.heavy 421.734 / 444.258 338.0 15.965800285339355 36 14 10 10 2 1.2814637165197844 60.67811326053409 0.0 14 0.9303005909655049 4.64721161904904 338.0 15.548 10.0 - - - - - - - 0.0 1 0 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 11 2 B20140410_SF109_01 B20140410_SF109_01 TB496968.[MT7]-EVAHSR.2y4_1.heavy 421.734 / 470.247 835.0 15.965800285339355 36 14 10 10 2 1.2814637165197844 60.67811326053409 0.0 14 0.9303005909655049 4.64721161904904 835.0 6.973882681564245 2.0 - - - - - - - 72.88888888888889 2 27 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 13 2 B20140410_SF109_01 B20140410_SF109_01 TB496968.[MT7]-EVAHSR.2y5_1.heavy 421.734 / 569.315 1590.0 15.965800285339355 36 14 10 10 2 1.2814637165197844 60.67811326053409 0.0 14 0.9303005909655049 4.64721161904904 1590.0 11.212121212121211 2.0 - - - - - - - 68.0 3 26 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 15 2 B20140410_SF109_01 B20140410_SF109_01 TB496968.[MT7]-EVAHSR.2b4_1.heavy 421.734 / 581.316 258.0 15.965800285339355 36 14 10 10 2 1.2814637165197844 60.67811326053409 0.0 14 0.9303005909655049 4.64721161904904 258.0 6.972531645569621 8.0 - - - - - - - 0.0 1 0 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 17 3 B20140410_SF109_01 B20140410_SF109_01 TB496969.[MT7]-TAQLLR.2y4_1.heavy 423.27 / 529.346 30761.0 25.80970001220703 43 13 10 10 10 0.937571261768265 66.94047714856688 0.0 3 0.9023588685533456 3.9169425509164735 30761.0 42.16632476208705 0.0 - - - - - - - 332.6 61 5 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 19 3 B20140410_SF109_01 B20140410_SF109_01 TB496969.[MT7]-TAQLLR.2b3_1.heavy 423.27 / 445.253 101429.0 25.80970001220703 43 13 10 10 10 0.937571261768265 66.94047714856688 0.0 3 0.9023588685533456 3.9169425509164735 101429.0 111.37322402435208 0.0 - - - - - - - 646.6666666666666 202 3 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 21 3 B20140410_SF109_01 B20140410_SF109_01 TB496969.[MT7]-TAQLLR.2y5_1.heavy 423.27 / 600.383 218793.0 25.80970001220703 43 13 10 10 10 0.937571261768265 66.94047714856688 0.0 3 0.9023588685533456 3.9169425509164735 218793.0 350.1500419557822 0.0 - - - - - - - 139.0 437 3 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 23 3 B20140410_SF109_01 B20140410_SF109_01 TB496969.[MT7]-TAQLLR.2b4_1.heavy 423.27 / 558.337 183182.0 25.80970001220703 43 13 10 10 10 0.937571261768265 66.94047714856688 0.0 3 0.9023588685533456 3.9169425509164735 183182.0 156.9527227768523 0.0 - - - - - - - 803.6 366 5 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 25 4 B20140410_SF109_01 B20140410_SF109_01 TB496966.[MT7]-GEDVNR.2y4_1.heavy 417.215 / 503.257 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTPN myotrophin 27 4 B20140410_SF109_01 B20140410_SF109_01 TB496966.[MT7]-GEDVNR.2b3_1.heavy 417.215 / 446.2 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTPN myotrophin 29 4 B20140410_SF109_01 B20140410_SF109_01 TB496966.[MT7]-GEDVNR.2b4_1.heavy 417.215 / 545.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTPN myotrophin 31 4 B20140410_SF109_01 B20140410_SF109_01 TB496966.[MT7]-GEDVNR.2b5_1.heavy 417.215 / 659.312 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTPN myotrophin 33 5 B20140410_SF109_01 B20140410_SF109_01 TB497052.[MT7]-VVGEDTK[MT7].2y5_1.heavy 518.3 / 693.354 45258.0 21.065099716186523 43 13 10 10 10 1.0303039654033646 64.35510885371586 0.0 3 0.916375821710093 4.23762458632855 45258.0 147.2286718931475 0.0 - - - - - - - 621.2857142857143 90 7 APOA5 apolipoprotein A-V 35 5 B20140410_SF109_01 B20140410_SF109_01 TB497052.[MT7]-VVGEDTK[MT7].2y3_1.heavy 518.3 / 507.289 17690.0 21.065099716186523 43 13 10 10 10 1.0303039654033646 64.35510885371586 0.0 3 0.916375821710093 4.23762458632855 17690.0 17.776214910271023 0.0 - - - - - - - 1236.7777777777778 35 9 APOA5 apolipoprotein A-V 37 5 B20140410_SF109_01 B20140410_SF109_01 TB497052.[MT7]-VVGEDTK[MT7].2y6_1.heavy 518.3 / 792.422 78870.0 21.065099716186523 43 13 10 10 10 1.0303039654033646 64.35510885371586 0.0 3 0.916375821710093 4.23762458632855 78870.0 163.7328358208955 0.0 - - - - - - - 722.5 157 10 APOA5 apolipoprotein A-V 39 5 B20140410_SF109_01 B20140410_SF109_01 TB497052.[MT7]-VVGEDTK[MT7].2b5_1.heavy 518.3 / 644.337 75847.0 21.065099716186523 43 13 10 10 10 1.0303039654033646 64.35510885371586 0.0 3 0.916375821710093 4.23762458632855 75847.0 55.04796174691022 0.0 - - - - - - - 1271.375 151 8 APOA5 apolipoprotein A-V 41 6 B20140410_SF109_01 B20140410_SF109_01 TB497051.[MT7]-VAGTTAVK[MT7].2y4_1.heavy 517.826 / 562.368 16814.0 21.592599868774414 50 20 10 10 10 11.876002457476883 8.420341807612383 0.0 3 0.9966215502412747 21.226641805155158 16814.0 5.103227333115955 1.0 - - - - - - - 304.5 33 4 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 43 6 B20140410_SF109_01 B20140410_SF109_01 TB497051.[MT7]-VAGTTAVK[MT7].2b6_1.heavy 517.826 / 645.369 12915.0 21.592599868774414 50 20 10 10 10 11.876002457476883 8.420341807612383 0.0 3 0.9966215502412747 21.226641805155158 12915.0 14.093909960298635 0.0 - - - - - - - 1230.0 25 7 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 45 6 B20140410_SF109_01 B20140410_SF109_01 TB497051.[MT7]-VAGTTAVK[MT7].2y6_1.heavy 517.826 / 720.437 22338.0 21.592599868774414 50 20 10 10 10 11.876002457476883 8.420341807612383 0.0 3 0.9966215502412747 21.226641805155158 22338.0 33.011822660098524 0.0 - - - - - - - 650.0 44 8 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 47 6 B20140410_SF109_01 B20140410_SF109_01 TB497051.[MT7]-VAGTTAVK[MT7].2y7_1.heavy 517.826 / 791.474 56778.0 21.592599868774414 50 20 10 10 10 11.876002457476883 8.420341807612383 0.0 3 0.9966215502412747 21.226641805155158 56778.0 42.474538839570904 0.0 - - - - - - - 731.2857142857143 113 7 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 49 7 B20140410_SF109_01 B20140410_SF109_01 TB375964.[MT7]-GFGVQELK[MT7].2b4_1.heavy 583.345 / 505.289 23469.0 29.788000106811523 44 14 10 10 10 1.2825810095088863 47.27171007437757 0.0 3 0.937921455663341 4.927412189985142 23469.0 9.323593078858947 0.0 - - - - - - - 1226.0 46 11 ADAT1 adenosine deaminase, tRNA-specific 1 51 7 B20140410_SF109_01 B20140410_SF109_01 TB375964.[MT7]-GFGVQELK[MT7].2b6_1.heavy 583.345 / 762.39 25932.0 29.788000106811523 44 14 10 10 10 1.2825810095088863 47.27171007437757 0.0 3 0.937921455663341 4.927412189985142 25932.0 28.917628980008296 0.0 - - - - - - - 680.875 51 8 ADAT1 adenosine deaminase, tRNA-specific 1 53 7 B20140410_SF109_01 B20140410_SF109_01 TB375964.[MT7]-GFGVQELK[MT7].2y6_1.heavy 583.345 / 817.49 16986.0 29.788000106811523 44 14 10 10 10 1.2825810095088863 47.27171007437757 0.0 3 0.937921455663341 4.927412189985142 16986.0 11.060658470308187 0.0 - - - - - - - 1167.0 33 8 ADAT1 adenosine deaminase, tRNA-specific 1 55 7 B20140410_SF109_01 B20140410_SF109_01 TB375964.[MT7]-GFGVQELK[MT7].2y7_1.heavy 583.345 / 964.558 11669.0 29.788000106811523 44 14 10 10 10 1.2825810095088863 47.27171007437757 0.0 3 0.937921455663341 4.927412189985142 11669.0 51.773097953444775 0.0 - - - - - - - 313.25 23 12 ADAT1 adenosine deaminase, tRNA-specific 1 57 8 B20140410_SF109_01 B20140410_SF109_01 TB238467.[MT7]-RSANDELFR.3y3_1.heavy 417.89 / 435.271 58595.0 25.80970001220703 42 12 10 10 10 1.7153625360647125 45.91066163179885 0.0 3 0.8949581093012351 3.7740192139806283 58595.0 47.8209752415322 0.0 - - - - - - - 347.5 117 2 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 59 8 B20140410_SF109_01 B20140410_SF109_01 TB238467.[MT7]-RSANDELFR.3b4_1.heavy 417.89 / 573.323 16523.0 25.80970001220703 42 12 10 10 10 1.7153625360647125 45.91066163179885 0.0 3 0.8949581093012351 3.7740192139806283 16523.0 21.634058372878815 0.0 - - - - - - - 771.2222222222222 33 9 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 61 8 B20140410_SF109_01 B20140410_SF109_01 TB238467.[MT7]-RSANDELFR.3b5_1.heavy 417.89 / 688.349 16246.0 25.80970001220703 42 12 10 10 10 1.7153625360647125 45.91066163179885 0.0 3 0.8949581093012351 3.7740192139806283 16246.0 28.70458840328477 1.0 - - - - - - - 231.66666666666666 54 9 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 63 8 B20140410_SF109_01 B20140410_SF109_01 TB238467.[MT7]-RSANDELFR.3y4_1.heavy 417.89 / 564.314 40128.0 25.80970001220703 42 12 10 10 10 1.7153625360647125 45.91066163179885 0.0 3 0.8949581093012351 3.7740192139806283 40128.0 81.95632386287849 1.0 - - - - - - - 417.0 80 4 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 65 9 B20140410_SF109_01 B20140410_SF109_01 TB375962.[MT7]-EVQDEEK[MT7].2y4_1.heavy 582.803 / 664.327 5170.0 19.373199462890625 46 20 10 6 10 7.720631040573442 12.952309140856523 0.0355987548828125 3 0.9929904454297711 14.732048784061767 5170.0 26.868016755656505 0.0 - - - - - - - 208.76470588235293 10 17 NQO1 NAD(P)H dehydrogenase, quinone 1 67 9 B20140410_SF109_01 B20140410_SF109_01 TB375962.[MT7]-EVQDEEK[MT7].2b4_1.heavy 582.803 / 616.306 8409.0 19.373199462890625 46 20 10 6 10 7.720631040573442 12.952309140856523 0.0355987548828125 3 0.9929904454297711 14.732048784061767 8409.0 22.67785556591277 0.0 - - - - - - - 303.5625 16 16 NQO1 NAD(P)H dehydrogenase, quinone 1 69 9 B20140410_SF109_01 B20140410_SF109_01 TB375962.[MT7]-EVQDEEK[MT7].2y3_1.heavy 582.803 / 549.3 9468.0 19.373199462890625 46 20 10 6 10 7.720631040573442 12.952309140856523 0.0355987548828125 3 0.9929904454297711 14.732048784061767 9468.0 13.621986485559017 0.0 - - - - - - - 753.7 18 10 NQO1 NAD(P)H dehydrogenase, quinone 1 71 9 B20140410_SF109_01 B20140410_SF109_01 TB375962.[MT7]-EVQDEEK[MT7].2y6_1.heavy 582.803 / 891.454 7412.0 19.373199462890625 46 20 10 6 10 7.720631040573442 12.952309140856523 0.0355987548828125 3 0.9929904454297711 14.732048784061767 7412.0 14.460074074074074 0.0 - - - - - - - 265.6 14 15 NQO1 NAD(P)H dehydrogenase, quinone 1 73 10 B20140410_SF109_01 B20140410_SF109_01 TB376051.[MT7]-EAAAAALK[MT7]K[MT7].3b4_1.heavy 435.614 / 487.263 18269.0 22.418899536132812 38 8 10 10 10 0.8607768939539732 74.04347108161738 0.0 3 0.7879621492948532 2.6312657525061587 18269.0 24.44478919926617 0.0 - - - - - - - 1665.5714285714287 36 7 NQO1 NAD(P)H dehydrogenase, quinone 1 75 10 B20140410_SF109_01 B20140410_SF109_01 TB376051.[MT7]-EAAAAALK[MT7]K[MT7].3b5_1.heavy 435.614 / 558.3 19095.0 22.418899536132812 38 8 10 10 10 0.8607768939539732 74.04347108161738 0.0 3 0.7879621492948532 2.6312657525061587 19095.0 30.497558410337316 0.0 - - - - - - - 642.7142857142857 38 7 NQO1 NAD(P)H dehydrogenase, quinone 1 77 10 B20140410_SF109_01 B20140410_SF109_01 TB376051.[MT7]-EAAAAALK[MT7]K[MT7].3y4_1.heavy 435.614 / 747.533 16433.0 22.418899536132812 38 8 10 10 10 0.8607768939539732 74.04347108161738 0.0 3 0.7879621492948532 2.6312657525061587 16433.0 68.9559128065395 0.0 - - - - - - - 246.6875 32 16 NQO1 NAD(P)H dehydrogenase, quinone 1 79 10 B20140410_SF109_01 B20140410_SF109_01 TB376051.[MT7]-EAAAAALK[MT7]K[MT7].3y8_2.heavy 435.614 / 516.344 74270.0 22.418899536132812 38 8 10 10 10 0.8607768939539732 74.04347108161738 0.0 3 0.7879621492948532 2.6312657525061587 74270.0 28.87603294168759 0.0 - - - - - - - 2282.1428571428573 148 7 NQO1 NAD(P)H dehydrogenase, quinone 1 81 11 B20140410_SF109_01 B20140410_SF109_01 TB376430.[MT7]-EIEWDDLAQLPFLTMC[CAM]LK[MT7].3b6_1.heavy 837.435 / 932.412 32492.0 45.44139862060547 45 15 10 10 10 2.7575515440450475 36.26405468864244 0.0 3 0.9586095177883094 6.045088408966536 32492.0 66.55188964141213 0.0 - - - - - - - 747.2 64 10 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 83 11 B20140410_SF109_01 B20140410_SF109_01 TB376430.[MT7]-EIEWDDLAQLPFLTMC[CAM]LK[MT7].3b5_1.heavy 837.435 / 817.385 5714.0 45.44139862060547 45 15 10 10 10 2.7575515440450475 36.26405468864244 0.0 3 0.9586095177883094 6.045088408966536 5714.0 12.122193118244528 0.0 - - - - - - - 700.2307692307693 11 13 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 85 11 B20140410_SF109_01 B20140410_SF109_01 TB376430.[MT7]-EIEWDDLAQLPFLTMC[CAM]LK[MT7].3b3_1.heavy 837.435 / 516.279 11521.0 45.44139862060547 45 15 10 10 10 2.7575515440450475 36.26405468864244 0.0 3 0.9586095177883094 6.045088408966536 11521.0 20.29578884339365 0.0 - - - - - - - 673.7692307692307 23 13 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 87 11 B20140410_SF109_01 B20140410_SF109_01 TB376430.[MT7]-EIEWDDLAQLPFLTMC[CAM]LK[MT7].3y8_1.heavy 837.435 / 1153.62 24235.0 45.44139862060547 45 15 10 10 10 2.7575515440450475 36.26405468864244 0.0 3 0.9586095177883094 6.045088408966536 24235.0 64.23841531263054 0.0 - - - - - - - 681.0 48 10 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 89 12 B20140410_SF109_01 B20140410_SF109_01 TB238463.[MT7]-TSFNYAMK[MT7].2y4_1.heavy 625.328 / 656.356 6591.0 28.04789924621582 39 14 10 5 10 1.538696480369475 46.38991590103629 0.04380035400390625 3 0.939981425606505 5.012138728115702 6591.0 12.133198536350848 0.0 - - - - - - - 685.4 13 15 NQO1 NAD(P)H dehydrogenase, quinone 1 91 12 B20140410_SF109_01 B20140410_SF109_01 TB238463.[MT7]-TSFNYAMK[MT7].2y5_1.heavy 625.328 / 770.399 6064.0 28.04789924621582 39 14 10 5 10 1.538696480369475 46.38991590103629 0.04380035400390625 3 0.939981425606505 5.012138728115702 6064.0 17.984254936345078 1.0 - - - - - - - 263.7 12 10 NQO1 NAD(P)H dehydrogenase, quinone 1 93 12 B20140410_SF109_01 B20140410_SF109_01 TB238463.[MT7]-TSFNYAMK[MT7].2b4_1.heavy 625.328 / 594.3 6723.0 28.04789924621582 39 14 10 5 10 1.538696480369475 46.38991590103629 0.04380035400390625 3 0.939981425606505 5.012138728115702 6723.0 4.632618954705587 0.0 - - - - - - - 1167.4285714285713 13 7 NQO1 NAD(P)H dehydrogenase, quinone 1 95 12 B20140410_SF109_01 B20140410_SF109_01 TB238463.[MT7]-TSFNYAMK[MT7].2y7_1.heavy 625.328 / 1004.5 10414.0 28.04789924621582 39 14 10 5 10 1.538696480369475 46.38991590103629 0.04380035400390625 3 0.939981425606505 5.012138728115702 10414.0 43.22636706458819 0.0 - - - - - - - 252.75 20 12 NQO1 NAD(P)H dehydrogenase, quinone 1 97 13 B20140410_SF109_01 B20140410_SF109_01 TB238462.[MT7]-GVRPDGQVK[MT7].2y6_1.heavy 622.372 / 787.443 1725.0 19.93899917602539 37 11 10 6 10 1.4704540656315015 55.84053718404677 0.033599853515625 3 0.8746794289714387 3.449115404246617 1725.0 8.713230279609002 0.0 - - - - - - - 207.25 3 16 LOC100507338 hypothetical protein LOC100507338 99 13 B20140410_SF109_01 B20140410_SF109_01 TB238462.[MT7]-GVRPDGQVK[MT7].2y4_1.heavy 622.372 / 575.363 8958.0 19.93899917602539 37 11 10 6 10 1.4704540656315015 55.84053718404677 0.033599853515625 3 0.8746794289714387 3.449115404246617 8958.0 30.938327229367175 0.0 - - - - - - - 644.7142857142857 17 7 LOC100507338 hypothetical protein LOC100507338 101 13 B20140410_SF109_01 B20140410_SF109_01 TB238462.[MT7]-GVRPDGQVK[MT7].2b7_1.heavy 622.372 / 854.46 398.0 19.93899917602539 37 11 10 6 10 1.4704540656315015 55.84053718404677 0.033599853515625 3 0.8746794289714387 3.449115404246617 398.0 1.6 9.0 - - - - - - - 0.0 1 0 LOC100507338 hypothetical protein LOC100507338 103 13 B20140410_SF109_01 B20140410_SF109_01 TB238462.[MT7]-GVRPDGQVK[MT7].2b5_1.heavy 622.372 / 669.38 5640.0 19.93899917602539 37 11 10 6 10 1.4704540656315015 55.84053718404677 0.033599853515625 3 0.8746794289714387 3.449115404246617 5640.0 39.699781928510475 0.0 - - - - - - - 159.13333333333333 11 15 LOC100507338 hypothetical protein LOC100507338 105 14 B20140410_SF109_01 B20140410_SF109_01 TB376195.[MT7]-ILQSDLLFEQSR.2y9_1.heavy 796.942 / 1094.55 29955.0 35.83369827270508 43 13 10 10 10 0.8453236151145658 59.605608928311256 0.0 3 0.9104586037740512 4.093127540690768 29955.0 24.387348867796746 1.0 - - - - - - - 773.8888888888889 62 9 ADAT1 adenosine deaminase, tRNA-specific 1 107 14 B20140410_SF109_01 B20140410_SF109_01 TB376195.[MT7]-ILQSDLLFEQSR.2y10_1.heavy 796.942 / 1222.61 26890.0 35.83369827270508 43 13 10 10 10 0.8453236151145658 59.605608928311256 0.0 3 0.9104586037740512 4.093127540690768 26890.0 105.1924385030548 0.0 - - - - - - - 215.1818181818182 53 11 ADAT1 adenosine deaminase, tRNA-specific 1 109 14 B20140410_SF109_01 B20140410_SF109_01 TB376195.[MT7]-ILQSDLLFEQSR.2b5_1.heavy 796.942 / 701.395 34692.0 35.83369827270508 43 13 10 10 10 0.8453236151145658 59.605608928311256 0.0 3 0.9104586037740512 4.093127540690768 34692.0 44.1875086360418 0.0 - - - - - - - 836.0 69 8 ADAT1 adenosine deaminase, tRNA-specific 1 111 14 B20140410_SF109_01 B20140410_SF109_01 TB376195.[MT7]-ILQSDLLFEQSR.2y7_1.heavy 796.942 / 892.489 30512.0 35.83369827270508 43 13 10 10 10 0.8453236151145658 59.605608928311256 0.0 3 0.9104586037740512 4.093127540690768 30512.0 35.9847694761379 0.0 - - - - - - - 371.6666666666667 61 6 ADAT1 adenosine deaminase, tRNA-specific 1 113 15 B20140410_SF109_01 B20140410_SF109_01 TB238321.[MT7]-SASTPETR.2y4_1.heavy 496.76 / 502.262 6932.0 17.493000030517578 41 11 10 10 10 0.9035767528322952 67.86342629792067 0.0 3 0.8727138741037397 3.421793222686013 6932.0 15.847806420169395 0.0 - - - - - - - 242.94444444444446 13 18 LOC100132288;LOC100509396 hypothetical protein LOC100132288;tektin-4 like protein LOC389833-like 115 15 B20140410_SF109_01 B20140410_SF109_01 TB238321.[MT7]-SASTPETR.2b6_1.heavy 496.76 / 717.354 23576.0 17.493000030517578 41 11 10 10 10 0.9035767528322952 67.86342629792067 0.0 3 0.8727138741037397 3.421793222686013 23576.0 65.37346488875738 0.0 - - - - - - - 168.07692307692307 47 13 LOC100132288;LOC100509396 hypothetical protein LOC100132288;tektin-4 like protein LOC389833-like 117 15 B20140410_SF109_01 B20140410_SF109_01 TB238321.[MT7]-SASTPETR.2y6_1.heavy 496.76 / 690.342 7080.0 17.493000030517578 41 11 10 10 10 0.9035767528322952 67.86342629792067 0.0 3 0.8727138741037397 3.421793222686013 7080.0 59.130792590343155 0.0 - - - - - - - 162.61111111111111 14 18 LOC100132288;LOC100509396 hypothetical protein LOC100132288;tektin-4 like protein LOC389833-like 119 15 B20140410_SF109_01 B20140410_SF109_01 TB238321.[MT7]-SASTPETR.2y7_1.heavy 496.76 / 761.379 14494.0 17.493000030517578 41 11 10 10 10 0.9035767528322952 67.86342629792067 0.0 3 0.8727138741037397 3.421793222686013 14494.0 114.54791645777313 0.0 - - - - - - - 159.0 28 17 LOC100132288;LOC100509396 hypothetical protein LOC100132288;tektin-4 like protein LOC389833-like 121 16 B20140410_SF109_01 B20140410_SF109_01 TB497431.[MT7]-AAQFGLVGAAGLGGLGVGGLGVPGVGGLGGIPPAAAAK[MT7].4b8_1.heavy 861.5 / 888.506 10184.0 40.95209884643555 40 10 10 10 10 1.1904675220912562 74.03673928656433 0.0 3 0.834385938149485 2.9897110814091334 10184.0 17.146928563613343 0.0 - - - - - - - 343.0 20 6 ELN elastin 123 16 B20140410_SF109_01 B20140410_SF109_01 TB497431.[MT7]-AAQFGLVGAAGLGGLGVGGLGVPGVGGLGGIPPAAAAK[MT7].4b5_1.heavy 861.5 / 619.332 11359.0 40.95209884643555 40 10 10 10 10 1.1904675220912562 74.03673928656433 0.0 3 0.834385938149485 2.9897110814091334 11359.0 12.247548852995951 0.0 - - - - - - - 245.0 22 2 ELN elastin 125 16 B20140410_SF109_01 B20140410_SF109_01 TB497431.[MT7]-AAQFGLVGAAGLGGLGVGGLGVPGVGGLGGIPPAAAAK[MT7].4y7_1.heavy 861.5 / 769.469 107716.0 40.95209884643555 40 10 10 10 10 1.1904675220912562 74.03673928656433 0.0 3 0.834385938149485 2.9897110814091334 107716.0 59.00546219471024 0.0 - - - - - - - 245.0 215 2 ELN elastin 127 16 B20140410_SF109_01 B20140410_SF109_01 TB497431.[MT7]-AAQFGLVGAAGLGGLGVGGLGVPGVGGLGGIPPAAAAK[MT7].4b6_1.heavy 861.5 / 732.416 23991.0 40.95209884643555 40 10 10 10 10 1.1904675220912562 74.03673928656433 0.0 3 0.834385938149485 2.9897110814091334 23991.0 19.84268504786379 0.0 - - - - - - - 392.0 47 2 ELN elastin 129 17 B20140410_SF109_01 B20140410_SF109_01 TB238250.[MT7]-K[MT7]TIGSLQAR.3y7_1.heavy 421.266 / 744.436 6127.0 23.140899658203125 27 11 0 10 6 6.512450071633946 15.355204093704542 0.0 6 0.8569831554564024 3.2236768200988704 6127.0 14.755977672530445 1.0 - - - - - - - 271.7142857142857 48 14 ADAT1 adenosine deaminase, tRNA-specific 1 131 17 B20140410_SF109_01 B20140410_SF109_01 TB238250.[MT7]-K[MT7]TIGSLQAR.3y4_1.heavy 421.266 / 487.299 7606.0 23.140899658203125 27 11 0 10 6 6.512450071633946 15.355204093704542 0.0 6 0.8569831554564024 3.2236768200988704 7606.0 5.19156157424405 4.0 - - - - - - - 1256.0 72 9 ADAT1 adenosine deaminase, tRNA-specific 1 133 17 B20140410_SF109_01 B20140410_SF109_01 TB238250.[MT7]-K[MT7]TIGSLQAR.3y8_1.heavy 421.266 / 845.484 528.0 23.140899658203125 27 11 0 10 6 6.512450071633946 15.355204093704542 0.0 6 0.8569831554564024 3.2236768200988704 528.0 6.984444245730126 4.0 - - - - - - - 0.0 1 0 ADAT1 adenosine deaminase, tRNA-specific 1 135 17 B20140410_SF109_01 B20140410_SF109_01 TB238250.[MT7]-K[MT7]TIGSLQAR.3y5_1.heavy 421.266 / 574.331 10247.0 23.140899658203125 27 11 0 10 6 6.512450071633946 15.355204093704542 0.0 6 0.8569831554564024 3.2236768200988704 10247.0 16.73292217088272 0.0 - - - - - - - 721.75 20 12 ADAT1 adenosine deaminase, tRNA-specific 1 137 18 B20140410_SF109_01 B20140410_SF109_01 TB238252.[MT7]-VTVIDR.2y4_1.heavy 423.762 / 502.298 12004.0 24.918700218200684 43 18 10 5 10 2.2595411457208447 32.88784196410589 0.04920005798339844 3 0.9886205145278955 11.558150833508826 12004.0 3.403409217060906 1.0 - - - - - - - 666.5 24 2 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 139 18 B20140410_SF109_01 B20140410_SF109_01 TB238252.[MT7]-VTVIDR.2b3_1.heavy 423.762 / 444.294 15738.0 24.918700218200684 43 18 10 5 10 2.2595411457208447 32.88784196410589 0.04920005798339844 3 0.9886205145278955 11.558150833508826 15738.0 12.712882761992947 1.0 - - - - - - - 755.6666666666666 31 3 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 141 18 B20140410_SF109_01 B20140410_SF109_01 TB238252.[MT7]-VTVIDR.2y5_1.heavy 423.762 / 603.346 70154.0 24.918700218200684 43 18 10 5 10 2.2595411457208447 32.88784196410589 0.04920005798339844 3 0.9886205145278955 11.558150833508826 70154.0 248.8187370556745 0.0 - - - - - - - 266.6666666666667 140 3 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 143 18 B20140410_SF109_01 B20140410_SF109_01 TB238252.[MT7]-VTVIDR.2b5_1.heavy 423.762 / 672.405 22273.0 24.918700218200684 43 18 10 5 10 2.2595411457208447 32.88784196410589 0.04920005798339844 3 0.9886205145278955 11.558150833508826 22273.0 27.05378597265108 1.0 - - - - - - - 311.0 44 3 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 145 19 B20140410_SF109_01 B20140410_SF109_01 TB238899.[MT7]-AAAGLGAGIPGLGVGVGVPGLGVGAGVPGLGVGAGVPGFGAVPGALAAAK[MT7].4b8_1.heavy 1087.38 / 713.406 38301.0 42.811100006103516 43 13 10 10 10 1.3516636062369098 52.29492488034981 0.0 3 0.9163800665189099 4.237733689130844 38301.0 230.19791151291406 0.0 - - - - - - - 192.15384615384616 76 13 ELN elastin 147 19 B20140410_SF109_01 B20140410_SF109_01 TB238899.[MT7]-AAAGLGAGIPGLGVGVGVPGLGVGAGVPGLGVGAGVPGFGAVPGALAAAK[MT7].4y8_1.heavy 1087.38 / 842.522 51021.0 42.811100006103516 43 13 10 10 10 1.3516636062369098 52.29492488034981 0.0 3 0.9163800665189099 4.237733689130844 51021.0 194.285761297526 0.0 - - - - - - - 285.6666666666667 102 12 ELN elastin 149 19 B20140410_SF109_01 B20140410_SF109_01 TB238899.[MT7]-AAAGLGAGIPGLGVGVGVPGLGVGAGVPGLGVGAGVPGFGAVPGALAAAK[MT7].4b5_1.heavy 1087.38 / 528.326 11576.0 42.811100006103516 43 13 10 10 10 1.3516636062369098 52.29492488034981 0.0 3 0.9163800665189099 4.237733689130844 11576.0 43.173892773892774 0.0 - - - - - - - 242.16666666666666 23 18 ELN elastin 151 19 B20140410_SF109_01 B20140410_SF109_01 TB238899.[MT7]-AAAGLGAGIPGLGVGVGVPGLGVGAGVPGLGVGAGVPGFGAVPGALAAAK[MT7].4b9_1.heavy 1087.38 / 826.49 59524.0 42.811100006103516 43 13 10 10 10 1.3516636062369098 52.29492488034981 0.0 3 0.9163800665189099 4.237733689130844 59524.0 300.99996419580424 0.0 - - - - - - - 190.41666666666666 119 12 ELN elastin 153 20 B20140410_SF109_01 B20140410_SF109_01 TB238319.[MT7]-TIGSLQAR.2y5_1.heavy 495.297 / 574.331 9976.0 25.288000106811523 46 20 10 10 6 7.248099560293715 13.796719977167049 0.0 5 0.9936277729129664 15.452041259068025 9976.0 12.036762412538078 1.0 - - - - - - - 703.0 26 7 ADAT1 adenosine deaminase, tRNA-specific 1 155 20 B20140410_SF109_01 B20140410_SF109_01 TB238319.[MT7]-TIGSLQAR.2b4_1.heavy 495.297 / 503.295 8337.0 25.288000106811523 46 20 10 10 6 7.248099560293715 13.796719977167049 0.0 5 0.9936277729129664 15.452041259068025 8337.0 7.466181382091783 1.0 - - - - - - - 341.6666666666667 24 6 ADAT1 adenosine deaminase, tRNA-specific 1 157 20 B20140410_SF109_01 B20140410_SF109_01 TB238319.[MT7]-TIGSLQAR.2y6_1.heavy 495.297 / 631.352 53436.0 25.288000106811523 46 20 10 10 6 7.248099560293715 13.796719977167049 0.0 5 0.9936277729129664 15.452041259068025 53436.0 116.96764150988473 0.0 - - - - - - - 751.75 106 8 ADAT1 adenosine deaminase, tRNA-specific 1 159 20 B20140410_SF109_01 B20140410_SF109_01 TB238319.[MT7]-TIGSLQAR.2b5_1.heavy 495.297 / 616.379 6560.0 25.288000106811523 46 20 10 10 6 7.248099560293715 13.796719977167049 0.0 5 0.9936277729129664 15.452041259068025 6560.0 5.629831302919048 3.0 - - - - - - - 245.8 15 5 ADAT1 adenosine deaminase, tRNA-specific 1 161 21 B20140410_SF109_01 B20140410_SF109_01 TB497429.[MT7]-YGAAVPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAK[MT7].4y4_1.heavy 826.476 / 504.326 7052.0 40.20650100708008 46 18 10 10 8 9.998048685518382 10.001951695318752 0.0 4 0.9884674012829068 11.481021108466194 7052.0 -0.35429516063441435 2.0 - - - - - - - 819.3333333333334 17 9 ELN elastin 163 21 B20140410_SF109_01 B20140410_SF109_01 TB497429.[MT7]-YGAAVPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAK[MT7].4b8_1.heavy 826.476 / 859.479 8227.0 40.20650100708008 46 18 10 10 8 9.998048685518382 10.001951695318752 0.0 4 0.9884674012829068 11.481021108466194 8227.0 8.880748005038825 0.0 - - - - - - - 274.85714285714283 16 7 ELN elastin 165 21 B20140410_SF109_01 B20140410_SF109_01 TB497429.[MT7]-YGAAVPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAK[MT7].4b7_1.heavy 826.476 / 760.411 4487.0 40.20650100708008 46 18 10 10 8 9.998048685518382 10.001951695318752 0.0 4 0.9884674012829068 11.481021108466194 4487.0 3.420220888646421 0.0 - - - - - - - 737.3 8 10 ELN elastin 167 21 B20140410_SF109_01 B20140410_SF109_01 TB497429.[MT7]-YGAAVPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAK[MT7].4b5_1.heavy 826.476 / 606.337 37075.0 40.20650100708008 46 18 10 10 8 9.998048685518382 10.001951695318752 0.0 4 0.9884674012829068 11.481021108466194 37075.0 63.83143885915663 0.0 - - - - - - - 338.3333333333333 74 6 ELN elastin 169 22 B20140410_SF109_01 B20140410_SF109_01 TB375816.[MT7]-RADSPGR.2b3_1.heavy 451.75 / 487.275 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAT1 adenosine deaminase, tRNA-specific 1 171 22 B20140410_SF109_01 B20140410_SF109_01 TB375816.[MT7]-RADSPGR.2b4_1.heavy 451.75 / 574.307 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAT1 adenosine deaminase, tRNA-specific 1 173 22 B20140410_SF109_01 B20140410_SF109_01 TB375816.[MT7]-RADSPGR.2b6_1.heavy 451.75 / 728.381 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAT1 adenosine deaminase, tRNA-specific 1 175 22 B20140410_SF109_01 B20140410_SF109_01 TB375816.[MT7]-RADSPGR.2y6_1.heavy 451.75 / 602.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAT1 adenosine deaminase, tRNA-specific 1 177 23 B20140410_SF109_01 B20140410_SF109_01 TB376048.[MT7]-C[CAM]QNVSALPK[MT7].2b3_1.heavy 652.865 / 547.242 4222.0 24.173799514770508 43 13 10 10 10 1.20555730229941 56.94431406359057 0.0 3 0.9169823375753934 4.253297944310202 4222.0 4.5612888377445335 2.0 - - - - - - - 235.9 8 10 ADAT1 adenosine deaminase, tRNA-specific 1 179 23 B20140410_SF109_01 B20140410_SF109_01 TB376048.[MT7]-C[CAM]QNVSALPK[MT7].2b4_1.heavy 652.865 / 646.31 7078.0 24.173799514770508 43 13 10 10 10 1.20555730229941 56.94431406359057 0.0 3 0.9169823375753934 4.253297944310202 7078.0 8.29952479683984 1.0 - - - - - - - 1288.5 14 8 ADAT1 adenosine deaminase, tRNA-specific 1 181 23 B20140410_SF109_01 B20140410_SF109_01 TB376048.[MT7]-C[CAM]QNVSALPK[MT7].2b6_1.heavy 652.865 / 804.379 6085.0 24.173799514770508 43 13 10 10 10 1.20555730229941 56.94431406359057 0.0 3 0.9169823375753934 4.253297944310202 6085.0 19.580785057576005 0.0 - - - - - - - 310.5 12 8 ADAT1 adenosine deaminase, tRNA-specific 1 183 23 B20140410_SF109_01 B20140410_SF109_01 TB376048.[MT7]-C[CAM]QNVSALPK[MT7].2b5_1.heavy 652.865 / 733.342 3353.0 24.173799514770508 43 13 10 10 10 1.20555730229941 56.94431406359057 0.0 3 0.9169823375753934 4.253297944310202 3353.0 9.709624844809904 0.0 - - - - - - - 258.8333333333333 6 12 ADAT1 adenosine deaminase, tRNA-specific 1 185 24 B20140410_SF109_01 B20140410_SF109_01 TB376043.[MT7]-EVVSMGTGTK[MT7].2y8_1.heavy 648.857 / 924.494 6100.0 24.894100189208984 37 17 2 10 8 3.1404150372183035 26.976342027702984 0.0 4 0.9717494243845372 7.325224845068891 6100.0 27.38666919503176 0.0 - - - - - - - 265.3333333333333 12 6 ADAT1 adenosine deaminase, tRNA-specific 1 187 24 B20140410_SF109_01 B20140410_SF109_01 TB376043.[MT7]-EVVSMGTGTK[MT7].2y5_1.heavy 648.857 / 607.353 12731.0 24.894100189208984 37 17 2 10 8 3.1404150372183035 26.976342027702984 0.0 4 0.9717494243845372 7.325224845068891 12731.0 28.800995645702635 1.0 - - - - - - - 305.2 50 10 ADAT1 adenosine deaminase, tRNA-specific 1 189 24 B20140410_SF109_01 B20140410_SF109_01 TB376043.[MT7]-EVVSMGTGTK[MT7].2y6_1.heavy 648.857 / 738.394 3183.0 24.894100189208984 37 17 2 10 8 3.1404150372183035 26.976342027702984 0.0 4 0.9717494243845372 7.325224845068891 3183.0 23.282232554183736 1.0 - - - - - - - 232.125 7 8 ADAT1 adenosine deaminase, tRNA-specific 1 191 24 B20140410_SF109_01 B20140410_SF109_01 TB376043.[MT7]-EVVSMGTGTK[MT7].2y7_1.heavy 648.857 / 825.426 12598.0 24.894100189208984 37 17 2 10 8 3.1404150372183035 26.976342027702984 0.0 4 0.9717494243845372 7.325224845068891 12598.0 60.197345785531425 0.0 - - - - - - - 217.1818181818182 25 11 ADAT1 adenosine deaminase, tRNA-specific 1 193 25 B20140410_SF109_01 B20140410_SF109_01 TB376421.[MT7]-DK[MT7]VFC[CAM]ELFPEVVEEIK[MT7].3b6_2.heavy 805.107 / 534.275 57131.0 39.65869903564453 42 12 10 10 10 2.540381195243467 39.36417108866849 0.0 3 0.8901074936047052 3.6882346447379097 57131.0 53.066504946638986 0.0 - - - - - - - 1122.375 114 8 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 195 25 B20140410_SF109_01 B20140410_SF109_01 TB376421.[MT7]-DK[MT7]VFC[CAM]ELFPEVVEEIK[MT7].3b6_1.heavy 805.107 / 1067.54 7632.0 39.65869903564453 42 12 10 10 10 2.540381195243467 39.36417108866849 0.0 3 0.8901074936047052 3.6882346447379097 7632.0 4.943018484497038 1.0 - - - - - - - 271.1666666666667 19 12 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 197 25 B20140410_SF109_01 B20140410_SF109_01 TB376421.[MT7]-DK[MT7]VFC[CAM]ELFPEVVEEIK[MT7].3y4_1.heavy 805.107 / 662.384 17846.0 39.65869903564453 42 12 10 10 10 2.540381195243467 39.36417108866849 0.0 3 0.8901074936047052 3.6882346447379097 17846.0 19.671404332011974 0.0 - - - - - - - 729.5 35 8 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 199 25 B20140410_SF109_01 B20140410_SF109_01 TB376421.[MT7]-DK[MT7]VFC[CAM]ELFPEVVEEIK[MT7].3y8_1.heavy 805.107 / 1086.62 18408.0 39.65869903564453 42 12 10 10 10 2.540381195243467 39.36417108866849 0.0 3 0.8901074936047052 3.6882346447379097 18408.0 49.17019566031101 0.0 - - - - - - - 710.7777777777778 36 9 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 201 26 B20140410_SF109_01 B20140410_SF109_01 TB238310.[MT7]-LWAESAR.2b3_1.heavy 488.77 / 515.31 5350.0 28.84819984436035 50 20 10 10 10 14.266675966755605 7.009341225175459 0.0 3 0.9904132500492361 12.594446976611627 5350.0 5.42827584342006 9.0 - - - - - - - 326.0 82 2 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 203 26 B20140410_SF109_01 B20140410_SF109_01 TB238310.[MT7]-LWAESAR.2y5_1.heavy 488.77 / 533.268 17486.0 28.84819984436035 50 20 10 10 10 14.266675966755605 7.009341225175459 0.0 3 0.9904132500492361 12.594446976611627 17486.0 15.940743979414547 1.0 - - - - - - - 304.0 34 3 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 205 26 B20140410_SF109_01 B20140410_SF109_01 TB238310.[MT7]-LWAESAR.2b4_1.heavy 488.77 / 644.352 8743.0 28.84819984436035 50 20 10 10 10 14.266675966755605 7.009341225175459 0.0 3 0.9904132500492361 12.594446976611627 8743.0 13.618649415689706 0.0 - - - - - - - 717.5 17 8 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 207 26 B20140410_SF109_01 B20140410_SF109_01 TB238310.[MT7]-LWAESAR.2y6_1.heavy 488.77 / 719.347 54546.0 28.84819984436035 50 20 10 10 10 14.266675966755605 7.009341225175459 0.0 3 0.9904132500492361 12.594446976611627 54546.0 65.37917770034844 0.0 - - - - - - - 1341.857142857143 109 7 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 209 27 B20140410_SF109_01 B20140410_SF109_01 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1930610.0 29.10546620686849 23 -3 10 6 10 null 0.0 0.03980064392089844 3 0.0 0.0 1930610.0 534.1333651107504 0.0 - - - - - - - 4446.0 3861 1 211 27 B20140410_SF109_01 B20140410_SF109_01 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 527561.0 29.10546620686849 23 -3 10 6 10 null 0.0 0.03980064392089844 3 0.0 0.0 527561.0 145.34565567977535 0.0 - - - - - - - 1700.0 1055 2 213 27 B20140410_SF109_01 B20140410_SF109_01 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 394505.0 29.10546620686849 23 -3 10 6 10 null 0.0 0.03980064392089844 3 0.0 0.0 394505.0 219.0731145358854 0.0 - - - - - - - 1177.0 789 1 215 28 B20140410_SF109_01 B20140410_SF109_01 TB238612.[MT7]-EDSIFVPGTQK[MT7].3b4_1.heavy 503.611 / 589.295 83684.0 29.925650596618652 43 17 10 6 10 6.92408405057204 14.442343459383398 0.03890037536621094 3 0.9793004222375938 8.563072567761797 83684.0 30.221724976692432 0.0 - - - - - - - 1038.0 167 1 ADAT1 adenosine deaminase, tRNA-specific 1 217 28 B20140410_SF109_01 B20140410_SF109_01 TB238612.[MT7]-EDSIFVPGTQK[MT7].3b5_1.heavy 503.611 / 736.363 108984.0 29.925650596618652 43 17 10 6 10 6.92408405057204 14.442343459383398 0.03890037536621094 3 0.9793004222375938 8.563072567761797 108984.0 186.52115250613667 0.0 - - - - - - - 632.5 217 8 ADAT1 adenosine deaminase, tRNA-specific 1 219 28 B20140410_SF109_01 B20140410_SF109_01 TB238612.[MT7]-EDSIFVPGTQK[MT7].3y4_1.heavy 503.611 / 577.343 58903.0 29.925650596618652 43 17 10 6 10 6.92408405057204 14.442343459383398 0.03890037536621094 3 0.9793004222375938 8.563072567761797 58903.0 57.88642121853506 0.0 - - - - - - - 745.75 117 4 ADAT1 adenosine deaminase, tRNA-specific 1 221 28 B20140410_SF109_01 B20140410_SF109_01 TB238612.[MT7]-EDSIFVPGTQK[MT7].3y5_1.heavy 503.611 / 674.395 122088.0 29.925650596618652 43 17 10 6 10 6.92408405057204 14.442343459383398 0.03890037536621094 3 0.9793004222375938 8.563072567761797 122088.0 99.5741363798187 0.0 - - - - - - - 778.0 244 1 ADAT1 adenosine deaminase, tRNA-specific 1 223 29 B20140410_SF109_01 B20140410_SF109_01 TB497421.[MT7]-AAGGGGPGGPGGSGDFLLIYLANLEAK[MT7].3b9_1.heavy 916.492 / 726.365 27118.0 43.18389892578125 46 16 10 10 10 10.400138994508112 9.615256108866037 0.0 3 0.9678024039030207 6.8592784889117535 27118.0 60.45024711070559 0.0 - - - - - - - 732.1 54 10 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 225 29 B20140410_SF109_01 B20140410_SF109_01 TB497421.[MT7]-AAGGGGPGGPGGSGDFLLIYLANLEAK[MT7].3b6_1.heavy 916.492 / 515.269 18975.0 43.18389892578125 46 16 10 10 10 10.400138994508112 9.615256108866037 0.0 3 0.9678024039030207 6.8592784889117535 18975.0 45.87678451030399 0.0 - - - - - - - 691.0 37 8 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 227 29 B20140410_SF109_01 B20140410_SF109_01 TB497421.[MT7]-AAGGGGPGGPGGSGDFLLIYLANLEAK[MT7].3b8_1.heavy 916.492 / 669.344 13372.0 43.18389892578125 46 16 10 10 10 10.400138994508112 9.615256108866037 0.0 3 0.9678024039030207 6.8592784889117535 13372.0 76.095057678894 0.0 - - - - - - - 719.0 26 8 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 229 29 B20140410_SF109_01 B20140410_SF109_01 TB497421.[MT7]-AAGGGGPGGPGGSGDFLLIYLANLEAK[MT7].3b15_1.heavy 916.492 / 1196.54 8442.0 43.18389892578125 46 16 10 10 10 10.400138994508112 9.615256108866037 0.0 3 0.9678024039030207 6.8592784889117535 8442.0 26.6325 0.0 - - - - - - - 267.5833333333333 16 12 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 231 30 B20140410_SF109_01 B20140410_SF109_01 TB238313.[MT7]-C[CAM]IGQSK[MT7].2y4_1.heavy 490.775 / 563.327 19409.0 19.64189910888672 45 15 10 10 10 4.0599712541158315 24.630716263969635 0.0 3 0.9564830393382843 5.894479244863073 19409.0 34.28708706584193 0.0 - - - - - - - 658.625 38 8 ADAT1 adenosine deaminase, tRNA-specific 1 233 30 B20140410_SF109_01 B20140410_SF109_01 TB238313.[MT7]-C[CAM]IGQSK[MT7].2y5_1.heavy 490.775 / 676.411 18767.0 19.64189910888672 45 15 10 10 10 4.0599712541158315 24.630716263969635 0.0 3 0.9564830393382843 5.894479244863073 18767.0 63.25539200745827 0.0 - - - - - - - 226.68421052631578 37 19 ADAT1 adenosine deaminase, tRNA-specific 1 235 30 B20140410_SF109_01 B20140410_SF109_01 TB238313.[MT7]-C[CAM]IGQSK[MT7].2b4_1.heavy 490.775 / 603.304 3599.0 19.64189910888672 45 15 10 10 10 4.0599712541158315 24.630716263969635 0.0 3 0.9564830393382843 5.894479244863073 3599.0 8.236591670986694 0.0 - - - - - - - 231.4 7 20 ADAT1 adenosine deaminase, tRNA-specific 1 237 30 B20140410_SF109_01 B20140410_SF109_01 TB238313.[MT7]-C[CAM]IGQSK[MT7].2y3_1.heavy 490.775 / 506.306 1800.0 19.64189910888672 45 15 10 10 10 4.0599712541158315 24.630716263969635 0.0 3 0.9564830393382843 5.894479244863073 1800.0 3.8521400778210113 6.0 - - - - - - - 664.1111111111111 3 9 ADAT1 adenosine deaminase, tRNA-specific 1 239 31 B20140410_SF109_01 B20140410_SF109_01 TB376187.[MT7]-QDTYLQIAAFTR.2b4_1.heavy 785.921 / 652.306 6532.0 35.2223014831543 44 14 10 10 10 1.3523728967058788 50.69604951901341 0.0 3 0.9370146482515682 4.891434985535951 6532.0 4.607876324034462 2.0 - - - - - - - 1191.4285714285713 13 7 APOA5 apolipoprotein A-V 241 31 B20140410_SF109_01 B20140410_SF109_01 TB376187.[MT7]-QDTYLQIAAFTR.2b6_1.heavy 785.921 / 893.448 6254.0 35.2223014831543 44 14 10 10 10 1.3523728967058788 50.69604951901341 0.0 3 0.9370146482515682 4.891434985535951 6254.0 13.327868904876098 0.0 - - - - - - - 238.28571428571428 12 7 APOA5 apolipoprotein A-V 243 31 B20140410_SF109_01 B20140410_SF109_01 TB376187.[MT7]-QDTYLQIAAFTR.2y10_1.heavy 785.921 / 1183.65 7227.0 35.2223014831543 44 14 10 10 10 1.3523728967058788 50.69604951901341 0.0 3 0.9370146482515682 4.891434985535951 7227.0 16.63769784172662 0.0 - - - - - - - 290.6363636363636 14 11 APOA5 apolipoprotein A-V 245 31 B20140410_SF109_01 B20140410_SF109_01 TB376187.[MT7]-QDTYLQIAAFTR.2y7_1.heavy 785.921 / 806.452 10007.0 35.2223014831543 44 14 10 10 10 1.3523728967058788 50.69604951901341 0.0 3 0.9370146482515682 4.891434985535951 10007.0 14.861372045220966 0.0 - - - - - - - 774.4285714285714 20 7 APOA5 apolipoprotein A-V 247 32 B20140410_SF109_01 B20140410_SF109_01 TB375802.[MT7]-EQPLPR.2b3_1.heavy 442.26 / 499.263 8901.0 21.91599988937378 43 17 10 6 10 3.3298764464152364 30.031144280940083 0.030401229858398438 3 0.9771429084626785 8.147440017089252 8901.0 12.99967674847916 0.0 - - - - - - - 749.7692307692307 17 13 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 249 32 B20140410_SF109_01 B20140410_SF109_01 TB375802.[MT7]-EQPLPR.2y4_1.heavy 442.26 / 482.309 109862.0 21.91599988937378 43 17 10 6 10 3.3298764464152364 30.031144280940083 0.030401229858398438 3 0.9771429084626785 8.147440017089252 109862.0 101.98189007015114 0.0 - - - - - - - 654.0 219 7 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 251 32 B20140410_SF109_01 B20140410_SF109_01 TB375802.[MT7]-EQPLPR.2y5_1.heavy 442.26 / 610.367 95197.0 21.91599988937378 43 17 10 6 10 3.3298764464152364 30.031144280940083 0.030401229858398438 3 0.9771429084626785 8.147440017089252 95197.0 59.25093111065954 0.0 - - - - - - - 381.5 190 2 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 253 32 B20140410_SF109_01 B20140410_SF109_01 TB375802.[MT7]-EQPLPR.2b4_1.heavy 442.26 / 612.347 48573.0 21.91599988937378 43 17 10 6 10 3.3298764464152364 30.031144280940083 0.030401229858398438 3 0.9771429084626785 8.147440017089252 48573.0 102.2818911754884 0.0 - - - - - - - 704.2307692307693 97 13 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 255 33 B20140410_SF109_01 B20140410_SF109_01 TB238605.[MT7]-GC[CAM]TQDVVLPDSR.3b6_1.heavy 497.585 / 805.363 39443.0 26.526199340820312 42 12 10 10 10 0.9598742796675367 56.79937793005363 0.0 3 0.8957418270763717 3.7884348099478338 39443.0 56.557414832592286 0.0 - - - - - - - 653.0 78 8 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 257 33 B20140410_SF109_01 B20140410_SF109_01 TB238605.[MT7]-GC[CAM]TQDVVLPDSR.3y6_1.heavy 497.585 / 686.383 54148.0 26.526199340820312 42 12 10 10 10 0.9598742796675367 56.79937793005363 0.0 3 0.8957418270763717 3.7884348099478338 54148.0 108.0708523908524 0.0 - - - - - - - 778.8888888888889 108 9 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 259 33 B20140410_SF109_01 B20140410_SF109_01 TB238605.[MT7]-GC[CAM]TQDVVLPDSR.3b5_1.heavy 497.585 / 706.295 105823.0 26.526199340820312 42 12 10 10 10 0.9598742796675367 56.79937793005363 0.0 3 0.8957418270763717 3.7884348099478338 105823.0 141.07329724511428 0.0 - - - - - - - 309.0 211 4 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 261 33 B20140410_SF109_01 B20140410_SF109_01 TB238605.[MT7]-GC[CAM]TQDVVLPDSR.3y4_1.heavy 497.585 / 474.231 109122.0 26.526199340820312 42 12 10 10 10 0.9598742796675367 56.79937793005363 0.0 3 0.8957418270763717 3.7884348099478338 109122.0 76.2385482881046 0.0 - - - - - - - 825.0 218 1 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 263 34 B20140410_SF109_01 B20140410_SF109_01 TB238882.[MT7]-HTGIHGSTFSSTTLGPIFWLLVK[MT7].4y5_1.heavy 697.641 / 802.531 9403.0 42.23140048980713 40 14 10 6 10 5.212142712456617 19.185967368277876 0.039997100830078125 3 0.9424547459932443 5.119795979957108 9403.0 20.411027466206498 0.0 - - - - - - - 887.125 18 8 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 265 34 B20140410_SF109_01 B20140410_SF109_01 TB238882.[MT7]-HTGIHGSTFSSTTLGPIFWLLVK[MT7].4y4_1.heavy 697.641 / 616.451 14637.0 42.23140048980713 40 14 10 6 10 5.212142712456617 19.185967368277876 0.039997100830078125 3 0.9424547459932443 5.119795979957108 14637.0 16.778560834967134 1.0 - - - - - - - 325.3333333333333 29 3 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 267 34 B20140410_SF109_01 B20140410_SF109_01 TB238882.[MT7]-HTGIHGSTFSSTTLGPIFWLLVK[MT7].4b4_1.heavy 697.641 / 553.321 3814.0 42.23140048980713 40 14 10 6 10 5.212142712456617 19.185967368277876 0.039997100830078125 3 0.9424547459932443 5.119795979957108 3814.0 1.8744182768534257 1.0 - - - - - - - 734.8571428571429 7 7 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 269 34 B20140410_SF109_01 B20140410_SF109_01 TB238882.[MT7]-HTGIHGSTFSSTTLGPIFWLLVK[MT7].4y3_1.heavy 697.641 / 503.367 25902.0 42.23140048980713 40 14 10 6 10 5.212142712456617 19.185967368277876 0.039997100830078125 3 0.9424547459932443 5.119795979957108 25902.0 28.7528957869117 1.0 - - - - - - - 355.0 51 4 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 271 35 B20140410_SF109_01 B20140410_SF109_01 TB238604.[MT7]-VC[CAM]HALAFLGMAR.2y8_1.heavy 745.398 / 878.492 7664.0 35.03196589152018 39 14 10 5 10 1.2787134032434442 56.45984841517714 0.044200897216796875 3 0.9305571024810064 4.655888891537269 7664.0 14.334870555290411 0.0 - - - - - - - 676.8571428571429 15 7 TMEM155 transmembrane protein 155 273 35 B20140410_SF109_01 B20140410_SF109_01 TB238604.[MT7]-VC[CAM]HALAFLGMAR.2y9_1.heavy 745.398 / 949.529 6967.0 35.03196589152018 39 14 10 5 10 1.2787134032434442 56.45984841517714 0.044200897216796875 3 0.9305571024810064 4.655888891537269 6967.0 19.29647559945906 0.0 - - - - - - - 676.5714285714286 13 7 TMEM155 transmembrane protein 155 275 35 B20140410_SF109_01 B20140410_SF109_01 TB238604.[MT7]-VC[CAM]HALAFLGMAR.2y10_1.heavy 745.398 / 1086.59 N/A 35.03196589152018 39 14 10 5 10 1.2787134032434442 56.45984841517714 0.044200897216796875 3 0.9305571024810064 4.655888891537269 8082.0 39.706609138819715 0.0 - - - - - - - 261.25 16 8 TMEM155 transmembrane protein 155 277 35 B20140410_SF109_01 B20140410_SF109_01 TB238604.[MT7]-VC[CAM]HALAFLGMAR.2y11_1.heavy 745.398 / 1246.62 3901.0 35.03196589152018 39 14 10 5 10 1.2787134032434442 56.45984841517714 0.044200897216796875 3 0.9305571024810064 4.655888891537269 3901.0 25.424781935217375 0.0 - - - - - - - 267.0833333333333 7 12 TMEM155 transmembrane protein 155 279 36 B20140410_SF109_01 B20140410_SF109_01 TB497412.[MT7]-C[CAM]VPGEAGDSGK[MT7]PGAAFHQVGLLR.4y5_1.heavy 653.597 / 557.377 36239.0 29.447900772094727 50 20 10 10 10 6.497696679055841 15.390068964335015 0.0 3 0.9938341302081362 15.708755935506305 36239.0 49.02097286821705 0.0 - - - - - - - 1241.625 72 8 ADAT1 adenosine deaminase, tRNA-specific 1 281 36 B20140410_SF109_01 B20140410_SF109_01 TB497412.[MT7]-C[CAM]VPGEAGDSGK[MT7]PGAAFHQVGLLR.4b5_1.heavy 653.597 / 687.325 16120.0 29.447900772094727 50 20 10 10 10 6.497696679055841 15.390068964335015 0.0 3 0.9938341302081362 15.708755935506305 16120.0 34.81063122923588 0.0 - - - - - - - 683.7 32 10 ADAT1 adenosine deaminase, tRNA-specific 1 283 36 B20140410_SF109_01 B20140410_SF109_01 TB497412.[MT7]-C[CAM]VPGEAGDSGK[MT7]PGAAFHQVGLLR.4y7_1.heavy 653.597 / 822.494 26051.0 29.447900772094727 50 20 10 10 10 6.497696679055841 15.390068964335015 0.0 3 0.9938341302081362 15.708755935506305 26051.0 37.94132017852948 0.0 - - - - - - - 1225.5 52 8 ADAT1 adenosine deaminase, tRNA-specific 1 285 36 B20140410_SF109_01 B20140410_SF109_01 TB497412.[MT7]-C[CAM]VPGEAGDSGK[MT7]PGAAFHQVGLLR.4y6_1.heavy 653.597 / 685.435 59194.0 29.447900772094727 50 20 10 10 10 6.497696679055841 15.390068964335015 0.0 3 0.9938341302081362 15.708755935506305 59194.0 75.19181465821 0.0 - - - - - - - 741.75 118 8 ADAT1 adenosine deaminase, tRNA-specific 1 287 37 B20140410_SF109_01 B20140410_SF109_01 TB497071.[MT7]-LSVSPPSLR.2y8_1.heavy 550.333 / 842.473 122429.0 29.984100341796875 38 18 0 10 10 3.754047857744223 26.637912938086302 0.0 3 0.9845847869550521 9.927230950241697 122429.0 26.103408327650317 1.0 - - - - - - - 2721.0 244 1 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 289 37 B20140410_SF109_01 B20140410_SF109_01 TB497071.[MT7]-LSVSPPSLR.2y5_1.heavy 550.333 / 569.341 71126.0 29.984100341796875 38 18 0 10 10 3.754047857744223 26.637912938086302 0.0 3 0.9845847869550521 9.927230950241697 71126.0 54.7623477630254 0.0 - - - - - - - 907.0 142 3 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 291 37 B20140410_SF109_01 B20140410_SF109_01 TB497071.[MT7]-LSVSPPSLR.2b4_1.heavy 550.333 / 531.326 51563.0 29.984100341796875 38 18 0 10 10 3.754047857744223 26.637912938086302 0.0 3 0.9845847869550521 9.927230950241697 51563.0 26.779119525634975 0.0 - - - - - - - 1425.0 103 1 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 293 37 B20140410_SF109_01 B20140410_SF109_01 TB497071.[MT7]-LSVSPPSLR.2y6_1.heavy 550.333 / 656.373 N/A 29.984100341796875 38 18 0 10 10 3.754047857744223 26.637912938086302 0.0 3 0.9845847869550521 9.927230950241697 72421.0 26.70431033678603 4.0 - - - - - - - 648.0 1254 1 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 295 38 B20140410_SF109_01 B20140410_SF109_01 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 914993.0 18.869699478149414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 914993.0 641.1403838993449 0.0 - - - - - - - 528.0 1829 1 297 38 B20140410_SF109_01 B20140410_SF109_01 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 1978840.0 18.869699478149414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1978840.0 2802.9046631022566 0.0 - - - - - - - 880.0 3957 1 299 38 B20140410_SF109_01 B20140410_SF109_01 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 667954.0 18.869699478149414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 667954.0 799.9682440515802 0.0 - - - - - - - 868.6 1335 5 301 39 B20140410_SF109_01 B20140410_SF109_01 TB238885.[MT7]-RAAGGGGPGGPGGSGDFLLIYLANLEAK[MT7].4b16_2.heavy 726.646 / 676.825 156190.0 41.553001403808594 41 11 10 10 10 1.1044448884087887 60.36214877386557 0.0 3 0.8612086587956157 3.273597071014262 156190.0 104.08336980785225 0.0 - - - - - - - 390.0 312 1 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 303 39 B20140410_SF109_01 B20140410_SF109_01 TB238885.[MT7]-RAAGGGGPGGPGGSGDFLLIYLANLEAK[MT7].4b10_1.heavy 726.646 / 882.466 27769.0 41.553001403808594 41 11 10 10 10 1.1044448884087887 60.36214877386557 0.0 3 0.8612086587956157 3.273597071014262 27769.0 16.554346120112637 0.0 - - - - - - - 1230.25 55 8 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 305 39 B20140410_SF109_01 B20140410_SF109_01 TB238885.[MT7]-RAAGGGGPGGPGGSGDFLLIYLANLEAK[MT7].4b18_2.heavy 726.646 / 806.901 245538.0 41.553001403808594 41 11 10 10 10 1.1044448884087887 60.36214877386557 0.0 3 0.8612086587956157 3.273597071014262 245538.0 172.40747506457728 0.0 - - - - - - - 219.0 491 4 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 307 39 B20140410_SF109_01 B20140410_SF109_01 TB238885.[MT7]-RAAGGGGPGGPGGSGDFLLIYLANLEAK[MT7].4b17_2.heavy 726.646 / 750.359 185907.0 41.553001403808594 41 11 10 10 10 1.1044448884087887 60.36214877386557 0.0 3 0.8612086587956157 3.273597071014262 185907.0 101.5066920449099 0.0 - - - - - - - 487.0 371 1 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 309 40 B20140410_SF109_01 B20140410_SF109_01 TB497413.[MT7]-SDLSVTVFLVLPSSLAFLPEAK[MT7].3b6_1.heavy 874.506 / 747.401 13353.0 46.77050018310547 41 14 10 7 10 2.79757758282577 35.74521064720295 0.02179718017578125 3 0.9350918278424978 4.817648497613881 13353.0 38.10268930200478 0.0 - - - - - - - 692.5384615384615 26 13 LOC100506590;LOC100508915 hypothetical protein LOC100506590;hypothetical protein LOC100508915 311 40 B20140410_SF109_01 B20140410_SF109_01 TB497413.[MT7]-SDLSVTVFLVLPSSLAFLPEAK[MT7].3y4_1.heavy 874.506 / 588.347 78581.0 46.77050018310547 41 14 10 7 10 2.79757758282577 35.74521064720295 0.02179718017578125 3 0.9350918278424978 4.817648497613881 78581.0 60.56984003423281 0.0 - - - - - - - 768.0769230769231 157 13 LOC100506590;LOC100508915 hypothetical protein LOC100506590;hypothetical protein LOC100508915 313 40 B20140410_SF109_01 B20140410_SF109_01 TB497413.[MT7]-SDLSVTVFLVLPSSLAFLPEAK[MT7].3b8_1.heavy 874.506 / 993.537 23634.0 46.77050018310547 41 14 10 7 10 2.79757758282577 35.74521064720295 0.02179718017578125 3 0.9350918278424978 4.817648497613881 23634.0 90.51864953554119 0.0 - - - - - - - 714.6428571428571 47 14 LOC100506590;LOC100508915 hypothetical protein LOC100506590;hypothetical protein LOC100508915 315 40 B20140410_SF109_01 B20140410_SF109_01 TB497413.[MT7]-SDLSVTVFLVLPSSLAFLPEAK[MT7].3b7_1.heavy 874.506 / 846.469 20648.0 46.77050018310547 41 14 10 7 10 2.79757758282577 35.74521064720295 0.02179718017578125 3 0.9350918278424978 4.817648497613881 20648.0 28.48081337637337 0.0 - - - - - - - 1206.3333333333333 41 9 LOC100506590;LOC100508915 hypothetical protein LOC100506590;hypothetical protein LOC100508915 317 41 B20140410_SF109_01 B20140410_SF109_01 TB497313.[MT7]-EITDQEHNVVALK[MT7].3b6_1.heavy 595.331 / 860.412 75836.0 27.29450035095215 40 10 10 10 10 0.9045103129892385 64.427397754808 0.0 3 0.8488807630805311 3.133827884766268 75836.0 136.65817811612317 0.0 - - - - - - - 696.7142857142857 151 7 LOC100132288 hypothetical protein LOC100132288 319 41 B20140410_SF109_01 B20140410_SF109_01 TB497313.[MT7]-EITDQEHNVVALK[MT7].3b4_1.heavy 595.331 / 603.311 74210.0 27.29450035095215 40 10 10 10 10 0.9045103129892385 64.427397754808 0.0 3 0.8488807630805311 3.133827884766268 74210.0 45.29024621122019 0.0 - - - - - - - 1315.4285714285713 148 7 LOC100132288 hypothetical protein LOC100132288 321 41 B20140410_SF109_01 B20140410_SF109_01 TB497313.[MT7]-EITDQEHNVVALK[MT7].3b5_1.heavy 595.331 / 731.369 37511.0 27.29450035095215 40 10 10 10 10 0.9045103129892385 64.427397754808 0.0 3 0.8488807630805311 3.133827884766268 37511.0 29.677641544952934 0.0 - - - - - - - 662.2222222222222 75 9 LOC100132288 hypothetical protein LOC100132288 323 41 B20140410_SF109_01 B20140410_SF109_01 TB497313.[MT7]-EITDQEHNVVALK[MT7].3y4_1.heavy 595.331 / 574.404 185255.0 27.29450035095215 40 10 10 10 10 0.9045103129892385 64.427397754808 0.0 3 0.8488807630805311 3.133827884766268 185255.0 70.17911484648269 0.0 - - - - - - - 948.0 370 1 LOC100132288 hypothetical protein LOC100132288 325 42 B20140410_SF109_01 B20140410_SF109_01 TB238245.[MT7]-NQIAAR.2b3_1.heavy 408.744 / 500.295 197592.0 18.820300102233887 23 9 0 6 8 1.2122207913179908 68.94162755399599 0.039600372314453125 4 0.8151837385427513 2.8253003970703694 197592.0 245.85666515735622 0.0 - - - - - - - 782.8571428571429 395 7 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 327 42 B20140410_SF109_01 B20140410_SF109_01 TB238245.[MT7]-NQIAAR.2y5_1.heavy 408.744 / 558.336 472.0 18.820300102233887 23 9 0 6 8 1.2122207913179908 68.94162755399599 0.039600372314453125 4 0.8151837385427513 2.8253003970703694 472.0 0.1420466608737684 29.0 - - - - - - - 707.25 35 8 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 329 42 B20140410_SF109_01 B20140410_SF109_01 TB238245.[MT7]-NQIAAR.2b4_1.heavy 408.744 / 571.332 343899.0 18.820300102233887 23 9 0 6 8 1.2122207913179908 68.94162755399599 0.039600372314453125 4 0.8151837385427513 2.8253003970703694 343899.0 589.902510015604 1.0 - - - - - - - 306.8 3969 5 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 331 42 B20140410_SF109_01 B20140410_SF109_01 TB238245.[MT7]-NQIAAR.2b5_1.heavy 408.744 / 642.369 180910.0 18.820300102233887 23 9 0 6 8 1.2122207913179908 68.94162755399599 0.039600372314453125 4 0.8151837385427513 2.8253003970703694 180910.0 175.92637981366258 0.0 - - - - - - - 413.0 361 1 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 333 43 B20140410_SF109_01 B20140410_SF109_01 TB376283.[MT7]-EFAEMTVMEMANK[MT7].3b6_1.heavy 606.961 / 853.388 17910.0 35.55164909362793 39 14 10 5 10 2.0479150347444985 43.197239375992865 0.043498992919921875 3 0.9305019297528764 4.654018470298983 17910.0 32.31798223289316 0.0 - - - - - - - 798.25 35 8 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 335 43 B20140410_SF109_01 B20140410_SF109_01 TB376283.[MT7]-EFAEMTVMEMANK[MT7].3b4_1.heavy 606.961 / 621.3 33599.0 35.55164909362793 39 14 10 5 10 2.0479150347444985 43.197239375992865 0.043498992919921875 3 0.9305019297528764 4.654018470298983 33599.0 31.737088784073688 0.0 - - - - - - - 1232.5 67 8 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 337 43 B20140410_SF109_01 B20140410_SF109_01 TB376283.[MT7]-EFAEMTVMEMANK[MT7].3b5_1.heavy 606.961 / 752.341 17910.0 35.55164909362793 39 14 10 5 10 2.0479150347444985 43.197239375992865 0.043498992919921875 3 0.9305019297528764 4.654018470298983 17910.0 12.522334572150276 0.0 - - - - - - - 417.0 35 1 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 339 43 B20140410_SF109_01 B20140410_SF109_01 TB376283.[MT7]-EFAEMTVMEMANK[MT7].3y5_1.heavy 606.961 / 736.378 18743.0 35.55164909362793 39 14 10 5 10 2.0479150347444985 43.197239375992865 0.043498992919921875 3 0.9305019297528764 4.654018470298983 18743.0 12.149675930869286 0.0 - - - - - - - 833.0 37 8 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 341 44 B20140410_SF109_01 B20140410_SF109_01 TB497315.[MT7]-NVLIEVNPQTRIPR.2y9_1.heavy 897.029 / 1080.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 343 44 B20140410_SF109_01 B20140410_SF109_01 TB497315.[MT7]-NVLIEVNPQTRIPR.2b4_1.heavy 897.029 / 584.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 345 44 B20140410_SF109_01 B20140410_SF109_01 TB497315.[MT7]-NVLIEVNPQTRIPR.2y10_1.heavy 897.029 / 1209.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 347 44 B20140410_SF109_01 B20140410_SF109_01 TB497315.[MT7]-NVLIEVNPQTRIPR.2b5_1.heavy 897.029 / 713.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 349 45 B20140410_SF109_01 B20140410_SF109_01 TB376286.[MT7]-GFWDYFSQTSGDK[MT7].3b4_1.heavy 609.293 / 650.305 147341.0 37.91680145263672 43 13 10 10 10 1.8906396684720523 47.92298091964722 0.0 3 0.9121085815695947 4.131956140784455 147341.0 92.68339783270957 0.0 - - - - - - - 655.1666666666666 294 6 APOA5 apolipoprotein A-V 351 45 B20140410_SF109_01 B20140410_SF109_01 TB376286.[MT7]-GFWDYFSQTSGDK[MT7].3b5_1.heavy 609.293 / 813.369 92547.0 37.91680145263672 43 13 10 10 10 1.8906396684720523 47.92298091964722 0.0 3 0.9121085815695947 4.131956140784455 92547.0 35.2597877620051 0.0 - - - - - - - 393.0 185 1 APOA5 apolipoprotein A-V 353 45 B20140410_SF109_01 B20140410_SF109_01 TB376286.[MT7]-GFWDYFSQTSGDK[MT7].3y4_1.heavy 609.293 / 550.295 94120.0 37.91680145263672 43 13 10 10 10 1.8906396684720523 47.92298091964722 0.0 3 0.9121085815695947 4.131956140784455 94120.0 42.49089154060187 0.0 - - - - - - - 918.0 188 1 APOA5 apolipoprotein A-V 355 45 B20140410_SF109_01 B20140410_SF109_01 TB376286.[MT7]-GFWDYFSQTSGDK[MT7].3y5_1.heavy 609.293 / 651.343 89925.0 37.91680145263672 43 13 10 10 10 1.8906396684720523 47.92298091964722 0.0 3 0.9121085815695947 4.131956140784455 89925.0 50.664170145037524 0.0 - - - - - - - 711.7142857142857 179 7 APOA5 apolipoprotein A-V 357 46 B20140410_SF109_01 B20140410_SF109_01 TB497419.[MT7]-SPELAAQPSTYLAVAEELADVSGK[MT7].4b7_1.heavy 684.365 / 841.454 80067.0 41.164100646972656 50 20 10 10 10 8.590313504948352 11.641018682542395 0.0 3 0.9962341755328386 20.10462373014865 80067.0 114.73329896874975 0.0 - - - - - - - 703.2857142857143 160 7 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 359 46 B20140410_SF109_01 B20140410_SF109_01 TB497419.[MT7]-SPELAAQPSTYLAVAEELADVSGK[MT7].4b4_1.heavy 684.365 / 571.321 75245.0 41.164100646972656 50 20 10 10 10 8.590313504948352 11.641018682542395 0.0 3 0.9962341755328386 20.10462373014865 75245.0 43.59678701347244 0.0 - - - - - - - 1808.0 150 1 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 361 46 B20140410_SF109_01 B20140410_SF109_01 TB497419.[MT7]-SPELAAQPSTYLAVAEELADVSGK[MT7].4b5_1.heavy 684.365 / 642.358 98652.0 41.164100646972656 50 20 10 10 10 8.590313504948352 11.641018682542395 0.0 3 0.9962341755328386 20.10462373014865 98652.0 116.0981929461921 0.0 - - - - - - - 703.0 197 3 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 363 46 B20140410_SF109_01 B20140410_SF109_01 TB497419.[MT7]-SPELAAQPSTYLAVAEELADVSGK[MT7].4b6_1.heavy 684.365 / 713.395 50230.0 41.164100646972656 50 20 10 10 10 8.590313504948352 11.641018682542395 0.0 3 0.9962341755328386 20.10462373014865 50230.0 87.17126501902436 0.0 - - - - - - - 281.2 100 5 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 365 47 B20140410_SF109_01 B20140410_SF109_01 TB376414.[MT7]-DTSEDLGLQC[CAM]DAVNLAFGRR.3b6_1.heavy 794.393 / 805.37 11995.0 34.65290069580078 41 11 10 10 10 0.8734292708957211 74.22899147142432 0.0 3 0.867365552439098 3.350524656546286 11995.0 21.6110633213859 0.0 - - - - - - - 753.1 23 10 LOC100509396 tektin-4 like protein LOC389833-like 367 47 B20140410_SF109_01 B20140410_SF109_01 TB376414.[MT7]-DTSEDLGLQC[CAM]DAVNLAFGRR.3b5_1.heavy 794.393 / 692.286 54816.0 34.65290069580078 41 11 10 10 10 0.8734292708957211 74.22899147142432 0.0 3 0.867365552439098 3.350524656546286 54816.0 83.9499841353781 0.0 - - - - - - - 794.8 109 10 LOC100509396 tektin-4 like protein LOC389833-like 369 47 B20140410_SF109_01 B20140410_SF109_01 TB376414.[MT7]-DTSEDLGLQC[CAM]DAVNLAFGRR.3y9_2.heavy 794.393 / 502.293 54677.0 34.65290069580078 41 11 10 10 10 0.8734292708957211 74.22899147142432 0.0 3 0.867365552439098 3.350524656546286 54677.0 65.76476968212452 0.0 - - - - - - - 279.0 109 1 LOC100509396 tektin-4 like protein LOC389833-like 371 47 B20140410_SF109_01 B20140410_SF109_01 TB376414.[MT7]-DTSEDLGLQC[CAM]DAVNLAFGRR.3b7_1.heavy 794.393 / 862.391 28315.0 34.65290069580078 41 11 10 10 10 0.8734292708957211 74.22899147142432 0.0 3 0.867365552439098 3.350524656546286 28315.0 49.39945684406936 0.0 - - - - - - - 743.7777777777778 56 9 LOC100509396 tektin-4 like protein LOC389833-like 373 48 B20140410_SF109_01 B20140410_SF109_01 TB238744.[MT7]-LQGSGVTVNALHPGVAR.3b6_1.heavy 607.347 / 686.395 41835.0 27.939199447631836 44 14 10 10 10 4.059023581096127 24.636466874872234 0.0 3 0.9359174410980444 4.848925181282233 41835.0 52.73844560260586 0.0 - - - - - - - 657.7142857142857 83 7 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 375 48 B20140410_SF109_01 B20140410_SF109_01 TB238744.[MT7]-LQGSGVTVNALHPGVAR.3y6_1.heavy 607.347 / 636.358 68015.0 27.939199447631836 44 14 10 10 10 4.059023581096127 24.636466874872234 0.0 3 0.9359174410980444 4.848925181282233 68015.0 55.26006240979083 0.0 - - - - - - - 740.0 136 8 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 377 48 B20140410_SF109_01 B20140410_SF109_01 TB238744.[MT7]-LQGSGVTVNALHPGVAR.3b5_1.heavy 607.347 / 587.327 26048.0 27.939199447631836 44 14 10 10 10 4.059023581096127 24.636466874872234 0.0 3 0.9359174410980444 4.848925181282233 26048.0 15.124481372286251 0.0 - - - - - - - 710.4 52 5 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 379 48 B20140410_SF109_01 B20140410_SF109_01 TB238744.[MT7]-LQGSGVTVNALHPGVAR.3b7_1.heavy 607.347 / 787.443 28153.0 27.939199447631836 44 14 10 10 10 4.059023581096127 24.636466874872234 0.0 3 0.9359174410980444 4.848925181282233 28153.0 32.163338023724485 0.0 - - - - - - - 237.0 56 5 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 381 49 B20140410_SF109_01 B20140410_SF109_01 TB238341.[MT7]-YFDGLK[MT7].2y4_1.heavy 515.794 / 576.347 43620.0 30.94029998779297 43 13 10 10 10 1.8289561376089647 44.1283816896524 0.0 3 0.9291642445538877 4.609337568189063 43620.0 25.968304073818437 0.0 - - - - - - - 906.0 87 1 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 383 49 B20140410_SF109_01 B20140410_SF109_01 TB238341.[MT7]-YFDGLK[MT7].2b3_1.heavy 515.794 / 570.268 117141.0 30.94029998779297 43 13 10 10 10 1.8289561376089647 44.1283816896524 0.0 3 0.9291642445538877 4.609337568189063 117141.0 47.07700443594944 0.0 - - - - - - - 2884.714285714286 234 7 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 385 49 B20140410_SF109_01 B20140410_SF109_01 TB238341.[MT7]-YFDGLK[MT7].2y5_1.heavy 515.794 / 723.416 94489.0 30.94029998779297 43 13 10 10 10 1.8289561376089647 44.1283816896524 0.0 3 0.9291642445538877 4.609337568189063 94489.0 92.29885761589404 0.0 - - - - - - - 1738.142857142857 188 7 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 387 49 B20140410_SF109_01 B20140410_SF109_01 TB238341.[MT7]-YFDGLK[MT7].2b4_1.heavy 515.794 / 627.289 14238.0 30.94029998779297 43 13 10 10 10 1.8289561376089647 44.1283816896524 0.0 3 0.9291642445538877 4.609337568189063 14238.0 8.315692262432009 2.0 - - - - - - - 906.0 38 1 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 389 50 B20140410_SF109_01 B20140410_SF109_01 TB238745.[MT7]-GFWDYFSQTSGDK[MT7].2b8_1.heavy 913.435 / 1175.53 1218.0 37.90620136260986 40 17 10 5 8 2.338443317816835 33.71863619618272 0.042400360107421875 4 0.9718945419382747 7.344201489344912 1218.0 2.8502772643253236 2.0 - - - - - - - 218.46153846153845 2 13 APOA5 apolipoprotein A-V 391 50 B20140410_SF109_01 B20140410_SF109_01 TB238745.[MT7]-GFWDYFSQTSGDK[MT7].2y4_1.heavy 913.435 / 550.295 3248.0 37.90620136260986 40 17 10 5 8 2.338443317816835 33.71863619618272 0.042400360107421875 4 0.9718945419382747 7.344201489344912 3248.0 7.77204335871296 0.0 - - - - - - - 257.1 6 10 APOA5 apolipoprotein A-V 393 50 B20140410_SF109_01 B20140410_SF109_01 TB238745.[MT7]-GFWDYFSQTSGDK[MT7].2y8_2.heavy 913.435 / 507.255 2707.0 37.90620136260986 40 17 10 5 8 2.338443317816835 33.71863619618272 0.042400360107421875 4 0.9718945419382747 7.344201489344912 2707.0 2.321253739544539 1.0 - - - - - - - 304.5 9 12 APOA5 apolipoprotein A-V 395 50 B20140410_SF109_01 B20140410_SF109_01 TB238745.[MT7]-GFWDYFSQTSGDK[MT7].2b4_1.heavy 913.435 / 650.305 19219.0 37.90620136260986 40 17 10 5 8 2.338443317816835 33.71863619618272 0.042400360107421875 4 0.9718945419382747 7.344201489344912 19219.0 45.97183252944211 0.0 - - - - - - - 300.8888888888889 38 9 APOA5 apolipoprotein A-V 397 51 B20140410_SF109_01 B20140410_SF109_01 TB238742.[MT7]-STNC[CAM]FDIIMDAIK[MT7].3b6_1.heavy 605.979 / 869.358 46326.0 39.790199279785156 43 13 10 10 10 2.2465384671671647 44.51292575733092 0.0 3 0.908442005034443 4.047096602276291 46326.0 102.14605741087499 0.0 - - - - - - - 319.90909090909093 92 11 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 399 51 B20140410_SF109_01 B20140410_SF109_01 TB238742.[MT7]-STNC[CAM]FDIIMDAIK[MT7].3y4_1.heavy 605.979 / 590.363 32839.0 39.790199279785156 43 13 10 10 10 2.2465384671671647 44.51292575733092 0.0 3 0.908442005034443 4.047096602276291 32839.0 35.42898509670198 0.0 - - - - - - - 195.33333333333334 65 3 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 401 51 B20140410_SF109_01 B20140410_SF109_01 TB238742.[MT7]-STNC[CAM]FDIIMDAIK[MT7].3b7_1.heavy 605.979 / 982.442 15246.0 39.790199279785156 43 13 10 10 10 2.2465384671671647 44.51292575733092 0.0 3 0.908442005034443 4.047096602276291 15246.0 83.10844077484917 0.0 - - - - - - - 207.46153846153845 30 13 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 403 51 B20140410_SF109_01 B20140410_SF109_01 TB238742.[MT7]-STNC[CAM]FDIIMDAIK[MT7].3y5_1.heavy 605.979 / 721.404 33660.0 39.790199279785156 43 13 10 10 10 2.2465384671671647 44.51292575733092 0.0 3 0.908442005034443 4.047096602276291 33660.0 54.19565217391305 0.0 - - - - - - - 787.4285714285714 67 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 405 52 B20140410_SF109_01 B20140410_SF109_01 TB238441.[MT7]-GVWK[MT7]LRR.2y4_1.heavy 601.89 / 716.501 9306.0 35.63140106201172 30 17 2 5 6 2.441651390691669 32.013460071519916 0.043498992919921875 5 0.9751211558074516 7.808052755854173 9306.0 6.253737823967328 2.0 - - - - - - - 417.0 44 1 ADAT1 adenosine deaminase, tRNA-specific 1 407 52 B20140410_SF109_01 B20140410_SF109_01 TB238441.[MT7]-GVWK[MT7]LRR.2y5_1.heavy 601.89 / 902.581 19584.0 35.63140106201172 30 17 2 5 6 2.441651390691669 32.013460071519916 0.043498992919921875 5 0.9751211558074516 7.808052755854173 19584.0 45.908165225744476 0.0 - - - - - - - 231.66666666666666 39 9 ADAT1 adenosine deaminase, tRNA-specific 1 409 52 B20140410_SF109_01 B20140410_SF109_01 TB238441.[MT7]-GVWK[MT7]LRR.2y3_1.heavy 601.89 / 444.304 N/A 35.63140106201172 30 17 2 5 6 2.441651390691669 32.013460071519916 0.043498992919921875 5 0.9751211558074516 7.808052755854173 0.0 0.0 34.0 - - - - - - - 786.6666666666666 84 3 ADAT1 adenosine deaminase, tRNA-specific 1 411 52 B20140410_SF109_01 B20140410_SF109_01 TB238441.[MT7]-GVWK[MT7]LRR.2y6_1.heavy 601.89 / 1001.65 6250.0 35.63140106201172 30 17 2 5 6 2.441651390691669 32.013460071519916 0.043498992919921875 5 0.9751211558074516 7.808052755854173 6250.0 12.981744234242235 0.0 - - - - - - - 312.75 12 12 ADAT1 adenosine deaminase, tRNA-specific 1 413 53 B20140410_SF109_01 B20140410_SF109_01 TB375988.[MT7]-QVDMWQTR.2y6_1.heavy 604.304 / 836.372 7752.0 28.805599212646484 38 18 10 10 0 5.3797048093918995 18.588380504710926 0.0 34 0.9857938601300429 10.34210267184108 7752.0 16.84576624235411 0.0 - - - - - - - 624.375 15 8 TMEM65 transmembrane protein 65 415 53 B20140410_SF109_01 B20140410_SF109_01 TB375988.[MT7]-QVDMWQTR.2y4_1.heavy 604.304 / 590.305 N/A 28.805599212646484 38 18 10 10 0 5.3797048093918995 18.588380504710926 0.0 34 0.9857938601300429 10.34210267184108 6175.0 1.8799765807962527 17.0 - - - - - - - 1314.0 17 1 TMEM65 transmembrane protein 65 417 53 B20140410_SF109_01 B20140410_SF109_01 TB375988.[MT7]-QVDMWQTR.2y5_1.heavy 604.304 / 721.345 22993.0 28.805599212646484 38 18 10 10 0 5.3797048093918995 18.588380504710926 0.0 34 0.9857938601300429 10.34210267184108 22993.0 32.497242584701944 0.0 - - - - - - - 733.5833333333334 45 12 TMEM65 transmembrane protein 65 419 53 B20140410_SF109_01 B20140410_SF109_01 TB375988.[MT7]-QVDMWQTR.2y7_1.heavy 604.304 / 935.44 16292.0 28.805599212646484 38 18 10 10 0 5.3797048093918995 18.588380504710926 0.0 34 0.9857938601300429 10.34210267184108 16292.0 118.07716018924332 0.0 - - - - - - - 286.6363636363636 32 11 TMEM65 transmembrane protein 65 421 54 B20140410_SF109_01 B20140410_SF109_01 TB238740.[MT7]-TLTSQGVDDFLQAK[MT7].3b9_1.heavy 604.331 / 1061.52 83226.0 33.91709899902344 46 16 10 10 10 2.102718240212889 37.910583954720465 0.0 3 0.9614455726066048 6.264983636829239 83226.0 233.77418103448275 0.0 - - - - - - - 278.3636363636364 166 11 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 423 54 B20140410_SF109_01 B20140410_SF109_01 TB238740.[MT7]-TLTSQGVDDFLQAK[MT7].3b6_1.heavy 604.331 / 732.401 148081.0 33.91709899902344 46 16 10 10 10 2.102718240212889 37.910583954720465 0.0 3 0.9614455726066048 6.264983636829239 148081.0 96.5891255099073 0.0 - - - - - - - 1652.625 296 8 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 425 54 B20140410_SF109_01 B20140410_SF109_01 TB238740.[MT7]-TLTSQGVDDFLQAK[MT7].3b4_1.heavy 604.331 / 547.321 58731.0 33.91709899902344 46 16 10 10 10 2.102718240212889 37.910583954720465 0.0 3 0.9614455726066048 6.264983636829239 58731.0 37.76772982238805 0.0 - - - - - - - 1113.0 117 2 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 427 54 B20140410_SF109_01 B20140410_SF109_01 TB238740.[MT7]-TLTSQGVDDFLQAK[MT7].3y4_1.heavy 604.331 / 603.395 142653.0 33.91709899902344 46 16 10 10 10 2.102718240212889 37.910583954720465 0.0 3 0.9614455726066048 6.264983636829239 142653.0 60.96227829003409 1.0 - - - - - - - 835.0 285 1 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 429 55 B20140410_SF109_01 B20140410_SF109_01 TB376078.[MT7]-LDTYQEYK[MT7].2b4_1.heavy 674.355 / 637.331 3586.0 27.070600509643555 48 18 10 10 10 4.5078606744269605 22.183471766840267 0.0 3 0.98930397710905 11.92239056070988 3586.0 7.9218809570735935 2.0 - - - - - - - 758.75 7 8 ADAT1 adenosine deaminase, tRNA-specific 1 431 55 B20140410_SF109_01 B20140410_SF109_01 TB376078.[MT7]-LDTYQEYK[MT7].2b6_1.heavy 674.355 / 894.432 4138.0 27.070600509643555 48 18 10 10 10 4.5078606744269605 22.183471766840267 0.0 3 0.98930397710905 11.92239056070988 4138.0 47.077246376811594 0.0 - - - - - - - 199.33333333333334 8 9 ADAT1 adenosine deaminase, tRNA-specific 1 433 55 B20140410_SF109_01 B20140410_SF109_01 TB376078.[MT7]-LDTYQEYK[MT7].2y3_1.heavy 674.355 / 583.321 4138.0 27.070600509643555 48 18 10 10 10 4.5078606744269605 22.183471766840267 0.0 3 0.98930397710905 11.92239056070988 4138.0 3.8010797393152376 0.0 - - - - - - - 689.8571428571429 8 7 ADAT1 adenosine deaminase, tRNA-specific 1 435 55 B20140410_SF109_01 B20140410_SF109_01 TB376078.[MT7]-LDTYQEYK[MT7].2y7_1.heavy 674.355 / 1090.52 5241.0 27.070600509643555 48 18 10 10 10 4.5078606744269605 22.183471766840267 0.0 3 0.98930397710905 11.92239056070988 5241.0 21.109583333333333 0.0 - - - - - - - 238.36363636363637 10 11 ADAT1 adenosine deaminase, tRNA-specific 1 437 56 B20140410_SF109_01 B20140410_SF109_01 TB238741.[MT7]-TLTSQGVDDFLQAK[MT7].2y5_1.heavy 905.993 / 750.463 7952.0 33.91709899902344 47 17 10 10 10 4.5370618331438655 22.040695868300965 0.0 3 0.973016744631745 7.496072429843975 7952.0 11.719051068559681 0.0 - - - - - - - 761.1818181818181 15 11 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 439 56 B20140410_SF109_01 B20140410_SF109_01 TB238741.[MT7]-TLTSQGVDDFLQAK[MT7].2y9_1.heavy 905.993 / 1136.61 8510.0 33.91709899902344 47 17 10 10 10 4.5370618331438655 22.040695868300965 0.0 3 0.973016744631745 7.496072429843975 8510.0 68.12357398873529 0.0 - - - - - - - 228.54545454545453 17 11 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 441 56 B20140410_SF109_01 B20140410_SF109_01 TB238741.[MT7]-TLTSQGVDDFLQAK[MT7].2b6_1.heavy 905.993 / 732.401 4743.0 33.91709899902344 47 17 10 10 10 4.5370618331438655 22.040695868300965 0.0 3 0.973016744631745 7.496072429843975 4743.0 12.45584725536993 0.0 - - - - - - - 819.75 9 8 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 443 56 B20140410_SF109_01 B20140410_SF109_01 TB238741.[MT7]-TLTSQGVDDFLQAK[MT7].2b9_1.heavy 905.993 / 1061.52 5720.0 33.91709899902344 47 17 10 10 10 4.5370618331438655 22.040695868300965 0.0 3 0.973016744631745 7.496072429843975 5720.0 31.421075953156947 0.0 - - - - - - - 254.0 11 11 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 445 57 B20140410_SF109_01 B20140410_SF109_01 TB497310.[MT7]-SVLQGGVYPPLPGGGAR.3y6_1.heavy 590.332 / 514.273 161511.0 32.59239959716797 48 18 10 10 10 3.3933421862407736 20.15765008041546 0.0 3 0.9856778007435897 10.300013879051697 161511.0 64.27720880216337 0.0 - - - - - - - 2725.25 323 4 LOC100507338 hypothetical protein LOC100507338 447 57 B20140410_SF109_01 B20140410_SF109_01 TB497310.[MT7]-SVLQGGVYPPLPGGGAR.3b6_1.heavy 590.332 / 686.395 156326.0 32.59239959716797 48 18 10 10 10 3.3933421862407736 20.15765008041546 0.0 3 0.9856778007435897 10.300013879051697 156326.0 44.0463253797512 0.0 - - - - - - - 1462.0 312 1 LOC100507338 hypothetical protein LOC100507338 449 57 B20140410_SF109_01 B20140410_SF109_01 TB497310.[MT7]-SVLQGGVYPPLPGGGAR.3y8_1.heavy 590.332 / 724.41 153801.0 32.59239959716797 48 18 10 10 10 3.3933421862407736 20.15765008041546 0.0 3 0.9856778007435897 10.300013879051697 153801.0 69.52982080586821 0.0 - - - - - - - 1262.5 307 2 LOC100507338 hypothetical protein LOC100507338 451 57 B20140410_SF109_01 B20140410_SF109_01 TB497310.[MT7]-SVLQGGVYPPLPGGGAR.3y9_1.heavy 590.332 / 821.463 168556.0 32.59239959716797 48 18 10 10 10 3.3933421862407736 20.15765008041546 0.0 3 0.9856778007435897 10.300013879051697 168556.0 66.20089423427878 0.0 - - - - - - - 1462.0 337 1 LOC100507338 hypothetical protein LOC100507338 453 58 B20140410_SF109_01 B20140410_SF109_01 TB497311.[MT7]-RQLAVQSLAFNLK[MT7].2y4_1.heavy 888.54 / 665.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 455 58 B20140410_SF109_01 B20140410_SF109_01 TB497311.[MT7]-RQLAVQSLAFNLK[MT7].2y3_1.heavy 888.54 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 457 58 B20140410_SF109_01 B20140410_SF109_01 TB497311.[MT7]-RQLAVQSLAFNLK[MT7].2b9_1.heavy 888.54 / 1111.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 459 58 B20140410_SF109_01 B20140410_SF109_01 TB497311.[MT7]-RQLAVQSLAFNLK[MT7].2y7_1.heavy 888.54 / 936.563 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 461 59 B20140410_SF109_01 B20140410_SF109_01 TB238445.[MT7]-SIREFAAK[MT7].3b6_1.heavy 403.911 / 848.475 N/A 25.19029998779297 44 14 10 10 10 1.9035057505530717 43.07202364067312 0.0 3 0.9344580915611125 4.794041164981121 0.0 0.0 9.0 - - - - - - - 0.0 0 0 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 463 59 B20140410_SF109_01 B20140410_SF109_01 TB238445.[MT7]-SIREFAAK[MT7].3y7_2.heavy 403.911 / 489.796 29738.0 25.19029998779297 44 14 10 10 10 1.9035057505530717 43.07202364067312 0.0 3 0.9344580915611125 4.794041164981121 29738.0 37.295832780358324 0.0 - - - - - - - 782.8571428571429 59 7 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 465 59 B20140410_SF109_01 B20140410_SF109_01 TB238445.[MT7]-SIREFAAK[MT7].3y4_1.heavy 403.911 / 580.357 16856.0 25.19029998779297 44 14 10 10 10 1.9035057505530717 43.07202364067312 0.0 3 0.9344580915611125 4.794041164981121 16856.0 49.829781021897816 0.0 - - - - - - - 671.3 33 10 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 467 59 B20140410_SF109_01 B20140410_SF109_01 TB238445.[MT7]-SIREFAAK[MT7].3y5_1.heavy 403.911 / 709.4 10552.0 25.19029998779297 44 14 10 10 10 1.9035057505530717 43.07202364067312 0.0 3 0.9344580915611125 4.794041164981121 10552.0 52.6316301703163 0.0 - - - - - - - 228.33333333333334 21 12 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 469 60 B20140410_SF109_01 B20140410_SF109_01 TB376070.[MT7]-LSEMIVPENR.2y4_1.heavy 666.359 / 515.257 52346.0 31.159000396728516 41 11 10 10 10 0.9122666488307507 73.07804878333886 0.0 3 0.8658901535324283 3.3316125656120192 52346.0 49.614062654986405 0.0 - - - - - - - 1224.0 104 10 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 471 60 B20140410_SF109_01 B20140410_SF109_01 TB376070.[MT7]-LSEMIVPENR.2b4_1.heavy 666.359 / 605.308 36851.0 31.159000396728516 41 11 10 10 10 0.9122666488307507 73.07804878333886 0.0 3 0.8658901535324283 3.3316125656120192 36851.0 29.56567838036171 0.0 - - - - - - - 1242.909090909091 73 11 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 473 60 B20140410_SF109_01 B20140410_SF109_01 TB376070.[MT7]-LSEMIVPENR.2y9_1.heavy 666.359 / 1074.52 29689.0 31.159000396728516 41 11 10 10 10 0.9122666488307507 73.07804878333886 0.0 3 0.8658901535324283 3.3316125656120192 29689.0 19.948860849429778 1.0 - - - - - - - 706.8571428571429 73 7 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 475 60 B20140410_SF109_01 B20140410_SF109_01 TB376070.[MT7]-LSEMIVPENR.2y7_1.heavy 666.359 / 858.45 23178.0 31.159000396728516 41 11 10 10 10 0.9122666488307507 73.07804878333886 0.0 3 0.8658901535324283 3.3316125656120192 23178.0 23.013887120788894 0.0 - - - - - - - 800.1428571428571 46 7 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 477 61 B20140410_SF109_01 B20140410_SF109_01 TB238440.[MT7]-LQHHLHK[MT7].3y3_1.heavy 400.912 / 541.358 34320.0 19.20359992980957 43 13 10 10 10 1.0522367615307735 55.118712353537525 0.0 3 0.9192150828280963 4.312501230848148 34320.0 88.46558220337072 0.0 - - - - - - - 634.4166666666666 68 12 LOC100132288 hypothetical protein LOC100132288 479 61 B20140410_SF109_01 B20140410_SF109_01 TB238440.[MT7]-LQHHLHK[MT7].3b4_1.heavy 400.912 / 660.37 10087.0 19.20359992980957 43 13 10 10 10 1.0522367615307735 55.118712353537525 0.0 3 0.9192150828280963 4.312501230848148 10087.0 40.901843294398496 0.0 - - - - - - - 250.8181818181818 20 22 LOC100132288 hypothetical protein LOC100132288 481 61 B20140410_SF109_01 B20140410_SF109_01 TB238440.[MT7]-LQHHLHK[MT7].3b3_1.heavy 400.912 / 523.311 46374.0 19.20359992980957 43 13 10 10 10 1.0522367615307735 55.118712353537525 0.0 3 0.9192150828280963 4.312501230848148 46374.0 141.40289737687215 0.0 - - - - - - - 672.4 92 10 LOC100132288 hypothetical protein LOC100132288 483 61 B20140410_SF109_01 B20140410_SF109_01 TB238440.[MT7]-LQHHLHK[MT7].3b4_2.heavy 400.912 / 330.689 46564.0 19.20359992980957 43 13 10 10 10 1.0522367615307735 55.118712353537525 0.0 3 0.9192150828280963 4.312501230848148 46564.0 74.8672116319948 0.0 - - - - - - - 659.8 93 10 LOC100132288 hypothetical protein LOC100132288 485 62 B20140410_SF109_01 B20140410_SF109_01 TB238343.[MT7]-VYNIHSR.2b3_1.heavy 516.789 / 521.284 5512.0 21.847000122070312 41 17 10 10 4 7.275396505446333 13.74495533338154 0.0 8 0.9780251165552444 8.309991097048172 5512.0 8.223246066264757 3.0 - - - - - - - 740.5 35 10 BRI3 brain protein I3 487 62 B20140410_SF109_01 B20140410_SF109_01 TB238343.[MT7]-VYNIHSR.2y5_1.heavy 516.789 / 626.337 9378.0 21.847000122070312 41 17 10 10 4 7.275396505446333 13.74495533338154 0.0 8 0.9780251165552444 8.309991097048172 9378.0 15.388305812746754 0.0 - - - - - - - 740.3 18 10 BRI3 brain protein I3 489 62 B20140410_SF109_01 B20140410_SF109_01 TB238343.[MT7]-VYNIHSR.2b4_1.heavy 516.789 / 634.368 6417.0 21.847000122070312 41 17 10 10 4 7.275396505446333 13.74495533338154 0.0 8 0.9780251165552444 8.309991097048172 6417.0 2.320016207455429 6.0 - - - - - - - 1840.625 38 8 BRI3 brain protein I3 491 62 B20140410_SF109_01 B20140410_SF109_01 TB238343.[MT7]-VYNIHSR.2y6_1.heavy 516.789 / 789.4 34469.0 21.847000122070312 41 17 10 10 4 7.275396505446333 13.74495533338154 0.0 8 0.9780251165552444 8.309991097048172 34469.0 49.241428571428564 1.0 - - - - - - - 784.7692307692307 74 13 BRI3 brain protein I3 493 63 B20140410_SF109_01 B20140410_SF109_01 TB238873.[MT7]-RNFEDLGNHLTELETIYVTK[MT7].4y4_1.heavy 670.86 / 654.394 78864.0 35.17879867553711 35 5 10 10 10 1.3391469070901423 67.69000239385596 0.0 3 0.697423375264307 2.184390751543949 78864.0 52.21645022651105 0.0 - - - - - - - 2182.1428571428573 157 7 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 495 63 B20140410_SF109_01 B20140410_SF109_01 TB238873.[MT7]-RNFEDLGNHLTELETIYVTK[MT7].4b8_1.heavy 670.86 / 1090.54 11108.0 35.17879867553711 35 5 10 10 10 1.3391469070901423 67.69000239385596 0.0 3 0.697423375264307 2.184390751543949 11108.0 103.88776978417266 0.0 - - - - - - - 231.66666666666666 22 12 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 497 63 B20140410_SF109_01 B20140410_SF109_01 TB238873.[MT7]-RNFEDLGNHLTELETIYVTK[MT7].4b5_1.heavy 670.86 / 806.391 15551.0 35.17879867553711 35 5 10 10 10 1.3391469070901423 67.69000239385596 0.0 3 0.697423375264307 2.184390751543949 15551.0 17.04588732452981 0.0 - - - - - - - 694.0 31 7 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 499 63 B20140410_SF109_01 B20140410_SF109_01 TB238873.[MT7]-RNFEDLGNHLTELETIYVTK[MT7].4b9_2.heavy 670.86 / 614.303 18189.0 35.17879867553711 35 5 10 10 10 1.3391469070901423 67.69000239385596 0.0 3 0.697423375264307 2.184390751543949 18189.0 7.797067901234568 0.0 - - - - - - - 1824.857142857143 36 7 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 501 64 B20140410_SF109_01 B20140410_SF109_01 TB497405.[MT7]-ILSVLQNFREQNVFYDFK[MT7].4y4_1.heavy 637.851 / 716.374 73933.0 41.63970184326172 43 13 10 10 10 1.0269366048098343 55.87067428298694 0.0 3 0.9122067893826645 4.1343015185415215 73933.0 80.01237135278514 0.0 - - - - - - - 376.6666666666667 147 3 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 503 64 B20140410_SF109_01 B20140410_SF109_01 TB497405.[MT7]-ILSVLQNFREQNVFYDFK[MT7].4b12_2.heavy 637.851 / 793.942 108381.0 41.63970184326172 43 13 10 10 10 1.0269366048098343 55.87067428298694 0.0 3 0.9122067893826645 4.1343015185415215 108381.0 90.37125486943157 0.0 - - - - - - - 308.25 216 4 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 505 64 B20140410_SF109_01 B20140410_SF109_01 TB497405.[MT7]-ILSVLQNFREQNVFYDFK[MT7].4b4_1.heavy 637.851 / 557.378 42571.0 41.63970184326172 43 13 10 10 10 1.0269366048098343 55.87067428298694 0.0 3 0.9122067893826645 4.1343015185415215 42571.0 82.92413551372384 0.0 - - - - - - - 673.0 85 11 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 507 64 B20140410_SF109_01 B20140410_SF109_01 TB497405.[MT7]-ILSVLQNFREQNVFYDFK[MT7].4y3_1.heavy 637.851 / 553.31 80617.0 41.63970184326172 43 13 10 10 10 1.0269366048098343 55.87067428298694 0.0 3 0.9122067893826645 4.1343015185415215 80617.0 46.56948975387618 0.0 - - - - - - - 1630.2857142857142 161 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 509 65 B20140410_SF109_01 B20140410_SF109_01 TB376408.[MT7]-IIEEEERVDILINNAGVMR.3y18_2.heavy 786.425 / 1050.54 125578.0 37.17660140991211 41 11 10 10 10 1.0455437735278983 59.73496196956877 0.0 3 0.8709548087691972 3.39786844918211 125578.0 333.5215712961924 0.0 - - - - - - - 243.0 251 5 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 511 65 B20140410_SF109_01 B20140410_SF109_01 TB376408.[MT7]-IIEEEERVDILINNAGVMR.3y8_1.heavy 786.425 / 874.456 36323.0 37.17660140991211 41 11 10 10 10 1.0455437735278983 59.73496196956877 0.0 3 0.8709548087691972 3.39786844918211 36323.0 69.91697037037036 0.0 - - - - - - - 694.2857142857143 72 7 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 513 65 B20140410_SF109_01 B20140410_SF109_01 TB376408.[MT7]-IIEEEERVDILINNAGVMR.3y10_1.heavy 786.425 / 1100.62 34973.0 37.17660140991211 41 11 10 10 10 1.0455437735278983 59.73496196956877 0.0 3 0.8709548087691972 3.39786844918211 34973.0 262.9451481481481 0.0 - - - - - - - 157.5 69 6 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 515 65 B20140410_SF109_01 B20140410_SF109_01 TB376408.[MT7]-IIEEEERVDILINNAGVMR.3y9_1.heavy 786.425 / 987.54 21605.0 37.17660140991211 41 11 10 10 10 1.0455437735278983 59.73496196956877 0.0 3 0.8709548087691972 3.39786844918211 21605.0 47.64531216931217 0.0 - - - - - - - 783.0 43 10 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 517 66 B20140410_SF109_01 B20140410_SF109_01 TB497402.[MT7]-LFLEEFERIWEQFNPTK[MT7].4b8_2.heavy 629.337 / 604.825 3628.0 47.02254867553711 41 13 10 8 10 1.2379384403783829 47.64886511932236 0.0196990966796875 3 0.91994110837172 4.332281465425536 3628.0 44.86236559139785 0.0 - - - - - - - 109.9090909090909 7 22 PLD6 phospholipase D family, member 6 519 66 B20140410_SF109_01 B20140410_SF109_01 TB497402.[MT7]-LFLEEFERIWEQFNPTK[MT7].4b11_2.heavy 629.337 / 818.928 8744.0 47.02254867553711 41 13 10 8 10 1.2379384403783829 47.64886511932236 0.0196990966796875 3 0.91994110837172 4.332281465425536 8744.0 163.19447004608296 0.0 - - - - - - - 156.47619047619048 17 21 PLD6 phospholipase D family, member 6 521 66 B20140410_SF109_01 B20140410_SF109_01 TB497402.[MT7]-LFLEEFERIWEQFNPTK[MT7].4b4_1.heavy 629.337 / 647.388 4372.0 47.02254867553711 41 13 10 8 10 1.2379384403783829 47.64886511932236 0.0196990966796875 3 0.91994110837172 4.332281465425536 4372.0 16.09762137504073 0.0 - - - - - - - 222.53571428571428 8 28 PLD6 phospholipase D family, member 6 523 66 B20140410_SF109_01 B20140410_SF109_01 TB497402.[MT7]-LFLEEFERIWEQFNPTK[MT7].4b3_1.heavy 629.337 / 518.346 3659.0 47.02254867553711 41 13 10 8 10 1.2379384403783829 47.64886511932236 0.0196990966796875 3 0.91994110837172 4.332281465425536 3659.0 6.227161564082676 2.0 - - - - - - - 228.07142857142858 7 28 PLD6 phospholipase D family, member 6 525 67 B20140410_SF109_01 B20140410_SF109_01 TB497401.[MT7]-EIEWDDLAQLPFLTMC[CAM]LK[MT7].4y5_1.heavy 628.328 / 796.418 6756.0 45.44139862060547 44 14 10 10 10 1.274085659822762 46.18280876383074 0.0 3 0.9378858946091199 4.925986548457994 6756.0 23.651552191124384 0.0 - - - - - - - 264.8421052631579 13 19 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 527 67 B20140410_SF109_01 B20140410_SF109_01 TB497401.[MT7]-EIEWDDLAQLPFLTMC[CAM]LK[MT7].4y3_1.heavy 628.328 / 564.33 18590.0 45.44139862060547 44 14 10 10 10 1.274085659822762 46.18280876383074 0.0 3 0.9378858946091199 4.925986548457994 18590.0 46.32312091503268 0.0 - - - - - - - 719.625 37 8 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 529 67 B20140410_SF109_01 B20140410_SF109_01 TB497401.[MT7]-EIEWDDLAQLPFLTMC[CAM]LK[MT7].4b3_1.heavy 628.328 / 516.279 11018.0 45.44139862060547 44 14 10 10 10 1.274085659822762 46.18280876383074 0.0 3 0.9378858946091199 4.925986548457994 11018.0 13.123400207296623 0.0 - - - - - - - 760.5555555555555 22 9 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 531 67 B20140410_SF109_01 B20140410_SF109_01 TB497401.[MT7]-EIEWDDLAQLPFLTMC[CAM]LK[MT7].4b6_1.heavy 628.328 / 932.412 16187.0 45.44139862060547 44 14 10 10 10 1.274085659822762 46.18280876383074 0.0 3 0.9378858946091199 4.925986548457994 16187.0 58.982325001780254 0.0 - - - - - - - 667.0 32 7 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 533 68 B20140410_SF109_01 B20140410_SF109_01 TB497400.[MT7]-AFAGTGTEEGAGPDPQMLSEEVR.3y7_1.heavy 831.728 / 863.429 39843.0 31.54560089111328 46 16 10 10 10 2.541594433481468 39.345380475601814 0.0 3 0.9605416027409026 6.192330931608181 39843.0 41.95210118139947 0.0 - - - - - - - 716.5714285714286 79 7 APOA5 apolipoprotein A-V 535 68 B20140410_SF109_01 B20140410_SF109_01 TB497400.[MT7]-AFAGTGTEEGAGPDPQMLSEEVR.3y6_1.heavy 831.728 / 732.389 60028.0 31.54560089111328 46 16 10 10 10 2.541594433481468 39.345380475601814 0.0 3 0.9605416027409026 6.192330931608181 60028.0 13.450498091477003 1.0 - - - - - - - 1253.0 121 8 APOA5 apolipoprotein A-V 537 68 B20140410_SF109_01 B20140410_SF109_01 TB497400.[MT7]-AFAGTGTEEGAGPDPQMLSEEVR.3y5_1.heavy 831.728 / 619.305 54751.0 31.54560089111328 46 16 10 10 10 2.541594433481468 39.345380475601814 0.0 3 0.9605416027409026 6.192330931608181 54751.0 46.748633493938925 0.0 - - - - - - - 697.7142857142857 109 7 APOA5 apolipoprotein A-V 539 68 B20140410_SF109_01 B20140410_SF109_01 TB497400.[MT7]-AFAGTGTEEGAGPDPQMLSEEVR.3y9_1.heavy 831.728 / 1088.54 82851.0 31.54560089111328 46 16 10 10 10 2.541594433481468 39.345380475601814 0.0 3 0.9605416027409026 6.192330931608181 82851.0 107.99038063315723 0.0 - - - - - - - 247.5 165 8 APOA5 apolipoprotein A-V 541 69 B20140410_SF109_01 B20140410_SF109_01 TB497060.[MT7]-IIEEEER.2y4_1.heavy 531.283 / 562.247 4960.0 24.894100189208984 48 18 10 10 10 4.865316385745471 20.55364791752959 0.0 3 0.980480516954857 8.818997887965157 4960.0 12.790674732397285 1.0 - - - - - - - 701.625 9 8 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 543 69 B20140410_SF109_01 B20140410_SF109_01 TB497060.[MT7]-IIEEEER.2y5_1.heavy 531.283 / 691.289 12270.0 24.894100189208984 48 18 10 10 10 4.865316385745471 20.55364791752959 0.0 3 0.980480516954857 8.818997887965157 12270.0 20.72031609195402 0.0 - - - - - - - 671.2857142857143 24 7 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 545 69 B20140410_SF109_01 B20140410_SF109_01 TB497060.[MT7]-IIEEEER.2b4_1.heavy 531.283 / 629.363 8093.0 24.894100189208984 48 18 10 10 10 4.865316385745471 20.55364791752959 0.0 3 0.980480516954857 8.818997887965157 8093.0 9.198939974457215 0.0 - - - - - - - 1223.625 16 8 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 547 69 B20140410_SF109_01 B20140410_SF109_01 TB497060.[MT7]-IIEEEER.2y6_1.heavy 531.283 / 804.373 24148.0 24.894100189208984 48 18 10 10 10 4.865316385745471 20.55364791752959 0.0 3 0.980480516954857 8.818997887965157 24148.0 53.75772784575453 1.0 - - - - - - - 261.0 48 2 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 549 70 B20140410_SF109_01 B20140410_SF109_01 TB497063.[MT7]-LLEGEESR.2b3_1.heavy 538.789 / 500.32 29793.0 26.122100830078125 48 18 10 10 10 7.914760362705343 12.634621317305305 0.0 3 0.980289040543423 8.77591750334293 29793.0 14.434507819548486 0.0 - - - - - - - 835.0 59 1 DES;KRT7;KRT8;KRT84;PRPH;VIM desmin;keratin 7;keratin 8;keratin 84;peripherin;vimentin 551 70 B20140410_SF109_01 B20140410_SF109_01 TB497063.[MT7]-LLEGEESR.2y5_1.heavy 538.789 / 577.258 31185.0 26.122100830078125 48 18 10 10 10 7.914760362705343 12.634621317305305 0.0 3 0.980289040543423 8.77591750334293 31185.0 45.94461837172405 0.0 - - - - - - - 418.0 62 3 DES;KRT7;KRT8;KRT84;PRPH;VIM desmin;keratin 7;keratin 8;keratin 84;peripherin;vimentin 553 70 B20140410_SF109_01 B20140410_SF109_01 TB497063.[MT7]-LLEGEESR.2y6_1.heavy 538.789 / 706.3 32995.0 26.122100830078125 48 18 10 10 10 7.914760362705343 12.634621317305305 0.0 3 0.980289040543423 8.77591750334293 32995.0 20.26416486374193 0.0 - - - - - - - 348.0 65 4 DES;KRT7;KRT8;KRT84;PRPH;VIM desmin;keratin 7;keratin 8;keratin 84;peripherin;vimentin 555 70 B20140410_SF109_01 B20140410_SF109_01 TB497063.[MT7]-LLEGEESR.2y7_1.heavy 538.789 / 819.384 63902.0 26.122100830078125 48 18 10 10 10 7.914760362705343 12.634621317305305 0.0 3 0.980289040543423 8.77591750334293 63902.0 70.1728448150734 0.0 - - - - - - - 278.5 127 2 DES;KRT7;KRT8;KRT84;PRPH;VIM desmin;keratin 7;keratin 8;keratin 84;peripherin;vimentin 557 71 B20140410_SF109_01 B20140410_SF109_01 TB497304.[MT7]-GLLALAPPGGLPGGPRR.3y6_1.heavy 581.689 / 639.369 27173.0 34.12689971923828 39 9 10 10 10 1.2330549028477509 66.89430437661865 0.0 3 0.8014834871543314 2.7227183150023238 27173.0 17.46776370770485 0.0 - - - - - - - 1254.0 54 8 TMEM65 transmembrane protein 65 559 71 B20140410_SF109_01 B20140410_SF109_01 TB497304.[MT7]-GLLALAPPGGLPGGPRR.3y11_2.heavy 581.689 / 530.804 116913.0 34.12689971923828 39 9 10 10 10 1.2330549028477509 66.89430437661865 0.0 3 0.8014834871543314 2.7227183150023238 116913.0 69.16512324657663 0.0 - - - - - - - 696.6666666666666 233 3 TMEM65 transmembrane protein 65 561 71 B20140410_SF109_01 B20140410_SF109_01 TB497304.[MT7]-GLLALAPPGGLPGGPRR.3b5_1.heavy 581.689 / 612.42 60338.0 34.12689971923828 39 9 10 10 10 1.2330549028477509 66.89430437661865 0.0 3 0.8014834871543314 2.7227183150023238 60338.0 24.563886293742137 0.0 - - - - - - - 836.0 120 1 TMEM65 transmembrane protein 65 563 71 B20140410_SF109_01 B20140410_SF109_01 TB497304.[MT7]-GLLALAPPGGLPGGPRR.3y10_1.heavy 581.689 / 963.548 15607.0 34.12689971923828 39 9 10 10 10 1.2330549028477509 66.89430437661865 0.0 3 0.8014834871543314 2.7227183150023238 15607.0 36.638986999227455 0.0 - - - - - - - 748.875 31 8 TMEM65 transmembrane protein 65 565 72 B20140410_SF109_01 B20140410_SF109_01 TB238232.[MT7]-LSVSPPSLR.3b4_1.heavy 367.225 / 531.326 67483.0 29.993825435638428 42 18 10 6 8 4.55127485312722 21.971865735880385 0.03890037536621094 4 0.9858355922544496 10.357362971399981 67483.0 107.21876398536293 0.0 - - - - - - - 681.25 134 8 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 567 72 B20140410_SF109_01 B20140410_SF109_01 TB238232.[MT7]-LSVSPPSLR.3b3_1.heavy 367.225 / 444.294 72025.0 29.993825435638428 42 18 10 6 8 4.55127485312722 21.971865735880385 0.03890037536621094 4 0.9858355922544496 10.357362971399981 72025.0 133.14575018068845 1.0 - - - - - - - 227.25 146 4 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 569 72 B20140410_SF109_01 B20140410_SF109_01 TB238232.[MT7]-LSVSPPSLR.3y4_1.heavy 367.225 / 472.288 200632.0 29.993825435638428 42 18 10 6 8 4.55127485312722 21.971865735880385 0.03890037536621094 4 0.9858355922544496 10.357362971399981 200632.0 318.221713859207 0.0 - - - - - - - 302.6666666666667 401 3 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 571 72 B20140410_SF109_01 B20140410_SF109_01 TB238232.[MT7]-LSVSPPSLR.3y5_1.heavy 367.225 / 569.341 60345.0 29.993825435638428 42 18 10 6 8 4.55127485312722 21.971865735880385 0.03890037536621094 4 0.9858355922544496 10.357362971399981 60345.0 318.33686200663743 0.0 - - - - - - - 259.8 120 5 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 573 73 B20140410_SF109_01 B20140410_SF109_01 TB497062.[MT7]-VGTSFSIPVVSDVR.3y7_1.heavy 536.302 / 771.436 84474.0 35.44139862060547 50 20 10 10 10 18.612281002241552 5.3727965953209385 0.0 3 0.9927640728920628 14.499500894045134 84474.0 130.00505248561507 0.0 - - - - - - - 417.0 168 3 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 575 73 B20140410_SF109_01 B20140410_SF109_01 TB497062.[MT7]-VGTSFSIPVVSDVR.3y6_1.heavy 536.302 / 674.383 20563.0 35.44139862060547 50 20 10 10 10 18.612281002241552 5.3727965953209385 0.0 3 0.9927640728920628 14.499500894045134 20563.0 19.9832284596206 0.0 - - - - - - - 794.2857142857143 41 7 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 577 73 B20140410_SF109_01 B20140410_SF109_01 TB497062.[MT7]-VGTSFSIPVVSDVR.3b6_1.heavy 536.302 / 723.379 40708.0 35.44139862060547 50 20 10 10 10 18.612281002241552 5.3727965953209385 0.0 3 0.9927640728920628 14.499500894045134 40708.0 42.73485302939412 0.0 - - - - - - - 834.0 81 5 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 579 73 B20140410_SF109_01 B20140410_SF109_01 TB497062.[MT7]-VGTSFSIPVVSDVR.3y5_1.heavy 536.302 / 575.315 56269.0 35.44139862060547 50 20 10 10 10 18.612281002241552 5.3727965953209385 0.0 3 0.9927640728920628 14.499500894045134 56269.0 42.814015679476356 0.0 - - - - - - - 1309.5714285714287 112 7 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 581 74 B20140410_SF109_01 B20140410_SF109_01 TB497065.[MT7]-LGPPLALVR.2y8_1.heavy 540.357 / 822.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100507338 hypothetical protein LOC100507338 583 74 B20140410_SF109_01 B20140410_SF109_01 TB497065.[MT7]-LGPPLALVR.2b6_1.heavy 540.357 / 693.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100507338 hypothetical protein LOC100507338 585 74 B20140410_SF109_01 B20140410_SF109_01 TB497065.[MT7]-LGPPLALVR.2y6_1.heavy 540.357 / 668.445 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100507338 hypothetical protein LOC100507338 587 74 B20140410_SF109_01 B20140410_SF109_01 TB497065.[MT7]-LGPPLALVR.2y7_1.heavy 540.357 / 765.498 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100507338 hypothetical protein LOC100507338 589 75 B20140410_SF109_01 B20140410_SF109_01 TB376401.[MT7]-C[CAM]IELLYAALTSSSTDQPK[MT7].4b7_1.heavy 572.054 / 1007.54 3255.0 39.65869903564453 44 14 10 10 10 1.204239482265401 47.98105482393538 0.0 3 0.9417768120554397 5.08960819929383 3255.0 14.878783052348442 0.0 - - - - - - - 210.25 6 8 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 591 75 B20140410_SF109_01 B20140410_SF109_01 TB376401.[MT7]-C[CAM]IELLYAALTSSSTDQPK[MT7].4b4_1.heavy 572.054 / 660.351 39621.0 39.65869903564453 44 14 10 10 10 1.204239482265401 47.98105482393538 0.0 3 0.9417768120554397 5.08960819929383 39621.0 59.89423514616386 0.0 - - - - - - - 246.6 79 5 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 593 75 B20140410_SF109_01 B20140410_SF109_01 TB376401.[MT7]-C[CAM]IELLYAALTSSSTDQPK[MT7].4b5_1.heavy 572.054 / 773.435 39958.0 39.65869903564453 44 14 10 10 10 1.204239482265401 47.98105482393538 0.0 3 0.9417768120554397 5.08960819929383 39958.0 84.98861915367483 0.0 - - - - - - - 715.375 79 8 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 595 75 B20140410_SF109_01 B20140410_SF109_01 TB376401.[MT7]-C[CAM]IELLYAALTSSSTDQPK[MT7].4b3_1.heavy 572.054 / 547.267 17061.0 39.65869903564453 44 14 10 10 10 1.204239482265401 47.98105482393538 0.0 3 0.9417768120554397 5.08960819929383 17061.0 7.934402265159672 0.0 - - - - - - - 785.875 34 8 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 597 76 B20140410_SF109_01 B20140410_SF109_01 TB497307.[MT7]-LIVVLEGASLETVK[MT7].2y8_1.heavy 880.045 / 948.548 29856.0 38.97589874267578 47 17 10 10 10 2.7434325367476653 28.75677924204085 0.0 3 0.9744342412223613 7.701998028469475 29856.0 40.36927576083282 0.0 - - - - - - - 208.33333333333334 59 3 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 599 76 B20140410_SF109_01 B20140410_SF109_01 TB497307.[MT7]-LIVVLEGASLETVK[MT7].2y9_1.heavy 880.045 / 1077.59 19238.0 38.97589874267578 47 17 10 10 10 2.7434325367476653 28.75677924204085 0.0 3 0.9744342412223613 7.701998028469475 19238.0 53.88565725725726 0.0 - - - - - - - 229.16666666666666 38 6 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 601 76 B20140410_SF109_01 B20140410_SF109_01 TB497307.[MT7]-LIVVLEGASLETVK[MT7].2b4_1.heavy 880.045 / 569.414 65209.0 38.97589874267578 47 17 10 10 10 2.7434325367476653 28.75677924204085 0.0 3 0.9744342412223613 7.701998028469475 65209.0 77.18303241445098 0.0 - - - - - - - 250.0 130 2 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 603 76 B20140410_SF109_01 B20140410_SF109_01 TB497307.[MT7]-LIVVLEGASLETVK[MT7].2y10_1.heavy 880.045 / 1190.67 22736.0 38.97589874267578 47 17 10 10 10 2.7434325367476653 28.75677924204085 0.0 3 0.9744342412223613 7.701998028469475 22736.0 87.670016 0.0 - - - - - - - 625.0 45 7 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 605 77 B20140410_SF109_01 B20140410_SF109_01 TB238237.[MT7]-ALLAAR.2b3_1.heavy 379.754 / 442.315 13816.0 26.034500122070312 47 17 10 10 10 4.812466839343856 20.779363959967412 0.0 3 0.9798565510295432 8.680879552537354 13816.0 21.88615172267346 0.0 - - - - - - - 314.25 27 4 PLD6 phospholipase D family, member 6 607 77 B20140410_SF109_01 B20140410_SF109_01 TB238237.[MT7]-ALLAAR.2y5_1.heavy 379.754 / 543.361 25119.0 26.034500122070312 47 17 10 10 10 4.812466839343856 20.779363959967412 0.0 3 0.9798565510295432 8.680879552537354 25119.0 48.73853766943364 0.0 - - - - - - - 299.2857142857143 50 7 PLD6 phospholipase D family, member 6 609 77 B20140410_SF109_01 B20140410_SF109_01 TB238237.[MT7]-ALLAAR.2b4_1.heavy 379.754 / 513.352 13536.0 26.034500122070312 47 17 10 10 10 4.812466839343856 20.779363959967412 0.0 3 0.9798565510295432 8.680879552537354 13536.0 24.441924257932442 0.0 - - - - - - - 279.0 27 4 PLD6 phospholipase D family, member 6 611 77 B20140410_SF109_01 B20140410_SF109_01 TB238237.[MT7]-ALLAAR.2b5_1.heavy 379.754 / 584.389 8792.0 26.034500122070312 47 17 10 10 10 4.812466839343856 20.779363959967412 0.0 3 0.9798565510295432 8.680879552537354 8792.0 10.476039800995025 0.0 - - - - - - - 256.0 17 6 PLD6 phospholipase D family, member 6 613 78 B20140410_SF109_01 B20140410_SF109_01 TB376403.[MT7]-EAIK[MT7]DK[MT7]EEPLHIAQTR.4y5_1.heavy 578.334 / 588.346 46619.0 24.796199798583984 48 18 10 10 10 7.341383586123184 13.621410572936389 0.0 3 0.9832473099118262 9.521643601981332 46619.0 47.27762287774786 0.0 - - - - - - - 393.0 93 1 LOC100132288 hypothetical protein LOC100132288 615 78 B20140410_SF109_01 B20140410_SF109_01 TB376403.[MT7]-EAIK[MT7]DK[MT7]EEPLHIAQTR.4b5_1.heavy 578.334 / 845.497 4583.0 24.796199798583984 48 18 10 10 10 7.341383586123184 13.621410572936389 0.0 3 0.9832473099118262 9.521643601981332 4583.0 12.894372955288986 0.0 - - - - - - - 636.2857142857143 9 7 LOC100132288 hypothetical protein LOC100132288 617 78 B20140410_SF109_01 B20140410_SF109_01 TB376403.[MT7]-EAIK[MT7]DK[MT7]EEPLHIAQTR.4y6_1.heavy 578.334 / 725.405 15321.0 24.796199798583984 48 18 10 10 10 7.341383586123184 13.621410572936389 0.0 3 0.9832473099118262 9.521643601981332 15321.0 34.08379498364231 0.0 - - - - - - - 762.1818181818181 30 11 LOC100132288 hypothetical protein LOC100132288 619 78 B20140410_SF109_01 B20140410_SF109_01 TB376403.[MT7]-EAIK[MT7]DK[MT7]EEPLHIAQTR.4b9_2.heavy 578.334 / 736.92 13226.0 24.796199798583984 48 18 10 10 10 7.341383586123184 13.621410572936389 0.0 3 0.9832473099118262 9.521643601981332 13226.0 30.288549618320612 0.0 - - - - - - - 280.7142857142857 26 7 LOC100132288 hypothetical protein LOC100132288 621 79 B20140410_SF109_01 B20140410_SF109_01 TB238737.[MT7]-YLLHQLQLAATLK[MT7].4y4_1.heavy 450.78 / 576.384 61722.0 36.4099006652832 35 5 10 10 10 0.6317164825438386 87.94915991872752 0.0 3 0.6434388860001136 2.001951068190812 61722.0 83.03408071748879 0.0 - - - - - - - 696.6666666666666 123 9 ADAT1 adenosine deaminase, tRNA-specific 1 623 79 B20140410_SF109_01 B20140410_SF109_01 TB238737.[MT7]-YLLHQLQLAATLK[MT7].4b7_2.heavy 450.78 / 520.804 264724.0 36.4099006652832 35 5 10 10 10 0.6317164825438386 87.94915991872752 0.0 3 0.6434388860001136 2.001951068190812 264724.0 509.116002565549 0.0 - - - - - - - 278.5 529 4 ADAT1 adenosine deaminase, tRNA-specific 1 625 79 B20140410_SF109_01 B20140410_SF109_01 TB238737.[MT7]-YLLHQLQLAATLK[MT7].4b4_1.heavy 450.78 / 671.4 33578.0 36.4099006652832 35 5 10 10 10 0.6317164825438386 87.94915991872752 0.0 3 0.6434388860001136 2.001951068190812 33578.0 139.63853586543456 0.0 - - - - - - - 250.7 67 10 ADAT1 adenosine deaminase, tRNA-specific 1 627 79 B20140410_SF109_01 B20140410_SF109_01 TB238737.[MT7]-YLLHQLQLAATLK[MT7].4b3_1.heavy 450.78 / 534.341 26054.0 36.4099006652832 35 5 10 10 10 0.6317164825438386 87.94915991872752 0.0 3 0.6434388860001136 2.001951068190812 26054.0 212.1962566679152 0.0 - - - - - - - 776.1428571428571 52 7 ADAT1 adenosine deaminase, tRNA-specific 1 629 80 B20140410_SF109_01 B20140410_SF109_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 1503910.0 20.763399124145508 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1503910.0 1561.1234007096043 0.0 - - - - - - - 1279.0 3007 3 631 80 B20140410_SF109_01 B20140410_SF109_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 988762.0 20.763399124145508 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 988762.0 1706.1440416907933 0.0 - - - - - - - 1271.4444444444443 1977 9 633 80 B20140410_SF109_01 B20140410_SF109_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 943653.0 20.763399124145508 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 943653.0 1279.8979152797754 0.0 - - - - - - - 721.0 1887 3 635 81 B20140410_SF109_01 B20140410_SF109_01 TB376160.[MT7]-APAPEAEDEEVAR.2y8_1.heavy 764.374 / 918.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 637 81 B20140410_SF109_01 B20140410_SF109_01 TB376160.[MT7]-APAPEAEDEEVAR.2y5_1.heavy 764.374 / 603.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 639 81 B20140410_SF109_01 B20140410_SF109_01 TB376160.[MT7]-APAPEAEDEEVAR.2y10_1.heavy 764.374 / 1144.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 641 81 B20140410_SF109_01 B20140410_SF109_01 TB376160.[MT7]-APAPEAEDEEVAR.2y11_1.heavy 764.374 / 1215.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 643 82 B20140410_SF109_01 B20140410_SF109_01 TB238430.[MT7]-HLDLASLK[MT7].3y3_1.heavy 395.58 / 491.331 77823.0 29.560400009155273 37 14 10 3 10 2.3578595098633133 32.813821237768565 0.07419967651367188 3 0.9443823360890513 5.208615306390317 77823.0 42.91510960205083 0.0 - - - - - - - 590.8571428571429 155 7 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 645 82 B20140410_SF109_01 B20140410_SF109_01 TB238430.[MT7]-HLDLASLK[MT7].3b4_1.heavy 395.58 / 623.363 27147.0 29.560400009155273 37 14 10 3 10 2.3578595098633133 32.813821237768565 0.07419967651367188 3 0.9443823360890513 5.208615306390317 27147.0 101.82493304951245 0.0 - - - - - - - 627.8571428571429 54 7 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 647 82 B20140410_SF109_01 B20140410_SF109_01 TB238430.[MT7]-HLDLASLK[MT7].3y4_1.heavy 395.58 / 562.368 24691.0 29.560400009155273 37 14 10 3 10 2.3578595098633133 32.813821237768565 0.07419967651367188 3 0.9443823360890513 5.208615306390317 24691.0 26.44739359603068 0.0 - - - - - - - 291.0 49 4 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 649 82 B20140410_SF109_01 B20140410_SF109_01 TB238430.[MT7]-HLDLASLK[MT7].3b3_1.heavy 395.58 / 510.279 62698.0 29.560400009155273 37 14 10 3 10 2.3578595098633133 32.813821237768565 0.07419967651367188 3 0.9443823360890513 5.208615306390317 62698.0 116.37024601686974 0.0 - - - - - - - 747.0 125 9 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 651 83 B20140410_SF109_01 B20140410_SF109_01 TB375976.[MT7]-GADINAPDK[MT7].2b4_1.heavy 594.827 / 501.279 7314.0 22.07509994506836 38 12 10 6 10 1.000310236025548 61.30526394061681 0.0316009521484375 3 0.8821214658818454 3.558635671808674 7314.0 15.032764478764477 0.0 - - - - - - - 726.0909090909091 14 11 MTPN myotrophin 653 83 B20140410_SF109_01 B20140410_SF109_01 TB375976.[MT7]-GADINAPDK[MT7].2b6_1.heavy 594.827 / 686.359 12610.0 22.07509994506836 38 12 10 6 10 1.000310236025548 61.30526394061681 0.0316009521484375 3 0.8821214658818454 3.558635671808674 12610.0 38.50940271749387 0.0 - - - - - - - 271.09090909090907 25 22 MTPN myotrophin 655 83 B20140410_SF109_01 B20140410_SF109_01 TB375976.[MT7]-GADINAPDK[MT7].2y3_1.heavy 594.827 / 503.295 12526.0 22.07509994506836 38 12 10 6 10 1.000310236025548 61.30526394061681 0.0316009521484375 3 0.8821214658818454 3.558635671808674 12526.0 23.848408923617008 0.0 - - - - - - - 637.3333333333334 25 12 MTPN myotrophin 657 83 B20140410_SF109_01 B20140410_SF109_01 TB375976.[MT7]-GADINAPDK[MT7].2b5_1.heavy 594.827 / 615.322 6053.0 22.07509994506836 38 12 10 6 10 1.000310236025548 61.30526394061681 0.0316009521484375 3 0.8821214658818454 3.558635671808674 6053.0 33.147380952380956 0.0 - - - - - - - 221.05263157894737 12 19 MTPN myotrophin 659 84 B20140410_SF109_01 B20140410_SF109_01 TB238730.[MT7]-RQLAVQSLAFNLK[MT7].3b4_1.heavy 592.696 / 613.39 31080.0 33.20949935913086 40 10 10 10 10 1.0233106118640505 56.395598598447926 0.0 3 0.8396150814909821 3.0394670670485695 31080.0 22.34166782266047 0.0 - - - - - - - 811.0 62 1 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 661 84 B20140410_SF109_01 B20140410_SF109_01 TB238730.[MT7]-RQLAVQSLAFNLK[MT7].3b5_1.heavy 592.696 / 712.459 54187.0 33.20949935913086 40 10 10 10 10 1.0233106118640505 56.395598598447926 0.0 3 0.8396150814909821 3.0394670670485695 54187.0 24.51713534148279 0.0 - - - - - - - 405.0 108 2 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 663 84 B20140410_SF109_01 B20140410_SF109_01 TB238730.[MT7]-RQLAVQSLAFNLK[MT7].3y4_1.heavy 592.696 / 665.41 108779.0 33.20949935913086 40 10 10 10 10 1.0233106118640505 56.395598598447926 0.0 3 0.8396150814909821 3.0394670670485695 108779.0 61.31857988138255 0.0 - - - - - - - 766.0 217 3 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 665 84 B20140410_SF109_01 B20140410_SF109_01 TB238730.[MT7]-RQLAVQSLAFNLK[MT7].3y5_1.heavy 592.696 / 736.447 99184.0 33.20949935913086 40 10 10 10 10 1.0233106118640505 56.395598598447926 0.0 3 0.8396150814909821 3.0394670670485695 99184.0 90.05133542142016 0.0 - - - - - - - 878.5 198 2 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 667 85 B20140410_SF109_01 B20140410_SF109_01 TB376066.[MT7]-SPGIISQASAPR.2y8_1.heavy 664.376 / 829.453 14375.0 25.94610023498535 48 18 10 10 10 2.6677147465540703 28.222449849094733 0.0 3 0.9888893706457963 11.697420738561714 14375.0 147.51488095238096 0.0 - - - - - - - 239.28571428571428 28 7 EPB49 erythrocyte membrane protein band 4.9 (dematin) 669 85 B20140410_SF109_01 B20140410_SF109_01 TB376066.[MT7]-SPGIISQASAPR.2y10_1.heavy 664.376 / 999.558 5024.0 25.94610023498535 48 18 10 10 10 2.6677147465540703 28.222449849094733 0.0 3 0.9888893706457963 11.697420738561714 5024.0 52.08058986175115 0.0 - - - - - - - 232.75 10 12 EPB49 erythrocyte membrane protein band 4.9 (dematin) 671 85 B20140410_SF109_01 B20140410_SF109_01 TB376066.[MT7]-SPGIISQASAPR.2y11_1.heavy 664.376 / 1096.61 39358.0 25.94610023498535 48 18 10 10 10 2.6677147465540703 28.222449849094733 0.0 3 0.9888893706457963 11.697420738561714 39358.0 128.20911404470016 0.0 - - - - - - - 266.6363636363636 78 11 EPB49 erythrocyte membrane protein band 4.9 (dematin) 673 85 B20140410_SF109_01 B20140410_SF109_01 TB376066.[MT7]-SPGIISQASAPR.2y7_1.heavy 664.376 / 716.369 7537.0 25.94610023498535 48 18 10 10 10 2.6677147465540703 28.222449849094733 0.0 3 0.9888893706457963 11.697420738561714 7537.0 49.898450291088224 1.0 - - - - - - - 217.44444444444446 17 9 EPB49 erythrocyte membrane protein band 4.9 (dematin) 675 86 B20140410_SF109_01 B20140410_SF109_01 TB376168.[MT7]-QLQEELEEVK[MT7].3y3_1.heavy 511.619 / 519.326 251552.0 30.982799530029297 43 13 10 10 10 1.3419848122845144 51.06562697491846 0.0 3 0.9096421322401825 4.074306154854865 251552.0 125.32659190386192 0.0 - - - - - - - 1164.0 503 1 APOA5 apolipoprotein A-V 677 86 B20140410_SF109_01 B20140410_SF109_01 TB376168.[MT7]-QLQEELEEVK[MT7].3b4_1.heavy 511.619 / 643.353 178220.0 30.982799530029297 43 13 10 10 10 1.3419848122845144 51.06562697491846 0.0 3 0.9096421322401825 4.074306154854865 178220.0 89.26783384443826 0.0 - - - - - - - 905.0 356 2 APOA5 apolipoprotein A-V 679 86 B20140410_SF109_01 B20140410_SF109_01 TB376168.[MT7]-QLQEELEEVK[MT7].3b5_1.heavy 511.619 / 772.396 307423.0 30.982799530029297 43 13 10 10 10 1.3419848122845144 51.06562697491846 0.0 3 0.9096421322401825 4.074306154854865 307423.0 290.11240539154574 0.0 - - - - - - - 733.0 614 3 APOA5 apolipoprotein A-V 681 86 B20140410_SF109_01 B20140410_SF109_01 TB376168.[MT7]-QLQEELEEVK[MT7].3b3_1.heavy 511.619 / 514.311 154294.0 30.982799530029297 43 13 10 10 10 1.3419848122845144 51.06562697491846 0.0 3 0.9096421322401825 4.074306154854865 154294.0 84.37661889949263 0.0 - - - - - - - 517.0 308 1 APOA5 apolipoprotein A-V 683 87 B20140410_SF109_01 B20140410_SF109_01 TB238336.[MT7]-LFQPWPTLLK[MT7].3y3_1.heavy 510.981 / 517.383 90466.0 40.55617618560791 41 15 10 6 10 3.7055452400668507 26.986581871604926 0.039699554443359375 3 0.9598222857538229 6.136275447614553 90466.0 167.56870212586614 0.0 - - - - - - - 426.6 180 5 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 685 87 B20140410_SF109_01 B20140410_SF109_01 TB238336.[MT7]-LFQPWPTLLK[MT7].3y4_1.heavy 510.981 / 618.431 79579.0 40.55617618560791 41 15 10 6 10 3.7055452400668507 26.986581871604926 0.039699554443359375 3 0.9598222857538229 6.136275447614553 79579.0 204.8693029933745 0.0 - - - - - - - 224.14285714285714 159 7 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 687 87 B20140410_SF109_01 B20140410_SF109_01 TB238336.[MT7]-LFQPWPTLLK[MT7].3b3_1.heavy 510.981 / 533.32 296765.0 40.55617618560791 41 15 10 6 10 3.7055452400668507 26.986581871604926 0.039699554443359375 3 0.9598222857538229 6.136275447614553 296765.0 283.93643251844605 0.0 - - - - - - - 186.66666666666666 593 3 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 689 87 B20140410_SF109_01 B20140410_SF109_01 TB238336.[MT7]-LFQPWPTLLK[MT7].3y5_1.heavy 510.981 / 715.483 281837.0 40.55617618560791 41 15 10 6 10 3.7055452400668507 26.986581871604926 0.039699554443359375 3 0.9598222857538229 6.136275447614553 281837.0 2557.248470504801 0.0 - - - - - - - 156.8 563 5 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 691 88 B20140410_SF109_01 B20140410_SF109_01 TB376164.[MT7]-LFQPWPTLLK[MT7].2b3_1.heavy 765.968 / 533.32 85370.0 40.56610107421875 38 8 10 10 10 0.5861008479194798 90.57673261853304 0.0 3 0.7583944608859123 2.458383308610489 85370.0 110.81682692307692 0.0 - - - - - - - 698.2857142857143 170 7 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 693 88 B20140410_SF109_01 B20140410_SF109_01 TB376164.[MT7]-LFQPWPTLLK[MT7].2y5_1.heavy 765.968 / 715.483 34002.0 40.56610107421875 38 8 10 10 10 0.5861008479194798 90.57673261853304 0.0 3 0.7583944608859123 2.458383308610489 34002.0 31.07394128865752 0.0 - - - - - - - 1277.7142857142858 68 7 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 695 88 B20140410_SF109_01 B20140410_SF109_01 TB376164.[MT7]-LFQPWPTLLK[MT7].2y3_1.heavy 765.968 / 517.383 6551.0 40.56610107421875 38 8 10 10 10 0.5861008479194798 90.57673261853304 0.0 3 0.7583944608859123 2.458383308610489 6551.0 5.284410734193343 0.0 - - - - - - - 312.0 13 5 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 697 88 B20140410_SF109_01 B20140410_SF109_01 TB376164.[MT7]-LFQPWPTLLK[MT7].2y7_1.heavy 765.968 / 998.615 57606.0 40.56610107421875 38 8 10 10 10 0.5861008479194798 90.57673261853304 0.0 3 0.7583944608859123 2.458383308610489 57606.0 304.89888986013983 0.0 - - - - - - - 802.2857142857143 115 7 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 699 89 B20140410_SF109_01 B20140410_SF109_01 TB376162.[MT7]-VFAMSPEEFGK[MT7].2y8_1.heavy 765.399 / 1068.52 5465.0 34.04079818725586 50 20 10 10 10 124.22556167406239 0.8049873041618892 0.0 3 0.9983281370632512 30.17876820874498 5465.0 18.314081996434936 0.0 - - - - - - - 210.0 10 10 EPB49 erythrocyte membrane protein band 4.9 (dematin) 701 89 B20140410_SF109_01 B20140410_SF109_01 TB376162.[MT7]-VFAMSPEEFGK[MT7].2y9_1.heavy 765.399 / 1139.55 5745.0 34.04079818725586 50 20 10 10 10 124.22556167406239 0.8049873041618892 0.0 3 0.9983281370632512 30.17876820874498 5745.0 18.482657428163847 0.0 - - - - - - - 641.0 11 7 EPB49 erythrocyte membrane protein band 4.9 (dematin) 703 89 B20140410_SF109_01 B20140410_SF109_01 TB376162.[MT7]-VFAMSPEEFGK[MT7].2y6_1.heavy 765.399 / 850.443 15134.0 34.04079818725586 50 20 10 10 10 124.22556167406239 0.8049873041618892 0.0 3 0.9983281370632512 30.17876820874498 15134.0 24.908811783632054 0.0 - - - - - - - 785.0 30 10 EPB49 erythrocyte membrane protein band 4.9 (dematin) 705 89 B20140410_SF109_01 B20140410_SF109_01 TB376162.[MT7]-VFAMSPEEFGK[MT7].2y7_1.heavy 765.399 / 937.475 10790.0 34.04079818725586 50 20 10 10 10 124.22556167406239 0.8049873041618892 0.0 3 0.9983281370632512 30.17876820874498 10790.0 10.106831726143222 1.0 - - - - - - - 280.0 27 6 EPB49 erythrocyte membrane protein band 4.9 (dematin) 707 90 B20140410_SF109_01 B20140410_SF109_01 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 2846030.0 34.432098388671875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2846030.0 229.69594340729435 0.0 - - - - - - - 417.0 5692 2 709 90 B20140410_SF109_01 B20140410_SF109_01 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 1340820.0 34.432098388671875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1340820.0 568.4969874055523 0.0 - - - - - - - 243.25 2681 4 711 90 B20140410_SF109_01 B20140410_SF109_01 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 1946900.0 34.432098388671875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1946900.0 170.54699472577983 0.0 - - - - - - - 139.0 3893 1 713 91 B20140410_SF109_01 B20140410_SF109_01 TB238861.[MT7]-LQPYMAEAHELVGWNLEGLR.4b8_1.heavy 618.322 / 1048.53 5967.0 39.02149963378906 42 12 10 10 10 1.0367311902713632 60.5848891928491 0.0 3 0.8986734463153101 3.8438241694358894 5967.0 24.687592785629437 0.0 - - - - - - - 273.4 11 15 APOA5 apolipoprotein A-V 715 91 B20140410_SF109_01 B20140410_SF109_01 TB238861.[MT7]-LQPYMAEAHELVGWNLEGLR.4b7_1.heavy 618.322 / 977.488 3232.0 39.02149963378906 42 12 10 10 10 1.0367311902713632 60.5848891928491 0.0 3 0.8986734463153101 3.8438241694358894 3232.0 18.923887162331418 1.0 - - - - - - - 227.83333333333334 7 12 APOA5 apolipoprotein A-V 717 91 B20140410_SF109_01 B20140410_SF109_01 TB238861.[MT7]-LQPYMAEAHELVGWNLEGLR.4y6_1.heavy 618.322 / 701.394 17776.0 39.02149963378906 42 12 10 10 10 1.0367311902713632 60.5848891928491 0.0 3 0.8986734463153101 3.8438241694358894 17776.0 29.070670241286866 0.0 - - - - - - - 746.0 35 9 APOA5 apolipoprotein A-V 719 91 B20140410_SF109_01 B20140410_SF109_01 TB238861.[MT7]-LQPYMAEAHELVGWNLEGLR.4b10_2.heavy 618.322 / 657.817 36298.0 39.02149963378906 42 12 10 10 10 1.0367311902713632 60.5848891928491 0.0 3 0.8986734463153101 3.8438241694358894 36298.0 73.57896196822496 0.0 - - - - - - - 763.7142857142857 72 7 APOA5 apolipoprotein A-V 721 92 B20140410_SF109_01 B20140410_SF109_01 TB497090.[MT7]-RAPTTATQR.2b8_1.heavy 573.329 / 971.539 5600.0 17.269800186157227 30 14 0 10 6 1.6785373967205297 59.57567593988472 0.0 5 0.9389690604227074 4.969966027676677 5600.0 68.55493895671475 1.0 - - - - - - - 208.84615384615384 14 13 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 723 92 B20140410_SF109_01 B20140410_SF109_01 TB497090.[MT7]-RAPTTATQR.2y8_1.heavy 573.329 / 845.448 10479.0 17.269800186157227 30 14 0 10 6 1.6785373967205297 59.57567593988472 0.0 5 0.9389690604227074 4.969966027676677 10479.0 49.334456421311984 0.0 - - - - - - - 172.92307692307693 20 13 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 725 92 B20140410_SF109_01 B20140410_SF109_01 TB497090.[MT7]-RAPTTATQR.2b6_1.heavy 573.329 / 742.433 721.0 17.269800186157227 30 14 0 10 6 1.6785373967205297 59.57567593988472 0.0 5 0.9389690604227074 4.969966027676677 721.0 6.8672277521913525 0.0 - - - - - - - 0.0 1 0 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 727 92 B20140410_SF109_01 B20140410_SF109_01 TB497090.[MT7]-RAPTTATQR.2y7_1.heavy 573.329 / 774.41 5600.0 17.269800186157227 30 14 0 10 6 1.6785373967205297 59.57567593988472 0.0 5 0.9389690604227074 4.969966027676677 5600.0 70.55118110236221 1.0 - - - - - - - 118.7 99 10 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 729 93 B20140410_SF109_01 B20140410_SF109_01 TB238860.[MT7]-SVINTSDAITDK[MT7]DIVFYK[MT7].3y6_1.heavy 821.123 / 928.526 3108.0 33.042999267578125 35 17 0 10 8 3.1685002893260523 31.56067251654575 0.0 4 0.9726279962427489 7.4424073943537286 3108.0 0.7195266272189347 1.0 - - - - - - - 712.5454545454545 6 11 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 731 93 B20140410_SF109_01 B20140410_SF109_01 TB238860.[MT7]-SVINTSDAITDK[MT7]DIVFYK[MT7].3y3_1.heavy 821.123 / 601.347 21484.0 33.042999267578125 35 17 0 10 8 3.1685002893260523 31.56067251654575 0.0 4 0.9726279962427489 7.4424073943537286 21484.0 24.64791964394245 0.0 - - - - - - - 761.8181818181819 42 11 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 733 93 B20140410_SF109_01 B20140410_SF109_01 TB238860.[MT7]-SVINTSDAITDK[MT7]DIVFYK[MT7].3b4_1.heavy 821.123 / 558.337 12431.0 33.042999267578125 35 17 0 10 8 3.1685002893260523 31.56067251654575 0.0 4 0.9726279962427489 7.4424073943537286 12431.0 6.33475356465488 1.0 - - - - - - - 1306.0 257 3 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 735 93 B20140410_SF109_01 B20140410_SF109_01 TB238860.[MT7]-SVINTSDAITDK[MT7]DIVFYK[MT7].3b7_1.heavy 821.123 / 861.443 5945.0 33.042999267578125 35 17 0 10 8 3.1685002893260523 31.56067251654575 0.0 4 0.9726279962427489 7.4424073943537286 5945.0 26.03864380236473 0.0 - - - - - - - 294.54545454545456 11 11 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 737 94 B20140410_SF109_01 B20140410_SF109_01 TB497197.[MT7]-EHLQETDVVR.3y6_1.heavy 457.245 / 718.373 202616.0 23.3533992767334 50 20 10 10 10 13.612276921074544 7.346309554221592 0.0 3 0.997983927069189 27.481235853366858 202616.0 684.8569403408529 0.0 - - - - - - - 259.0 405 6 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 739 94 B20140410_SF109_01 B20140410_SF109_01 TB497197.[MT7]-EHLQETDVVR.3b3_1.heavy 457.245 / 524.295 120203.0 23.3533992767334 50 20 10 10 10 13.612276921074544 7.346309554221592 0.0 3 0.997983927069189 27.481235853366858 120203.0 111.85427087980858 0.0 - - - - - - - 155.5 240 4 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 741 94 B20140410_SF109_01 B20140410_SF109_01 TB497197.[MT7]-EHLQETDVVR.3y4_1.heavy 457.245 / 488.283 172073.0 23.3533992767334 50 20 10 10 10 13.612276921074544 7.346309554221592 0.0 3 0.997983927069189 27.481235853366858 172073.0 126.379445674081 0.0 - - - - - - - 518.0 344 1 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 743 94 B20140410_SF109_01 B20140410_SF109_01 TB497197.[MT7]-EHLQETDVVR.3y5_1.heavy 457.245 / 589.33 225290.0 23.3533992767334 50 20 10 10 10 13.612276921074544 7.346309554221592 0.0 3 0.997983927069189 27.481235853366858 225290.0 123.6214133889485 0.0 - - - - - - - 311.0 450 1 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 745 95 B20140410_SF109_01 B20140410_SF109_01 TB497196.[MT7]-VVHHTGRFK[MT7].3y6_1.heavy 456.942 / 889.512 4986.0 19.169300079345703 33 5 10 10 8 0.619855403610873 92.64481821469181 0.0 4 0.6448714877534466 2.0062611698318427 4986.0 93.5459806183664 0.0 - - - - - - - 164.125 9 8 APOA5 apolipoprotein A-V 747 95 B20140410_SF109_01 B20140410_SF109_01 TB497196.[MT7]-VVHHTGRFK[MT7].3y7_2.heavy 456.942 / 513.789 20534.0 19.169300079345703 33 5 10 10 8 0.619855403610873 92.64481821469181 0.0 4 0.6448714877534466 2.0062611698318427 20534.0 50.31851621250679 0.0 - - - - - - - 680.625 41 8 APOA5 apolipoprotein A-V 749 95 B20140410_SF109_01 B20140410_SF109_01 TB497196.[MT7]-VVHHTGRFK[MT7].3y8_2.heavy 456.942 / 563.323 25848.0 19.169300079345703 33 5 10 10 8 0.619855403610873 92.64481821469181 0.0 4 0.6448714877534466 2.0062611698318427 25848.0 51.51975578234324 0.0 - - - - - - - 656.1 51 10 APOA5 apolipoprotein A-V 751 95 B20140410_SF109_01 B20140410_SF109_01 TB497196.[MT7]-VVHHTGRFK[MT7].3y5_1.heavy 456.942 / 752.453 8397.0 19.169300079345703 33 5 10 10 8 0.619855403610873 92.64481821469181 0.0 4 0.6448714877534466 2.0062611698318427 8397.0 16.66600883051872 1.0 - - - - - - - 227.76470588235293 19 17 APOA5 apolipoprotein A-V 753 96 B20140410_SF109_01 B20140410_SF109_01 TB375927.[MT7]-AAYC[CAM]QSK[MT7].2y4_1.heavy 558.292 / 666.336 8737.0 19.531200408935547 50 20 10 10 10 11.266148064654406 8.876148211981407 0.0 3 0.996275401620774 20.21565209640284 8737.0 74.06134524176163 0.0 - - - - - - - 201.07692307692307 17 13 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 755 96 B20140410_SF109_01 B20140410_SF109_01 TB375927.[MT7]-AAYC[CAM]QSK[MT7].2y5_1.heavy 558.292 / 829.399 7461.0 19.531200408935547 50 20 10 10 10 11.266148064654406 8.876148211981407 0.0 3 0.996275401620774 20.21565209640284 7461.0 63.67240837696335 0.0 - - - - - - - 127.66666666666667 14 12 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 757 96 B20140410_SF109_01 B20140410_SF109_01 TB375927.[MT7]-AAYC[CAM]QSK[MT7].2y3_1.heavy 558.292 / 506.306 4273.0 19.531200408935547 50 20 10 10 10 11.266148064654406 8.876148211981407 0.0 3 0.996275401620774 20.21565209640284 4273.0 21.309844182186982 0.0 - - - - - - - 645.75 8 8 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 759 96 B20140410_SF109_01 B20140410_SF109_01 TB375927.[MT7]-AAYC[CAM]QSK[MT7].2y6_1.heavy 558.292 / 900.437 9693.0 19.531200408935547 50 20 10 10 10 11.266148064654406 8.876148211981407 0.0 3 0.996275401620774 20.21565209640284 9693.0 186.5252282395288 0.0 - - - - - - - 171.84615384615384 19 13 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 761 97 B20140410_SF109_01 B20140410_SF109_01 TB375924.[MT7]-YIFIHK[MT7].3y3_1.heavy 370.23 / 541.358 8408.0 29.748300552368164 50 20 10 10 10 16.235023413028344 6.15952299272643 0.0 3 0.9983404750924123 30.29077630338718 8408.0 10.254502674251237 0.0 - - - - - - - 245.8 16 10 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 763 97 B20140410_SF109_01 B20140410_SF109_01 TB375924.[MT7]-YIFIHK[MT7].3b4_1.heavy 370.23 / 681.409 3622.0 29.748300552368164 50 20 10 10 10 16.235023413028344 6.15952299272643 0.0 3 0.9983404750924123 30.29077630338718 3622.0 39.24033887043189 0.0 - - - - - - - 242.375 7 8 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 765 97 B20140410_SF109_01 B20140410_SF109_01 TB375924.[MT7]-YIFIHK[MT7].3y4_1.heavy 370.23 / 688.426 2716.0 29.748300552368164 50 20 10 10 10 16.235023413028344 6.15952299272643 0.0 3 0.9983404750924123 30.29077630338718 2716.0 21.748837209302327 0.0 - - - - - - - 218.84615384615384 5 13 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 767 97 B20140410_SF109_01 B20140410_SF109_01 TB375924.[MT7]-YIFIHK[MT7].3b3_1.heavy 370.23 / 568.325 28717.0 29.748300552368164 50 20 10 10 10 16.235023413028344 6.15952299272643 0.0 3 0.9983404750924123 30.29077630338718 28717.0 222.44028010868698 0.0 - - - - - - - 232.8 57 10 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 769 98 B20140410_SF109_01 B20140410_SF109_01 TB497298.[MT7]-GITVFQALIHLVK[MT7].3b6_1.heavy 576.366 / 790.458 25633.0 43.445899963378906 42 12 10 10 10 1.0913627780028414 61.08570679739006 0.0 3 0.8864239579810103 3.626771371003485 25633.0 204.93615461346633 0.0 - - - - - - - 277.3076923076923 51 13 SLC36A2 solute carrier family 36 (proton/amino acid symporter), member 2 771 98 B20140410_SF109_01 B20140410_SF109_01 TB497298.[MT7]-GITVFQALIHLVK[MT7].3y3_1.heavy 576.366 / 503.367 93721.0 43.445899963378906 42 12 10 10 10 1.0913627780028414 61.08570679739006 0.0 3 0.8864239579810103 3.626771371003485 93721.0 386.2168209775823 0.0 - - - - - - - 260.125 187 8 SLC36A2 solute carrier family 36 (proton/amino acid symporter), member 2 773 98 B20140410_SF109_01 B20140410_SF109_01 TB497298.[MT7]-GITVFQALIHLVK[MT7].3b4_1.heavy 576.366 / 515.331 49904.0 43.445899963378906 42 12 10 10 10 1.0913627780028414 61.08570679739006 0.0 3 0.8864239579810103 3.626771371003485 49904.0 89.95378550635427 0.0 - - - - - - - 731.0 99 8 SLC36A2 solute carrier family 36 (proton/amino acid symporter), member 2 775 98 B20140410_SF109_01 B20140410_SF109_01 TB497298.[MT7]-GITVFQALIHLVK[MT7].3b7_1.heavy 576.366 / 861.495 56152.0 43.445899963378906 42 12 10 10 10 1.0913627780028414 61.08570679739006 0.0 3 0.8864239579810103 3.626771371003485 56152.0 459.46444014962594 0.0 - - - - - - - 240.2 112 10 SLC36A2 solute carrier family 36 (proton/amino acid symporter), member 2 777 99 B20140410_SF109_01 B20140410_SF109_01 TB497297.[MT7]-DK[MT7]EEPLHIAQTR.4y5_1.heavy 431.994 / 588.346 185304.0 23.981199264526367 48 18 10 10 10 9.341008112341363 10.705482620005409 0.0 3 0.9823827856316897 9.284405340098173 185304.0 206.72094607857704 0.0 - - - - - - - 400.5 370 2 LOC100132288 hypothetical protein LOC100132288 779 99 B20140410_SF109_01 B20140410_SF109_01 TB497297.[MT7]-DK[MT7]EEPLHIAQTR.4y4_1.heavy 431.994 / 475.262 345099.0 23.981199264526367 48 18 10 10 10 9.341008112341363 10.705482620005409 0.0 3 0.9823827856316897 9.284405340098173 345099.0 193.91836093358611 0.0 - - - - - - - 915.0 690 1 LOC100132288 hypothetical protein LOC100132288 781 99 B20140410_SF109_01 B20140410_SF109_01 TB497297.[MT7]-DK[MT7]EEPLHIAQTR.4b4_1.heavy 431.994 / 790.419 31456.0 23.981199264526367 48 18 10 10 10 9.341008112341363 10.705482620005409 0.0 3 0.9823827856316897 9.284405340098173 31456.0 210.7492329433333 0.0 - - - - - - - 244.0 62 15 LOC100132288 hypothetical protein LOC100132288 783 99 B20140410_SF109_01 B20140410_SF109_01 TB497297.[MT7]-DK[MT7]EEPLHIAQTR.4b5_2.heavy 431.994 / 444.239 235862.0 23.981199264526367 48 18 10 10 10 9.341008112341363 10.705482620005409 0.0 3 0.9823827856316897 9.284405340098173 235862.0 228.33273115720863 0.0 - - - - - - - 1389.0 471 7 LOC100132288 hypothetical protein LOC100132288 785 100 B20140410_SF109_01 B20140410_SF109_01 TB497087.[MT7]-DSLEQDLNNMNK[MT7].3y3_1.heavy 570.285 / 536.298 59392.0 30.55340003967285 45 15 10 10 10 2.778807288641442 35.98666248240984 0.0 3 0.9520700164616055 5.6144683598946505 59392.0 25.1919794344473 0.0 - - - - - - - 1734.5 118 8 APOA5 apolipoprotein A-V 787 100 B20140410_SF109_01 B20140410_SF109_01 TB497087.[MT7]-DSLEQDLNNMNK[MT7].3b6_1.heavy 570.285 / 832.38 91162.0 30.55340003967285 45 15 10 10 10 2.778807288641442 35.98666248240984 0.0 3 0.9520700164616055 5.6144683598946505 91162.0 163.37146786169325 0.0 - - - - - - - 722.4285714285714 182 7 APOA5 apolipoprotein A-V 789 100 B20140410_SF109_01 B20140410_SF109_01 TB497087.[MT7]-DSLEQDLNNMNK[MT7].3b5_1.heavy 570.285 / 717.354 25157.0 30.55340003967285 45 15 10 10 10 2.778807288641442 35.98666248240984 0.0 3 0.9520700164616055 5.6144683598946505 25157.0 39.6648500428449 0.0 - - - - - - - 741.0 50 7 APOA5 apolipoprotein A-V 791 100 B20140410_SF109_01 B20140410_SF109_01 TB497087.[MT7]-DSLEQDLNNMNK[MT7].3y4_1.heavy 570.285 / 650.341 38773.0 30.55340003967285 45 15 10 10 10 2.778807288641442 35.98666248240984 0.0 3 0.9520700164616055 5.6144683598946505 38773.0 32.655788849347566 0.0 - - - - - - - 389.0 77 1 APOA5 apolipoprotein A-V 793 101 B20140410_SF109_01 B20140410_SF109_01 TB497083.[MT7]-RLWAESAR.2y5_1.heavy 566.821 / 533.268 N/A 25.64033317565918 33 20 0 5 8 5.434369363029855 18.401399190916685 0.04599952697753906 4 0.9910093710413841 13.005930022795216 13972.0 1.1531052671418327 3.0 - - - - - - - 1492.0 104 1 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 795 101 B20140410_SF109_01 B20140410_SF109_01 TB497083.[MT7]-RLWAESAR.2y6_1.heavy 566.821 / 719.347 6918.0 25.64033317565918 33 20 0 5 8 5.434369363029855 18.401399190916685 0.04599952697753906 4 0.9910093710413841 13.005930022795216 6918.0 4.661199349577256 0.0 - - - - - - - 1356.2857142857142 13 7 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 797 101 B20140410_SF109_01 B20140410_SF109_01 TB497083.[MT7]-RLWAESAR.2b5_1.heavy 566.821 / 800.453 8546.0 25.64033317565918 33 20 0 5 8 5.434369363029855 18.401399190916685 0.04599952697753906 4 0.9910093710413841 13.005930022795216 8546.0 8.36233953807302 1.0 - - - - - - - 310.0 62 7 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 799 101 B20140410_SF109_01 B20140410_SF109_01 TB497083.[MT7]-RLWAESAR.2y7_1.heavy 566.821 / 832.431 12751.0 25.64033317565918 33 20 0 5 8 5.434369363029855 18.401399190916685 0.04599952697753906 4 0.9910093710413841 13.005930022795216 12751.0 35.23241139180366 0.0 - - - - - - - 271.45454545454544 25 11 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 801 102 B20140410_SF109_01 B20140410_SF109_01 TB238850.[MT7]-TLDFIDVLLLSEDK[MT7]NGK[MT7].4b7_1.heavy 588.84 / 948.516 17537.0 41.467498779296875 43 13 10 10 10 4.569905348297846 21.882291290178916 0.0 2 0.9279514886779149 4.569905277336449 17537.0 23.026016911114436 0.0 - - - - - - - 697.4285714285714 35 7 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 803 102 B20140410_SF109_01 B20140410_SF109_01 TB238850.[MT7]-TLDFIDVLLLSEDK[MT7]NGK[MT7].4b4_1.heavy 588.84 / 621.336 20726.0 41.467498779296875 43 13 10 10 10 4.569905348297846 21.882291290178916 0.0 2 0.9279514886779149 4.569905277336449 20726.0 4.6026092266449785 0.0 - - - - - - - 1323.857142857143 41 7 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 805 103 B20140410_SF109_01 B20140410_SF109_01 TB238851.[MT7]-ELVPSSDPIVFVVGAFAHGK[MT7].4y4_1.heavy 590.083 / 556.332 39790.0 42.52040100097656 44 18 8 10 8 5.75110776637102 17.387954471091494 0.0 4 0.9841257638187414 9.782272664322047 39790.0 34.123352231396666 1.0 - - - - - - - 735.375 139 8 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 807 103 B20140410_SF109_01 B20140410_SF109_01 TB238851.[MT7]-ELVPSSDPIVFVVGAFAHGK[MT7].4y8_1.heavy 590.083 / 930.528 29324.0 42.52040100097656 44 18 8 10 8 5.75110776637102 17.387954471091494 0.0 4 0.9841257638187414 9.782272664322047 29324.0 89.9156331406551 0.0 - - - - - - - 294.4 58 10 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 809 103 B20140410_SF109_01 B20140410_SF109_01 TB238851.[MT7]-ELVPSSDPIVFVVGAFAHGK[MT7].4b7_1.heavy 590.083 / 872.448 55014.0 42.52040100097656 44 18 8 10 8 5.75110776637102 17.387954471091494 0.0 4 0.9841257638187414 9.782272664322047 55014.0 76.98883944309948 0.0 - - - - - - - 279.0 110 9 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 811 103 B20140410_SF109_01 B20140410_SF109_01 TB238851.[MT7]-ELVPSSDPIVFVVGAFAHGK[MT7].4y7_1.heavy 590.083 / 831.459 53890.0 42.52040100097656 44 18 8 10 8 5.75110776637102 17.387954471091494 0.0 4 0.9841257638187414 9.782272664322047 53890.0 112.33302991708007 0.0 - - - - - - - 297.0 107 7 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 813 104 B20140410_SF109_01 B20140410_SF109_01 TB497183.[MT7]-EWISVSPLPR.2y8_1.heavy 664.378 / 868.525 19488.0 34.345401763916016 50 20 10 10 10 4.918632672194963 20.330853443336018 0.0 3 0.9912220428012819 13.162774553873806 19488.0 17.61103448275862 0.0 - - - - - - - 385.75 38 4 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 815 104 B20140410_SF109_01 B20140410_SF109_01 TB497183.[MT7]-EWISVSPLPR.2b4_1.heavy 664.378 / 660.347 8552.0 34.345401763916016 50 20 10 10 10 4.918632672194963 20.330853443336018 0.0 3 0.9912220428012819 13.162774553873806 8552.0 4.548869162066612 1.0 - - - - - - - 2716.5 17 8 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 817 104 B20140410_SF109_01 B20140410_SF109_01 TB497183.[MT7]-EWISVSPLPR.2y9_1.heavy 664.378 / 1054.6 26217.0 34.345401763916016 50 20 10 10 10 4.918632672194963 20.330853443336018 0.0 3 0.9912220428012819 13.162774553873806 26217.0 102.62194812453161 0.0 - - - - - - - 242.0909090909091 52 11 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 819 104 B20140410_SF109_01 B20140410_SF109_01 TB497183.[MT7]-EWISVSPLPR.2y6_1.heavy 664.378 / 668.409 10795.0 34.345401763916016 50 20 10 10 10 4.918632672194963 20.330853443336018 0.0 3 0.9912220428012819 13.162774553873806 10795.0 20.071810357549346 0.0 - - - - - - - 771.0 21 8 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 821 105 B20140410_SF109_01 B20140410_SF109_01 TB376080.[MT7]-MDNQVLGYK[MT7].2y4_1.heavy 678.365 / 624.384 15288.0 28.24530029296875 41 11 10 10 10 0.895710350293487 67.6893123606967 0.0 3 0.876567163469088 3.475963105091626 15288.0 6.409390760990851 0.0 - - - - - - - 857.0 30 2 EPB49 erythrocyte membrane protein band 4.9 (dematin) 823 105 B20140410_SF109_01 B20140410_SF109_01 TB376080.[MT7]-MDNQVLGYK[MT7].2y5_1.heavy 678.365 / 723.452 5008.0 28.24530029296875 41 11 10 10 10 0.895710350293487 67.6893123606967 0.0 3 0.876567163469088 3.475963105091626 5008.0 9.624616848498569 0.0 - - - - - - - 725.0 10 8 EPB49 erythrocyte membrane protein band 4.9 (dematin) 825 105 B20140410_SF109_01 B20140410_SF109_01 TB376080.[MT7]-MDNQVLGYK[MT7].2b4_1.heavy 678.365 / 633.278 7249.0 28.24530029296875 41 11 10 10 10 0.895710350293487 67.6893123606967 0.0 3 0.876567163469088 3.475963105091626 7249.0 3.7062293992734894 1.0 - - - - - - - 1318.0 14 9 EPB49 erythrocyte membrane protein band 4.9 (dematin) 827 105 B20140410_SF109_01 B20140410_SF109_01 TB376080.[MT7]-MDNQVLGYK[MT7].2y3_1.heavy 678.365 / 511.3 8830.0 28.24530029296875 41 11 10 10 10 0.895710350293487 67.6893123606967 0.0 3 0.876567163469088 3.475963105091626 8830.0 13.404174573055029 0.0 - - - - - - - 275.6363636363636 17 11 EPB49 erythrocyte membrane protein band 4.9 (dematin) 829 106 B20140410_SF109_01 B20140410_SF109_01 TB238651.[MT7]-GLLALAPPGGLPGGPR.2y12_1.heavy 793.979 / 1088.62 36613.0 36.43295097351074 41 16 10 5 10 1.6304698551554835 46.895973904780114 0.046100616455078125 3 0.9669661734524548 6.771425218769795 36613.0 69.41476676336075 0.0 - - - - - - - 298.2857142857143 73 7 TMEM65 transmembrane protein 65 831 106 B20140410_SF109_01 B20140410_SF109_01 TB238651.[MT7]-GLLALAPPGGLPGGPR.2y10_1.heavy 793.979 / 904.5 349008.0 36.43295097351074 41 16 10 5 10 1.6304698551554835 46.895973904780114 0.046100616455078125 3 0.9669661734524548 6.771425218769795 349008.0 333.49124363260864 0.0 - - - - - - - 278.0 698 3 TMEM65 transmembrane protein 65 833 106 B20140410_SF109_01 B20140410_SF109_01 TB238651.[MT7]-GLLALAPPGGLPGGPR.2b5_1.heavy 793.979 / 612.42 172346.0 36.43295097351074 41 16 10 5 10 1.6304698551554835 46.895973904780114 0.046100616455078125 3 0.9669661734524548 6.771425218769795 172346.0 160.35736368156068 0.0 - - - - - - - 418.0 344 2 TMEM65 transmembrane protein 65 835 106 B20140410_SF109_01 B20140410_SF109_01 TB238651.[MT7]-GLLALAPPGGLPGGPR.2y11_1.heavy 793.979 / 975.537 87565.0 36.43295097351074 41 16 10 5 10 1.6304698551554835 46.895973904780114 0.046100616455078125 3 0.9669661734524548 6.771425218769795 87565.0 157.26472701149424 0.0 - - - - - - - 348.0 175 4 TMEM65 transmembrane protein 65 837 107 B20140410_SF109_01 B20140410_SF109_01 TB375916.[MT7]-SANDELFR.2y4_1.heavy 548.281 / 564.314 44055.0 28.28849983215332 50 20 10 10 10 8.697456064422543 11.49761484959446 0.0 3 0.9904721236038523 12.63336032859205 44055.0 33.196203083910135 0.0 - - - - - - - 264.0 88 1 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 839 107 B20140410_SF109_01 B20140410_SF109_01 TB375916.[MT7]-SANDELFR.2b4_1.heavy 548.281 / 532.248 50386.0 28.28849983215332 50 20 10 10 10 8.697456064422543 11.49761484959446 0.0 3 0.9904721236038523 12.63336032859205 50386.0 30.179973601567163 0.0 - - - - - - - 791.0 100 1 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 841 107 B20140410_SF109_01 B20140410_SF109_01 TB375916.[MT7]-SANDELFR.2b5_1.heavy 548.281 / 661.291 23478.0 28.28849983215332 50 20 10 10 10 8.697456064422543 11.49761484959446 0.0 3 0.9904721236038523 12.63336032859205 23478.0 21.02052851547639 0.0 - - - - - - - 697.0 46 7 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 843 107 B20140410_SF109_01 B20140410_SF109_01 TB375916.[MT7]-SANDELFR.2y7_1.heavy 548.281 / 864.421 25193.0 28.28849983215332 50 20 10 10 10 8.697456064422543 11.49761484959446 0.0 3 0.9904721236038523 12.63336032859205 25193.0 76.10126166900238 0.0 - - - - - - - 264.0 50 11 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 845 108 B20140410_SF109_01 B20140410_SF109_01 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1893480.0 32.318599700927734 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1893480.0 291.82265936969645 0.0 - - - - - - - 3835.0 3786 1 847 108 B20140410_SF109_01 B20140410_SF109_01 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 556872.0 32.318599700927734 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 556872.0 159.8601104751803 0.0 - - - - - - - 1719.0 1113 1 849 108 B20140410_SF109_01 B20140410_SF109_01 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 768559.0 32.318599700927734 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 768559.0 127.92115279465347 0.0 - - - - - - - 1785.5 1537 2 851 109 B20140410_SF109_01 B20140410_SF109_01 TB375912.[MT7]-SSSLPAYGR.2y5_1.heavy 541.292 / 563.294 37199.0 24.173799514770508 50 20 10 10 10 20.25246323004793 4.937670981751652 0.0 3 0.9983043777226175 29.966527986268783 37199.0 67.47370827243196 0.0 - - - - - - - 810.1428571428571 74 7 EPB49 erythrocyte membrane protein band 4.9 (dematin) 853 109 B20140410_SF109_01 B20140410_SF109_01 TB375912.[MT7]-SSSLPAYGR.2b4_1.heavy 541.292 / 519.289 21020.0 24.173799514770508 50 20 10 10 10 20.25246323004793 4.937670981751652 0.0 3 0.9983043777226175 29.966527986268783 21020.0 10.721057555648715 0.0 - - - - - - - 886.0 42 2 EPB49 erythrocyte membrane protein band 4.9 (dematin) 855 109 B20140410_SF109_01 B20140410_SF109_01 TB375912.[MT7]-SSSLPAYGR.2y6_1.heavy 541.292 / 676.378 5432.0 24.173799514770508 50 20 10 10 10 20.25246323004793 4.937670981751652 0.0 3 0.9983043777226175 29.966527986268783 5432.0 11.493169015405659 0.0 - - - - - - - 343.27272727272725 10 11 EPB49 erythrocyte membrane protein band 4.9 (dematin) 857 109 B20140410_SF109_01 B20140410_SF109_01 TB375912.[MT7]-SSSLPAYGR.2y7_1.heavy 541.292 / 763.41 7440.0 24.173799514770508 50 20 10 10 10 20.25246323004793 4.937670981751652 0.0 3 0.9983043777226175 29.966527986268783 7440.0 20.32909341408459 0.0 - - - - - - - 295.0 14 8 EPB49 erythrocyte membrane protein band 4.9 (dematin) 859 110 B20140410_SF109_01 B20140410_SF109_01 TB497283.[MT7]-LVMAYEEK[MT7]EER.3y10_2.heavy 562.299 / 714.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBX7 chromobox homolog 7 861 110 B20140410_SF109_01 B20140410_SF109_01 TB497283.[MT7]-LVMAYEEK[MT7]EER.3y7_1.heavy 562.299 / 1126.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBX7 chromobox homolog 7 863 110 B20140410_SF109_01 B20140410_SF109_01 TB497283.[MT7]-LVMAYEEK[MT7]EER.3y6_1.heavy 562.299 / 963.486 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBX7 chromobox homolog 7 865 110 B20140410_SF109_01 B20140410_SF109_01 TB497283.[MT7]-LVMAYEEK[MT7]EER.3y8_1.heavy 562.299 / 1197.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBX7 chromobox homolog 7 867 111 B20140410_SF109_01 B20140410_SF109_01 TB497180.[MT7]-GTLFLPSWVR.2y5_1.heavy 660.383 / 644.352 68007.0 39.02149963378906 48 18 10 10 10 3.612170490159417 21.970026898415554 0.0 3 0.987814897890951 11.168781669532542 68007.0 34.64379861147709 1.0 - - - - - - - 698.0 136 2 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 869 111 B20140410_SF109_01 B20140410_SF109_01 TB497180.[MT7]-GTLFLPSWVR.2b4_1.heavy 660.383 / 563.331 48975.0 39.02149963378906 48 18 10 10 10 3.612170490159417 21.970026898415554 0.0 3 0.987814897890951 11.168781669532542 48975.0 63.877340073975546 0.0 - - - - - - - 706.8571428571429 97 7 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 871 111 B20140410_SF109_01 B20140410_SF109_01 TB497180.[MT7]-GTLFLPSWVR.2y6_1.heavy 660.383 / 757.435 32354.0 39.02149963378906 48 18 10 10 10 3.612170490159417 21.970026898415554 0.0 3 0.987814897890951 11.168781669532542 32354.0 22.694637818253913 0.0 - - - - - - - 254.0 64 2 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 873 111 B20140410_SF109_01 B20140410_SF109_01 TB497180.[MT7]-GTLFLPSWVR.2y7_1.heavy 660.383 / 904.504 36668.0 39.02149963378906 48 18 10 10 10 3.612170490159417 21.970026898415554 0.0 3 0.987814897890951 11.168781669532542 36668.0 86.24170697635876 0.0 - - - - - - - 269.875 73 8 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 875 112 B20140410_SF109_01 B20140410_SF109_01 TB497282.[MT7]-DSATALLYWAWSR.2b6_1.heavy 842.434 / 703.374 29752.0 42.140499114990234 48 18 10 10 10 5.974315939563652 16.738317995165104 0.0 3 0.9827047150986423 9.370668579100501 29752.0 67.76901158439946 0.0 - - - - - - - 758.7 59 10 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 877 112 B20140410_SF109_01 B20140410_SF109_01 TB497282.[MT7]-DSATALLYWAWSR.2y6_1.heavy 842.434 / 868.41 27387.0 42.140499114990234 48 18 10 10 10 5.974315939563652 16.738317995165104 0.0 3 0.9827047150986423 9.370668579100501 27387.0 52.96511648801927 0.0 - - - - - - - 788.2857142857143 54 7 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 879 112 B20140410_SF109_01 B20140410_SF109_01 TB497282.[MT7]-DSATALLYWAWSR.2b5_1.heavy 842.434 / 590.29 27781.0 42.140499114990234 48 18 10 10 10 5.974315939563652 16.738317995165104 0.0 3 0.9827047150986423 9.370668579100501 27781.0 45.0562940236952 0.0 - - - - - - - 798.1 55 10 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 881 112 B20140410_SF109_01 B20140410_SF109_01 TB497282.[MT7]-DSATALLYWAWSR.2y7_1.heavy 842.434 / 981.494 21279.0 42.140499114990234 48 18 10 10 10 5.974315939563652 16.738317995165104 0.0 3 0.9827047150986423 9.370668579100501 21279.0 55.988306454294545 0.0 - - - - - - - 266.2 42 10 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 883 113 B20140410_SF109_01 B20140410_SF109_01 TB238351.[MT7]-IQSPADK[MT7].2y4_1.heavy 523.808 / 574.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAT1 adenosine deaminase, tRNA-specific 1 885 113 B20140410_SF109_01 B20140410_SF109_01 TB238351.[MT7]-IQSPADK[MT7].2y5_1.heavy 523.808 / 661.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAT1 adenosine deaminase, tRNA-specific 1 887 113 B20140410_SF109_01 B20140410_SF109_01 TB238351.[MT7]-IQSPADK[MT7].2b6_1.heavy 523.808 / 756.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAT1 adenosine deaminase, tRNA-specific 1 889 113 B20140410_SF109_01 B20140410_SF109_01 TB238351.[MT7]-IQSPADK[MT7].2y6_1.heavy 523.808 / 789.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAT1 adenosine deaminase, tRNA-specific 1 891 114 B20140410_SF109_01 B20140410_SF109_01 TB376084.[MT7]-GK[MT7]VEYLVK[MT7].3y3_1.heavy 456.626 / 503.367 71377.0 26.480199813842773 44 14 10 10 10 1.5640091546612283 52.46346714584133 0.0 3 0.9308503597771549 4.665868052162582 71377.0 51.58817949487892 0.0 - - - - - - - 417.0 142 1 CBX7 chromobox homolog 7 893 114 B20140410_SF109_01 B20140410_SF109_01 TB376084.[MT7]-GK[MT7]VEYLVK[MT7].3b4_1.heavy 456.626 / 702.439 24857.0 26.480199813842773 44 14 10 10 10 1.5640091546612283 52.46346714584133 0.0 3 0.9308503597771549 4.665868052162582 24857.0 27.31385282507412 0.0 - - - - - - - 278.0 49 8 CBX7 chromobox homolog 7 895 114 B20140410_SF109_01 B20140410_SF109_01 TB376084.[MT7]-GK[MT7]VEYLVK[MT7].3b5_1.heavy 456.626 / 865.502 14025.0 26.480199813842773 44 14 10 10 10 1.5640091546612283 52.46346714584133 0.0 3 0.9308503597771549 4.665868052162582 14025.0 127.63758992805755 0.0 - - - - - - - 295.375 28 8 CBX7 chromobox homolog 7 897 114 B20140410_SF109_01 B20140410_SF109_01 TB376084.[MT7]-GK[MT7]VEYLVK[MT7].3y4_1.heavy 456.626 / 666.431 60268.0 26.480199813842773 44 14 10 10 10 1.5640091546612283 52.46346714584133 0.0 3 0.9308503597771549 4.665868052162582 60268.0 79.36898922531975 0.0 - - - - - - - 278.0 120 3 CBX7 chromobox homolog 7 899 115 B20140410_SF109_01 B20140410_SF109_01 TB375743.[MT7]-EAAAAR.2y4_1.heavy 366.71 / 388.23 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKAP2;CCDC153 A kinase (PRKA) anchor protein 2;coiled-coil domain containing 153 901 115 B20140410_SF109_01 B20140410_SF109_01 TB375743.[MT7]-EAAAAR.2y5_1.heavy 366.71 / 459.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKAP2;CCDC153 A kinase (PRKA) anchor protein 2;coiled-coil domain containing 153 903 115 B20140410_SF109_01 B20140410_SF109_01 TB375743.[MT7]-EAAAAR.2b4_2.heavy 366.71 / 244.135 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKAP2;CCDC153 A kinase (PRKA) anchor protein 2;coiled-coil domain containing 153 905 115 B20140410_SF109_01 B20140410_SF109_01 TB375743.[MT7]-EAAAAR.2y3_1.heavy 366.71 / 317.193 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKAP2;CCDC153 A kinase (PRKA) anchor protein 2;coiled-coil domain containing 153 907 116 B20140410_SF109_01 B20140410_SF109_01 TB375849.[MT7]-GC[CAM]AFVK[MT7].2y4_1.heavy 485.275 / 608.389 6633.0 24.437249183654785 28 15 0 5 8 2.497189187638101 27.053413512095254 0.04689979553222656 4 0.9547000334801743 5.776438854058925 6633.0 12.189035097800353 0.0 - - - - - - - 643.8571428571429 13 7 CELF3;CELF4;CELF6;CELF5 CUGBP, Elav-like family member 3;CUGBP, Elav-like family member 4;CUGBP, Elav-like family member 6;CUGBP, Elav-like family member 5 909 116 B20140410_SF109_01 B20140410_SF109_01 TB375849.[MT7]-GC[CAM]AFVK[MT7].2y5_1.heavy 485.275 / 768.419 5381.0 24.437249183654785 28 15 0 5 8 2.497189187638101 27.053413512095254 0.04689979553222656 4 0.9547000334801743 5.776438854058925 5381.0 8.87362892041169 0.0 - - - - - - - 187.5 10 8 CELF3;CELF4;CELF6;CELF5 CUGBP, Elav-like family member 3;CUGBP, Elav-like family member 4;CUGBP, Elav-like family member 6;CUGBP, Elav-like family member 5 911 116 B20140410_SF109_01 B20140410_SF109_01 TB375849.[MT7]-GC[CAM]AFVK[MT7].2b4_1.heavy 485.275 / 580.267 6007.0 24.437249183654785 28 15 0 5 8 2.497189187638101 27.053413512095254 0.04689979553222656 4 0.9547000334801743 5.776438854058925 6007.0 9.358665771513596 1.0 - - - - - - - 312.5 109 2 CELF3;CELF4;CELF6;CELF5 CUGBP, Elav-like family member 3;CUGBP, Elav-like family member 4;CUGBP, Elav-like family member 6;CUGBP, Elav-like family member 5 913 116 B20140410_SF109_01 B20140410_SF109_01 TB375849.[MT7]-GC[CAM]AFVK[MT7].2y3_1.heavy 485.275 / 537.352 5632.0 24.437249183654785 28 15 0 5 8 2.497189187638101 27.053413512095254 0.04689979553222656 4 0.9547000334801743 5.776438854058925 5632.0 9.33978021978022 0.0 - - - - - - - 250.0 11 3 CELF3;CELF4;CELF6;CELF5 CUGBP, Elav-like family member 3;CUGBP, Elav-like family member 4;CUGBP, Elav-like family member 6;CUGBP, Elav-like family member 5 915 117 B20140410_SF109_01 B20140410_SF109_01 TB375847.[MT7]-STEGPQGAVAIK[MT7].3b4_1.heavy 482.612 / 519.253 37092.0 24.99340057373047 41 11 10 10 10 0.8700619000777261 69.24183709470265 0.0 3 0.8602718341748621 3.2623359988763645 37092.0 20.826858315845183 0.0 - - - - - - - 406.0 74 1 SLC36A2 solute carrier family 36 (proton/amino acid symporter), member 2 917 117 B20140410_SF109_01 B20140410_SF109_01 TB375847.[MT7]-STEGPQGAVAIK[MT7].3y4_1.heavy 482.612 / 574.404 38175.0 24.99340057373047 41 11 10 10 10 0.8700619000777261 69.24183709470265 0.0 3 0.8602718341748621 3.2623359988763645 38175.0 16.731838370652525 0.0 - - - - - - - 677.0 76 1 SLC36A2 solute carrier family 36 (proton/amino acid symporter), member 2 919 117 B20140410_SF109_01 B20140410_SF109_01 TB375847.[MT7]-STEGPQGAVAIK[MT7].3b8_1.heavy 482.612 / 872.423 15026.0 24.99340057373047 41 11 10 10 10 0.8700619000777261 69.24183709470265 0.0 3 0.8602718341748621 3.2623359988763645 15026.0 41.282658788774 0.0 - - - - - - - 212.57142857142858 30 7 SLC36A2 solute carrier family 36 (proton/amino acid symporter), member 2 921 117 B20140410_SF109_01 B20140410_SF109_01 TB375847.[MT7]-STEGPQGAVAIK[MT7].3b7_1.heavy 482.612 / 801.386 19088.0 24.99340057373047 41 11 10 10 10 0.8700619000777261 69.24183709470265 0.0 3 0.8602718341748621 3.2623359988763645 19088.0 26.979244858557877 0.0 - - - - - - - 715.2857142857143 38 7 SLC36A2 solute carrier family 36 (proton/amino acid symporter), member 2 923 118 B20140410_SF109_01 B20140410_SF109_01 TB375846.[MT7]-FLLDRR.2b3_1.heavy 482.296 / 518.346 14234.0 28.46030044555664 48 18 10 10 10 23.579514250055475 4.240969467798291 0.0 3 0.9826920504114334 9.367229618693463 14234.0 7.900673818286444 2.0 - - - - - - - 747.0 28 3 EIF4EBP2 eukaryotic translation initiation factor 4E binding protein 2 925 118 B20140410_SF109_01 B20140410_SF109_01 TB375846.[MT7]-FLLDRR.2y5_1.heavy 482.296 / 672.415 17792.0 28.46030044555664 48 18 10 10 10 23.579514250055475 4.240969467798291 0.0 3 0.9826920504114334 9.367229618693463 17792.0 7.180997954248928 1.0 - - - - - - - 1318.0 39 8 EIF4EBP2 eukaryotic translation initiation factor 4E binding protein 2 927 118 B20140410_SF109_01 B20140410_SF109_01 TB375846.[MT7]-FLLDRR.2b4_1.heavy 482.296 / 633.373 155255.0 28.46030044555664 48 18 10 10 10 23.579514250055475 4.240969467798291 0.0 3 0.9826920504114334 9.367229618693463 155255.0 130.37687632179515 0.0 - - - - - - - 791.0 310 7 EIF4EBP2 eukaryotic translation initiation factor 4E binding protein 2 929 118 B20140410_SF109_01 B20140410_SF109_01 TB375846.[MT7]-FLLDRR.2b5_1.heavy 482.296 / 789.474 28863.0 28.46030044555664 48 18 10 10 10 23.579514250055475 4.240969467798291 0.0 3 0.9826920504114334 9.367229618693463 28863.0 24.439938987814703 0.0 - - - - - - - 307.6666666666667 57 3 EIF4EBP2 eukaryotic translation initiation factor 4E binding protein 2 931 119 B20140410_SF109_01 B20140410_SF109_01 TB376311.[MT7]-AC[CAM]DTPDK[MT7]PVQVTK[MT7].3b6_1.heavy 631.016 / 804.331 7365.0 22.86240005493164 43 13 10 10 10 1.95095474967651 41.66223415021278 0.0 3 0.9250895231476427 4.480659762743782 7365.0 17.079773869346734 1.0 - - - - - - - 192.14285714285714 14 14 ADAT1 adenosine deaminase, tRNA-specific 1 933 119 B20140410_SF109_01 B20140410_SF109_01 TB376311.[MT7]-AC[CAM]DTPDK[MT7]PVQVTK[MT7].3y6_1.heavy 631.016 / 815.511 6768.0 22.86240005493164 43 13 10 10 10 1.95095474967651 41.66223415021278 0.0 3 0.9250895231476427 4.480659762743782 6768.0 34.72426130653267 1.0 - - - - - - - 269.47058823529414 13 17 ADAT1 adenosine deaminase, tRNA-specific 1 935 119 B20140410_SF109_01 B20140410_SF109_01 TB376311.[MT7]-AC[CAM]DTPDK[MT7]PVQVTK[MT7].3y7_2.heavy 631.016 / 544.357 20901.0 22.86240005493164 43 13 10 10 10 1.95095474967651 41.66223415021278 0.0 3 0.9250895231476427 4.480659762743782 20901.0 31.49732311109117 0.0 - - - - - - - 723.9090909090909 41 11 ADAT1 adenosine deaminase, tRNA-specific 1 937 119 B20140410_SF109_01 B20140410_SF109_01 TB376311.[MT7]-AC[CAM]DTPDK[MT7]PVQVTK[MT7].3b7_2.heavy 631.016 / 538.768 10451.0 22.86240005493164 43 13 10 10 10 1.95095474967651 41.66223415021278 0.0 3 0.9250895231476427 4.480659762743782 10451.0 21.635061137826867 0.0 - - - - - - - 321.0 20 9 ADAT1 adenosine deaminase, tRNA-specific 1 939 120 B20140410_SF109_01 B20140410_SF109_01 TB376315.[MT7]-K[MT7]LEAADLVIFQSK[MT7].3b6_1.heavy 632.051 / 916.534 72904.0 33.91709899902344 39 9 10 10 10 0.6676416423640364 76.73931261551553 0.0 3 0.8142343179925936 2.817831943504954 72904.0 78.28731517509728 0.0 - - - - - - - 718.5 145 8 NQO1 NAD(P)H dehydrogenase, quinone 1 941 120 B20140410_SF109_01 B20140410_SF109_01 TB376315.[MT7]-K[MT7]LEAADLVIFQSK[MT7].3y4_1.heavy 632.051 / 653.374 182960.0 33.91709899902344 39 9 10 10 10 0.6676416423640364 76.73931261551553 0.0 3 0.8142343179925936 2.817831943504954 182960.0 142.83779935692317 0.0 - - - - - - - 280.5 365 2 NQO1 NAD(P)H dehydrogenase, quinone 1 943 120 B20140410_SF109_01 B20140410_SF109_01 TB376315.[MT7]-K[MT7]LEAADLVIFQSK[MT7].3b7_1.heavy 632.051 / 1029.62 43742.0 33.91709899902344 39 9 10 10 10 0.6676416423640364 76.73931261551553 0.0 3 0.8142343179925936 2.817831943504954 43742.0 220.56536138445875 0.0 - - - - - - - 233.5 87 12 NQO1 NAD(P)H dehydrogenase, quinone 1 945 120 B20140410_SF109_01 B20140410_SF109_01 TB376315.[MT7]-K[MT7]LEAADLVIFQSK[MT7].3y5_1.heavy 632.051 / 766.458 110337.0 33.91709899902344 39 9 10 10 10 0.6676416423640364 76.73931261551553 0.0 3 0.8142343179925936 2.817831943504954 110337.0 166.43585738154755 0.0 - - - - - - - 1282.0 220 7 NQO1 NAD(P)H dehydrogenase, quinone 1 947 121 B20140410_SF109_01 B20140410_SF109_01 TB238640.[MT7]-SRQVAALLPPRGR.4y5_1.heavy 391.993 / 582.347 14047.0 25.14150047302246 40 10 10 10 10 0.6987134137047413 82.12055096758573 0.0 3 0.835630535065021 3.0013401890030873 14047.0 22.032953234776578 0.0 - - - - - - - 357.8 28 5 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 949 121 B20140410_SF109_01 B20140410_SF109_01 TB238640.[MT7]-SRQVAALLPPRGR.4y8_2.heavy 391.993 / 440.28 21484.0 25.14150047302246 40 10 10 10 10 0.6987134137047413 82.12055096758573 0.0 3 0.835630535065021 3.0013401890030873 21484.0 9.94472058156905 0.0 - - - - - - - 275.5 42 2 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 951 121 B20140410_SF109_01 B20140410_SF109_01 TB238640.[MT7]-SRQVAALLPPRGR.4b7_1.heavy 391.993 / 870.528 N/A 25.14150047302246 40 10 10 10 10 0.6987134137047413 82.12055096758573 0.0 3 0.835630535065021 3.0013401890030873 138.0 1.501818181818182 13.0 - - - - - - - 0.0 0 0 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 953 121 B20140410_SF109_01 B20140410_SF109_01 TB238640.[MT7]-SRQVAALLPPRGR.4b6_1.heavy 391.993 / 757.444 9089.0 25.14150047302246 40 10 10 10 10 0.6987134137047413 82.12055096758573 0.0 3 0.835630535065021 3.0013401890030873 9089.0 18.68962006091988 0.0 - - - - - - - 413.0 18 3 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 955 122 B20140410_SF109_01 B20140410_SF109_01 TB238846.[MT7]-GK[MT7]PEPNHEWTLLAAVVK[MT7].4y4_1.heavy 581.089 / 560.389 29825.0 34.432098388671875 36 8 10 10 8 1.5458742792848899 46.34006882118477 0.0 4 0.7612583553357394 2.4737325256281903 29825.0 18.11831317664312 0.0 - - - - - - - 700.0 59 1 ADAT1 adenosine deaminase, tRNA-specific 1 957 122 B20140410_SF109_01 B20140410_SF109_01 TB238846.[MT7]-GK[MT7]PEPNHEWTLLAAVVK[MT7].4y5_1.heavy 581.089 / 631.426 47048.0 34.432098388671875 36 8 10 10 8 1.5458742792848899 46.34006882118477 0.0 4 0.7612583553357394 2.4737325256281903 47048.0 5.482151347997879 1.0 - - - - - - - 840.0 136 1 ADAT1 adenosine deaminase, tRNA-specific 1 959 122 B20140410_SF109_01 B20140410_SF109_01 TB238846.[MT7]-GK[MT7]PEPNHEWTLLAAVVK[MT7].4b8_2.heavy 581.089 / 589.314 23664.0 34.432098388671875 36 8 10 10 8 1.5458742792848899 46.34006882118477 0.0 4 0.7612583553357394 2.4737325256281903 23664.0 13.389810322141898 1.0 - - - - - - - 1260.0 50 8 ADAT1 adenosine deaminase, tRNA-specific 1 961 122 B20140410_SF109_01 B20140410_SF109_01 TB238846.[MT7]-GK[MT7]PEPNHEWTLLAAVVK[MT7].4b6_1.heavy 581.089 / 911.519 4341.0 34.432098388671875 36 8 10 10 8 1.5458742792848899 46.34006882118477 0.0 4 0.7612583553357394 2.4737325256281903 4341.0 7.2202346938775515 0.0 - - - - - - - 280.0 8 9 ADAT1 adenosine deaminase, tRNA-specific 1 963 123 B20140410_SF109_01 B20140410_SF109_01 TB497177.[MT7]-ITQLYFLK[MT7].2y4_1.heavy 657.407 / 714.431 36642.0 36.68949890136719 48 18 10 10 10 19.250604368669695 5.194642104990206 0.0 3 0.9868354699124988 10.744398183070965 36642.0 47.04296046870296 0.0 - - - - - - - 875.7142857142857 73 7 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 965 123 B20140410_SF109_01 B20140410_SF109_01 TB497177.[MT7]-ITQLYFLK[MT7].2b4_1.heavy 657.407 / 600.384 23407.0 36.68949890136719 48 18 10 10 10 19.250604368669695 5.194642104990206 0.0 3 0.9868354699124988 10.744398183070965 23407.0 22.245142922657745 0.0 - - - - - - - 1751.5714285714287 46 7 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 967 123 B20140410_SF109_01 B20140410_SF109_01 TB497177.[MT7]-ITQLYFLK[MT7].2y3_1.heavy 657.407 / 551.367 18809.0 36.68949890136719 48 18 10 10 10 19.250604368669695 5.194642104990206 0.0 3 0.9868354699124988 10.744398183070965 18809.0 20.30875172481766 0.0 - - - - - - - 371.6666666666667 37 3 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 969 123 B20140410_SF109_01 B20140410_SF109_01 TB497177.[MT7]-ITQLYFLK[MT7].2y7_1.heavy 657.407 / 1056.62 20063.0 36.68949890136719 48 18 10 10 10 19.250604368669695 5.194642104990206 0.0 3 0.9868354699124988 10.744398183070965 20063.0 23.353228652853538 0.0 - - - - - - - 306.6 40 5 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 971 124 B20140410_SF109_01 B20140410_SF109_01 TB238481.[MT7]-IQQNLDQLR.2y8_1.heavy 636.363 / 1014.53 14013.0 28.37470054626465 38 18 2 10 8 3.0234157003714497 25.497503767067204 0.0 4 0.9817350011275051 9.117783753101905 14013.0 25.672671755725187 0.0 - - - - - - - 622.25 28 12 APOA5 apolipoprotein A-V 973 124 B20140410_SF109_01 B20140410_SF109_01 TB238481.[MT7]-IQQNLDQLR.2b6_1.heavy 636.363 / 856.464 5631.0 28.37470054626465 38 18 2 10 8 3.0234157003714497 25.497503767067204 0.0 4 0.9817350011275051 9.117783753101905 5631.0 10.101412213740456 0.0 - - - - - - - 209.6 11 10 APOA5 apolipoprotein A-V 975 124 B20140410_SF109_01 B20140410_SF109_01 TB238481.[MT7]-IQQNLDQLR.2y6_1.heavy 636.363 / 758.416 4584.0 28.37470054626465 38 18 2 10 8 3.0234157003714497 25.497503767067204 0.0 4 0.9817350011275051 9.117783753101905 4584.0 5.169326856349757 2.0 - - - - - - - 707.4 64 10 APOA5 apolipoprotein A-V 977 124 B20140410_SF109_01 B20140410_SF109_01 TB238481.[MT7]-IQQNLDQLR.2y7_1.heavy 636.363 / 886.474 2619.0 28.37470054626465 38 18 2 10 8 3.0234157003714497 25.497503767067204 0.0 4 0.9817350011275051 9.117783753101905 2619.0 4.498282442748092 1.0 - - - - - - - 222.7 5 10 APOA5 apolipoprotein A-V 979 125 B20140410_SF109_01 B20140410_SF109_01 TB238387.[MT7]-RTPEIVLR.3y6_1.heavy 376.572 / 726.451 7982.0 26.526199340820312 43 15 10 10 8 2.405513835670941 32.78335263801161 0.0 4 0.9591859660607895 6.087925390610059 7982.0 30.92300242130751 0.0 - - - - - - - 344.0 15 4 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 981 125 B20140410_SF109_01 B20140410_SF109_01 TB238387.[MT7]-RTPEIVLR.3y3_1.heavy 376.572 / 387.271 88764.0 26.526199340820312 43 15 10 10 8 2.405513835670941 32.78335263801161 0.0 4 0.9591859660607895 6.087925390610059 88764.0 136.5833012008111 0.0 - - - - - - - 138.0 177 1 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 983 125 B20140410_SF109_01 B20140410_SF109_01 TB238387.[MT7]-RTPEIVLR.3b4_1.heavy 376.572 / 628.354 36056.0 26.526199340820312 43 15 10 10 8 2.405513835670941 32.78335263801161 0.0 4 0.9591859660607895 6.087925390610059 36056.0 42.19127176205563 2.0 - - - - - - - 275.3333333333333 113 3 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 985 125 B20140410_SF109_01 B20140410_SF109_01 TB238387.[MT7]-RTPEIVLR.3y4_1.heavy 376.572 / 500.355 57249.0 26.526199340820312 43 15 10 10 8 2.405513835670941 32.78335263801161 0.0 4 0.9591859660607895 6.087925390610059 57249.0 34.564947628363655 0.0 - - - - - - - 688.0 114 7 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 987 126 B20140410_SF109_01 B20140410_SF109_01 TB376317.[MT7]-SFLSSPITFAFISLAR.3y7_1.heavy 634.36 / 777.462 20912.0 46.978126525878906 46 18 10 8 10 11.668358861688644 8.570185506407025 0.0196990966796875 3 0.9874649418366453 11.011449413439104 20912.0 87.8603624104509 0.0 - - - - - - - 622.3333333333334 41 9 TMEM155 transmembrane protein 155 989 126 B20140410_SF109_01 B20140410_SF109_01 TB376317.[MT7]-SFLSSPITFAFISLAR.3y6_1.heavy 634.36 / 706.425 33031.0 46.978126525878906 46 18 10 8 10 11.668358861688644 8.570185506407025 0.0196990966796875 3 0.9874649418366453 11.011449413439104 33031.0 111.21186093779542 0.0 - - - - - - - 276.23333333333335 66 30 TMEM155 transmembrane protein 155 991 126 B20140410_SF109_01 B20140410_SF109_01 TB376317.[MT7]-SFLSSPITFAFISLAR.3b5_1.heavy 634.36 / 666.358 23509.0 46.978126525878906 46 18 10 8 10 11.668358861688644 8.570185506407025 0.0196990966796875 3 0.9874649418366453 11.011449413439104 23509.0 96.5561791439591 0.0 - - - - - - - 254.7741935483871 47 31 TMEM155 transmembrane protein 155 993 126 B20140410_SF109_01 B20140410_SF109_01 TB376317.[MT7]-SFLSSPITFAFISLAR.3y5_1.heavy 634.36 / 559.356 21896.0 46.978126525878906 46 18 10 8 10 11.668358861688644 8.570185506407025 0.0196990966796875 3 0.9874649418366453 11.011449413439104 21896.0 81.71796286472149 0.0 - - - - - - - 630.4285714285714 43 7 TMEM155 transmembrane protein 155 995 127 B20140410_SF109_01 B20140410_SF109_01 TB497171.[MT7]-SVAPHAPASPAR.3y7_1.heavy 435.578 / 669.368 48875.0 20.625999450683594 44 14 10 10 10 2.3272479531622197 32.400713147144074 0.0 3 0.9358906426638662 4.847900534920238 48875.0 72.43878282955968 0.0 - - - - - - - 786.625 97 8 APOA5 apolipoprotein A-V 997 127 B20140410_SF109_01 B20140410_SF109_01 TB497171.[MT7]-SVAPHAPASPAR.3y6_1.heavy 435.578 / 598.331 297703.0 20.625999450683594 44 14 10 10 10 2.3272479531622197 32.400713147144074 0.0 3 0.9358906426638662 4.847900534920238 297703.0 78.27644614079729 1.0 - - - - - - - 424.0 595 1 APOA5 apolipoprotein A-V 999 127 B20140410_SF109_01 B20140410_SF109_01 TB497171.[MT7]-SVAPHAPASPAR.3b3_1.heavy 435.578 / 402.247 165438.0 20.625999450683594 44 14 10 10 10 2.3272479531622197 32.400713147144074 0.0 3 0.9358906426638662 4.847900534920238 165438.0 86.28622073446999 0.0 - - - - - - - 1344.0 330 1 APOA5 apolipoprotein A-V 1001 127 B20140410_SF109_01 B20140410_SF109_01 TB497171.[MT7]-SVAPHAPASPAR.3y5_1.heavy 435.578 / 501.278 59201.0 20.625999450683594 44 14 10 10 10 2.3272479531622197 32.400713147144074 0.0 3 0.9358906426638662 4.847900534920238 59201.0 23.919595959595963 1.0 - - - - - - - 495.0 118 1 APOA5 apolipoprotein A-V 1003 128 B20140410_SF109_01 B20140410_SF109_01 TB238384.[MT7]-VVLSWTK[MT7].2y4_1.heavy 560.852 / 665.374 39367.0 32.499698638916016 45 17 10 10 8 8.635123359736124 11.580610471215763 0.0 4 0.9715190921261967 7.2954027420352965 39367.0 31.448337442053948 0.0 - - - - - - - 132.0 78 1 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1005 128 B20140410_SF109_01 B20140410_SF109_01 TB238384.[MT7]-VVLSWTK[MT7].2y5_1.heavy 560.852 / 778.458 25016.0 32.499698638916016 45 17 10 10 8 8.635123359736124 11.580610471215763 0.0 4 0.9715190921261967 7.2954027420352965 25016.0 71.68493078737337 0.0 - - - - - - - 752.5714285714286 50 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1007 128 B20140410_SF109_01 B20140410_SF109_01 TB238384.[MT7]-VVLSWTK[MT7].2y3_1.heavy 560.852 / 578.342 15799.0 32.499698638916016 45 17 10 10 8 8.635123359736124 11.580610471215763 0.0 4 0.9715190921261967 7.2954027420352965 15799.0 9.37911858361251 0.0 - - - - - - - 1222.4285714285713 31 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1009 128 B20140410_SF109_01 B20140410_SF109_01 TB238384.[MT7]-VVLSWTK[MT7].2y6_1.heavy 560.852 / 877.526 25806.0 32.499698638916016 45 17 10 10 8 8.635123359736124 11.580610471215763 0.0 4 0.9715190921261967 7.2954027420352965 25806.0 34.208096332359624 1.0 - - - - - - - 282.0 68 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1011 129 B20140410_SF109_01 B20140410_SF109_01 TB238385.[MT7]-RNNQFFR.3y3_1.heavy 375.873 / 469.256 21749.0 24.894100189208984 44 14 10 10 10 2.7841328837710737 35.91782582753422 0.0 3 0.9365036010448881 4.871498589875335 21749.0 50.82052763819095 0.0 - - - - - - - 736.7777777777778 43 9 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1013 129 B20140410_SF109_01 B20140410_SF109_01 TB238385.[MT7]-RNNQFFR.3b4_1.heavy 375.873 / 657.355 3050.0 24.894100189208984 44 14 10 10 10 2.7841328837710737 35.91782582753422 0.0 3 0.9365036010448881 4.871498589875335 3050.0 14.253768844221106 0.0 - - - - - - - 303.2857142857143 6 7 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1015 129 B20140410_SF109_01 B20140410_SF109_01 TB238385.[MT7]-RNNQFFR.3y4_1.heavy 375.873 / 597.314 5437.0 24.894100189208984 44 14 10 10 10 2.7841328837710737 35.91782582753422 0.0 3 0.9365036010448881 4.871498589875335 5437.0 19.085962264150943 1.0 - - - - - - - 625.0 10 7 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1017 129 B20140410_SF109_01 B20140410_SF109_01 TB238385.[MT7]-RNNQFFR.3b3_1.heavy 375.873 / 529.296 7559.0 24.894100189208984 44 14 10 10 10 2.7841328837710737 35.91782582753422 0.0 3 0.9365036010448881 4.871498589875335 7559.0 6.574652846599586 0.0 - - - - - - - 199.0 15 4 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1019 130 B20140410_SF109_01 B20140410_SF109_01 TB238788.[MT7]-VTVIDRGTLFLPSWVR.3y7_1.heavy 668.39 / 904.504 6796.0 38.698699951171875 46 16 10 10 10 4.2043998797220015 23.784607283028485 0.0 3 0.9607551122208869 6.209264685104589 6796.0 11.459142300194932 0.0 - - - - - - - 612.6666666666666 13 9 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1021 130 B20140410_SF109_01 B20140410_SF109_01 TB238788.[MT7]-VTVIDRGTLFLPSWVR.3y6_1.heavy 668.39 / 757.435 6924.0 38.698699951171875 46 16 10 10 10 4.2043998797220015 23.784607283028485 0.0 3 0.9607551122208869 6.209264685104589 6924.0 13.502341462672721 0.0 - - - - - - - 714.2857142857143 13 7 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1023 130 B20140410_SF109_01 B20140410_SF109_01 TB238788.[MT7]-VTVIDRGTLFLPSWVR.3y5_1.heavy 668.39 / 644.352 23465.0 38.698699951171875 46 16 10 10 10 4.2043998797220015 23.784607283028485 0.0 3 0.9607551122208869 6.209264685104589 23465.0 22.982327687834584 0.0 - - - - - - - 320.5 46 4 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1025 130 B20140410_SF109_01 B20140410_SF109_01 TB238788.[MT7]-VTVIDRGTLFLPSWVR.3y10_1.heavy 668.39 / 1175.66 3334.0 38.698699951171875 46 16 10 10 10 4.2043998797220015 23.784607283028485 0.0 3 0.9607551122208869 6.209264685104589 3334.0 14.721558441558443 0.0 - - - - - - - 299.1111111111111 6 9 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1027 131 B20140410_SF109_01 B20140410_SF109_01 TB497170.[MT7]-SIPTDNQIK[MT7].2y4_1.heavy 652.377 / 646.4 25542.0 24.699199676513672 48 18 10 10 10 3.7286096876261703 26.819648173919028 0.0 3 0.9887520980436358 11.625688748057891 25542.0 17.396963912443304 0.0 - - - - - - - 713.0 51 2 NQO1 NAD(P)H dehydrogenase, quinone 1 1029 131 B20140410_SF109_01 B20140410_SF109_01 TB497170.[MT7]-SIPTDNQIK[MT7].2y5_1.heavy 652.377 / 761.427 2593.0 24.699199676513672 48 18 10 10 10 3.7286096876261703 26.819648173919028 0.0 3 0.9887520980436358 11.625688748057891 2593.0 4.041540186994256 0.0 - - - - - - - 704.0 5 7 NQO1 NAD(P)H dehydrogenase, quinone 1 1031 131 B20140410_SF109_01 B20140410_SF109_01 TB497170.[MT7]-SIPTDNQIK[MT7].2y6_1.heavy 652.377 / 862.475 2204.0 24.699199676513672 48 18 10 10 10 3.7286096876261703 26.819648173919028 0.0 3 0.9887520980436358 11.625688748057891 2204.0 5.777788019444536 1.0 - - - - - - - 270.1666666666667 4 12 NQO1 NAD(P)H dehydrogenase, quinone 1 1033 131 B20140410_SF109_01 B20140410_SF109_01 TB497170.[MT7]-SIPTDNQIK[MT7].2y7_1.heavy 652.377 / 959.528 72089.0 24.699199676513672 48 18 10 10 10 3.7286096876261703 26.819648173919028 0.0 3 0.9887520980436358 11.625688748057891 72089.0 546.9811334569044 0.0 - - - - - - - 237.66666666666666 144 6 NQO1 NAD(P)H dehydrogenase, quinone 1 1035 132 B20140410_SF109_01 B20140410_SF109_01 TB238787.[MT7]-RLQGSGVTVNALHPGVAR.4y5_1.heavy 494.787 / 499.299 860790.0 25.94610023498535 45 15 10 10 10 2.163660567266822 35.21140902802066 0.0 3 0.9540215158672466 5.733328438051001 860790.0 73.97621879764117 0.0 - - - - - - - 742.3333333333334 1721 3 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1037 132 B20140410_SF109_01 B20140410_SF109_01 TB238787.[MT7]-RLQGSGVTVNALHPGVAR.4y6_1.heavy 494.787 / 636.358 163875.0 25.94610023498535 45 15 10 10 10 2.163660567266822 35.21140902802066 0.0 3 0.9540215158672466 5.733328438051001 163875.0 48.1945394901462 0.0 - - - - - - - 278.0 327 2 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1039 132 B20140410_SF109_01 B20140410_SF109_01 TB238787.[MT7]-RLQGSGVTVNALHPGVAR.4b10_2.heavy 494.787 / 578.831 380196.0 25.94610023498535 45 15 10 10 10 2.163660567266822 35.21140902802066 0.0 3 0.9540215158672466 5.733328438051001 380196.0 54.78504274193186 0.0 - - - - - - - 347.5 760 4 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1041 132 B20140410_SF109_01 B20140410_SF109_01 TB238787.[MT7]-RLQGSGVTVNALHPGVAR.4b6_1.heavy 494.787 / 743.428 63157.0 25.94610023498535 45 15 10 10 10 2.163660567266822 35.21140902802066 0.0 3 0.9540215158672466 5.733328438051001 63157.0 53.247348782791335 0.0 - - - - - - - 735.5714285714286 126 7 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1043 133 B20140410_SF109_01 B20140410_SF109_01 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 512603.0 23.981199264526367 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 512603.0 165.03600713285135 0.0 - - - - - - - 787.5 1025 2 1045 133 B20140410_SF109_01 B20140410_SF109_01 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 901566.0 23.981199264526367 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 901566.0 528.3888917853775 0.0 - - - - - - - 318.3333333333333 1803 6 1047 133 B20140410_SF109_01 B20140410_SF109_01 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 3007140.0 23.981199264526367 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 3007140.0 931.428168709627 0.0 - - - - - - - 225.0 6014 1 1049 134 B20140410_SF109_01 B20140410_SF109_01 TB238489.[MT7]-VQELQEQLR.3b4_1.heavy 429.578 / 614.363 38876.0 28.200700759887695 50 20 10 10 10 9.79728283131907 10.206911622509153 0.0 3 0.9981976904587502 29.06580994893574 38876.0 43.046089965397925 0.0 - - - - - - - 1274.1 77 10 APOA5 apolipoprotein A-V 1051 134 B20140410_SF109_01 B20140410_SF109_01 TB238489.[MT7]-VQELQEQLR.3y4_1.heavy 429.578 / 545.304 113477.0 28.200700759887695 50 20 10 10 10 9.79728283131907 10.206911622509153 0.0 3 0.9981976904587502 29.06580994893574 113477.0 127.1440633361868 0.0 - - - - - - - 1211.2222222222222 226 9 APOA5 apolipoprotein A-V 1053 134 B20140410_SF109_01 B20140410_SF109_01 TB238489.[MT7]-VQELQEQLR.3b3_1.heavy 429.578 / 501.279 169559.0 28.200700759887695 50 20 10 10 10 9.79728283131907 10.206911622509153 0.0 3 0.9981976904587502 29.06580994893574 169559.0 80.04489944333784 0.0 - - - - - - - 2413.125 339 8 APOA5 apolipoprotein A-V 1055 134 B20140410_SF109_01 B20140410_SF109_01 TB238489.[MT7]-VQELQEQLR.3y5_1.heavy 429.578 / 673.363 59497.0 28.200700759887695 50 20 10 10 10 9.79728283131907 10.206911622509153 0.0 3 0.9981976904587502 29.06580994893574 59497.0 51.349489408917464 0.0 - - - - - - - 738.625 118 8 APOA5 apolipoprotein A-V 1057 135 B20140410_SF109_01 B20140410_SF109_01 TB375833.[MT7]-EPATLK[MT7].2b3_1.heavy 473.794 / 442.242 N/A N/A - - - - - - - - - 0.0 - - - - - - - APOA5 apolipoprotein A-V 1059 135 B20140410_SF109_01 B20140410_SF109_01 TB375833.[MT7]-EPATLK[MT7].2y4_1.heavy 473.794 / 576.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - APOA5 apolipoprotein A-V 1061 135 B20140410_SF109_01 B20140410_SF109_01 TB375833.[MT7]-EPATLK[MT7].2y5_1.heavy 473.794 / 673.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - APOA5 apolipoprotein A-V 1063 135 B20140410_SF109_01 B20140410_SF109_01 TB375833.[MT7]-EPATLK[MT7].2y3_1.heavy 473.794 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - APOA5 apolipoprotein A-V 1065 136 B20140410_SF109_01 B20140410_SF109_01 TB375835.[MT7]-IGDLDK[MT7].2y4_1.heavy 474.784 / 634.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - GABARAP GABA(A) receptor-associated protein 1067 136 B20140410_SF109_01 B20140410_SF109_01 TB375835.[MT7]-IGDLDK[MT7].2y5_1.heavy 474.784 / 691.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - GABARAP GABA(A) receptor-associated protein 1069 136 B20140410_SF109_01 B20140410_SF109_01 TB375835.[MT7]-IGDLDK[MT7].2y3_1.heavy 474.784 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - GABARAP GABA(A) receptor-associated protein 1071 136 B20140410_SF109_01 B20140410_SF109_01 TB375835.[MT7]-IGDLDK[MT7].2b5_1.heavy 474.784 / 658.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - GABARAP GABA(A) receptor-associated protein 1073 137 B20140410_SF109_01 B20140410_SF109_01 TB238830.[MT7]-FPGVGVLPGVPTGAGVK[MT7]PK[MT7].3b6_1.heavy 737.119 / 701.41 10031.0 33.292301177978516 37 9 10 10 8 1.0093523126223547 57.206057373139544 0.0 4 0.8099184044646374 2.7845814445390227 10031.0 4.0625333296937605 2.0 - - - - - - - 768.0 21 3 ELN elastin 1075 137 B20140410_SF109_01 B20140410_SF109_01 TB238830.[MT7]-FPGVGVLPGVPTGAGVK[MT7]PK[MT7].3b5_1.heavy 737.119 / 602.342 7456.0 33.292301177978516 37 9 10 10 8 1.0093523126223547 57.206057373139544 0.0 4 0.8099184044646374 2.7845814445390227 7456.0 3.691949606945364 0.0 - - - - - - - 1265.111111111111 14 9 ELN elastin 1077 137 B20140410_SF109_01 B20140410_SF109_01 TB238830.[MT7]-FPGVGVLPGVPTGAGVK[MT7]PK[MT7].3y9_2.heavy 737.119 / 571.86 25484.0 33.292301177978516 37 9 10 10 8 1.0093523126223547 57.206057373139544 0.0 4 0.8099184044646374 2.7845814445390227 25484.0 30.45010166211293 0.0 - - - - - - - 361.6666666666667 50 3 ELN elastin 1079 137 B20140410_SF109_01 B20140410_SF109_01 TB238830.[MT7]-FPGVGVLPGVPTGAGVK[MT7]PK[MT7].3y9_1.heavy 737.119 / 1142.71 10709.0 33.292301177978516 37 9 10 10 8 1.0093523126223547 57.206057373139544 0.0 4 0.8099184044646374 2.7845814445390227 10709.0 21.467233803157704 0.0 - - - - - - - 254.375 21 8 ELN elastin 1081 138 B20140410_SF109_01 B20140410_SF109_01 TB497169.[MT7]-YLPHLIEK[MT7].3y3_1.heavy 434.267 / 533.341 165541.0 30.638900756835938 50 20 10 10 10 9.548023993805755 10.473371250938898 0.0 3 0.9988276067392086 36.03987480312005 165541.0 99.84445569213156 0.0 - - - - - - - 302.3333333333333 331 3 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1083 138 B20140410_SF109_01 B20140410_SF109_01 TB497169.[MT7]-YLPHLIEK[MT7].3b4_1.heavy 434.267 / 655.368 43652.0 30.638900756835938 50 20 10 10 10 9.548023993805755 10.473371250938898 0.0 3 0.9988276067392086 36.03987480312005 43652.0 46.852007221723234 0.0 - - - - - - - 1184.2857142857142 87 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1085 138 B20140410_SF109_01 B20140410_SF109_01 TB497169.[MT7]-YLPHLIEK[MT7].3b3_1.heavy 434.267 / 518.31 36010.0 30.638900756835938 50 20 10 10 10 9.548023993805755 10.473371250938898 0.0 3 0.9988276067392086 36.03987480312005 36010.0 31.284689942742197 0.0 - - - - - - - 777.2857142857143 72 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1087 138 B20140410_SF109_01 B20140410_SF109_01 TB497169.[MT7]-YLPHLIEK[MT7].3y4_1.heavy 434.267 / 646.426 64506.0 30.638900756835938 50 20 10 10 10 9.548023993805755 10.473371250938898 0.0 3 0.9988276067392086 36.03987480312005 64506.0 70.15131274131275 0.0 - - - - - - - 684.7142857142857 129 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1089 139 B20140410_SF109_01 B20140410_SF109_01 TB375831.[MT7]-C[CAM]EAAAK[MT7].2b3_1.heavy 469.254 / 505.22 2183.0 17.671600341796875 46 16 10 10 10 2.96877504262005 27.43849011601849 0.0 3 0.9627560775082442 6.374959954088268 2183.0 7.9498433839736675 1.0 - - - - - - - 234.0 4 11 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1091 139 B20140410_SF109_01 B20140410_SF109_01 TB375831.[MT7]-C[CAM]EAAAK[MT7].2y4_1.heavy 469.254 / 504.326 5483.0 17.671600341796875 46 16 10 10 10 2.96877504262005 27.43849011601849 0.0 3 0.9627560775082442 6.374959954088268 5483.0 4.2645081175783535 0.0 - - - - - - - 215.88888888888889 10 9 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1093 139 B20140410_SF109_01 B20140410_SF109_01 TB375831.[MT7]-C[CAM]EAAAK[MT7].2y5_1.heavy 469.254 / 633.369 6550.0 17.671600341796875 46 16 10 10 10 2.96877504262005 27.43849011601849 0.0 3 0.9627560775082442 6.374959954088268 6550.0 14.676432191485032 0.0 - - - - - - - 184.53333333333333 13 15 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1095 139 B20140410_SF109_01 B20140410_SF109_01 TB375831.[MT7]-C[CAM]EAAAK[MT7].2b4_1.heavy 469.254 / 576.257 2280.0 17.671600341796875 46 16 10 10 10 2.96877504262005 27.43849011601849 0.0 3 0.9627560775082442 6.374959954088268 2280.0 4.982740646357001 0.0 - - - - - - - 154.35294117647058 4 17 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1097 140 B20140410_SF109_01 B20140410_SF109_01 TB375935.[MT7]-APAHTFWR.3y3_1.heavy 377.206 / 508.267 92991.0 27.72450065612793 38 14 8 10 6 2.5193620775142125 39.69258761673008 0.0 5 0.9394508899812121 4.989906440782079 92991.0 166.0826913580247 1.0 - - - - - - - 270.0 353 8 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1099 140 B20140410_SF109_01 B20140410_SF109_01 TB375935.[MT7]-APAHTFWR.3y4_1.heavy 377.206 / 609.314 126462.0 27.72450065612793 38 14 8 10 6 2.5193620775142125 39.69258761673008 0.0 5 0.9394508899812121 4.989906440782079 126462.0 60.54529992293246 1.0 - - - - - - - 540.0 445 1 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1101 140 B20140410_SF109_01 B20140410_SF109_01 TB375935.[MT7]-APAHTFWR.3b3_1.heavy 377.206 / 384.236 160608.0 27.72450065612793 38 14 8 10 6 2.5193620775142125 39.69258761673008 0.0 5 0.9394508899812121 4.989906440782079 160608.0 226.95603418803418 0.0 - - - - - - - 270.0 321 5 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1103 140 B20140410_SF109_01 B20140410_SF109_01 TB375935.[MT7]-APAHTFWR.3b4_2.heavy 377.206 / 261.151 68292.0 27.72450065612793 38 14 8 10 6 2.5193620775142125 39.69258761673008 0.0 5 0.9394508899812121 4.989906440782079 68292.0 95.10293333333334 0.0 - - - - - - - 790.7142857142857 136 7 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1105 141 B20140410_SF109_01 B20140410_SF109_01 TB375938.[MT7]-RLWAESAR.3b6_2.heavy 378.216 / 444.246 138088.0 25.64799976348877 42 17 10 5 10 3.213217948914023 25.468770203410358 0.04599952697753906 3 0.9721683071845664 7.380403679629163 138088.0 68.80578095231274 0.0 - - - - - - - 769.0 276 6 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1107 141 B20140410_SF109_01 B20140410_SF109_01 TB375938.[MT7]-RLWAESAR.3b3_1.heavy 378.216 / 600.374 31877.0 25.64799976348877 42 17 10 5 10 3.213217948914023 25.468770203410358 0.04599952697753906 3 0.9721683071845664 7.380403679629163 31877.0 68.63213541779913 1.0 - - - - - - - 226.11111111111111 63 9 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1109 141 B20140410_SF109_01 B20140410_SF109_01 TB375938.[MT7]-RLWAESAR.3y4_1.heavy 378.216 / 462.231 217441.0 25.64799976348877 42 17 10 5 10 3.213217948914023 25.468770203410358 0.04599952697753906 3 0.9721683071845664 7.380403679629163 217441.0 92.01754555572401 0.0 - - - - - - - 763.125 434 8 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1111 141 B20140410_SF109_01 B20140410_SF109_01 TB375938.[MT7]-RLWAESAR.3y5_1.heavy 378.216 / 533.268 180409.0 25.64799976348877 42 17 10 5 10 3.213217948914023 25.468770203410358 0.04599952697753906 3 0.9721683071845664 7.380403679629163 180409.0 74.75578613224425 1.0 - - - - - - - 305.25 360 4 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1113 142 B20140410_SF109_01 B20140410_SF109_01 TB497167.[MT7]-AQSALHEQK[MT7].3y3_1.heavy 433.913 / 548.316 142779.0 19.71579933166504 47 17 10 10 10 3.1922023076860415 25.037457417677324 0.0 3 0.9796294193004048 8.632183428432564 142779.0 164.52264740140885 0.0 - - - - - - - 1638.857142857143 285 7 CELF3;CELF4;CELF6 CUGBP, Elav-like family member 3;CUGBP, Elav-like family member 4;CUGBP, Elav-like family member 6 1115 142 B20140410_SF109_01 B20140410_SF109_01 TB497167.[MT7]-AQSALHEQK[MT7].3b4_1.heavy 433.913 / 502.274 139370.0 19.71579933166504 47 17 10 10 10 3.1922023076860415 25.037457417677324 0.0 3 0.9796294193004048 8.632183428432564 139370.0 97.82010806087786 0.0 - - - - - - - 426.0 278 2 CELF3;CELF4;CELF6 CUGBP, Elav-like family member 3;CUGBP, Elav-like family member 4;CUGBP, Elav-like family member 6 1117 142 B20140410_SF109_01 B20140410_SF109_01 TB497167.[MT7]-AQSALHEQK[MT7].3b5_1.heavy 433.913 / 615.358 122785.0 19.71579933166504 47 17 10 10 10 3.1922023076860415 25.037457417677324 0.0 3 0.9796294193004048 8.632183428432564 122785.0 199.71601646391613 0.0 - - - - - - - 754.125 245 8 CELF3;CELF4;CELF6 CUGBP, Elav-like family member 3;CUGBP, Elav-like family member 4;CUGBP, Elav-like family member 6 1119 142 B20140410_SF109_01 B20140410_SF109_01 TB497167.[MT7]-AQSALHEQK[MT7].3y4_1.heavy 433.913 / 685.375 36645.0 19.71579933166504 47 17 10 10 10 3.1922023076860415 25.037457417677324 0.0 3 0.9796294193004048 8.632183428432564 36645.0 128.60887171848816 0.0 - - - - - - - 254.58823529411765 73 17 CELF3;CELF4;CELF6 CUGBP, Elav-like family member 3;CUGBP, Elav-like family member 4;CUGBP, Elav-like family member 6 1121 143 B20140410_SF109_01 B20140410_SF109_01 TB497161.[MT7]-LEEQC[CAM]VDPR.2b3_1.heavy 645.317 / 516.279 29082.0 24.413799285888672 38 8 10 10 10 1.3680222601158119 73.09822574929034 0.0 3 0.7642832293365945 2.490242421509163 29082.0 32.78223058867384 0.0 - - - - - - - 428.0 58 4 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1123 143 B20140410_SF109_01 B20140410_SF109_01 TB497161.[MT7]-LEEQC[CAM]VDPR.2b4_1.heavy 645.317 / 644.337 24195.0 24.413799285888672 38 8 10 10 10 1.3680222601158119 73.09822574929034 0.0 3 0.7642832293365945 2.490242421509163 24195.0 21.632204218483807 0.0 - - - - - - - 733.0 48 2 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1125 143 B20140410_SF109_01 B20140410_SF109_01 TB497161.[MT7]-LEEQC[CAM]VDPR.2b7_1.heavy 645.317 / 1018.46 273472.0 24.413799285888672 38 8 10 10 10 1.3680222601158119 73.09822574929034 0.0 3 0.7642832293365945 2.490242421509163 273472.0 250.14906761302427 0.0 - - - - - - - 336.0 546 4 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1127 143 B20140410_SF109_01 B20140410_SF109_01 TB497161.[MT7]-LEEQC[CAM]VDPR.2b5_1.heavy 645.317 / 804.368 18329.0 24.413799285888672 38 8 10 10 10 1.3680222601158119 73.09822574929034 0.0 3 0.7642832293365945 2.490242421509163 18329.0 193.17212042703352 0.0 - - - - - - - 233.36363636363637 36 11 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1129 144 B20140410_SF109_01 B20140410_SF109_01 TB376308.[MT7]-IQQNLDQLREELSR.3b4_1.heavy 629.345 / 628.354 84780.0 34.25859832763672 43 13 10 10 10 2.284480622002645 43.773625846008265 0.0 3 0.9283125723747094 4.581541542312935 84780.0 40.72156658550517 0.0 - - - - - - - 981.0 169 1 APOA5 apolipoprotein A-V 1131 144 B20140410_SF109_01 B20140410_SF109_01 TB376308.[MT7]-IQQNLDQLREELSR.3y8_2.heavy 629.345 / 515.786 458372.0 34.25859832763672 43 13 10 10 10 2.284480622002645 43.773625846008265 0.0 3 0.9283125723747094 4.581541542312935 458372.0 104.74184460515869 0.0 - - - - - - - 701.0 916 1 APOA5 apolipoprotein A-V 1133 144 B20140410_SF109_01 B20140410_SF109_01 TB376308.[MT7]-IQQNLDQLREELSR.3y5_1.heavy 629.345 / 633.32 60117.0 34.25859832763672 43 13 10 10 10 2.284480622002645 43.773625846008265 0.0 3 0.9283125723747094 4.581541542312935 60117.0 32.655673512872625 0.0 - - - - - - - 747.6666666666666 120 3 APOA5 apolipoprotein A-V 1135 144 B20140410_SF109_01 B20140410_SF109_01 TB376308.[MT7]-IQQNLDQLREELSR.3y13_2.heavy 629.345 / 814.921 394331.0 34.25859832763672 43 13 10 10 10 2.284480622002645 43.773625846008265 0.0 3 0.9283125723747094 4.581541542312935 394331.0 280.27131044411374 0.0 - - - - - - - 861.0 788 7 APOA5 apolipoprotein A-V 1137 145 B20140410_SF109_01 B20140410_SF109_01 TB238634.[MT7]-DYVAK[MT7]GEDVNR.3y10_2.heavy 518.61 / 647.847 35437.0 22.47029972076416 37 11 10 6 10 0.7027135045007075 71.27321207573905 0.03420066833496094 3 0.8520649699688458 3.1682648625354113 35437.0 51.171841700652415 0.0 - - - - - - - 701.0 70 11 MTPN myotrophin 1139 145 B20140410_SF109_01 B20140410_SF109_01 TB238634.[MT7]-DYVAK[MT7]GEDVNR.3y6_1.heavy 518.61 / 689.321 13128.0 22.47029972076416 37 11 10 6 10 0.7027135045007075 71.27321207573905 0.03420066833496094 3 0.8520649699688458 3.1682648625354113 13128.0 13.863768126358915 0.0 - - - - - - - 767.7272727272727 26 11 MTPN myotrophin 1141 145 B20140410_SF109_01 B20140410_SF109_01 TB238634.[MT7]-DYVAK[MT7]GEDVNR.3b3_1.heavy 518.61 / 522.268 9181.0 22.47029972076416 37 11 10 6 10 0.7027135045007075 71.27321207573905 0.03420066833496094 3 0.8520649699688458 3.1682648625354113 9181.0 9.424101251600463 0.0 - - - - - - - 703.8888888888889 18 9 MTPN myotrophin 1143 145 B20140410_SF109_01 B20140410_SF109_01 TB238634.[MT7]-DYVAK[MT7]GEDVNR.3b8_2.heavy 518.61 / 583.8 47739.0 22.47029972076416 37 11 10 6 10 0.7027135045007075 71.27321207573905 0.03420066833496094 3 0.8520649699688458 3.1682648625354113 47739.0 259.5116591947217 0.0 - - - - - - - 721.2857142857143 95 7 MTPN myotrophin 1145 146 B20140410_SF109_01 B20140410_SF109_01 TB238371.[MT7]-AEDGLWLR.2y5_1.heavy 552.302 / 644.388 17087.0 33.042999267578125 50 20 10 10 10 22.014154170459644 4.542532010345781 0.0 3 0.9994538241490397 52.80515892296688 17087.0 9.731221586843995 1.0 - - - - - - - 845.3333333333334 34 3 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1147 146 B20140410_SF109_01 B20140410_SF109_01 TB238371.[MT7]-AEDGLWLR.2b4_1.heavy 552.302 / 517.237 N/A 33.042999267578125 50 20 10 10 10 22.014154170459644 4.542532010345781 0.0 3 0.9994538241490397 52.80515892296688 4272.0 0.9640809240835948 33.0 - - - - - - - 4182.777777777777 28 9 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1149 146 B20140410_SF109_01 B20140410_SF109_01 TB238371.[MT7]-AEDGLWLR.2b5_1.heavy 552.302 / 630.321 9211.0 33.042999267578125 50 20 10 10 10 22.014154170459644 4.542532010345781 0.0 3 0.9994538241490397 52.80515892296688 9211.0 3.3964149167504045 1.0 - - - - - - - 2746.0 18 7 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1151 146 B20140410_SF109_01 B20140410_SF109_01 TB238371.[MT7]-AEDGLWLR.2y7_1.heavy 552.302 / 888.457 8677.0 33.042999267578125 50 20 10 10 10 22.014154170459644 4.542532010345781 0.0 3 0.9994538241490397 52.80515892296688 8677.0 10.500547658366523 1.0 - - - - - - - 377.8333333333333 17 6 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1153 147 B20140410_SF109_01 B20140410_SF109_01 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 1197240.0 30.467899322509766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1197240.0 4260.894306436598 0.0 - - - - - - - 649.0 2394 1 1155 147 B20140410_SF109_01 B20140410_SF109_01 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 1164160.0 30.467899322509766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1164160.0 394.9324498237463 0.0 - - - - - - - 1731.3333333333333 2328 3 1157 147 B20140410_SF109_01 B20140410_SF109_01 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1966870.0 30.467899322509766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1966870.0 1321.3979055581372 0.0 - - - - - - - 3181.0 3933 2 1159 148 B20140410_SF109_01 B20140410_SF109_01 TB375930.[MT7]-ELSDEDIR.2b4_1.heavy 560.784 / 589.295 5663.0 25.19029998779297 45 17 10 10 8 3.9530796347552526 25.296732987821862 0.0 4 0.9719480464398782 7.351235201215148 5663.0 7.00109282700422 0.0 - - - - - - - 395.0 11 3 CYP4F8;CYP4F22;CYP4F11 cytochrome P450, family 4, subfamily F, polypeptide 8;cytochrome P450, family 4, subfamily F, polypeptide 22;cytochrome P450, family 4, subfamily F, polypeptide 11 1161 148 B20140410_SF109_01 B20140410_SF109_01 TB375930.[MT7]-ELSDEDIR.2b6_1.heavy 560.784 / 833.365 19359.0 25.19029998779297 45 17 10 10 8 3.9530796347552526 25.296732987821862 0.0 4 0.9719480464398782 7.351235201215148 19359.0 26.487644427646867 0.0 - - - - - - - 197.5 38 2 CYP4F8;CYP4F22;CYP4F11 cytochrome P450, family 4, subfamily F, polypeptide 8;cytochrome P450, family 4, subfamily F, polypeptide 22;cytochrome P450, family 4, subfamily F, polypeptide 11 1163 148 B20140410_SF109_01 B20140410_SF109_01 TB375930.[MT7]-ELSDEDIR.2y6_1.heavy 560.784 / 734.331 3424.0 25.19029998779297 45 17 10 10 8 3.9530796347552526 25.296732987821862 0.0 4 0.9719480464398782 7.351235201215148 3424.0 0.8668354430379746 0.0 - - - - - - - 856.125 6 8 CYP4F8;CYP4F22;CYP4F11 cytochrome P450, family 4, subfamily F, polypeptide 8;cytochrome P450, family 4, subfamily F, polypeptide 22;cytochrome P450, family 4, subfamily F, polypeptide 11 1165 148 B20140410_SF109_01 B20140410_SF109_01 TB375930.[MT7]-ELSDEDIR.2y7_1.heavy 560.784 / 847.416 4873.0 25.19029998779297 45 17 10 10 8 3.9530796347552526 25.296732987821862 0.0 4 0.9719480464398782 7.351235201215148 4873.0 8.780007600178212 1.0 - - - - - - - 716.6666666666666 17 9 CYP4F8;CYP4F22;CYP4F11 cytochrome P450, family 4, subfamily F, polypeptide 8;cytochrome P450, family 4, subfamily F, polypeptide 22;cytochrome P450, family 4, subfamily F, polypeptide 11 1167 149 B20140410_SF109_01 B20140410_SF109_01 TB238374.[MT7]-AVQLLHQR.3y3_1.heavy 370.228 / 440.236 258074.0 25.288000106811523 48 18 10 10 10 5.367597864665574 18.630307731935588 0.0 3 0.9894478120317503 12.003515925298403 258074.0 101.73601858142226 0.0 - - - - - - - 275.5 516 2 PLD6 phospholipase D family, member 6 1169 149 B20140410_SF109_01 B20140410_SF109_01 TB238374.[MT7]-AVQLLHQR.3b4_1.heavy 370.228 / 556.357 107164.0 25.288000106811523 48 18 10 10 10 5.367597864665574 18.630307731935588 0.0 3 0.9894478120317503 12.003515925298403 107164.0 207.06888091150302 0.0 - - - - - - - 275.5 214 4 PLD6 phospholipase D family, member 6 1171 149 B20140410_SF109_01 B20140410_SF109_01 TB238374.[MT7]-AVQLLHQR.3y4_1.heavy 370.228 / 553.32 72360.0 25.288000106811523 48 18 10 10 10 5.367597864665574 18.630307731935588 0.0 3 0.9894478120317503 12.003515925298403 72360.0 157.86201776052206 0.0 - - - - - - - 275.2 144 5 PLD6 phospholipase D family, member 6 1173 149 B20140410_SF109_01 B20140410_SF109_01 TB238374.[MT7]-AVQLLHQR.3b3_1.heavy 370.228 / 443.273 238265.0 25.288000106811523 48 18 10 10 10 5.367597864665574 18.630307731935588 0.0 3 0.9894478120317503 12.003515925298403 238265.0 185.79304761942646 0.0 - - - - - - - 275.5 476 2 PLD6 phospholipase D family, member 6 1175 150 B20140410_SF109_01 B20140410_SF109_01 TB238771.[MT7]-ERDDGSVTITNLSSK[MT7].3y6_1.heavy 637.34 / 793.454 11987.0 26.435800552368164 44 14 10 10 10 6.465979024079781 15.465562079244714 0.0 3 0.945337020873356 5.254329114376275 11987.0 21.711717696965174 0.0 - - - - - - - 767.5714285714286 23 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1177 150 B20140410_SF109_01 B20140410_SF109_01 TB238771.[MT7]-ERDDGSVTITNLSSK[MT7].3y4_1.heavy 637.34 / 578.363 11849.0 26.435800552368164 44 14 10 10 10 6.465979024079781 15.465562079244714 0.0 3 0.945337020873356 5.254329114376275 11849.0 20.508952114844064 0.0 - - - - - - - 1220.2857142857142 23 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1179 150 B20140410_SF109_01 B20140410_SF109_01 TB238771.[MT7]-ERDDGSVTITNLSSK[MT7].3y5_1.heavy 637.34 / 692.406 14053.0 26.435800552368164 44 14 10 10 10 6.465979024079781 15.465562079244714 0.0 3 0.945337020873356 5.254329114376275 14053.0 44.122849364791286 0.0 - - - - - - - 220.8 28 10 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1181 150 B20140410_SF109_01 B20140410_SF109_01 TB238771.[MT7]-ERDDGSVTITNLSSK[MT7].3b7_1.heavy 637.34 / 903.429 4133.0 26.435800552368164 44 14 10 10 10 6.465979024079781 15.465562079244714 0.0 3 0.945337020873356 5.254329114376275 4133.0 18.29153805663754 0.0 - - - - - - - 252.66666666666666 8 12 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1183 151 B20140410_SF109_01 B20140410_SF109_01 TB497254.[MT7]-IQILEGWK[MT7]K[MT7].3y6_1.heavy 516.328 / 1048.64 N/A 32.868499755859375 37 7 10 10 10 0.5044276810759837 89.46420800754258 0.0 3 0.7183535370561173 2.2685362644815115 264.0 3.78 5.0 - - - - - - - 0.0 0 0 NQO1 NAD(P)H dehydrogenase, quinone 1 1185 151 B20140410_SF109_01 B20140410_SF109_01 TB497254.[MT7]-IQILEGWK[MT7]K[MT7].3y8_2.heavy 516.328 / 645.395 116559.0 32.868499755859375 37 7 10 10 10 0.5044276810759837 89.46420800754258 0.0 3 0.7183535370561173 2.2685362644815115 116559.0 49.3875221898329 0.0 - - - - - - - 1255.5 233 2 NQO1 NAD(P)H dehydrogenase, quinone 1 1187 151 B20140410_SF109_01 B20140410_SF109_01 TB497254.[MT7]-IQILEGWK[MT7]K[MT7].3y5_1.heavy 516.328 / 935.555 35549.0 32.868499755859375 37 7 10 10 10 0.5044276810759837 89.46420800754258 0.0 3 0.7183535370561173 2.2685362644815115 35549.0 137.2465903362548 0.0 - - - - - - - 216.0 71 11 NQO1 NAD(P)H dehydrogenase, quinone 1 1189 151 B20140410_SF109_01 B20140410_SF109_01 TB497254.[MT7]-IQILEGWK[MT7]K[MT7].3y4_1.heavy 516.328 / 806.513 45196.0 32.868499755859375 37 7 10 10 10 0.5044276810759837 89.46420800754258 0.0 3 0.7183535370561173 2.2685362644815115 45196.0 150.99141783801252 0.0 - - - - - - - 282.85714285714283 90 7 NQO1 NAD(P)H dehydrogenase, quinone 1 1191 152 B20140410_SF109_01 B20140410_SF109_01 TB497362.[MT7]-THNPDLTELGQAEPQQR.3y6_1.heavy 693.351 / 728.369 47300.0 26.302200317382812 47 17 10 10 10 10.326737284288491 9.683600661764096 0.0 3 0.9778062067956614 8.268754420916895 47300.0 53.49848920309055 1.0 - - - - - - - 359.0 101 7 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1193 152 B20140410_SF109_01 B20140410_SF109_01 TB497362.[MT7]-THNPDLTELGQAEPQQR.3b5_1.heavy 693.351 / 709.339 19394.0 26.302200317382812 47 17 10 10 10 10.326737284288491 9.683600661764096 0.0 3 0.9778062067956614 8.268754420916895 19394.0 141.5450425263821 0.0 - - - - - - - 279.4 38 10 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1195 152 B20140410_SF109_01 B20140410_SF109_01 TB497362.[MT7]-THNPDLTELGQAEPQQR.3y4_1.heavy 693.351 / 528.289 95018.0 26.302200317382812 47 17 10 10 10 10.326737284288491 9.683600661764096 0.0 3 0.9778062067956614 8.268754420916895 95018.0 221.25457825567503 0.0 - - - - - - - 777.5714285714286 190 7 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1197 152 B20140410_SF109_01 B20140410_SF109_01 TB497362.[MT7]-THNPDLTELGQAEPQQR.3y8_1.heavy 693.351 / 913.449 62787.0 26.302200317382812 47 17 10 10 10 10.326737284288491 9.683600661764096 0.0 3 0.9778062067956614 8.268754420916895 62787.0 150.55377419354838 0.0 - - - - - - - 294.77777777777777 125 9 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1199 153 B20140410_SF109_01 B20140410_SF109_01 TB238827.[MT7]-LQAFRQDTYLQIAAFTR.4y5_1.heavy 547.301 / 565.309 97860.0 36.85765075683594 36 11 10 5 10 0.9279862905315016 55.97696735698366 0.04850006103515625 3 0.8587421199253475 3.2441874117678497 97860.0 50.001999530828 0.0 - - - - - - - 381.25 195 4 APOA5 apolipoprotein A-V 1201 153 B20140410_SF109_01 B20140410_SF109_01 TB238827.[MT7]-LQAFRQDTYLQIAAFTR.4b7_2.heavy 547.301 / 502.276 28970.0 36.85765075683594 36 11 10 5 10 0.9279862905315016 55.97696735698366 0.04850006103515625 3 0.8587421199253475 3.2441874117678497 28970.0 17.261688810558297 0.0 - - - - - - - 797.0 57 4 APOA5 apolipoprotein A-V 1203 153 B20140410_SF109_01 B20140410_SF109_01 TB238827.[MT7]-LQAFRQDTYLQIAAFTR.4y6_1.heavy 547.301 / 678.393 52673.0 36.85765075683594 36 11 10 5 10 0.9279862905315016 55.97696735698366 0.04850006103515625 3 0.8587421199253475 3.2441874117678497 52673.0 63.71006662251608 0.0 - - - - - - - 323.3333333333333 105 3 APOA5 apolipoprotein A-V 1205 153 B20140410_SF109_01 B20140410_SF109_01 TB238827.[MT7]-LQAFRQDTYLQIAAFTR.4b9_2.heavy 547.301 / 634.331 122672.0 36.85765075683594 36 11 10 5 10 0.9279862905315016 55.97696735698366 0.04850006103515625 3 0.8587421199253475 3.2441874117678497 122672.0 92.74304698691232 0.0 - - - - - - - 416.0 245 1 APOA5 apolipoprotein A-V 1207 154 B20140410_SF109_01 B20140410_SF109_01 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 794607.0 26.571199417114258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 794607.0 797.4996485586092 0.0 - - - - - - - 5851.0 1589 1 1209 154 B20140410_SF109_01 B20140410_SF109_01 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 1164960.0 26.571199417114258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1164960.0 1635.4950586781692 0.0 - - - - - - - 7384.0 2329 1 1211 154 B20140410_SF109_01 B20140410_SF109_01 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 1313430.0 26.571199417114258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1313430.0 736.9712573009039 0.0 - - - - - - - 8637.0 2626 1 1213 155 B20140410_SF109_01 B20140410_SF109_01 TB376323.[MT7]-RLIVVLEGASLETVK[MT7].3y6_1.heavy 639.066 / 820.49 21400.0 35.2223014831543 43 13 10 10 10 4.441631165467825 22.514251245683354 0.0 3 0.9268112483005566 4.533724591945657 21400.0 22.985904587083933 0.0 - - - - - - - 417.0 42 3 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1215 155 B20140410_SF109_01 B20140410_SF109_01 TB376323.[MT7]-RLIVVLEGASLETVK[MT7].3b4_1.heavy 639.066 / 626.447 20427.0 35.2223014831543 43 13 10 10 10 4.441631165467825 22.514251245683354 0.0 3 0.9268112483005566 4.533724591945657 20427.0 16.28616935990025 0.0 - - - - - - - 417.0 40 1 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1217 155 B20140410_SF109_01 B20140410_SF109_01 TB376323.[MT7]-RLIVVLEGASLETVK[MT7].3b5_1.heavy 639.066 / 725.515 39742.0 35.2223014831543 43 13 10 10 10 4.441631165467825 22.514251245683354 0.0 3 0.9268112483005566 4.533724591945657 39742.0 29.277366857948252 0.0 - - - - - - - 347.5 79 2 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1219 155 B20140410_SF109_01 B20140410_SF109_01 TB376323.[MT7]-RLIVVLEGASLETVK[MT7].3y4_1.heavy 639.066 / 620.374 68229.0 35.2223014831543 43 13 10 10 10 4.441631165467825 22.514251245683354 0.0 3 0.9268112483005566 4.533724591945657 68229.0 55.62898833481408 0.0 - - - - - - - 834.0 136 1 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1221 156 B20140410_SF109_01 B20140410_SF109_01 TB238825.[MT7]-YLVPSDLTVGQFYFLIR.3b6_1.heavy 725.737 / 819.437 17867.0 44.29520034790039 48 18 10 10 10 3.715803214462737 22.401713513624685 0.0 3 0.987272669152139 10.927781603146007 17867.0 52.46030037685657 1.0 - - - - - - - 648.6666666666666 35 9 GABARAP;GABARAPL1 GABA(A) receptor-associated protein;GABA(A) receptor-associated protein like 1 1223 156 B20140410_SF109_01 B20140410_SF109_01 TB238825.[MT7]-YLVPSDLTVGQFYFLIR.3b3_1.heavy 725.737 / 520.325 51692.0 44.29520034790039 48 18 10 10 10 3.715803214462737 22.401713513624685 0.0 3 0.987272669152139 10.927781603146007 51692.0 99.01322314658029 0.0 - - - - - - - 713.0 103 9 GABARAP;GABARAPL1 GABA(A) receptor-associated protein;GABA(A) receptor-associated protein like 1 1225 156 B20140410_SF109_01 B20140410_SF109_01 TB238825.[MT7]-YLVPSDLTVGQFYFLIR.3y8_1.heavy 725.737 / 1043.57 22839.0 44.29520034790039 48 18 10 10 10 3.715803214462737 22.401713513624685 0.0 3 0.987272669152139 10.927781603146007 22839.0 65.87131226741529 0.0 - - - - - - - 627.5714285714286 45 7 GABARAP;GABARAPL1 GABA(A) receptor-associated protein;GABA(A) receptor-associated protein like 1 1227 156 B20140410_SF109_01 B20140410_SF109_01 TB238825.[MT7]-YLVPSDLTVGQFYFLIR.3y5_1.heavy 725.737 / 711.419 12605.0 44.29520034790039 48 18 10 10 10 3.715803214462737 22.401713513624685 0.0 3 0.987272669152139 10.927781603146007 12605.0 32.055341344805015 0.0 - - - - - - - 614.125 25 8 GABARAP;GABARAPL1 GABA(A) receptor-associated protein;GABA(A) receptor-associated protein like 1 1229 157 B20140410_SF109_01 B20140410_SF109_01 TB238826.[MT7]-LQAFRQDTYLQIAAFTR.2b8_1.heavy 1093.6 / 1104.59 N/A 36.84956741333008 43 18 10 5 10 4.135070169020002 24.18338647532544 0.04850006103515625 3 0.9883177296308677 11.407094496966725 139.0 0.24214223839223836 33.0 - - - - - - - 0.0 1 0 APOA5 apolipoprotein A-V 1231 157 B20140410_SF109_01 B20140410_SF109_01 TB238826.[MT7]-LQAFRQDTYLQIAAFTR.2b11_2.heavy 1093.6 / 754.903 1110.0 36.84956741333008 43 18 10 5 10 4.135070169020002 24.18338647532544 0.04850006103515625 3 0.9883177296308677 11.407094496966725 1110.0 5.4733233823937795 0.0 - - - - - - - 242.75 2 4 APOA5 apolipoprotein A-V 1233 157 B20140410_SF109_01 B20140410_SF109_01 TB238826.[MT7]-LQAFRQDTYLQIAAFTR.2b7_1.heavy 1093.6 / 1003.54 3607.0 36.84956741333008 43 18 10 5 10 4.135070169020002 24.18338647532544 0.04850006103515625 3 0.9883177296308677 11.407094496966725 3607.0 12.178624306999307 0.0 - - - - - - - 265.75 7 12 APOA5 apolipoprotein A-V 1235 157 B20140410_SF109_01 B20140410_SF109_01 TB238826.[MT7]-LQAFRQDTYLQIAAFTR.2y10_1.heavy 1093.6 / 1183.65 4023.0 36.84956741333008 43 18 10 5 10 4.135070169020002 24.18338647532544 0.04850006103515625 3 0.9883177296308677 11.407094496966725 4023.0 29.35014492252352 0.0 - - - - - - - 277.2857142857143 8 7 APOA5 apolipoprotein A-V 1237 158 B20140410_SF109_01 B20140410_SF109_01 TB238820.[MT7]-TFDRFC[CAM]GLMVQLLHK[MT7].4b8_1.heavy 539.046 / 1141.56 N/A 38.566001892089844 43 13 10 10 10 1.5933857910944587 53.43150198220413 0.0 3 0.9222762712212864 4.3977615423074985 0.0 0.0 11.0 - - - - - - - 0.0 0 0 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1239 158 B20140410_SF109_01 B20140410_SF109_01 TB238820.[MT7]-TFDRFC[CAM]GLMVQLLHK[MT7].4b8_2.heavy 539.046 / 571.283 72069.0 38.566001892089844 43 13 10 10 10 1.5933857910944587 53.43150198220413 0.0 3 0.9222762712212864 4.3977615423074985 72069.0 136.85161213235293 0.0 - - - - - - - 256.0 144 5 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1241 158 B20140410_SF109_01 B20140410_SF109_01 TB238820.[MT7]-TFDRFC[CAM]GLMVQLLHK[MT7].4b7_2.heavy 539.046 / 514.741 13825.0 38.566001892089844 43 13 10 10 10 1.5933857910944587 53.43150198220413 0.0 3 0.9222762712212864 4.3977615423074985 13825.0 36.69496193910256 0.0 - - - - - - - 672.0 27 8 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1243 158 B20140410_SF109_01 B20140410_SF109_01 TB238820.[MT7]-TFDRFC[CAM]GLMVQLLHK[MT7].4b9_2.heavy 539.046 / 636.803 134665.0 38.566001892089844 43 13 10 10 10 1.5933857910944587 53.43150198220413 0.0 3 0.9222762712212864 4.3977615423074985 134665.0 220.1832868303571 0.0 - - - - - - - 688.0 269 8 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1245 159 B20140410_SF109_01 B20140410_SF109_01 TB497158.[MT7]-VQELQEQLR.2b3_1.heavy 643.863 / 501.279 61318.0 28.200700759887695 50 20 10 10 10 16.400475500736327 6.097384188373704 0.0 3 0.9979155243165324 27.02641770035352 61318.0 101.76735536431661 0.0 - - - - - - - 764.6 122 10 APOA5 apolipoprotein A-V 1247 159 B20140410_SF109_01 B20140410_SF109_01 TB497158.[MT7]-VQELQEQLR.2y8_1.heavy 643.863 / 1043.55 119736.0 28.200700759887695 50 20 10 10 10 16.400475500736327 6.097384188373704 0.0 3 0.9979155243165324 27.02641770035352 119736.0 435.45865324970714 0.0 - - - - - - - 242.0 239 6 APOA5 apolipoprotein A-V 1249 159 B20140410_SF109_01 B20140410_SF109_01 TB497158.[MT7]-VQELQEQLR.2y6_1.heavy 643.863 / 786.447 46945.0 28.200700759887695 50 20 10 10 10 16.400475500736327 6.097384188373704 0.0 3 0.9979155243165324 27.02641770035352 46945.0 63.22114099763358 0.0 - - - - - - - 774.5 93 8 APOA5 apolipoprotein A-V 1251 159 B20140410_SF109_01 B20140410_SF109_01 TB497158.[MT7]-VQELQEQLR.2y7_1.heavy 643.863 / 915.489 54329.0 28.200700759887695 50 20 10 10 10 16.400475500736327 6.097384188373704 0.0 3 0.9979155243165324 27.02641770035352 54329.0 80.53980766658844 0.0 - - - - - - - 277.2 108 10 APOA5 apolipoprotein A-V 1253 160 B20140410_SF109_01 B20140410_SF109_01 TB376118.[MT7]-NVLIEVNPQTR.2y8_1.heavy 713.91 / 956.516 37813.0 30.101600646972656 40 16 6 10 8 3.0071200291175986 27.310391623557763 0.0 4 0.9692259643503301 7.016977056055058 37813.0 120.44681467181466 0.0 - - - - - - - 246.8181818181818 75 11 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1255 160 B20140410_SF109_01 B20140410_SF109_01 TB376118.[MT7]-NVLIEVNPQTR.2y9_1.heavy 713.91 / 1069.6 24993.0 30.101600646972656 40 16 6 10 8 3.0071200291175986 27.310391623557763 0.0 4 0.9692259643503301 7.016977056055058 24993.0 130.2992402714041 1.0 - - - - - - - 201.22222222222223 55 9 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1257 160 B20140410_SF109_01 B20140410_SF109_01 TB376118.[MT7]-NVLIEVNPQTR.2y10_1.heavy 713.91 / 1168.67 13079.0 30.101600646972656 40 16 6 10 8 3.0071200291175986 27.310391623557763 0.0 4 0.9692259643503301 7.016977056055058 13079.0 26.86057405921022 1.0 - - - - - - - 719.1111111111111 128 9 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1259 160 B20140410_SF109_01 B20140410_SF109_01 TB376118.[MT7]-NVLIEVNPQTR.2y7_1.heavy 713.91 / 843.432 42086.0 30.101600646972656 40 16 6 10 8 3.0071200291175986 27.310391623557763 0.0 4 0.9692259643503301 7.016977056055058 42086.0 79.58718824311539 0.0 - - - - - - - 663.625 84 8 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1261 161 B20140410_SF109_01 B20140410_SF109_01 TB376222.[MT7]-STPQEEGGSPQRK[MT7].3y8_1.heavy 563.632 / 1002.54 1755.0 17.92729949951172 34 9 10 5 10 0.7724981324743733 89.85128472636164 0.04559898376464844 3 0.8141551890699941 2.8172120435968857 1755.0 50.8599 0.0 - - - - - - - 75.0 3 6 TMEM155 transmembrane protein 155 1263 161 B20140410_SF109_01 B20140410_SF109_01 TB376222.[MT7]-STPQEEGGSPQRK[MT7].3y11_2.heavy 563.632 / 678.853 14741.0 17.92729949951172 34 9 10 5 10 0.7724981324743733 89.85128472636164 0.04559898376464844 3 0.8141551890699941 2.8172120435968857 14741.0 133.99128239202656 0.0 - - - - - - - 150.22222222222223 29 9 TMEM155 transmembrane protein 155 1265 161 B20140410_SF109_01 B20140410_SF109_01 TB376222.[MT7]-STPQEEGGSPQRK[MT7].3b4_1.heavy 563.632 / 558.3 5315.0 17.92729949951172 34 9 10 5 10 0.7724981324743733 89.85128472636164 0.04559898376464844 3 0.8141551890699941 2.8172120435968857 5315.0 9.99462118112384 0.0 - - - - - - - 702.0833333333334 10 12 TMEM155 transmembrane protein 155 1267 161 B20140410_SF109_01 B20140410_SF109_01 TB376222.[MT7]-STPQEEGGSPQRK[MT7].3y9_1.heavy 563.632 / 1131.59 N/A 17.92729949951172 34 9 10 5 10 0.7724981324743733 89.85128472636164 0.04559898376464844 3 0.8141551890699941 2.8172120435968857 0.0 0.0 7.0 - - - - - - - 0.0 0 0 TMEM155 transmembrane protein 155 1269 162 B20140410_SF109_01 B20140410_SF109_01 TB497243.[MT7]-VFAMSPEEFGK[MT7].3b4_1.heavy 510.602 / 593.324 58742.0 34.04079818725586 50 20 10 10 10 10.563352541979528 9.466691526444162 0.0 3 0.9905993501194102 12.718697024302173 58742.0 47.90186567583555 0.0 - - - - - - - 1382.4285714285713 117 7 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1271 162 B20140410_SF109_01 B20140410_SF109_01 TB497243.[MT7]-VFAMSPEEFGK[MT7].3b5_1.heavy 510.602 / 680.356 73053.0 34.04079818725586 50 20 10 10 10 10.563352541979528 9.466691526444162 0.0 3 0.9905993501194102 12.718697024302173 73053.0 116.59803032975023 0.0 - - - - - - - 698.375 146 8 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1273 162 B20140410_SF109_01 B20140410_SF109_01 TB497243.[MT7]-VFAMSPEEFGK[MT7].3y4_1.heavy 510.602 / 624.347 66238.0 34.04079818725586 50 20 10 10 10 10.563352541979528 9.466691526444162 0.0 3 0.9905993501194102 12.718697024302173 66238.0 56.19755886895601 0.0 - - - - - - - 681.3333333333334 132 6 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1275 162 B20140410_SF109_01 B20140410_SF109_01 TB497243.[MT7]-VFAMSPEEFGK[MT7].3y5_1.heavy 510.602 / 753.39 20580.0 34.04079818725586 50 20 10 10 10 10.563352541979528 9.466691526444162 0.0 3 0.9905993501194102 12.718697024302173 20580.0 48.442698361598865 0.0 - - - - - - - 739.7142857142857 41 7 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1277 163 B20140410_SF109_01 B20140410_SF109_01 TB497371.[MT7]-ERLDSANLWVLVDC[CAM]ILR.4y5_1.heavy 554.805 / 676.345 39534.0 45.332401275634766 37 7 10 10 10 3.55521590781949 23.228174133047446 0.0 3 0.7189235223348275 2.270955711571505 39534.0 72.80977024288035 0.0 - - - - - - - 734.5714285714286 79 7 LOC100132288;LOC100509396 hypothetical protein LOC100132288;tektin-4 like protein LOC389833-like 1279 163 B20140410_SF109_01 B20140410_SF109_01 TB497371.[MT7]-ERLDSANLWVLVDC[CAM]ILR.4b7_1.heavy 554.805 / 930.476 6856.0 45.332401275634766 37 7 10 10 10 3.55521590781949 23.228174133047446 0.0 3 0.7189235223348275 2.270955711571505 6856.0 50.398142025466214 0.0 - - - - - - - 147.41666666666666 13 12 LOC100132288;LOC100509396 hypothetical protein LOC100132288;tektin-4 like protein LOC389833-like 1281 163 B20140410_SF109_01 B20140410_SF109_01 TB497371.[MT7]-ERLDSANLWVLVDC[CAM]ILR.4y7_1.heavy 554.805 / 888.497 25434.0 45.332401275634766 37 7 10 10 10 3.55521590781949 23.228174133047446 0.0 3 0.7189235223348275 2.270955711571505 25434.0 547.5162846565199 0.0 - - - - - - - 195.05882352941177 50 17 LOC100132288;LOC100509396 hypothetical protein LOC100132288;tektin-4 like protein LOC389833-like 1283 163 B20140410_SF109_01 B20140410_SF109_01 TB497371.[MT7]-ERLDSANLWVLVDC[CAM]ILR.4y6_1.heavy 554.805 / 775.413 28088.0 45.332401275634766 37 7 10 10 10 3.55521590781949 23.228174133047446 0.0 3 0.7189235223348275 2.270955711571505 28088.0 72.77791205021089 0.0 - - - - - - - 233.07142857142858 56 14 LOC100132288;LOC100509396 hypothetical protein LOC100132288;tektin-4 like protein LOC389833-like 1285 164 B20140410_SF109_01 B20140410_SF109_01 TB238580.[MT7]-K[MT7]EVQDEEK[MT7].3y3_1.heavy 479.603 / 549.3 11108.0 18.74839973449707 32 14 2 10 6 2.523213074040505 39.632007708277555 0.0 5 0.9305691144209576 4.656296404919021 11108.0 8.159160592648856 1.0 - - - - - - - 1307.2857142857142 35 7 NQO1 NAD(P)H dehydrogenase, quinone 1 1287 164 B20140410_SF109_01 B20140410_SF109_01 TB238580.[MT7]-K[MT7]EVQDEEK[MT7].3b5_2.heavy 479.603 / 444.755 23655.0 18.74839973449707 32 14 2 10 6 2.523213074040505 39.632007708277555 0.0 5 0.9305691144209576 4.656296404919021 23655.0 11.169064305324028 1.0 - - - - - - - 1266.0 113 1 NQO1 NAD(P)H dehydrogenase, quinone 1 1289 164 B20140410_SF109_01 B20140410_SF109_01 TB238580.[MT7]-K[MT7]EVQDEEK[MT7].3b3_1.heavy 479.603 / 645.417 3684.0 18.74839973449707 32 14 2 10 6 2.523213074040505 39.632007708277555 0.0 5 0.9305691144209576 4.656296404919021 3684.0 12.949968104750713 0.0 - - - - - - - 262.1666666666667 7 18 NQO1 NAD(P)H dehydrogenase, quinone 1 1291 164 B20140410_SF109_01 B20140410_SF109_01 TB238580.[MT7]-K[MT7]EVQDEEK[MT7].3y4_1.heavy 479.603 / 664.327 10187.0 18.74839973449707 32 14 2 10 6 2.523213074040505 39.632007708277555 0.0 5 0.9305691144209576 4.656296404919021 10187.0 50.59979285791348 0.0 - - - - - - - 195.8 20 20 NQO1 NAD(P)H dehydrogenase, quinone 1 1293 165 B20140410_SF109_01 B20140410_SF109_01 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 489909.0 33.714698791503906 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 489909.0 138.05252879043195 0.0 - - - - - - - 734.5714285714286 979 7 1295 165 B20140410_SF109_01 B20140410_SF109_01 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 1085670.0 33.714698791503906 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1085670.0 135.09370565241426 0.0 - - - - - - - 135.0 2171 1 1297 165 B20140410_SF109_01 B20140410_SF109_01 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 1045090.0 33.714698791503906 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1045090.0 117.84568587355537 0.0 - - - - - - - 947.0 2090 1 1299 166 B20140410_SF109_01 B20140410_SF109_01 TB238399.[MT7]-RAPTTATQR.3y6_1.heavy 382.555 / 677.358 38003.0 17.269800186157227 50 20 10 10 10 10.47466843333094 9.546841567012738 0.0 3 0.9955775127187093 18.551066762436463 38003.0 203.979634464752 0.0 - - - - - - - 187.5 76 18 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 1301 166 B20140410_SF109_01 B20140410_SF109_01 TB238399.[MT7]-RAPTTATQR.3y3_1.heavy 382.555 / 404.225 229862.0 17.269800186157227 50 20 10 10 10 10.47466843333094 9.546841567012738 0.0 3 0.9955775127187093 18.551066762436463 229862.0 146.05811038233568 0.0 - - - - - - - 716.0 459 7 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 1303 166 B20140410_SF109_01 B20140410_SF109_01 TB238399.[MT7]-RAPTTATQR.3y4_1.heavy 382.555 / 475.262 242320.0 17.269800186157227 50 20 10 10 10 10.47466843333094 9.546841567012738 0.0 3 0.9955775127187093 18.551066762436463 242320.0 139.58093886538663 0.0 - - - - - - - 221.875 484 8 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 1305 166 B20140410_SF109_01 B20140410_SF109_01 TB238399.[MT7]-RAPTTATQR.3y5_1.heavy 382.555 / 576.31 172788.0 17.269800186157227 50 20 10 10 10 10.47466843333094 9.546841567012738 0.0 3 0.9955775127187093 18.551066762436463 172788.0 191.98666666666665 0.0 - - - - - - - 220.44444444444446 345 9 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 1307 167 B20140410_SF109_01 B20140410_SF109_01 TB238586.[MT7]-TYELLNC[CAM]DK[MT7].3y3_1.heavy 481.918 / 566.273 80666.0 28.805599212646484 44 14 10 10 10 3.432840093394136 29.130398526989783 0.0 3 0.9427520894283941 5.133204705214486 80666.0 46.42619839130482 0.0 - - - - - - - 388.0 161 1 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1309 167 B20140410_SF109_01 B20140410_SF109_01 TB238586.[MT7]-TYELLNC[CAM]DK[MT7].3b4_1.heavy 481.918 / 651.347 199270.0 28.805599212646484 44 14 10 10 10 3.432840093394136 29.130398526989783 0.0 3 0.9427520894283941 5.133204705214486 199270.0 79.42579678522819 0.0 - - - - - - - 258.5 398 2 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1311 167 B20140410_SF109_01 B20140410_SF109_01 TB238586.[MT7]-TYELLNC[CAM]DK[MT7].3y4_1.heavy 481.918 / 680.315 73804.0 28.805599212646484 44 14 10 10 10 3.432840093394136 29.130398526989783 0.0 3 0.9427520894283941 5.133204705214486 73804.0 91.18640926640927 0.0 - - - - - - - 721.2857142857143 147 7 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1313 167 B20140410_SF109_01 B20140410_SF109_01 TB238586.[MT7]-TYELLNC[CAM]DK[MT7].3b3_1.heavy 481.918 / 538.263 212866.0 28.805599212646484 44 14 10 10 10 3.432840093394136 29.130398526989783 0.0 3 0.9427520894283941 5.133204705214486 212866.0 58.803623916215535 0.0 - - - - - - - 647.0 425 2 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1315 168 B20140410_SF109_01 B20140410_SF109_01 TB238681.[MT7]-RQLQEELEEVK[MT7].3y3_1.heavy 563.652 / 519.326 145506.0 28.503599166870117 42 12 10 10 10 1.0101597083660054 65.73788753982694 0.0 3 0.8852683310601072 3.608097188126034 145506.0 87.2568311100811 0.0 - - - - - - - 755.0 291 5 APOA5 apolipoprotein A-V 1317 168 B20140410_SF109_01 B20140410_SF109_01 TB238681.[MT7]-RQLQEELEEVK[MT7].3b6_1.heavy 563.652 / 928.497 51929.0 28.503599166870117 42 12 10 10 10 1.0101597083660054 65.73788753982694 0.0 3 0.8852683310601072 3.608097188126034 51929.0 169.0637560777359 0.0 - - - - - - - 292.5 103 8 APOA5 apolipoprotein A-V 1319 168 B20140410_SF109_01 B20140410_SF109_01 TB238681.[MT7]-RQLQEELEEVK[MT7].3b4_1.heavy 563.652 / 670.412 28893.0 28.503599166870117 42 12 10 10 10 1.0101597083660054 65.73788753982694 0.0 3 0.8852683310601072 3.608097188126034 28893.0 36.96428618211615 0.0 - - - - - - - 1134.0 57 7 APOA5 apolipoprotein A-V 1321 168 B20140410_SF109_01 B20140410_SF109_01 TB238681.[MT7]-RQLQEELEEVK[MT7].3y4_1.heavy 563.652 / 648.369 155007.0 28.503599166870117 42 12 10 10 10 1.0101597083660054 65.73788753982694 0.0 3 0.8852683310601072 3.608097188126034 155007.0 136.0057460927173 0.0 - - - - - - - 1227.0 310 7 APOA5 apolipoprotein A-V 1323 169 B20140410_SF109_01 B20140410_SF109_01 TB238587.[MT7]-TYELLNC[CAM]DK[MT7].2y4_1.heavy 722.373 / 680.315 22771.0 28.805599212646484 46 16 10 10 10 2.3494284266764636 34.15079920145962 0.0 3 0.9697957933563659 7.083198662492826 22771.0 32.1917019604094 0.0 - - - - - - - 726.7692307692307 45 13 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1325 169 B20140410_SF109_01 B20140410_SF109_01 TB238587.[MT7]-TYELLNC[CAM]DK[MT7].2b3_1.heavy 722.373 / 538.263 22512.0 28.805599212646484 46 16 10 10 10 2.3494284266764636 34.15079920145962 0.0 3 0.9697957933563659 7.083198662492826 22512.0 21.75072463768116 0.0 - - - - - - - 614.75 45 8 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1327 169 B20140410_SF109_01 B20140410_SF109_01 TB238587.[MT7]-TYELLNC[CAM]DK[MT7].2y5_1.heavy 722.373 / 793.399 17725.0 28.805599212646484 46 16 10 10 10 2.3494284266764636 34.15079920145962 0.0 3 0.9697957933563659 7.083198662492826 17725.0 45.68298969072165 0.0 - - - - - - - 250.5625 35 16 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1329 169 B20140410_SF109_01 B20140410_SF109_01 TB238587.[MT7]-TYELLNC[CAM]DK[MT7].2b4_1.heavy 722.373 / 651.347 21218.0 28.805599212646484 46 16 10 10 10 2.3494284266764636 34.15079920145962 0.0 3 0.9697957933563659 7.083198662492826 21218.0 14.892638585936535 0.0 - - - - - - - 727.875 42 8 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1331 170 B20140410_SF109_01 B20140410_SF109_01 TB375890.[MT7]-EAAAAALK[MT7].2b3_1.heavy 516.818 / 416.226 33875.0 23.703100204467773 45 15 10 10 10 2.0397468530889147 39.15898381728696 0.0 3 0.9561434840486337 5.871447303769363 33875.0 29.83195316208334 0.0 - - - - - - - 768.3333333333334 67 3 NQO1 NAD(P)H dehydrogenase, quinone 1 1333 170 B20140410_SF109_01 B20140410_SF109_01 TB375890.[MT7]-EAAAAALK[MT7].2y5_1.heavy 516.818 / 617.41 32377.0 23.703100204467773 45 15 10 10 10 2.0397468530889147 39.15898381728696 0.0 3 0.9561434840486337 5.871447303769363 32377.0 39.359530173238895 0.0 - - - - - - - 1195.375 64 8 NQO1 NAD(P)H dehydrogenase, quinone 1 1335 170 B20140410_SF109_01 B20140410_SF109_01 TB375890.[MT7]-EAAAAALK[MT7].2b5_1.heavy 516.818 / 558.3 26040.0 23.703100204467773 45 15 10 10 10 2.0397468530889147 39.15898381728696 0.0 3 0.9561434840486337 5.871447303769363 26040.0 32.08684876336036 0.0 - - - - - - - 345.7142857142857 52 7 NQO1 NAD(P)H dehydrogenase, quinone 1 1337 170 B20140410_SF109_01 B20140410_SF109_01 TB375890.[MT7]-EAAAAALK[MT7].2y7_1.heavy 516.818 / 759.484 40097.0 23.703100204467773 45 15 10 10 10 2.0397468530889147 39.15898381728696 0.0 3 0.9561434840486337 5.871447303769363 40097.0 87.97614699504336 0.0 - - - - - - - 705.75 80 8 NQO1 NAD(P)H dehydrogenase, quinone 1 1339 171 B20140410_SF109_01 B20140410_SF109_01 TB497144.[MT7]-FLIITENK[MT7].2b3_1.heavy 633.389 / 518.346 119278.0 33.83620071411133 48 18 10 10 10 4.105332732716127 24.358561537066706 0.0 3 0.9841921878630951 9.802858135174707 119278.0 46.9220094827549 0.0 - - - - - - - 1219.0 238 1 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1341 171 B20140410_SF109_01 B20140410_SF109_01 TB497144.[MT7]-FLIITENK[MT7].2y4_1.heavy 633.389 / 635.348 119820.0 33.83620071411133 48 18 10 10 10 4.105332732716127 24.358561537066706 0.0 3 0.9841921878630951 9.802858135174707 119820.0 56.081328781522124 0.0 - - - - - - - 880.0 239 2 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1343 171 B20140410_SF109_01 B20140410_SF109_01 TB497144.[MT7]-FLIITENK[MT7].2y5_1.heavy 633.389 / 748.432 121986.0 33.83620071411133 48 18 10 10 10 4.105332732716127 24.358561537066706 0.0 3 0.9841921878630951 9.802858135174707 121986.0 103.04752224965588 0.0 - - - - - - - 271.0 243 1 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1345 171 B20140410_SF109_01 B20140410_SF109_01 TB497144.[MT7]-FLIITENK[MT7].2y3_1.heavy 633.389 / 534.3 34795.0 33.83620071411133 48 18 10 10 10 4.105332732716127 24.358561537066706 0.0 3 0.9841921878630951 9.802858135174707 34795.0 10.153669404760882 1.0 - - - - - - - 1489.0 69 1 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1347 172 B20140410_SF109_01 B20140410_SF109_01 TB375897.[MT7]-GALVADISR.2y8_1.heavy 523.31 / 844.489 27852.0 28.67650032043457 48 18 10 10 10 5.102816326090917 19.5970212544582 0.0 3 0.9850450901475498 10.079239008265102 27852.0 21.607391601174882 0.0 - - - - - - - 218.16666666666666 55 6 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1349 172 B20140410_SF109_01 B20140410_SF109_01 TB375897.[MT7]-GALVADISR.2y5_1.heavy 523.31 / 561.299 53481.0 28.67650032043457 48 18 10 10 10 5.102816326090917 19.5970212544582 0.0 3 0.9850450901475498 10.079239008265102 53481.0 32.97134125882232 0.0 - - - - - - - 1801.4444444444443 106 9 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1351 172 B20140410_SF109_01 B20140410_SF109_01 TB375897.[MT7]-GALVADISR.2b6_1.heavy 523.31 / 671.385 100293.0 28.67650032043457 48 18 10 10 10 5.102816326090917 19.5970212544582 0.0 3 0.9850450901475498 10.079239008265102 100293.0 150.78099828213996 0.0 - - - - - - - 262.0 200 1 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1353 172 B20140410_SF109_01 B20140410_SF109_01 TB375897.[MT7]-GALVADISR.2y6_1.heavy 523.31 / 660.367 54004.0 28.67650032043457 48 18 10 10 10 5.102816326090917 19.5970212544582 0.0 3 0.9850450901475498 10.079239008265102 54004.0 58.37866575403283 0.0 - - - - - - - 262.0 108 1 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1355 173 B20140410_SF109_01 B20140410_SF109_01 TB238507.[MT7]-MAREPATLK[MT7].3y3_1.heavy 435.591 / 505.347 75558.0 23.309900283813477 47 17 10 10 10 3.802379541482329 26.29932096705311 0.0 3 0.9780590175164551 8.316432178574003 75558.0 83.7163443895554 0.0 - - - - - - - 858.375 151 8 APOA5 apolipoprotein A-V 1357 173 B20140410_SF109_01 B20140410_SF109_01 TB238507.[MT7]-MAREPATLK[MT7].3y4_1.heavy 435.591 / 576.384 25622.0 23.309900283813477 47 17 10 10 10 3.802379541482329 26.29932096705311 0.0 3 0.9780590175164551 8.316432178574003 25622.0 38.16995194408038 1.0 - - - - - - - 272.5 65 10 APOA5 apolipoprotein A-V 1359 173 B20140410_SF109_01 B20140410_SF109_01 TB238507.[MT7]-MAREPATLK[MT7].3y8_2.heavy 435.591 / 515.312 62475.0 23.309900283813477 47 17 10 10 10 3.802379541482329 26.29932096705311 0.0 3 0.9780590175164551 8.316432178574003 62475.0 50.72186688629178 1.0 - - - - - - - 1275.3 124 10 APOA5 apolipoprotein A-V 1361 173 B20140410_SF109_01 B20140410_SF109_01 TB238507.[MT7]-MAREPATLK[MT7].3y5_1.heavy 435.591 / 673.437 63347.0 23.309900283813477 47 17 10 10 10 3.802379541482329 26.29932096705311 0.0 3 0.9780590175164551 8.316432178574003 63347.0 143.21569462647443 0.0 - - - - - - - 733.2727272727273 126 11 APOA5 apolipoprotein A-V 1363 174 B20140410_SF109_01 B20140410_SF109_01 TB375753.[MT7]-TTGTPR.2b3_1.heavy 388.723 / 404.226 4034.0 18.502399444580078 42 14 10 10 8 2.972455219853989 33.64222254117327 0.0 4 0.9418366109908874 5.092249821479845 4034.0 3.8869660837809787 2.0 - - - - - - - 719.8 17 15 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1365 174 B20140410_SF109_01 B20140410_SF109_01 TB375753.[MT7]-TTGTPR.2y4_1.heavy 388.723 / 430.241 2729.0 18.502399444580078 42 14 10 10 8 2.972455219853989 33.64222254117327 0.0 4 0.9418366109908874 5.092249821479845 2729.0 3.4454764218849334 2.0 - - - - - - - 1214.857142857143 11 7 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1367 174 B20140410_SF109_01 B20140410_SF109_01 TB375753.[MT7]-TTGTPR.2y5_1.heavy 388.723 / 531.289 8227.0 18.502399444580078 42 14 10 10 8 2.972455219853989 33.64222254117327 0.0 4 0.9418366109908874 5.092249821479845 8227.0 9.100060975982306 0.0 - - - - - - - 763.3 16 10 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1369 174 B20140410_SF109_01 B20140410_SF109_01 TB375753.[MT7]-TTGTPR.2b4_1.heavy 388.723 / 505.274 4430.0 18.502399444580078 42 14 10 10 8 2.972455219853989 33.64222254117327 0.0 4 0.9418366109908874 5.092249821479845 4430.0 2.034150726083613 1.0 - - - - - - - 308.4 8 5 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1371 175 B20140410_SF109_01 B20140410_SF109_01 TB497248.[MT7]-FTQDNLC[CAM]HAQR.3b4_1.heavy 511.916 / 636.311 65256.0 23.839599609375 44 20 4 10 10 5.3203245979197265 18.795845659323213 0.0 3 0.9916064845884821 13.461274601732157 65256.0 99.4129663146717 0.0 - - - - - - - 792.0 130 10 LOC100132288 hypothetical protein LOC100132288 1373 175 B20140410_SF109_01 B20140410_SF109_01 TB497248.[MT7]-FTQDNLC[CAM]HAQR.3b5_1.heavy 511.916 / 750.354 87485.0 23.839599609375 44 20 4 10 10 5.3203245979197265 18.795845659323213 0.0 3 0.9916064845884821 13.461274601732157 87485.0 48.18321949018121 0.0 - - - - - - - 780.0 174 11 LOC100132288 hypothetical protein LOC100132288 1375 175 B20140410_SF109_01 B20140410_SF109_01 TB497248.[MT7]-FTQDNLC[CAM]HAQR.3y4_1.heavy 511.916 / 511.274 N/A 23.839599609375 44 20 4 10 10 5.3203245979197265 18.795845659323213 0.0 3 0.9916064845884821 13.461274601732157 195107.0 2.0178710445384773 1.0 - - - - - - - 20578.0 691 1 LOC100132288 hypothetical protein LOC100132288 1377 175 B20140410_SF109_01 B20140410_SF109_01 TB497248.[MT7]-FTQDNLC[CAM]HAQR.3y5_1.heavy 511.916 / 671.304 93317.0 23.839599609375 44 20 4 10 10 5.3203245979197265 18.795845659323213 0.0 3 0.9916064845884821 13.461274601732157 93317.0 196.7332424242424 0.0 - - - - - - - 825.0 186 10 LOC100132288 hypothetical protein LOC100132288 1379 176 B20140410_SF109_01 B20140410_SF109_01 TB497246.[MT7]-DFLYFLTPC[CAM]GR.2b3_1.heavy 766.888 / 520.289 41052.0 41.424800872802734 48 18 10 10 10 2.628971164188637 25.95470391753443 0.0 3 0.982286477259244 9.259056501355301 41052.0 111.50319783756868 0.0 - - - - - - - 712.2857142857143 82 7 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1381 176 B20140410_SF109_01 B20140410_SF109_01 TB497246.[MT7]-DFLYFLTPC[CAM]GR.2y8_1.heavy 766.888 / 1013.49 27050.0 41.424800872802734 48 18 10 10 10 2.628971164188637 25.95470391753443 0.0 3 0.982286477259244 9.259056501355301 27050.0 80.53862924194945 0.0 - - - - - - - 609.75 54 8 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1383 176 B20140410_SF109_01 B20140410_SF109_01 TB497246.[MT7]-DFLYFLTPC[CAM]GR.2y6_1.heavy 766.888 / 703.356 21321.0 41.424800872802734 48 18 10 10 10 2.628971164188637 25.95470391753443 0.0 3 0.982286477259244 9.259056501355301 21321.0 48.428544702011294 0.0 - - - - - - - 702.75 42 8 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1385 176 B20140410_SF109_01 B20140410_SF109_01 TB497246.[MT7]-DFLYFLTPC[CAM]GR.2y7_1.heavy 766.888 / 850.424 34263.0 41.424800872802734 48 18 10 10 10 2.628971164188637 25.95470391753443 0.0 3 0.982286477259244 9.259056501355301 34263.0 62.78759675652782 0.0 - - - - - - - 265.0 68 6 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1387 177 B20140410_SF109_01 B20140410_SF109_01 TB376205.[MT7]-FC[CAM]GLMVQLLHK[MT7].3y3_1.heavy 545.31 / 541.358 65055.0 37.657798767089844 42 12 10 10 10 1.4146341277795786 64.42234356045267 0.0 3 0.8836988034054618 3.5831786452207193 65055.0 40.39428452850064 0.0 - - - - - - - 261.0 130 2 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1389 177 B20140410_SF109_01 B20140410_SF109_01 TB376205.[MT7]-FC[CAM]GLMVQLLHK[MT7].3b4_1.heavy 545.31 / 622.314 72747.0 37.657798767089844 42 12 10 10 10 1.4146341277795786 64.42234356045267 0.0 3 0.8836988034054618 3.5831786452207193 72747.0 72.1866955608447 0.0 - - - - - - - 238.83333333333334 145 6 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1391 177 B20140410_SF109_01 B20140410_SF109_01 TB376205.[MT7]-FC[CAM]GLMVQLLHK[MT7].3b5_1.heavy 545.31 / 753.354 80830.0 37.657798767089844 42 12 10 10 10 1.4146341277795786 64.42234356045267 0.0 3 0.8836988034054618 3.5831786452207193 80830.0 144.68307470227356 0.0 - - - - - - - 260.875 161 8 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1393 177 B20140410_SF109_01 B20140410_SF109_01 TB376205.[MT7]-FC[CAM]GLMVQLLHK[MT7].3b3_1.heavy 545.31 / 509.23 20077.0 37.657798767089844 42 12 10 10 10 1.4146341277795786 64.42234356045267 0.0 3 0.8836988034054618 3.5831786452207193 20077.0 14.986337133163076 0.0 - - - - - - - 1711.125 40 8 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1395 178 B20140410_SF109_01 B20140410_SF109_01 TB497385.[MT7]-C[CAM]IELLYAALTSSSTDQPK[MT7].3b4_1.heavy 762.403 / 660.351 38313.0 39.65869903564453 46 16 10 10 10 2.677940637169596 37.34212723464001 0.0 3 0.968491842137122 6.934320335473321 38313.0 45.698605114459575 0.0 - - - - - - - 476.0 76 2 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1397 178 B20140410_SF109_01 B20140410_SF109_01 TB497385.[MT7]-C[CAM]IELLYAALTSSSTDQPK[MT7].3b5_1.heavy 762.403 / 773.435 54970.0 39.65869903564453 46 16 10 10 10 2.677940637169596 37.34212723464001 0.0 3 0.968491842137122 6.934320335473321 54970.0 44.47385094511099 0.0 - - - - - - - 416.5 109 2 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1399 178 B20140410_SF109_01 B20140410_SF109_01 TB497385.[MT7]-C[CAM]IELLYAALTSSSTDQPK[MT7].3b3_1.heavy 762.403 / 547.267 14040.0 39.65869903564453 46 16 10 10 10 2.677940637169596 37.34212723464001 0.0 3 0.968491842137122 6.934320335473321 14040.0 14.408679249202772 0.0 - - - - - - - 476.0 28 1 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1401 178 B20140410_SF109_01 B20140410_SF109_01 TB497385.[MT7]-C[CAM]IELLYAALTSSSTDQPK[MT7].3b7_1.heavy 762.403 / 1007.54 11898.0 39.65869903564453 46 16 10 10 10 2.677940637169596 37.34212723464001 0.0 3 0.968491842137122 6.934320335473321 11898.0 21.424969987995198 0.0 - - - - - - - 357.0 23 8 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1403 179 B20140410_SF109_01 B20140410_SF109_01 TB497386.[MT7]-LC[CAM]FSLTC[CAM]PLGSGSPEGVVK[MT7].3y6_1.heavy 766.069 / 772.469 73524.0 36.881900787353516 44 14 10 10 10 1.3863642848206956 42.40386641995691 0.0 3 0.93978549311703 5.003894013925075 73524.0 106.87524381785256 0.0 - - - - - - - 768.8571428571429 147 7 CBX7 chromobox homolog 7 1405 179 B20140410_SF109_01 B20140410_SF109_01 TB497386.[MT7]-LC[CAM]FSLTC[CAM]PLGSGSPEGVVK[MT7].3b4_1.heavy 766.069 / 652.325 33796.0 36.881900787353516 44 14 10 10 10 1.3863642848206956 42.40386641995691 0.0 3 0.93978549311703 5.003894013925075 33796.0 22.915025440666053 0.0 - - - - - - - 1672.25 67 8 CBX7 chromobox homolog 7 1407 179 B20140410_SF109_01 B20140410_SF109_01 TB497386.[MT7]-LC[CAM]FSLTC[CAM]PLGSGSPEGVVK[MT7].3b3_1.heavy 766.069 / 565.292 19312.0 36.881900787353516 44 14 10 10 10 1.3863642848206956 42.40386641995691 0.0 3 0.93978549311703 5.003894013925075 19312.0 29.573984962693338 0.0 - - - - - - - 790.3636363636364 38 11 CBX7 chromobox homolog 7 1409 179 B20140410_SF109_01 B20140410_SF109_01 TB497386.[MT7]-LC[CAM]FSLTC[CAM]PLGSGSPEGVVK[MT7].3y4_1.heavy 766.069 / 546.373 38210.0 36.881900787353516 44 14 10 10 10 1.3863642848206956 42.40386641995691 0.0 3 0.93978549311703 5.003894013925075 38210.0 39.89734769038725 0.0 - - - - - - - 1195.5555555555557 76 9 CBX7 chromobox homolog 7 1411 180 B20140410_SF109_01 B20140410_SF109_01 TB497388.[MT7]-LRPLSGSEAPRLPQDPVGMR.4b8_1.heavy 580.822 / 984.56 7640.0 29.597299575805664 46 18 10 10 8 1.8765779642083837 38.3528908499207 0.0 4 0.9805768196213727 8.840905187788774 7640.0 18.200612984118138 0.0 - - - - - - - 184.57142857142858 15 14 APOA5 apolipoprotein A-V 1413 180 B20140410_SF109_01 B20140410_SF109_01 TB497388.[MT7]-LRPLSGSEAPRLPQDPVGMR.4y5_1.heavy 580.822 / 559.302 200833.0 29.597299575805664 46 18 10 10 8 1.8765779642083837 38.3528908499207 0.0 4 0.9805768196213727 8.840905187788774 200833.0 65.20869721145098 0.0 - - - - - - - 1683.5 401 2 APOA5 apolipoprotein A-V 1415 180 B20140410_SF109_01 B20140410_SF109_01 TB497388.[MT7]-LRPLSGSEAPRLPQDPVGMR.4y8_1.heavy 580.822 / 899.44 16963.0 29.597299575805664 46 18 10 10 8 1.8765779642083837 38.3528908499207 0.0 4 0.9805768196213727 8.840905187788774 16963.0 44.754375804375805 1.0 - - - - - - - 721.2857142857143 47 7 APOA5 apolipoprotein A-V 1417 180 B20140410_SF109_01 B20140410_SF109_01 TB497388.[MT7]-LRPLSGSEAPRLPQDPVGMR.4b9_2.heavy 580.822 / 528.302 40141.0 29.597299575805664 46 18 10 10 8 1.8765779642083837 38.3528908499207 0.0 4 0.9805768196213727 8.840905187788774 40141.0 21.208394024568726 0.0 - - - - - - - 841.5 80 2 APOA5 apolipoprotein A-V 1419 181 B20140410_SF109_01 B20140410_SF109_01 TB497382.[MT7]-AQLLGGVDEAWALLQGLQSR.4y5_1.heavy 568.066 / 560.315 63191.0 45.03839874267578 48 18 10 10 10 5.930541418424166 16.86186689284964 0.0 3 0.9835075329196563 9.596676640856437 63191.0 273.6405832096718 0.0 - - - - - - - 277.11764705882354 126 17 APOA5 apolipoprotein A-V 1421 181 B20140410_SF109_01 B20140410_SF109_01 TB497382.[MT7]-AQLLGGVDEAWALLQGLQSR.4y7_1.heavy 568.066 / 801.458 25348.0 45.03839874267578 48 18 10 10 10 5.930541418424166 16.86186689284964 0.0 3 0.9835075329196563 9.596676640856437 25348.0 136.1172748330835 0.0 - - - - - - - 173.5 50 18 APOA5 apolipoprotein A-V 1423 181 B20140410_SF109_01 B20140410_SF109_01 TB497382.[MT7]-AQLLGGVDEAWALLQGLQSR.4y6_1.heavy 568.066 / 688.374 58121.0 45.03839874267578 48 18 10 10 10 5.930541418424166 16.86186689284964 0.0 3 0.9835075329196563 9.596676640856437 58121.0 179.30862115253865 0.0 - - - - - - - 258.94117647058823 116 17 APOA5 apolipoprotein A-V 1425 181 B20140410_SF109_01 B20140410_SF109_01 TB497382.[MT7]-AQLLGGVDEAWALLQGLQSR.4b6_1.heavy 568.066 / 684.416 34514.0 45.03839874267578 48 18 10 10 10 5.930541418424166 16.86186689284964 0.0 3 0.9835075329196563 9.596676640856437 34514.0 306.25900588011336 0.0 - - - - - - - 163.8 69 20 APOA5 apolipoprotein A-V 1427 182 B20140410_SF109_01 B20140410_SF109_01 TB238699.[MT7]-DK[MT7]EEPLHIAQTR.3b6_1.heavy 575.656 / 1000.56 24620.0 23.981199264526367 48 18 10 10 10 5.7723047356647585 17.32410269023741 0.0 3 0.9852272576642771 10.141348588536866 24620.0 265.77369252545543 0.0 - - - - - - - 207.0 49 7 LOC100132288 hypothetical protein LOC100132288 1429 182 B20140410_SF109_01 B20140410_SF109_01 TB238699.[MT7]-DK[MT7]EEPLHIAQTR.3b4_1.heavy 575.656 / 790.419 28241.0 23.981199264526367 48 18 10 10 10 5.7723047356647585 17.32410269023741 0.0 3 0.9852272576642771 10.141348588536866 28241.0 59.23112695554167 0.0 - - - - - - - 310.14285714285717 56 7 LOC100132288 hypothetical protein LOC100132288 1431 182 B20140410_SF109_01 B20140410_SF109_01 TB238699.[MT7]-DK[MT7]EEPLHIAQTR.3y8_1.heavy 575.656 / 935.542 8328.0 23.981199264526367 48 18 10 10 10 5.7723047356647585 17.32410269023741 0.0 3 0.9852272576642771 10.141348588536866 8328.0 24.139130434782608 0.0 - - - - - - - 260.0 16 13 LOC100132288 hypothetical protein LOC100132288 1433 182 B20140410_SF109_01 B20140410_SF109_01 TB238699.[MT7]-DK[MT7]EEPLHIAQTR.3y5_1.heavy 575.656 / 588.346 76879.0 23.981199264526367 48 18 10 10 10 5.7723047356647585 17.32410269023741 0.0 3 0.9852272576642771 10.141348588536866 76879.0 128.95125252795546 0.0 - - - - - - - 777.7777777777778 153 9 LOC100132288 hypothetical protein LOC100132288 1435 183 B20140410_SF109_01 B20140410_SF109_01 TB497384.[MT7]-AQLLGGVDEAWALLQGLQSR.2b4_1.heavy 1135.12 / 570.373 30464.0 45.03839874267578 37 7 10 10 10 1.1178493674334662 76.95196009072095 0.0 3 0.729734161092201 2.31825530262362 30464.0 138.61879555044112 0.0 - - - - - - - 216.05 60 20 APOA5 apolipoprotein A-V 1437 183 B20140410_SF109_01 B20140410_SF109_01 TB497384.[MT7]-AQLLGGVDEAWALLQGLQSR.2y10_1.heavy 1135.12 / 1171.66 4691.0 45.03839874267578 37 7 10 10 10 1.1178493674334662 76.95196009072095 0.0 3 0.729734161092201 2.31825530262362 4691.0 23.95874287599736 0.0 - - - - - - - 160.94736842105263 9 19 APOA5 apolipoprotein A-V 1439 183 B20140410_SF109_01 B20140410_SF109_01 TB497384.[MT7]-AQLLGGVDEAWALLQGLQSR.2y11_1.heavy 1135.12 / 1242.7 2952.0 45.03839874267578 37 7 10 10 10 1.1178493674334662 76.95196009072095 0.0 3 0.729734161092201 2.31825530262362 2952.0 24.152727272727272 0.0 - - - - - - - 126.66666666666667 5 15 APOA5 apolipoprotein A-V 1441 183 B20140410_SF109_01 B20140410_SF109_01 TB497384.[MT7]-AQLLGGVDEAWALLQGLQSR.2y7_1.heavy 1135.12 / 801.458 10647.0 45.03839874267578 37 7 10 10 10 1.1178493674334662 76.95196009072095 0.0 3 0.729734161092201 2.31825530262362 10647.0 70.64360189573459 0.0 - - - - - - - 140.66666666666666 21 18 APOA5 apolipoprotein A-V 1443 184 B20140410_SF109_01 B20140410_SF109_01 TB497135.[MT7]-ALIVLAHSER.3b4_1.heavy 418.255 / 541.383 348875.0 29.320724964141846 43 17 10 6 10 3.7396843925211383 26.74022444246537 0.03909873962402344 3 0.9705705449325697 7.17629657259853 348875.0 276.4290931371386 0.0 - - - - - - - 645.0 697 2 NQO1 NAD(P)H dehydrogenase, quinone 1 1445 184 B20140410_SF109_01 B20140410_SF109_01 TB497135.[MT7]-ALIVLAHSER.3y4_1.heavy 418.255 / 528.253 286967.0 29.320724964141846 43 17 10 6 10 3.7396843925211383 26.74022444246537 0.03909873962402344 3 0.9705705449325697 7.17629657259853 286967.0 51.244468740448355 0.0 - - - - - - - 516.0 573 1 NQO1 NAD(P)H dehydrogenase, quinone 1 1447 184 B20140410_SF109_01 B20140410_SF109_01 TB497135.[MT7]-ALIVLAHSER.3b3_1.heavy 418.255 / 442.315 409493.0 29.320724964141846 43 17 10 6 10 3.7396843925211383 26.74022444246537 0.03909873962402344 3 0.9705705449325697 7.17629657259853 409493.0 277.82818080074475 0.0 - - - - - - - 688.0 818 3 NQO1 NAD(P)H dehydrogenase, quinone 1 1449 184 B20140410_SF109_01 B20140410_SF109_01 TB497135.[MT7]-ALIVLAHSER.3y5_1.heavy 418.255 / 599.29 263365.0 29.320724964141846 43 17 10 6 10 3.7396843925211383 26.74022444246537 0.03909873962402344 3 0.9705705449325697 7.17629657259853 263365.0 173.0204761229354 0.0 - - - - - - - 774.0 526 2 NQO1 NAD(P)H dehydrogenase, quinone 1 1451 185 B20140410_SF109_01 B20140410_SF109_01 TB376346.[MT7]-EAASSYQEAWSTLRK[MT7].3y7_1.heavy 672.353 / 1005.6 9085.0 30.220600128173828 46 16 10 10 10 2.5548383795950693 39.141419198442435 0.0 3 0.9688822864408688 6.977918011268321 9085.0 22.570931788569215 0.0 - - - - - - - 251.0 18 15 ADAT1 adenosine deaminase, tRNA-specific 1 1453 185 B20140410_SF109_01 B20140410_SF109_01 TB376346.[MT7]-EAASSYQEAWSTLRK[MT7].3b5_1.heavy 672.353 / 590.29 N/A 30.220600128173828 46 16 10 10 10 2.5548383795950693 39.141419198442435 0.0 3 0.9688822864408688 6.977918011268321 6230.0 3.181987479860129 1.0 - - - - - - - 1225.7777777777778 14 9 ADAT1 adenosine deaminase, tRNA-specific 1 1455 185 B20140410_SF109_01 B20140410_SF109_01 TB376346.[MT7]-EAASSYQEAWSTLRK[MT7].3y8_1.heavy 672.353 / 1134.64 3634.0 30.220600128173828 46 16 10 10 10 2.5548383795950693 39.141419198442435 0.0 3 0.9688822864408688 6.977918011268321 3634.0 39.414923076923074 0.0 - - - - - - - 227.25 7 8 ADAT1 adenosine deaminase, tRNA-specific 1 1457 185 B20140410_SF109_01 B20140410_SF109_01 TB376346.[MT7]-EAASSYQEAWSTLRK[MT7].3y5_1.heavy 672.353 / 748.48 9734.0 30.220600128173828 46 16 10 10 10 2.5548383795950693 39.141419198442435 0.0 3 0.9688822864408688 6.977918011268321 9734.0 10.040699717778363 1.0 - - - - - - - 677.8888888888889 19 9 ADAT1 adenosine deaminase, tRNA-specific 1 1459 186 B20140410_SF109_01 B20140410_SF109_01 TB497130.[MT7]-GVRPDGQVK[MT7].3y6_1.heavy 415.25 / 787.443 12105.0 19.930599212646484 45 15 10 10 10 2.0121088671322145 41.249110089155536 0.0 3 0.9561324007365128 5.870700024361022 12105.0 119.24328358208955 0.0 - - - - - - - 184.0625 24 16 LOC100507338 hypothetical protein LOC100507338 1461 186 B20140410_SF109_01 B20140410_SF109_01 TB497130.[MT7]-GVRPDGQVK[MT7].3b5_1.heavy 415.25 / 669.38 8427.0 19.930599212646484 45 15 10 10 10 2.0121088671322145 41.249110089155536 0.0 3 0.9561324007365128 5.870700024361022 8427.0 24.938878205128205 0.0 - - - - - - - 685.75 16 8 LOC100507338 hypothetical protein LOC100507338 1463 186 B20140410_SF109_01 B20140410_SF109_01 TB497130.[MT7]-GVRPDGQVK[MT7].3y4_1.heavy 415.25 / 575.363 79854.0 19.930599212646484 45 15 10 10 10 2.0121088671322145 41.249110089155536 0.0 3 0.9561324007365128 5.870700024361022 79854.0 57.31205727320197 0.0 - - - - - - - 1242.0 159 7 LOC100507338 hypothetical protein LOC100507338 1465 186 B20140410_SF109_01 B20140410_SF109_01 TB497130.[MT7]-GVRPDGQVK[MT7].3b7_1.heavy 415.25 / 854.46 N/A 19.930599212646484 45 15 10 10 10 2.0121088671322145 41.249110089155536 0.0 3 0.9561324007365128 5.870700024361022 67.0 0.8 24.0 - - - - - - - 0.0 0 0 LOC100507338 hypothetical protein LOC100507338 1467 187 B20140410_SF109_01 B20140410_SF109_01 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 729282.0 35.83369827270508 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 729282.0 159.60969614799654 0.0 - - - - - - - 417.0 1458 2 1469 187 B20140410_SF109_01 B20140410_SF109_01 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 1345220.0 35.83369827270508 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1345220.0 186.579072721937 0.0 - - - - - - - 880.3333333333334 2690 3 1471 187 B20140410_SF109_01 B20140410_SF109_01 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 1630790.0 35.83369827270508 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1630790.0 189.109587746434 0.0 - - - - - - - 1112.0 3261 1 1473 188 B20140410_SF109_01 B20140410_SF109_01 TB375884.[MT7]-LFVIGGK[MT7].2b3_1.heavy 511.336 / 504.33 46698.0 33.714698791503906 45 15 10 10 10 2.0297299700784475 40.74230758483585 0.0 3 0.9568441954099715 5.91927331956128 46698.0 27.244605922311678 0.0 - - - - - - - 973.0 93 1 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1475 188 B20140410_SF109_01 B20140410_SF109_01 TB375884.[MT7]-LFVIGGK[MT7].2y4_1.heavy 511.336 / 518.342 61708.0 33.714698791503906 45 15 10 10 10 2.0297299700784475 40.74230758483585 0.0 3 0.9568441954099715 5.91927331956128 61708.0 30.978401454660446 0.0 - - - - - - - 1231.142857142857 123 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1477 188 B20140410_SF109_01 B20140410_SF109_01 TB375884.[MT7]-LFVIGGK[MT7].2y6_1.heavy 511.336 / 764.479 36830.0 33.714698791503906 45 15 10 10 10 2.0297299700784475 40.74230758483585 0.0 3 0.9568441954099715 5.91927331956128 36830.0 15.93126471598856 0.0 - - - - - - - 208.5 73 2 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1479 189 B20140410_SF109_01 B20140410_SF109_01 TB375785.[MT7]-FQDGPR.2b3_1.heavy 432.228 / 535.263 127362.0 22.034299850463867 44 14 10 10 10 2.1201846981102737 47.16570216223628 0.0 3 0.9366176916485816 4.875928526771504 127362.0 114.84607544214603 0.0 - - - - - - - 846.25 254 8 TMEM155 transmembrane protein 155 1481 189 B20140410_SF109_01 B20140410_SF109_01 TB375785.[MT7]-FQDGPR.2y5_1.heavy 432.228 / 572.279 28557.0 22.034299850463867 44 14 10 10 10 2.1201846981102737 47.16570216223628 0.0 3 0.9366176916485816 4.875928526771504 28557.0 52.327020145754474 0.0 - - - - - - - 1212.4285714285713 57 7 TMEM155 transmembrane protein 155 1483 189 B20140410_SF109_01 B20140410_SF109_01 TB375785.[MT7]-FQDGPR.2b4_1.heavy 432.228 / 592.285 14605.0 22.034299850463867 44 14 10 10 10 2.1201846981102737 47.16570216223628 0.0 3 0.9366176916485816 4.875928526771504 14605.0 15.860547869266185 1.0 - - - - - - - 815.7 29 10 TMEM155 transmembrane protein 155 1485 189 B20140410_SF109_01 B20140410_SF109_01 TB375785.[MT7]-FQDGPR.2y3_1.heavy 432.228 / 329.193 156979.0 22.034299850463867 44 14 10 10 10 2.1201846981102737 47.16570216223628 0.0 3 0.9366176916485816 4.875928526771504 156979.0 213.97236401918627 0.0 - - - - - - - 449.0 313 2 TMEM155 transmembrane protein 155 1487 190 B20140410_SF109_01 B20140410_SF109_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 897396.0 32.14619827270508 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 897396.0 295.2252455393118 0.0 - - - - - - - 1733.75 1794 8 1489 190 B20140410_SF109_01 B20140410_SF109_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 152469.0 32.14619827270508 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 152469.0 165.62187968232658 1.0 - - - - - - - 1309.0 542 1 1491 190 B20140410_SF109_01 B20140410_SF109_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 104700.0 32.14619827270508 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 104700.0 76.76619625990207 0.0 - - - - - - - 393.0 209 1 1493 191 B20140410_SF109_01 B20140410_SF109_01 TB497399.[MT7]-LK[MT7]DPANFQYPAESVLAYK[MT7].4y4_1.heavy 622.347 / 638.399 71032.0 33.8564510345459 33 8 10 5 10 7.013553960955966 14.258106597125224 0.040500640869140625 3 0.7910286821063611 2.651236302204842 71032.0 68.6452885475688 0.0 - - - - - - - 881.0 142 2 NQO1 NAD(P)H dehydrogenase, quinone 1 1495 191 B20140410_SF109_01 B20140410_SF109_01 TB497399.[MT7]-LK[MT7]DPANFQYPAESVLAYK[MT7].4b8_2.heavy 622.347 / 601.842 100719.0 33.8564510345459 33 8 10 5 10 7.013553960955966 14.258106597125224 0.040500640869140625 3 0.7910286821063611 2.651236302204842 100719.0 63.862170032234175 0.0 - - - - - - - 745.5 201 2 NQO1 NAD(P)H dehydrogenase, quinone 1 1497 191 B20140410_SF109_01 B20140410_SF109_01 TB497399.[MT7]-LK[MT7]DPANFQYPAESVLAYK[MT7].4y3_1.heavy 622.347 / 525.315 105600.0 33.8564510345459 33 8 10 5 10 7.013553960955966 14.258106597125224 0.040500640869140625 3 0.7910286821063611 2.651236302204842 105600.0 37.977272865867086 0.0 - - - - - - - 678.0 211 1 NQO1 NAD(P)H dehydrogenase, quinone 1 1499 191 B20140410_SF109_01 B20140410_SF109_01 TB497399.[MT7]-LK[MT7]DPANFQYPAESVLAYK[MT7].4b3_1.heavy 622.347 / 645.417 31856.0 33.8564510345459 33 8 10 5 10 7.013553960955966 14.258106597125224 0.040500640869140625 3 0.7910286821063611 2.651236302204842 31856.0 28.692501061010873 0.0 - - - - - - - 136.0 63 1 NQO1 NAD(P)H dehydrogenase, quinone 1 1501 192 B20140410_SF109_01 B20140410_SF109_01 TB497263.[MT7]-ELVPSSDPIVFVVGAFAHGK[MT7].3y7_1.heavy 786.442 / 831.459 44017.0 42.498451232910156 36 11 10 5 10 0.987184385946526 62.86898515493593 0.0438995361328125 3 0.875589493039266 3.4619827928421048 44017.0 88.09156892298395 0.0 - - - - - - - 328.8 88 5 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1503 192 B20140410_SF109_01 B20140410_SF109_01 TB497263.[MT7]-ELVPSSDPIVFVVGAFAHGK[MT7].3y8_1.heavy 786.442 / 930.528 28036.0 42.498451232910156 36 11 10 5 10 0.987184385946526 62.86898515493593 0.0438995361328125 3 0.875589493039266 3.4619827928421048 28036.0 56.27664233576642 0.0 - - - - - - - 274.0 56 7 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1505 192 B20140410_SF109_01 B20140410_SF109_01 TB497263.[MT7]-ELVPSSDPIVFVVGAFAHGK[MT7].3b7_1.heavy 786.442 / 872.448 34520.0 42.498451232910156 36 11 10 5 10 0.987184385946526 62.86898515493593 0.0438995361328125 3 0.875589493039266 3.4619827928421048 34520.0 48.090427528675704 0.0 - - - - - - - 328.8 69 5 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1507 192 B20140410_SF109_01 B20140410_SF109_01 TB497263.[MT7]-ELVPSSDPIVFVVGAFAHGK[MT7].3y10_1.heavy 786.442 / 1176.66 10411.0 42.498451232910156 36 11 10 5 10 0.987184385946526 62.86898515493593 0.0438995361328125 3 0.875589493039266 3.4619827928421048 10411.0 46.91331304869513 0.0 - - - - - - - 199.1818181818182 20 11 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1509 193 B20140410_SF109_01 B20140410_SF109_01 TB497396.[MT7]-DK[MT7]VFC[CAM]ELFPEVVEEIK[MT7].4y4_1.heavy 604.082 / 662.384 73373.0 39.68084907531738 33 8 10 5 10 1.5480845500385785 44.32993920332933 0.044300079345703125 3 0.7853317107804088 2.6144725817759293 73373.0 119.11796540180498 0.0 - - - - - - - 363.0 146 2 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 1511 193 B20140410_SF109_01 B20140410_SF109_01 TB497396.[MT7]-DK[MT7]VFC[CAM]ELFPEVVEEIK[MT7].4b7_2.heavy 604.082 / 590.817 100087.0 39.68084907531738 33 8 10 5 10 1.5480845500385785 44.32993920332933 0.044300079345703125 3 0.7853317107804088 2.6144725817759293 100087.0 162.1203000169033 0.0 - - - - - - - 302.5 200 4 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 1513 193 B20140410_SF109_01 B20140410_SF109_01 TB497396.[MT7]-DK[MT7]VFC[CAM]ELFPEVVEEIK[MT7].4b6_1.heavy 604.082 / 1067.54 10516.0 39.68084907531738 33 8 10 5 10 1.5480845500385785 44.32993920332933 0.044300079345703125 3 0.7853317107804088 2.6144725817759293 10516.0 41.11026004728132 0.0 - - - - - - - 268.8888888888889 21 9 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 1515 193 B20140410_SF109_01 B20140410_SF109_01 TB497396.[MT7]-DK[MT7]VFC[CAM]ELFPEVVEEIK[MT7].4b6_2.heavy 604.082 / 534.275 73252.0 39.68084907531738 33 8 10 5 10 1.5480845500385785 44.32993920332933 0.044300079345703125 3 0.7853317107804088 2.6144725817759293 73252.0 94.49620052843832 0.0 - - - - - - - 794.1428571428571 146 7 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 1517 194 B20140410_SF109_01 B20140410_SF109_01 TB376216.[MT7]-RSPMAFIPFSAGPR.3y7_1.heavy 559.972 / 731.383 74168.0 34.783199310302734 44 14 10 10 10 1.842892150556217 42.13246586858935 0.0 3 0.9416966496882005 5.086073377152716 74168.0 25.657046312479398 1.0 - - - - - - - 417.0 153 1 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1519 194 B20140410_SF109_01 B20140410_SF109_01 TB376216.[MT7]-RSPMAFIPFSAGPR.3b6_1.heavy 559.972 / 834.441 27413.0 34.783199310302734 44 14 10 10 10 1.842892150556217 42.13246586858935 0.0 3 0.9416966496882005 5.086073377152716 27413.0 50.19807205966903 0.0 - - - - - - - 723.8 54 10 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1521 194 B20140410_SF109_01 B20140410_SF109_01 TB376216.[MT7]-RSPMAFIPFSAGPR.3b4_1.heavy 559.972 / 616.336 6818.0 34.783199310302734 44 14 10 10 10 1.842892150556217 42.13246586858935 0.0 3 0.9416966496882005 5.086073377152716 6818.0 2.4934923477106983 2.0 - - - - - - - 1729.5714285714287 25 7 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1523 194 B20140410_SF109_01 B20140410_SF109_01 TB376216.[MT7]-RSPMAFIPFSAGPR.3b5_1.heavy 559.972 / 687.373 20594.0 34.783199310302734 44 14 10 10 10 1.842892150556217 42.13246586858935 0.0 3 0.9416966496882005 5.086073377152716 20594.0 14.709768710691822 0.0 - - - - - - - 775.4285714285714 41 7 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1525 195 B20140410_SF109_01 B20140410_SF109_01 TB497397.[MT7]-LQPYMAEAHELVGWNLEGLR.3b8_1.heavy 824.094 / 1048.53 17394.0 39.02149963378906 47 17 10 10 10 2.3998148998059965 32.88475130478767 0.0 3 0.9770181374400497 8.12520804967968 17394.0 79.89370078740157 0.0 - - - - - - - 211.66666666666666 34 6 APOA5 apolipoprotein A-V 1527 195 B20140410_SF109_01 B20140410_SF109_01 TB497397.[MT7]-LQPYMAEAHELVGWNLEGLR.3y8_1.heavy 824.094 / 944.495 52054.0 39.02149963378906 47 17 10 10 10 2.3998148998059965 32.88475130478767 0.0 3 0.9770181374400497 8.12520804967968 52054.0 43.05013598449743 0.0 - - - - - - - 685.8 104 10 APOA5 apolipoprotein A-V 1529 195 B20140410_SF109_01 B20140410_SF109_01 TB497397.[MT7]-LQPYMAEAHELVGWNLEGLR.3y10_1.heavy 824.094 / 1156.65 21329.0 39.02149963378906 47 17 10 10 10 2.3998148998059965 32.88475130478767 0.0 3 0.9770181374400497 8.12520804967968 21329.0 60.74006561679789 0.0 - - - - - - - 725.7142857142857 42 7 APOA5 apolipoprotein A-V 1531 195 B20140410_SF109_01 B20140410_SF109_01 TB497397.[MT7]-LQPYMAEAHELVGWNLEGLR.3y9_1.heavy 824.094 / 1043.56 36438.0 39.02149963378906 47 17 10 10 10 2.3998148998059965 32.88475130478767 0.0 3 0.9770181374400497 8.12520804967968 36438.0 63.19546783924737 0.0 - - - - - - - 689.4285714285714 72 7 APOA5 apolipoprotein A-V 1533 196 B20140410_SF109_01 B20140410_SF109_01 TB497266.[MT7]-GLLALAPPGGLPGGPR.3b6_1.heavy 529.655 / 683.457 302510.0 36.43295097351074 39 14 10 5 10 2.4178986519475334 41.35822645810794 0.046100616455078125 3 0.9356606008290264 4.839131066890199 302510.0 372.38541472866495 0.0 - - - - - - - 370.6666666666667 605 3 TMEM65 transmembrane protein 65 1535 196 B20140410_SF109_01 B20140410_SF109_01 TB497266.[MT7]-GLLALAPPGGLPGGPR.3b5_1.heavy 529.655 / 612.42 490571.0 36.43295097351074 39 14 10 5 10 2.4178986519475334 41.35822645810794 0.046100616455078125 3 0.9356606008290264 4.839131066890199 490571.0 632.4192360744579 0.0 - - - - - - - 278.0 981 3 TMEM65 transmembrane protein 65 1537 196 B20140410_SF109_01 B20140410_SF109_01 TB497266.[MT7]-GLLALAPPGGLPGGPR.3y8_1.heavy 529.655 / 710.394 215979.0 36.43295097351074 39 14 10 5 10 2.4178986519475334 41.35822645810794 0.046100616455078125 3 0.9356606008290264 4.839131066890199 215979.0 142.64878964474315 0.0 - - - - - - - 694.5 431 2 TMEM65 transmembrane protein 65 1539 196 B20140410_SF109_01 B20140410_SF109_01 TB497266.[MT7]-GLLALAPPGGLPGGPR.3y9_1.heavy 529.655 / 807.447 642107.0 36.43295097351074 39 14 10 5 10 2.4178986519475334 41.35822645810794 0.046100616455078125 3 0.9356606008290264 4.839131066890199 642107.0 1093.6158603482634 0.0 - - - - - - - 278.0 1284 2 TMEM65 transmembrane protein 65 1541 197 B20140410_SF109_01 B20140410_SF109_01 TB375771.[MT7]-FLIITENK[MT7].3y3_1.heavy 422.595 / 534.3 225623.0 33.83620071411133 50 20 10 10 10 6.3660051474771535 12.088646244184606 0.0 3 0.9980344044265769 27.831981311357843 225623.0 439.2186134809123 0.0 - - - - - - - 220.0 451 7 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1543 197 B20140410_SF109_01 B20140410_SF109_01 TB375771.[MT7]-FLIITENK[MT7].3b4_1.heavy 422.595 / 631.43 96736.0 33.83620071411133 50 20 10 10 10 6.3660051474771535 12.088646244184606 0.0 3 0.9980344044265769 27.831981311357843 96736.0 30.78231346591037 0.0 - - - - - - - 140.0 193 2 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1545 197 B20140410_SF109_01 B20140410_SF109_01 TB375771.[MT7]-FLIITENK[MT7].3y4_1.heavy 422.595 / 635.348 219333.0 33.83620071411133 50 20 10 10 10 6.3660051474771535 12.088646244184606 0.0 3 0.9980344044265769 27.831981311357843 219333.0 544.3503222277157 0.0 - - - - - - - 279.75 438 4 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1547 197 B20140410_SF109_01 B20140410_SF109_01 TB375771.[MT7]-FLIITENK[MT7].3b3_1.heavy 422.595 / 518.346 605569.0 33.83620071411133 50 20 10 10 10 6.3660051474771535 12.088646244184606 0.0 3 0.9980344044265769 27.831981311357843 605569.0 1403.3034021319304 0.0 - - - - - - - 307.6 1211 5 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1549 198 B20140410_SF109_01 B20140410_SF109_01 TB376217.[MT7]-DSATALLYWAWSR.3y6_1.heavy 561.959 / 868.41 76012.0 42.140499114990234 50 20 10 10 10 12.760450029097699 7.83671420459072 0.0 3 0.9952218258960156 17.846715688597882 76012.0 186.23985178752352 0.0 - - - - - - - 685.7777777777778 152 9 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1551 198 B20140410_SF109_01 B20140410_SF109_01 TB376217.[MT7]-DSATALLYWAWSR.3b6_1.heavy 561.959 / 703.374 113930.0 42.140499114990234 50 20 10 10 10 12.760450029097699 7.83671420459072 0.0 3 0.9952218258960156 17.846715688597882 113930.0 275.5936953735495 0.0 - - - - - - - 330.75 227 4 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1553 198 B20140410_SF109_01 B20140410_SF109_01 TB376217.[MT7]-DSATALLYWAWSR.3b5_1.heavy 561.959 / 590.29 158373.0 42.140499114990234 50 20 10 10 10 12.760450029097699 7.83671420459072 0.0 3 0.9952218258960156 17.846715688597882 158373.0 313.685652173913 0.0 - - - - - - - 335.2 316 5 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1555 198 B20140410_SF109_01 B20140410_SF109_01 TB376217.[MT7]-DSATALLYWAWSR.3y5_1.heavy 561.959 / 705.347 128568.0 42.140499114990234 50 20 10 10 10 12.760450029097699 7.83671420459072 0.0 3 0.9952218258960156 17.846715688597882 128568.0 208.56314131131415 0.0 - - - - - - - 783.8888888888889 257 9 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1557 199 B20140410_SF109_01 B20140410_SF109_01 TB497393.[MT7]-TLPGMNRPIQVK[MT7]PADSESR.4y5_1.heavy 596.829 / 593.253 3172.0 26.864749908447266 22 3 10 5 4 0.5740056951825059 91.85334698373785 0.046298980712890625 8 0.5793583855339773 1.8316839109546323 3172.0 3.1947981211229988 8.0 - - - - - - - 414.0 12 1 CELF3;CELF4 CUGBP, Elav-like family member 3;CUGBP, Elav-like family member 4 1559 199 B20140410_SF109_01 B20140410_SF109_01 TB497393.[MT7]-TLPGMNRPIQVK[MT7]PADSESR.4b11_2.heavy 596.829 / 676.385 30618.0 26.864749908447266 22 3 10 5 4 0.5740056951825059 91.85334698373785 0.046298980712890625 8 0.5793583855339773 1.8316839109546323 30618.0 50.790905026169746 0.0 - - - - - - - 276.0 61 5 CELF3;CELF4 CUGBP, Elav-like family member 3;CUGBP, Elav-like family member 4 1561 199 B20140410_SF109_01 B20140410_SF109_01 TB497393.[MT7]-TLPGMNRPIQVK[MT7]PADSESR.4b4_1.heavy 596.829 / 513.315 1793.0 26.864749908447266 22 3 10 5 4 0.5740056951825059 91.85334698373785 0.046298980712890625 8 0.5793583855339773 1.8316839109546323 1793.0 2.172172794159394 13.0 - - - - - - - 729.1428571428571 5 7 CELF3;CELF4 CUGBP, Elav-like family member 3;CUGBP, Elav-like family member 4 1563 199 B20140410_SF109_01 B20140410_SF109_01 TB497393.[MT7]-TLPGMNRPIQVK[MT7]PADSESR.4y7_1.heavy 596.829 / 761.342 14619.0 26.864749908447266 22 3 10 5 4 0.5740056951825059 91.85334698373785 0.046298980712890625 8 0.5793583855339773 1.8316839109546323 14619.0 23.75269904143925 0.0 - - - - - - - 253.0 29 6 CELF3;CELF4 CUGBP, Elav-like family member 3;CUGBP, Elav-like family member 4 1565 200 B20140410_SF109_01 B20140410_SF109_01 TB497265.[MT7]-K[MT7]ITQLYFLK[MT7].3y3_1.heavy 529.34 / 551.367 219968.0 33.33440017700195 45 15 10 10 10 2.265107502836226 44.14801499477895 0.0 3 0.9518212421049312 5.599836071600244 219968.0 49.705729145283996 0.0 - - - - - - - 1272.0 439 6 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1567 200 B20140410_SF109_01 B20140410_SF109_01 TB497265.[MT7]-K[MT7]ITQLYFLK[MT7].3b4_1.heavy 529.34 / 759.497 65067.0 33.33440017700195 45 15 10 10 10 2.265107502836226 44.14801499477895 0.0 3 0.9518212421049312 5.599836071600244 65067.0 82.06949548009615 0.0 - - - - - - - 335.0 130 6 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1569 200 B20140410_SF109_01 B20140410_SF109_01 TB497265.[MT7]-K[MT7]ITQLYFLK[MT7].3b5_1.heavy 529.34 / 872.581 34006.0 33.33440017700195 45 15 10 10 10 2.265107502836226 44.14801499477895 0.0 3 0.9518212421049312 5.599836071600244 34006.0 105.13311134908417 0.0 - - - - - - - 684.3333333333334 68 9 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1571 200 B20140410_SF109_01 B20140410_SF109_01 TB497265.[MT7]-K[MT7]ITQLYFLK[MT7].3y4_1.heavy 529.34 / 714.431 122904.0 33.33440017700195 45 15 10 10 10 2.265107502836226 44.14801499477895 0.0 3 0.9518212421049312 5.599836071600244 122904.0 100.91770954356846 0.0 - - - - - - - 402.0 245 1 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 1573 201 B20140410_SF109_01 B20140410_SF109_01 TB497121.[MT7]-LFLEEFER.2y4_1.heavy 613.831 / 580.273 45778.0 38.132999420166016 50 20 10 10 10 7.941433517863051 12.592184997213055 0.0 3 0.9980030917704233 27.612836372545523 45778.0 51.9545683494229 0.0 - - - - - - - 1252.888888888889 91 9 PLD6 phospholipase D family, member 6 1575 201 B20140410_SF109_01 B20140410_SF109_01 TB497121.[MT7]-LFLEEFER.2y5_1.heavy 613.831 / 709.315 60545.0 38.132999420166016 50 20 10 10 10 7.941433517863051 12.592184997213055 0.0 3 0.9980030917704233 27.612836372545523 60545.0 79.28467963177468 0.0 - - - - - - - 1687.5714285714287 121 7 PLD6 phospholipase D family, member 6 1577 201 B20140410_SF109_01 B20140410_SF109_01 TB497121.[MT7]-LFLEEFER.2y6_1.heavy 613.831 / 822.399 77729.0 38.132999420166016 50 20 10 10 10 7.941433517863051 12.592184997213055 0.0 3 0.9980030917704233 27.612836372545523 77729.0 130.27206703910613 0.0 - - - - - - - 686.0 155 9 PLD6 phospholipase D family, member 6 1579 201 B20140410_SF109_01 B20140410_SF109_01 TB497121.[MT7]-LFLEEFER.2y7_1.heavy 613.831 / 969.468 188885.0 38.132999420166016 50 20 10 10 10 7.941433517863051 12.592184997213055 0.0 3 0.9980030917704233 27.612836372545523 188885.0 245.73771465070666 0.0 - - - - - - - 313.0 377 3 PLD6 phospholipase D family, member 6 1581 202 B20140410_SF109_01 B20140410_SF109_01 TB238563.[MT7]-RALIVLAHSER.4b4_1.heavy 352.968 / 598.416 47446.0 26.25790023803711 38 8 10 10 10 0.9356595042470304 72.73832822822175 0.0 3 0.7581568220809304 2.457121735021344 47446.0 142.89931084772695 0.0 - - - - - - - 276.75 94 12 NQO1 NAD(P)H dehydrogenase, quinone 1 1583 202 B20140410_SF109_01 B20140410_SF109_01 TB238563.[MT7]-RALIVLAHSER.4b5_1.heavy 352.968 / 697.484 13971.0 26.25790023803711 38 8 10 10 10 0.9356595042470304 72.73832822822175 0.0 3 0.7581568220809304 2.457121735021344 13971.0 88.264440433213 0.0 - - - - - - - 261.22222222222223 27 9 NQO1 NAD(P)H dehydrogenase, quinone 1 1585 202 B20140410_SF109_01 B20140410_SF109_01 TB238563.[MT7]-RALIVLAHSER.4y3_1.heavy 352.968 / 391.194 180517.0 26.25790023803711 38 8 10 10 10 0.9356595042470304 72.73832822822175 0.0 3 0.7581568220809304 2.457121735021344 180517.0 88.54493690892579 0.0 - - - - - - - 332.0 361 5 NQO1 NAD(P)H dehydrogenase, quinone 1 1587 202 B20140410_SF109_01 B20140410_SF109_01 TB238563.[MT7]-RALIVLAHSER.4b3_1.heavy 352.968 / 485.332 19781.0 26.25790023803711 38 8 10 10 10 0.9356595042470304 72.73832822822175 0.0 3 0.7581568220809304 2.457121735021344 19781.0 41.23027710843374 0.0 - - - - - - - 249.0 39 10 NQO1 NAD(P)H dehydrogenase, quinone 1 1589 203 B20140410_SF109_01 B20140410_SF109_01 TB376356.[MT7]-ALTEFYC[CAM]QVIQFNK[MT7].3b6_1.heavy 683.695 / 869.453 21709.0 38.60929870605469 47 17 10 10 10 2.1505874431653553 37.07787336501008 0.0 3 0.973049649143873 7.500667899377416 21709.0 57.24037697709058 0.0 - - - - - - - 735.8571428571429 43 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1591 203 B20140410_SF109_01 B20140410_SF109_01 TB376356.[MT7]-ALTEFYC[CAM]QVIQFNK[MT7].3y3_1.heavy 683.695 / 552.326 38390.0 38.60929870605469 47 17 10 10 10 2.1505874431653553 37.07787336501008 0.0 3 0.973049649143873 7.500667899377416 38390.0 35.05173913043478 0.0 - - - - - - - 827.875 76 8 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1593 203 B20140410_SF109_01 B20140410_SF109_01 TB376356.[MT7]-ALTEFYC[CAM]QVIQFNK[MT7].3b4_1.heavy 683.695 / 559.321 26248.0 38.60929870605469 47 17 10 10 10 2.1505874431653553 37.07787336501008 0.0 3 0.973049649143873 7.500667899377416 26248.0 32.88217190584885 0.0 - - - - - - - 1272.625 52 8 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1595 203 B20140410_SF109_01 B20140410_SF109_01 TB376356.[MT7]-ALTEFYC[CAM]QVIQFNK[MT7].3b5_1.heavy 683.695 / 706.389 43542.0 38.60929870605469 47 17 10 10 10 2.1505874431653553 37.07787336501008 0.0 3 0.973049649143873 7.500667899377416 43542.0 73.30414840402861 0.0 - - - - - - - 806.0 87 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1597 204 B20140410_SF109_01 B20140410_SF109_01 TB375879.[MT7]-VTSNLGK[MT7].2y6_1.heavy 503.81 / 763.443 16763.0 22.979400634765625 46 20 10 10 6 8.161569461700674 12.252545355309934 0.0 6 0.9982636106245516 29.612559598860138 16763.0 16.598990930747977 2.0 - - - - - - - 307.5833333333333 38 12 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1599 204 B20140410_SF109_01 B20140410_SF109_01 TB375879.[MT7]-VTSNLGK[MT7].2y4_1.heavy 503.81 / 575.363 N/A 22.979400634765625 46 20 10 10 6 8.161569461700674 12.252545355309934 0.0 6 0.9982636106245516 29.612559598860138 6186.0 7.026403182304459 1.0 - - - - - - - 399.0 13 2 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1601 204 B20140410_SF109_01 B20140410_SF109_01 TB375879.[MT7]-VTSNLGK[MT7].2y5_1.heavy 503.81 / 662.395 7084.0 22.979400634765625 46 20 10 10 6 8.161569461700674 12.252545355309934 0.0 6 0.9982636106245516 29.612559598860138 7084.0 21.65750448264951 2.0 - - - - - - - 785.75 14 8 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1603 204 B20140410_SF109_01 B20140410_SF109_01 TB375879.[MT7]-VTSNLGK[MT7].2b4_1.heavy 503.81 / 546.3 4390.0 22.979400634765625 46 20 10 10 6 8.161569461700674 12.252545355309934 0.0 6 0.9982636106245516 29.612559598860138 4390.0 1.649686847599165 1.0 - - - - - - - 760.75 14 8 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1605 205 B20140410_SF109_01 B20140410_SF109_01 TB375876.[MT7]-C[CAM]VQVLSR.2b3_1.heavy 503.285 / 532.267 28612.0 25.239099502563477 48 18 10 10 10 3.9219327901018324 25.497632252235384 0.0 3 0.9811506063134511 8.974889808402084 28612.0 25.935101682406113 0.0 - - - - - - - 409.0 57 1 APOA5 apolipoprotein A-V 1607 205 B20140410_SF109_01 B20140410_SF109_01 TB375876.[MT7]-C[CAM]VQVLSR.2y5_1.heavy 503.285 / 602.362 27113.0 25.239099502563477 48 18 10 10 10 3.9219327901018324 25.497632252235384 0.0 3 0.9811506063134511 8.974889808402084 27113.0 17.049300156546533 0.0 - - - - - - - 1226.0 54 7 APOA5 apolipoprotein A-V 1609 205 B20140410_SF109_01 B20140410_SF109_01 TB375876.[MT7]-C[CAM]VQVLSR.2b4_1.heavy 503.285 / 631.335 28339.0 25.239099502563477 48 18 10 10 10 3.9219327901018324 25.497632252235384 0.0 3 0.9811506063134511 8.974889808402084 28339.0 24.729665698849097 0.0 - - - - - - - 739.5714285714286 56 7 APOA5 apolipoprotein A-V 1611 205 B20140410_SF109_01 B20140410_SF109_01 TB375876.[MT7]-C[CAM]VQVLSR.2y6_1.heavy 503.285 / 701.43 53408.0 25.239099502563477 48 18 10 10 10 3.9219327901018324 25.497632252235384 0.0 3 0.9811506063134511 8.974889808402084 53408.0 105.8748898678414 0.0 - - - - - - - 681.1 106 10 APOA5 apolipoprotein A-V 1613 206 B20140410_SF109_01 B20140410_SF109_01 TB497126.[MT7]-ILSVLQNFR.2y8_1.heavy 617.375 / 976.557 40614.0 39.74729919433594 39 17 4 10 8 2.824432436663025 35.405343283108145 0.0 4 0.9746082555495346 7.728457704723256 40614.0 100.48824742268042 0.0 - - - - - - - 287.75 81 8 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1615 206 B20140410_SF109_01 B20140410_SF109_01 TB497126.[MT7]-ILSVLQNFR.2y5_1.heavy 617.375 / 677.373 20489.0 39.74729919433594 39 17 4 10 8 2.824432436663025 35.405343283108145 0.0 4 0.9746082555495346 7.728457704723256 20489.0 35.50159886933545 1.0 - - - - - - - 1316.2857142857142 140 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1617 206 B20140410_SF109_01 B20140410_SF109_01 TB497126.[MT7]-ILSVLQNFR.2y6_1.heavy 617.375 / 776.441 7517.0 39.74729919433594 39 17 4 10 8 2.824432436663025 35.405343283108145 0.0 4 0.9746082555495346 7.728457704723256 7517.0 6.32072169528279 1.0 - - - - - - - 329.0 15 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1619 206 B20140410_SF109_01 B20140410_SF109_01 TB497126.[MT7]-ILSVLQNFR.2y7_1.heavy 617.375 / 863.473 26066.0 39.74729919433594 39 17 4 10 8 2.824432436663025 35.405343283108145 0.0 4 0.9746082555495346 7.728457704723256 26066.0 106.74364015522431 0.0 - - - - - - - 333.3333333333333 52 12 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 1621 207 B20140410_SF109_01 B20140410_SF109_01 TB376153.[MT7]-DFIYSLHSTER.3b4_1.heavy 504.592 / 683.352 49406.0 30.34280014038086 46 18 10 10 8 5.189821368624888 15.650439799558356 0.0 4 0.9874400280873505 11.000499985024062 49406.0 60.020556206134515 1.0 - - - - - - - 389.0 148 1 TMEM65 transmembrane protein 65 1623 207 B20140410_SF109_01 B20140410_SF109_01 TB376153.[MT7]-DFIYSLHSTER.3b5_1.heavy 504.592 / 770.384 36698.0 30.34280014038086 46 18 10 10 8 5.189821368624888 15.650439799558356 0.0 4 0.9874400280873505 11.000499985024062 36698.0 42.1185745825285 0.0 - - - - - - - 259.2857142857143 73 7 TMEM65 transmembrane protein 65 1625 207 B20140410_SF109_01 B20140410_SF109_01 TB376153.[MT7]-DFIYSLHSTER.3b3_1.heavy 504.592 / 520.289 115541.0 30.34280014038086 46 18 10 10 8 5.189821368624888 15.650439799558356 0.0 4 0.9874400280873505 11.000499985024062 115541.0 49.305413881748066 0.0 - - - - - - - 1783.0 231 4 TMEM65 transmembrane protein 65 1627 207 B20140410_SF109_01 B20140410_SF109_01 TB376153.[MT7]-DFIYSLHSTER.3y5_1.heavy 504.592 / 629.3 119172.0 30.34280014038086 46 18 10 10 8 5.189821368624888 15.650439799558356 0.0 4 0.9874400280873505 11.000499985024062 119172.0 69.13300704576204 0.0 - - - - - - - 519.0 238 1 TMEM65 transmembrane protein 65 1629 208 B20140410_SF109_01 B20140410_SF109_01 TB376368.[MT7]-MVSISNYPLSAALTC[CAM]AK[MT7].3y3_1.heavy 705.379 / 522.283 13988.0 36.36389923095703 44 14 10 10 10 1.8318638712881856 37.18563386717108 0.0 3 0.9338904075670257 4.773182124549903 13988.0 16.911427247776725 1.0 - - - - - - - 762.1111111111111 27 9 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1631 208 B20140410_SF109_01 B20140410_SF109_01 TB376368.[MT7]-MVSISNYPLSAALTC[CAM]AK[MT7].3b6_1.heavy 705.379 / 776.409 14125.0 36.36389923095703 44 14 10 10 10 1.8318638712881856 37.18563386717108 0.0 3 0.9338904075670257 4.773182124549903 14125.0 18.89521097340102 0.0 - - - - - - - 342.5 28 4 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1633 208 B20140410_SF109_01 B20140410_SF109_01 TB376368.[MT7]-MVSISNYPLSAALTC[CAM]AK[MT7].3y4_1.heavy 705.379 / 623.33 18377.0 36.36389923095703 44 14 10 10 10 1.8318638712881856 37.18563386717108 0.0 3 0.9338904075670257 4.773182124549903 18377.0 5.595165558363717 1.0 - - - - - - - 720.25 38 4 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1635 208 B20140410_SF109_01 B20140410_SF109_01 TB376368.[MT7]-MVSISNYPLSAALTC[CAM]AK[MT7].3b7_1.heavy 705.379 / 939.473 14537.0 36.36389923095703 44 14 10 10 10 1.8318638712881856 37.18563386717108 0.0 3 0.9338904075670257 4.773182124549903 14537.0 21.27096191009519 0.0 - - - - - - - 308.25 29 4 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1637 209 B20140410_SF109_01 B20140410_SF109_01 TB376151.[MT7]-EDSIFVPGTQK[MT7].2y5_1.heavy 754.914 / 674.395 69030.0 29.925650596618652 43 17 10 6 10 1.7597200745066095 42.71133966188212 0.03890037536621094 3 0.9784676013176073 8.395252937733787 69030.0 49.65338744042548 0.0 - - - - - - - 778.6 138 5 ADAT1 adenosine deaminase, tRNA-specific 1 1639 209 B20140410_SF109_01 B20140410_SF109_01 TB376151.[MT7]-EDSIFVPGTQK[MT7].2b4_1.heavy 754.914 / 589.295 15441.0 29.925650596618652 43 17 10 6 10 1.7597200745066095 42.71133966188212 0.03890037536621094 3 0.9784676013176073 8.395252937733787 15441.0 22.31686040589748 0.0 - - - - - - - 246.9 30 10 ADAT1 adenosine deaminase, tRNA-specific 1 1641 209 B20140410_SF109_01 B20140410_SF109_01 TB376151.[MT7]-EDSIFVPGTQK[MT7].2y6_1.heavy 754.914 / 773.464 10251.0 29.925650596618652 43 17 10 6 10 1.7597200745066095 42.71133966188212 0.03890037536621094 3 0.9784676013176073 8.395252937733787 10251.0 26.6666261363347 0.0 - - - - - - - 616.375 20 8 ADAT1 adenosine deaminase, tRNA-specific 1 1643 209 B20140410_SF109_01 B20140410_SF109_01 TB376151.[MT7]-EDSIFVPGTQK[MT7].2b5_1.heavy 754.914 / 736.363 26730.0 29.925650596618652 43 17 10 6 10 1.7597200745066095 42.71133966188212 0.03890037536621094 3 0.9784676013176073 8.395252937733787 26730.0 16.9335596886738 0.0 - - - - - - - 1265.25 53 8 ADAT1 adenosine deaminase, tRNA-specific 1 1645 210 B20140410_SF109_01 B20140410_SF109_01 TB497111.[MT7]-C[CAM]QDLFLVR.2b3_1.heavy 597.825 / 548.226 42767.0 33.50669860839844 47 17 10 10 10 5.994445925102484 16.68210894709011 0.0 3 0.9779167299415725 8.289497449279544 42767.0 24.8145810965282 0.0 - - - - - - - 1255.0 85 3 TMEM155 transmembrane protein 155 1647 210 B20140410_SF109_01 B20140410_SF109_01 TB497111.[MT7]-C[CAM]QDLFLVR.2y5_1.heavy 597.825 / 647.424 39001.0 33.50669860839844 47 17 10 10 10 5.994445925102484 16.68210894709011 0.0 3 0.9779167299415725 8.289497449279544 39001.0 38.90130198718876 0.0 - - - - - - - 914.2 78 5 TMEM155 transmembrane protein 155 1649 210 B20140410_SF109_01 B20140410_SF109_01 TB497111.[MT7]-C[CAM]QDLFLVR.2b4_1.heavy 597.825 / 661.31 12238.0 33.50669860839844 47 17 10 10 10 5.994445925102484 16.68210894709011 0.0 3 0.9779167299415725 8.289497449279544 12238.0 12.201640565001412 0.0 - - - - - - - 1227.125 24 8 TMEM155 transmembrane protein 155 1651 210 B20140410_SF109_01 B20140410_SF109_01 TB497111.[MT7]-C[CAM]QDLFLVR.2b5_1.heavy 597.825 / 808.378 16542.0 33.50669860839844 47 17 10 10 10 5.994445925102484 16.68210894709011 0.0 3 0.9779167299415725 8.289497449279544 16542.0 31.168155868295273 0.0 - - - - - - - 660.1818181818181 33 11 TMEM155 transmembrane protein 155 1653 211 B20140410_SF109_01 B20140410_SF109_01 TB497210.[MT7]-RALIVLAHSER.3b4_1.heavy 470.288 / 598.416 57920.0 26.25790023803711 45 17 10 10 8 4.366865711656243 18.249231129270417 0.0 4 0.9744815890453911 7.709170711640982 57920.0 59.48151362777001 0.0 - - - - - - - 872.125 115 8 NQO1 NAD(P)H dehydrogenase, quinone 1 1655 211 B20140410_SF109_01 B20140410_SF109_01 TB497210.[MT7]-RALIVLAHSER.3b5_1.heavy 470.288 / 697.484 62944.0 26.25790023803711 45 17 10 10 8 4.366865711656243 18.249231129270417 0.0 4 0.9744815890453911 7.709170711640982 62944.0 65.8620370430735 0.0 - - - - - - - 319.2857142857143 125 7 NQO1 NAD(P)H dehydrogenase, quinone 1 1657 211 B20140410_SF109_01 B20140410_SF109_01 TB497210.[MT7]-RALIVLAHSER.3y4_1.heavy 470.288 / 528.253 84298.0 26.25790023803711 45 17 10 10 8 4.366865711656243 18.249231129270417 0.0 4 0.9744815890453911 7.709170711640982 84298.0 57.58769319194757 2.0 - - - - - - - 419.0 195 1 NQO1 NAD(P)H dehydrogenase, quinone 1 1659 211 B20140410_SF109_01 B20140410_SF109_01 TB497210.[MT7]-RALIVLAHSER.3y5_1.heavy 470.288 / 599.29 99930.0 26.25790023803711 45 17 10 10 8 4.366865711656243 18.249231129270417 0.0 4 0.9744815890453911 7.709170711640982 99930.0 67.31587899557917 0.0 - - - - - - - 784.875 199 8 NQO1 NAD(P)H dehydrogenase, quinone 1 1661 212 B20140410_SF109_01 B20140410_SF109_01 TB376014.[MT7]-FVYK[MT7]EEHPFEK[MT7].3b6_1.heavy 629.012 / 1084.59 3406.0 27.249799728393555 50 20 10 10 10 4.9178571985199655 20.334059319594537 0.0 3 0.9909365276910116 12.953481203091457 3406.0 16.642091722997264 0.0 - - - - - - - 217.7 6 10 GABARAP GABA(A) receptor-associated protein 1663 212 B20140410_SF109_01 B20140410_SF109_01 TB376014.[MT7]-FVYK[MT7]EEHPFEK[MT7].3y3_1.heavy 629.012 / 567.326 11717.0 27.249799728393555 50 20 10 10 10 4.9178571985199655 20.334059319594537 0.0 3 0.9909365276910116 12.953481203091457 11717.0 18.430472480748456 0.0 - - - - - - - 775.5384615384615 23 13 GABARAP GABA(A) receptor-associated protein 1665 212 B20140410_SF109_01 B20140410_SF109_01 TB376014.[MT7]-FVYK[MT7]EEHPFEK[MT7].3b5_1.heavy 629.012 / 955.549 1771.0 27.249799728393555 50 20 10 10 10 4.9178571985199655 20.334059319594537 0.0 3 0.9909365276910116 12.953481203091457 1771.0 1.9224927465933692 2.0 - - - - - - - 622.7142857142857 5 7 GABARAP GABA(A) receptor-associated protein 1667 212 B20140410_SF109_01 B20140410_SF109_01 TB376014.[MT7]-FVYK[MT7]EEHPFEK[MT7].3y4_1.heavy 629.012 / 664.379 41419.0 27.249799728393555 50 20 10 10 10 4.9178571985199655 20.334059319594537 0.0 3 0.9909365276910116 12.953481203091457 41419.0 57.44401670226634 0.0 - - - - - - - 694.6 82 10 GABARAP GABA(A) receptor-associated protein 1669 213 B20140410_SF109_01 B20140410_SF109_01 TB376460.[MT7]-RAAGGGGPGGPGGSGDFLLIYLANLEAK[MT7].3b16_2.heavy 968.525 / 676.825 27776.0 41.553001403808594 42 12 10 10 10 2.9140717966669123 27.03152185686484 0.0 3 0.8999555784676183 3.868805529774651 27776.0 110.24177383592018 0.0 - - - - - - - 256.61538461538464 55 13 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1671 213 B20140410_SF109_01 B20140410_SF109_01 TB376460.[MT7]-RAAGGGGPGGPGGSGDFLLIYLANLEAK[MT7].3b10_1.heavy 968.525 / 882.466 3878.0 41.553001403808594 42 12 10 10 10 2.9140717966669123 27.03152185686484 0.0 3 0.8999555784676183 3.868805529774651 3878.0 11.721325172013223 0.0 - - - - - - - 653.75 7 8 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1673 213 B20140410_SF109_01 B20140410_SF109_01 TB376460.[MT7]-RAAGGGGPGGPGGSGDFLLIYLANLEAK[MT7].3b17_2.heavy 968.525 / 750.359 30661.0 41.553001403808594 42 12 10 10 10 2.9140717966669123 27.03152185686484 0.0 3 0.8999555784676183 3.868805529774651 30661.0 39.058204621760765 0.0 - - - - - - - 687.625 61 8 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1675 213 B20140410_SF109_01 B20140410_SF109_01 TB376460.[MT7]-RAAGGGGPGGPGGSGDFLLIYLANLEAK[MT7].3y8_1.heavy 968.525 / 1065.61 15691.0 41.553001403808594 42 12 10 10 10 2.9140717966669123 27.03152185686484 0.0 3 0.8999555784676183 3.868805529774651 15691.0 98.9037743659985 0.0 - - - - - - - 201.15384615384616 31 13 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1677 214 B20140410_SF109_01 B20140410_SF109_01 TB376461.[MT7]-ATC[CAM]LMLAWPGDRSPLGLC[CAM]PVAAGLAGR.4y9_1.heavy 739.388 / 811.479 50670.0 39.247100830078125 47 17 10 10 10 2.4400582034957425 32.68650606937746 0.0 3 0.9700700104248225 7.1157370534767725 50670.0 102.4433958283096 0.0 - - - - - - - 310.75 101 4 LOC100507338 hypothetical protein LOC100507338 1679 214 B20140410_SF109_01 B20140410_SF109_01 TB376461.[MT7]-ATC[CAM]LMLAWPGDRSPLGLC[CAM]PVAAGLAGR.4b4_1.heavy 739.388 / 590.309 30085.0 39.247100830078125 47 17 10 10 10 2.4400582034957425 32.68650606937746 0.0 3 0.9700700104248225 7.1157370534767725 30085.0 57.21191971832987 0.0 - - - - - - - 749.625 60 8 LOC100507338 hypothetical protein LOC100507338 1681 214 B20140410_SF109_01 B20140410_SF109_01 TB376461.[MT7]-ATC[CAM]LMLAWPGDRSPLGLC[CAM]PVAAGLAGR.4b5_1.heavy 739.388 / 721.349 30198.0 39.247100830078125 47 17 10 10 10 2.4400582034957425 32.68650606937746 0.0 3 0.9700700104248225 7.1157370534767725 30198.0 14.64515281636777 0.0 - - - - - - - 905.0 60 1 LOC100507338 hypothetical protein LOC100507338 1683 214 B20140410_SF109_01 B20140410_SF109_01 TB376461.[MT7]-ATC[CAM]LMLAWPGDRSPLGLC[CAM]PVAAGLAGR.4y7_1.heavy 739.388 / 615.357 41282.0 39.247100830078125 47 17 10 10 10 2.4400582034957425 32.68650606937746 0.0 3 0.9700700104248225 7.1157370534767725 41282.0 46.57921527416647 0.0 - - - - - - - 1244.0 82 9 LOC100507338 hypothetical protein LOC100507338 1685 215 B20140410_SF109_01 B20140410_SF109_01 TB376269.[MT7]-EIEEHVFTLYSK[MT7].3y6_1.heavy 594.989 / 902.51 52146.0 32.22869873046875 43 13 10 10 10 1.7310100823666668 37.48856249909114 0.0 3 0.9282043896716697 4.578046082038434 52146.0 106.11470068300522 0.0 - - - - - - - 684.1111111111111 104 9 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1687 215 B20140410_SF109_01 B20140410_SF109_01 TB376269.[MT7]-EIEEHVFTLYSK[MT7].3y3_1.heavy 594.989 / 541.31 104686.0 32.22869873046875 43 13 10 10 10 1.7310100823666668 37.48856249909114 0.0 3 0.9282043896716697 4.578046082038434 104686.0 72.52917751284402 0.0 - - - - - - - 1342.75 209 4 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1689 215 B20140410_SF109_01 B20140410_SF109_01 TB376269.[MT7]-EIEEHVFTLYSK[MT7].3b4_1.heavy 594.989 / 645.321 102327.0 32.22869873046875 43 13 10 10 10 1.7310100823666668 37.48856249909114 0.0 3 0.9282043896716697 4.578046082038434 102327.0 53.1525037703891 0.0 - - - - - - - 131.0 204 1 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1691 215 B20140410_SF109_01 B20140410_SF109_01 TB376269.[MT7]-EIEEHVFTLYSK[MT7].3b3_1.heavy 594.989 / 516.279 28300.0 32.22869873046875 43 13 10 10 10 1.7310100823666668 37.48856249909114 0.0 3 0.9282043896716697 4.578046082038434 28300.0 14.700087530192537 0.0 - - - - - - - 131.0 56 1 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1693 216 B20140410_SF109_01 B20140410_SF109_01 TB497011.[MT7]-RLLLQR.2b3_1.heavy 471.82 / 527.379 5666.0 25.855499267578125 41 11 10 10 10 0.8475332068351866 62.07136981788068 0.0 3 0.871222420836617 3.4014768073635375 5666.0 3.905364213690654 2.0 - - - - - - - 1717.5714285714287 11 7 CBX7 chromobox homolog 7 1695 216 B20140410_SF109_01 B20140410_SF109_01 TB497011.[MT7]-RLLLQR.2y5_1.heavy 471.82 / 642.43 25290.0 25.855499267578125 41 11 10 10 10 0.8475332068351866 62.07136981788068 0.0 3 0.871222420836617 3.4014768073635375 25290.0 28.28070816185975 0.0 - - - - - - - 345.75 50 4 CBX7 chromobox homolog 7 1697 216 B20140410_SF109_01 B20140410_SF109_01 TB497011.[MT7]-RLLLQR.2b4_1.heavy 471.82 / 640.463 8845.0 25.855499267578125 41 11 10 10 10 0.8475332068351866 62.07136981788068 0.0 3 0.871222420836617 3.4014768073635375 8845.0 20.43985421732808 0.0 - - - - - - - 716.0909090909091 17 11 CBX7 chromobox homolog 7 1699 216 B20140410_SF109_01 B20140410_SF109_01 TB497011.[MT7]-RLLLQR.2b5_1.heavy 471.82 / 768.521 31094.0 25.855499267578125 41 11 10 10 10 0.8475332068351866 62.07136981788068 0.0 3 0.871222420836617 3.4014768073635375 31094.0 41.70533395742602 0.0 - - - - - - - 725.5 62 8 CBX7 chromobox homolog 7 1701 217 B20140410_SF109_01 B20140410_SF109_01 TB497324.[MT7]-VLTQLVATYPQGFVR.3y6_1.heavy 612.688 / 703.389 192164.0 37.402198791503906 47 17 10 10 10 4.015323426473696 24.904594070974046 0.0 3 0.9789379200267216 8.488804237990275 192164.0 144.96105610561057 0.0 - - - - - - - 673.0 384 1 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1703 217 B20140410_SF109_01 B20140410_SF109_01 TB497324.[MT7]-VLTQLVATYPQGFVR.3b4_1.heavy 612.688 / 586.368 114598.0 37.402198791503906 47 17 10 10 10 4.015323426473696 24.904594070974046 0.0 3 0.9789379200267216 8.488804237990275 114598.0 78.54191507041259 0.0 - - - - - - - 808.0 229 2 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1705 217 B20140410_SF109_01 B20140410_SF109_01 TB497324.[MT7]-VLTQLVATYPQGFVR.3b5_1.heavy 612.688 / 699.452 111232.0 37.402198791503906 47 17 10 10 10 4.015323426473696 24.904594070974046 0.0 3 0.9789379200267216 8.488804237990275 111232.0 116.03460120305903 0.0 - - - - - - - 336.5 222 2 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1707 217 B20140410_SF109_01 B20140410_SF109_01 TB497324.[MT7]-VLTQLVATYPQGFVR.3y9_1.heavy 612.688 / 1038.54 33800.0 37.402198791503906 47 17 10 10 10 4.015323426473696 24.904594070974046 0.0 3 0.9789379200267216 8.488804237990275 33800.0 170.34705612664814 0.0 - - - - - - - 195.9090909090909 67 11 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1709 218 B20140410_SF109_01 B20140410_SF109_01 TB497325.[MT7]-VLTQLVATYPQGFVR.2b4_1.heavy 918.529 / 586.368 20411.0 37.402198791503906 43 13 10 10 10 1.982375944149643 33.89837587882635 0.0 3 0.9247321845922299 4.469874116406132 20411.0 58.38249030779397 0.0 - - - - - - - 313.6666666666667 40 6 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1711 218 B20140410_SF109_01 B20140410_SF109_01 TB497325.[MT7]-VLTQLVATYPQGFVR.2y9_1.heavy 918.529 / 1038.54 24037.0 37.402198791503906 43 13 10 10 10 1.982375944149643 33.89837587882635 0.0 3 0.9247321845922299 4.469874116406132 24037.0 63.107825128599586 0.0 - - - - - - - 238.77777777777777 48 9 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1713 218 B20140410_SF109_01 B20140410_SF109_01 TB497325.[MT7]-VLTQLVATYPQGFVR.2y10_1.heavy 918.529 / 1137.61 11951.0 37.402198791503906 43 13 10 10 10 1.982375944149643 33.89837587882635 0.0 3 0.9247321845922299 4.469874116406132 11951.0 87.73512556442824 0.0 - - - - - - - 232.0 23 11 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1715 218 B20140410_SF109_01 B20140410_SF109_01 TB497325.[MT7]-VLTQLVATYPQGFVR.2b5_1.heavy 918.529 / 699.452 27126.0 37.402198791503906 43 13 10 10 10 1.982375944149643 33.89837587882635 0.0 3 0.9247321845922299 4.469874116406132 27126.0 69.19034614691489 0.0 - - - - - - - 690.5714285714286 54 7 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1717 219 B20140410_SF109_01 B20140410_SF109_01 TB497013.[MT7]-VVHHTGR.2y6_1.heavy 475.276 / 706.374 3394.0 16.031600952148438 44 18 10 10 6 4.648223472009151 21.51359559242016 0.0 5 0.9860255697271733 10.42769360759246 3394.0 62.269483294483294 0.0 - - - - - - - 79.29411764705883 6 17 APOA5 apolipoprotein A-V 1719 219 B20140410_SF109_01 B20140410_SF109_01 TB497013.[MT7]-VVHHTGR.2b3_1.heavy 475.276 / 480.305 380.0 16.031600952148438 44 18 10 10 6 4.648223472009151 21.51359559242016 0.0 5 0.9860255697271733 10.42769360759246 380.0 6.440677966101695 5.0 - - - - - - - 0.0 0 0 APOA5 apolipoprotein A-V 1721 219 B20140410_SF109_01 B20140410_SF109_01 TB497013.[MT7]-VVHHTGR.2y4_1.heavy 475.276 / 470.247 N/A 16.031600952148438 44 18 10 10 6 4.648223472009151 21.51359559242016 0.0 5 0.9860255697271733 10.42769360759246 1492.0 9.044804523739886 7.0 - - - - - - - 198.875 6 24 APOA5 apolipoprotein A-V 1723 219 B20140410_SF109_01 B20140410_SF109_01 TB497013.[MT7]-VVHHTGR.2y5_1.heavy 475.276 / 607.306 3277.0 16.031600952148438 44 18 10 10 6 4.648223472009151 21.51359559242016 0.0 5 0.9860255697271733 10.42769360759246 3277.0 20.086556768052006 0.0 - - - - - - - 64.92857142857143 6 14 APOA5 apolipoprotein A-V 1725 220 B20140410_SF109_01 B20140410_SF109_01 TB376019.[MT7]-ADLWQNFAR.2y8_1.heavy 632.831 / 1049.52 50493.0 34.73979949951172 45 15 10 10 10 3.7800412412296907 21.111879472851626 0.0 3 0.9563681684580356 5.886657574058464 50493.0 58.1868908470434 1.0 - - - - - - - 679.0 106 7 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1727 220 B20140410_SF109_01 B20140410_SF109_01 TB376019.[MT7]-ADLWQNFAR.2y5_1.heavy 632.831 / 635.326 50074.0 34.73979949951172 45 15 10 10 10 3.7800412412296907 21.111879472851626 0.0 3 0.9563681684580356 5.886657574058464 50074.0 66.53719627261275 0.0 - - - - - - - 1217.0 100 10 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1729 220 B20140410_SF109_01 B20140410_SF109_01 TB376019.[MT7]-ADLWQNFAR.2y6_1.heavy 632.831 / 821.405 75810.0 34.73979949951172 45 15 10 10 10 3.7800412412296907 21.111879472851626 0.0 3 0.9563681684580356 5.886657574058464 75810.0 87.62229832137888 0.0 - - - - - - - 233.33333333333334 151 3 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1731 220 B20140410_SF109_01 B20140410_SF109_01 TB376019.[MT7]-ADLWQNFAR.2y7_1.heavy 632.831 / 934.489 66019.0 34.73979949951172 45 15 10 10 10 3.7800412412296907 21.111879472851626 0.0 3 0.9563681684580356 5.886657574058464 66019.0 128.70144762296667 0.0 - - - - - - - 308.0 132 5 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1733 221 B20140410_SF109_01 B20140410_SF109_01 TB376469.[MT7]-LQSTEFSPSGSETGSPGLQIYPYEMLVVTNK[MT7].4y4_1.heavy 912.715 / 605.374 12443.0 39.34000015258789 42 12 10 10 10 2.177296801923652 38.32540195672195 0.0 3 0.880996535938739 3.541428821499399 12443.0 31.019207943834605 0.0 - - - - - - - 722.2 24 10 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1735 221 B20140410_SF109_01 B20140410_SF109_01 TB376469.[MT7]-LQSTEFSPSGSETGSPGLQIYPYEMLVVTNK[MT7].4b7_1.heavy 912.715 / 937.475 9554.0 39.34000015258789 42 12 10 10 10 2.177296801923652 38.32540195672195 0.0 3 0.880996535938739 3.541428821499399 9554.0 27.215292353823088 0.0 - - - - - - - 624.875 19 8 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1737 221 B20140410_SF109_01 B20140410_SF109_01 TB376469.[MT7]-LQSTEFSPSGSETGSPGLQIYPYEMLVVTNK[MT7].4b5_1.heavy 912.715 / 703.374 8555.0 39.34000015258789 42 12 10 10 10 2.177296801923652 38.32540195672195 0.0 3 0.880996535938739 3.541428821499399 8555.0 24.60535361466213 0.0 - - - - - - - 360.75 17 8 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1739 221 B20140410_SF109_01 B20140410_SF109_01 TB376469.[MT7]-LQSTEFSPSGSETGSPGLQIYPYEMLVVTNK[MT7].4y3_1.heavy 912.715 / 506.306 16220.0 39.34000015258789 42 12 10 10 10 2.177296801923652 38.32540195672195 0.0 3 0.880996535938739 3.541428821499399 16220.0 25.137137659752472 0.0 - - - - - - - 682.5714285714286 32 7 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1741 222 B20140410_SF109_01 B20140410_SF109_01 TB376468.[MT7]-QQLK[MT7]PYTMDLMEQVALRVQELQEQLR.4y17_2.heavy 869.722 / 1042.07 8056.0 43.48870086669922 46 16 10 10 10 2.5195300278216495 33.04171144820743 0.0 3 0.961754507754204 6.29040029386364 8056.0 35.82234666666666 0.0 - - - - - - - 633.7142857142857 16 7 APOA5 apolipoprotein A-V 1743 222 B20140410_SF109_01 B20140410_SF109_01 TB376468.[MT7]-QQLK[MT7]PYTMDLMEQVALRVQELQEQLR.4b3_1.heavy 869.722 / 514.311 4621.0 43.48870086669922 46 16 10 10 10 2.5195300278216495 33.04171144820743 0.0 3 0.961754507754204 6.29040029386364 4621.0 9.458307826805848 0.0 - - - - - - - 672.2941176470588 9 17 APOA5 apolipoprotein A-V 1745 222 B20140410_SF109_01 B20140410_SF109_01 TB376468.[MT7]-QQLK[MT7]PYTMDLMEQVALRVQELQEQLR.4b9_2.heavy 869.722 / 697.373 27354.0 43.48870086669922 46 16 10 10 10 2.5195300278216495 33.04171144820743 0.0 3 0.961754507754204 6.29040029386364 27354.0 52.5710911596109 0.0 - - - - - - - 666.25 54 12 APOA5 apolipoprotein A-V 1747 222 B20140410_SF109_01 B20140410_SF109_01 TB376468.[MT7]-QQLK[MT7]PYTMDLMEQVALRVQELQEQLR.4y14_2.heavy 869.722 / 855.487 9368.0 43.48870086669922 46 16 10 10 10 2.5195300278216495 33.04171144820743 0.0 3 0.961754507754204 6.29040029386364 9368.0 18.10552097642357 0.0 - - - - - - - 726.7272727272727 18 11 APOA5 apolipoprotein A-V 1749 223 B20140410_SF109_01 B20140410_SF109_01 TB497116.[MT7]-HLSAEDFSR.2y4_1.heavy 603.305 / 524.246 1936.0 25.018400192260742 39 18 10 5 6 5.1864973280999775 19.280835152118748 0.049999237060546875 5 0.9877017054008617 11.117159244172862 1936.0 1.9378486512294102 6.0 - - - - - - - 677.625 4 8 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1751 223 B20140410_SF109_01 B20140410_SF109_01 TB497116.[MT7]-HLSAEDFSR.2y8_1.heavy 603.305 / 924.442 8003.0 25.018400192260742 39 18 10 5 6 5.1864973280999775 19.280835152118748 0.049999237060546875 5 0.9877017054008617 11.117159244172862 8003.0 57.07565891472868 0.0 - - - - - - - 258.0 16 8 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1753 223 B20140410_SF109_01 B20140410_SF109_01 TB497116.[MT7]-HLSAEDFSR.2y5_1.heavy 603.305 / 653.289 1420.0 25.018400192260742 39 18 10 5 6 5.1864973280999775 19.280835152118748 0.049999237060546875 5 0.9877017054008617 11.117159244172862 1420.0 2.2928082020505123 4.0 - - - - - - - 241.875 2 8 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1755 223 B20140410_SF109_01 B20140410_SF109_01 TB497116.[MT7]-HLSAEDFSR.2y7_1.heavy 603.305 / 811.358 6584.0 25.018400192260742 39 18 10 5 6 5.1864973280999775 19.280835152118748 0.049999237060546875 5 0.9877017054008617 11.117159244172862 6584.0 15.111627906976747 1.0 - - - - - - - 243.66666666666666 13 9 EPB49 erythrocyte membrane protein band 4.9 (dematin) 1757 224 B20140410_SF109_01 B20140410_SF109_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 681811.0 38.30739974975586 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 681811.0 482.0626804632094 0.0 - - - - - - - 918.0 1363 2 1759 224 B20140410_SF109_01 B20140410_SF109_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 1211670.0 38.30739974975586 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1211670.0 325.7843392983243 0.0 - - - - - - - 1049.0 2423 1 1761 224 B20140410_SF109_01 B20140410_SF109_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 1183640.0 38.30739974975586 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1183640.0 329.1608782964608 0.0 - - - - - - - 1180.0 2367 2 1763 225 B20140410_SF109_01 B20140410_SF109_01 TB497008.[MT7]-IAPGSAK[MT7].2y4_1.heavy 466.294 / 506.306 17664.0 21.228900909423828 46 16 10 10 10 2.390430188361681 41.833474362427026 0.0 3 0.9686388077364204 6.950635355760842 17664.0 40.69647058823529 1.0 - - - - - - - 764.7647058823529 35 17 ADAT1 adenosine deaminase, tRNA-specific 1 1765 225 B20140410_SF109_01 B20140410_SF109_01 TB497008.[MT7]-IAPGSAK[MT7].2y5_1.heavy 466.294 / 603.358 159203.0 21.228900909423828 46 16 10 10 10 2.390430188361681 41.833474362427026 0.0 3 0.9686388077364204 6.950635355760842 159203.0 154.67987860449753 0.0 - - - - - - - 280.3333333333333 318 6 ADAT1 adenosine deaminase, tRNA-specific 1 1767 225 B20140410_SF109_01 B20140410_SF109_01 TB497008.[MT7]-IAPGSAK[MT7].2y3_1.heavy 466.294 / 449.284 9405.0 21.228900909423828 46 16 10 10 10 2.390430188361681 41.833474362427026 0.0 3 0.9686388077364204 6.950635355760842 9405.0 7.174694856146469 2.0 - - - - - - - 2719.8571428571427 42 7 ADAT1 adenosine deaminase, tRNA-specific 1 1769 225 B20140410_SF109_01 B20140410_SF109_01 TB497008.[MT7]-IAPGSAK[MT7].2y6_1.heavy 466.294 / 674.395 111870.0 21.228900909423828 46 16 10 10 10 2.390430188361681 41.833474362427026 0.0 3 0.9686388077364204 6.950635355760842 111870.0 76.26399299268064 0.0 - - - - - - - 369.6666666666667 223 6 ADAT1 adenosine deaminase, tRNA-specific 1 1771 226 B20140410_SF109_01 B20140410_SF109_01 TB238544.[MT7]-GK[MT7]VEYLVK[MT7].2b3_1.heavy 684.435 / 573.396 N/A 26.480199813842773 43 15 10 10 8 1.772686567228825 38.914555186475184 0.0 4 0.9585107980939117 6.037841823890146 1922.0 4.269794020902966 1.0 - - - - - - - 709.25 3 12 CBX7 chromobox homolog 7 1773 226 B20140410_SF109_01 B20140410_SF109_01 TB238544.[MT7]-GK[MT7]VEYLVK[MT7].2b5_1.heavy 684.435 / 865.502 2608.0 26.480199813842773 43 15 10 10 8 1.772686567228825 38.914555186475184 0.0 4 0.9585107980939117 6.037841823890146 2608.0 20.896050537491703 1.0 - - - - - - - 205.9 7 10 CBX7 chromobox homolog 7 1775 226 B20140410_SF109_01 B20140410_SF109_01 TB238544.[MT7]-GK[MT7]VEYLVK[MT7].2b4_1.heavy 684.435 / 702.439 3432.0 26.480199813842773 43 15 10 10 8 1.772686567228825 38.914555186475184 0.0 4 0.9585107980939117 6.037841823890146 3432.0 8.748877924558332 0.0 - - - - - - - 291.875 6 8 CBX7 chromobox homolog 7 1777 226 B20140410_SF109_01 B20140410_SF109_01 TB238544.[MT7]-GK[MT7]VEYLVK[MT7].2b6_1.heavy 684.435 / 978.586 4118.0 26.480199813842773 43 15 10 10 8 1.772686567228825 38.914555186475184 0.0 4 0.9585107980939117 6.037841823890146 4118.0 23.809527272727273 0.0 - - - - - - - 240.375 8 8 CBX7 chromobox homolog 7 1779 227 B20140410_SF109_01 B20140410_SF109_01 TB238547.[MT7]-EHLQETDVVR.2b3_1.heavy 685.363 / 524.295 6131.0 23.3533992767334 46 16 10 10 10 2.794239826791327 28.160283436086765 0.0 3 0.9679898265947744 6.879438781415375 6131.0 18.710366882872954 0.0 - - - - - - - 189.46666666666667 12 15 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1781 227 B20140410_SF109_01 B20140410_SF109_01 TB238547.[MT7]-EHLQETDVVR.2y8_1.heavy 685.363 / 959.516 8649.0 23.3533992767334 46 16 10 10 10 2.794239826791327 28.160283436086765 0.0 3 0.9679898265947744 6.879438781415375 8649.0 99.87056931004147 0.0 - - - - - - - 164.0 17 6 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1783 227 B20140410_SF109_01 B20140410_SF109_01 TB238547.[MT7]-EHLQETDVVR.2b7_1.heavy 685.363 / 997.471 4708.0 23.3533992767334 46 16 10 10 10 2.794239826791327 28.160283436086765 0.0 3 0.9679898265947744 6.879438781415375 4708.0 56.048098026894564 0.0 - - - - - - - 205.125 9 8 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1785 227 B20140410_SF109_01 B20140410_SF109_01 TB238547.[MT7]-EHLQETDVVR.2y7_1.heavy 685.363 / 846.432 11824.0 23.3533992767334 46 16 10 10 10 2.794239826791327 28.160283436086765 0.0 3 0.9679898265947744 6.879438781415375 11824.0 59.62040316293574 0.0 - - - - - - - 249.85714285714286 23 7 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1787 228 B20140410_SF109_01 B20140410_SF109_01 TB497208.[MT7]-ASLIEQLMSK[MT7].2b4_1.heavy 704.41 / 529.347 14872.0 38.698699951171875 43 13 10 10 10 0.9853818713046132 58.92807252575555 0.0 3 0.906944910525771 4.01389080583963 14872.0 15.628382712793686 0.0 - - - - - - - 1196.5 29 8 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1789 228 B20140410_SF109_01 B20140410_SF109_01 TB497208.[MT7]-ASLIEQLMSK[MT7].2b6_1.heavy 704.41 / 786.448 7889.0 38.698699951171875 43 13 10 10 10 0.9853818713046132 58.92807252575555 0.0 3 0.906944910525771 4.01389080583963 7889.0 7.2858032646048105 1.0 - - - - - - - 1256.4285714285713 25 7 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1791 228 B20140410_SF109_01 B20140410_SF109_01 TB497208.[MT7]-ASLIEQLMSK[MT7].2y3_1.heavy 704.41 / 509.287 8535.0 38.698699951171875 43 13 10 10 10 0.9853818713046132 58.92807252575555 0.0 3 0.906944910525771 4.01389080583963 8535.0 15.696853786468257 1.0 - - - - - - - 301.8333333333333 17 6 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1793 228 B20140410_SF109_01 B20140410_SF109_01 TB497208.[MT7]-ASLIEQLMSK[MT7].2y6_1.heavy 704.41 / 879.473 18752.0 38.698699951171875 43 13 10 10 10 0.9853818713046132 58.92807252575555 0.0 3 0.906944910525771 4.01389080583963 18752.0 15.392540277326333 0.0 - - - - - - - 718.4444444444445 37 9 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1795 229 B20140410_SF109_01 B20140410_SF109_01 TB375906.[MT7]-HVQELHR.3y3_1.heavy 354.869 / 425.262 83655.0 18.707399368286133 47 17 10 10 10 10.243939546993456 9.761869400073675 0.0 3 0.9770405364749847 8.129185824287354 83655.0 71.12974722542256 0.0 - - - - - - - 387.3333333333333 167 3 APOA5 apolipoprotein A-V 1797 229 B20140410_SF109_01 B20140410_SF109_01 TB375906.[MT7]-HVQELHR.3b4_1.heavy 354.869 / 638.338 29454.0 18.707399368286133 47 17 10 10 10 10.243939546993456 9.761869400073675 0.0 3 0.9770405364749847 8.129185824287354 29454.0 170.0513099433124 0.0 - - - - - - - 189.94444444444446 58 18 APOA5 apolipoprotein A-V 1799 229 B20140410_SF109_01 B20140410_SF109_01 TB375906.[MT7]-HVQELHR.3b3_1.heavy 354.869 / 509.295 29576.0 18.707399368286133 47 17 10 10 10 10.243939546993456 9.761869400073675 0.0 3 0.9770405364749847 8.129185824287354 29576.0 140.46176754806783 0.0 - - - - - - - 267.3125 59 16 APOA5 apolipoprotein A-V 1801 229 B20140410_SF109_01 B20140410_SF109_01 TB375906.[MT7]-HVQELHR.3y4_1.heavy 354.869 / 554.305 79683.0 18.707399368286133 47 17 10 10 10 10.243939546993456 9.761869400073675 0.0 3 0.9770405364749847 8.129185824287354 79683.0 225.13264889061892 0.0 - - - - - - - 282.625 159 16 APOA5 apolipoprotein A-V 1803 230 B20140410_SF109_01 B20140410_SF109_01 TB497337.[MT7]-K[MT7]LEAADLVIFQSK[MT7].4y4_1.heavy 474.29 / 653.374 237498.0 33.91709899902344 32 2 10 10 10 0.29574421610386076 137.38838448876933 0.0 3 0.4981169424585355 1.6632153816063604 237498.0 373.0731301484718 0.0 - - - - - - - 352.6 474 5 NQO1 NAD(P)H dehydrogenase, quinone 1 1805 230 B20140410_SF109_01 B20140410_SF109_01 TB497337.[MT7]-K[MT7]LEAADLVIFQSK[MT7].4b7_1.heavy 474.29 / 1029.62 N/A 33.91709899902344 32 2 10 10 10 0.29574421610386076 137.38838448876933 0.0 3 0.4981169424585355 1.6632153816063604 136.0 1.2 18.0 - - - - - - - 0.0 0 0 NQO1 NAD(P)H dehydrogenase, quinone 1 1807 230 B20140410_SF109_01 B20140410_SF109_01 TB497337.[MT7]-K[MT7]LEAADLVIFQSK[MT7].4b7_2.heavy 474.29 / 515.313 757746.0 33.91709899902344 32 2 10 10 10 0.29574421610386076 137.38838448876933 0.0 3 0.4981169424585355 1.6632153816063604 757746.0 389.1906806728306 0.0 - - - - - - - 2259.3333333333335 1515 6 NQO1 NAD(P)H dehydrogenase, quinone 1 1809 230 B20140410_SF109_01 B20140410_SF109_01 TB497337.[MT7]-K[MT7]LEAADLVIFQSK[MT7].4b6_1.heavy 474.29 / 916.534 116038.0 33.91709899902344 32 2 10 10 10 0.29574421610386076 137.38838448876933 0.0 3 0.4981169424585355 1.6632153816063604 116038.0 676.1843362920116 0.0 - - - - - - - 271.375 232 8 NQO1 NAD(P)H dehydrogenase, quinone 1 1811 231 B20140410_SF109_01 B20140410_SF109_01 TB497209.[MT7]-ASLIEQLMSK[MT7].3b6_1.heavy 469.942 / 786.448 93137.0 38.698699951171875 50 20 10 10 10 8.5903046636186 11.641030663733847 0.0 3 0.9961147722795876 19.793081780501435 93137.0 738.3296367521367 0.0 - - - - - - - 207.6 186 5 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1813 231 B20140410_SF109_01 B20140410_SF109_01 TB497209.[MT7]-ASLIEQLMSK[MT7].3y3_1.heavy 469.942 / 509.287 237830.0 38.698699951171875 50 20 10 10 10 8.5903046636186 11.641030663733847 0.0 3 0.9961147722795876 19.793081780501435 237830.0 727.2142849074 0.0 - - - - - - - 233.4 475 5 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1815 231 B20140410_SF109_01 B20140410_SF109_01 TB497209.[MT7]-ASLIEQLMSK[MT7].3b4_1.heavy 469.942 / 529.347 180704.0 38.698699951171875 50 20 10 10 10 8.5903046636186 11.641030663733847 0.0 3 0.9961147722795876 19.793081780501435 180704.0 350.3478665737614 0.0 - - - - - - - 345.6666666666667 361 3 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1817 231 B20140410_SF109_01 B20140410_SF109_01 TB497209.[MT7]-ASLIEQLMSK[MT7].3b5_1.heavy 469.942 / 658.389 115029.0 38.698699951171875 50 20 10 10 10 8.5903046636186 11.641030663733847 0.0 3 0.9961147722795876 19.793081780501435 115029.0 230.1145008577461 0.0 - - - - - - - 280.6666666666667 230 6 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1819 232 B20140410_SF109_01 B20140410_SF109_01 TB375992.[MT7]-EFMWALK[MT7].2b3_1.heavy 606.838 / 552.261 11419.0 36.98139953613281 38 20 0 10 8 10.899279757123246 9.174918180684811 0.0 4 0.9948730288525315 17.228450011635125 11419.0 10.17747131446815 0.0 - - - - - - - 344.0 22 2 MTPN myotrophin 1821 232 B20140410_SF109_01 B20140410_SF109_01 TB375992.[MT7]-EFMWALK[MT7].2y4_1.heavy 606.838 / 661.415 15271.0 36.98139953613281 38 20 0 10 8 10.899279757123246 9.174918180684811 0.0 4 0.9948730288525315 17.228450011635125 15271.0 18.95778827793246 1.0 - - - - - - - 413.0 104 2 MTPN myotrophin 1823 232 B20140410_SF109_01 B20140410_SF109_01 TB375992.[MT7]-EFMWALK[MT7].2y5_1.heavy 606.838 / 792.456 7979.0 36.98139953613281 38 20 0 10 8 10.899279757123246 9.174918180684811 0.0 4 0.9948730288525315 17.228450011635125 7979.0 13.053909366224328 0.0 - - - - - - - 703.0 15 9 MTPN myotrophin 1825 232 B20140410_SF109_01 B20140410_SF109_01 TB375992.[MT7]-EFMWALK[MT7].2b5_1.heavy 606.838 / 809.377 7704.0 36.98139953613281 38 20 0 10 8 10.899279757123246 9.174918180684811 0.0 4 0.9948730288525315 17.228450011635125 7704.0 8.140237499448217 0.0 - - - - - - - 292.5 15 8 MTPN myotrophin 1827 233 B20140410_SF109_01 B20140410_SF109_01 TB375909.[MT7]-DIVFYK[MT7].2y4_1.heavy 536.818 / 700.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1829 233 B20140410_SF109_01 B20140410_SF109_01 TB375909.[MT7]-DIVFYK[MT7].2y5_1.heavy 536.818 / 813.499 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1831 233 B20140410_SF109_01 B20140410_SF109_01 TB375909.[MT7]-DIVFYK[MT7].2y3_2.heavy 536.818 / 301.177 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1833 233 B20140410_SF109_01 B20140410_SF109_01 TB375909.[MT7]-DIVFYK[MT7].2y3_1.heavy 536.818 / 601.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1835 234 B20140410_SF109_01 B20140410_SF109_01 TB376277.[MT7]-YLLHQLQLAATLK[MT7].3b4_1.heavy 600.704 / 671.4 46015.0 36.4099006652832 39 9 10 10 10 0.600941804938356 85.02405310133301 0.0 3 0.8028056889459951 2.732155888519645 46015.0 40.3041525978137 0.0 - - - - - - - 792.1428571428571 92 7 ADAT1 adenosine deaminase, tRNA-specific 1 1837 234 B20140410_SF109_01 B20140410_SF109_01 TB376277.[MT7]-YLLHQLQLAATLK[MT7].3y4_1.heavy 600.704 / 576.384 119750.0 36.4099006652832 39 9 10 10 10 0.600941804938356 85.02405310133301 0.0 3 0.8028056889459951 2.732155888519645 119750.0 125.94792398650112 0.0 - - - - - - - 277.0 239 2 ADAT1 adenosine deaminase, tRNA-specific 1 1839 234 B20140410_SF109_01 B20140410_SF109_01 TB376277.[MT7]-YLLHQLQLAATLK[MT7].3b3_1.heavy 600.704 / 534.341 60429.0 36.4099006652832 39 9 10 10 10 0.600941804938356 85.02405310133301 0.0 3 0.8028056889459951 2.732155888519645 60429.0 62.49271284271284 0.0 - - - - - - - 139.0 120 1 ADAT1 adenosine deaminase, tRNA-specific 1 1841 234 B20140410_SF109_01 B20140410_SF109_01 TB376277.[MT7]-YLLHQLQLAATLK[MT7].3y5_1.heavy 600.704 / 647.421 116978.0 36.4099006652832 39 9 10 10 10 0.600941804938356 85.02405310133301 0.0 3 0.8028056889459951 2.732155888519645 116978.0 160.47772069594527 0.0 - - - - - - - 346.5 233 2 ADAT1 adenosine deaminase, tRNA-specific 1 1843 235 B20140410_SF109_01 B20140410_SF109_01 TB376271.[MT7]-EITDQEHNVVALK[MT7].4b4_1.heavy 446.75 / 603.311 34928.0 27.29450035095215 35 5 10 10 10 0.7817999444253115 85.05952526755749 0.0 3 0.6861580268003996 2.142554778599042 34928.0 17.218884156222078 1.0 - - - - - - - 1237.875 74 8 LOC100132288 hypothetical protein LOC100132288 1845 235 B20140410_SF109_01 B20140410_SF109_01 TB376271.[MT7]-EITDQEHNVVALK[MT7].4b5_1.heavy 446.75 / 731.369 14587.0 27.29450035095215 35 5 10 10 10 0.7817999444253115 85.05952526755749 0.0 3 0.6861580268003996 2.142554778599042 14587.0 11.670750110875673 0.0 - - - - - - - 736.0 29 8 LOC100132288 hypothetical protein LOC100132288 1847 235 B20140410_SF109_01 B20140410_SF109_01 TB376271.[MT7]-EITDQEHNVVALK[MT7].4y3_1.heavy 446.75 / 475.336 249448.0 27.29450035095215 35 5 10 10 10 0.7817999444253115 85.05952526755749 0.0 3 0.6861580268003996 2.142554778599042 249448.0 109.67547625578868 0.0 - - - - - - - 535.0 498 1 LOC100132288 hypothetical protein LOC100132288 1849 235 B20140410_SF109_01 B20140410_SF109_01 TB376271.[MT7]-EITDQEHNVVALK[MT7].4b6_1.heavy 446.75 / 860.412 35999.0 27.29450035095215 35 5 10 10 10 0.7817999444253115 85.05952526755749 0.0 3 0.6861580268003996 2.142554778599042 35999.0 139.14825436408975 0.0 - - - - - - - 256.5833333333333 71 12 LOC100132288 hypothetical protein LOC100132288 1851 236 B20140410_SF109_01 B20140410_SF109_01 TB376274.[MT7]-NVLIEVNPQTRIPR.3y11_2.heavy 598.355 / 661.881 145118.0 30.55340003967285 47 17 10 10 10 3.4897612083807776 24.476875079367833 0.0 3 0.9741107282389517 7.653516263858717 145118.0 101.11409249710583 0.0 - - - - - - - 129.0 290 2 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1853 236 B20140410_SF109_01 B20140410_SF109_01 TB376274.[MT7]-NVLIEVNPQTRIPR.3b5_1.heavy 598.355 / 713.431 58538.0 30.55340003967285 47 17 10 10 10 3.4897612083807776 24.476875079367833 0.0 3 0.9741107282389517 7.653516263858717 58538.0 64.84894052396587 0.0 - - - - - - - 1163.0 117 7 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1855 236 B20140410_SF109_01 B20140410_SF109_01 TB376274.[MT7]-NVLIEVNPQTRIPR.3y12_2.heavy 598.355 / 718.423 160495.0 30.55340003967285 47 17 10 10 10 3.4897612083807776 24.476875079367833 0.0 3 0.9741107282389517 7.653516263858717 160495.0 163.4372517935713 0.0 - - - - - - - 711.0 320 2 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1857 236 B20140410_SF109_01 B20140410_SF109_01 TB376274.[MT7]-NVLIEVNPQTRIPR.3y13_2.heavy 598.355 / 767.957 114492.0 30.55340003967285 47 17 10 10 10 3.4897612083807776 24.476875079367833 0.0 3 0.9741107282389517 7.653516263858717 114492.0 174.5233819718611 0.0 - - - - - - - 258.0 228 2 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1859 237 B20140410_SF109_01 B20140410_SF109_01 TB376007.[MT7]-VSVEYTEK[MT7].2y4_1.heavy 621.845 / 684.369 13680.0 25.19029998779297 46 16 10 10 10 5.3731282923012715 18.611132018433665 0.0 3 0.9695487975571425 7.054266717487754 13680.0 42.98512801121071 0.0 - - - - - - - 301.5 27 8 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1861 237 B20140410_SF109_01 B20140410_SF109_01 TB376007.[MT7]-VSVEYTEK[MT7].2y5_1.heavy 621.845 / 813.411 10864.0 25.19029998779297 46 16 10 10 10 5.3731282923012715 18.611132018433665 0.0 3 0.9695487975571425 7.054266717487754 10864.0 26.316521739130437 0.0 - - - - - - - 282.8888888888889 21 9 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1863 237 B20140410_SF109_01 B20140410_SF109_01 TB376007.[MT7]-VSVEYTEK[MT7].2y3_1.heavy 621.845 / 521.305 7779.0 25.19029998779297 46 16 10 10 10 5.3731282923012715 18.611132018433665 0.0 3 0.9695487975571425 7.054266717487754 7779.0 15.658436969979647 0.0 - - - - - - - 201.0 15 4 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1865 237 B20140410_SF109_01 B20140410_SF109_01 TB376007.[MT7]-VSVEYTEK[MT7].2y7_1.heavy 621.845 / 999.511 19045.0 25.19029998779297 46 16 10 10 10 5.3731282923012715 18.611132018433665 0.0 3 0.9695487975571425 7.054266717487754 19045.0 165.57779850746266 0.0 - - - - - - - 268.0 38 10 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 1867 238 B20140410_SF109_01 B20140410_SF109_01 TB496996.[MT7]-SAVQAK[MT7].2b3_1.heavy 446.279 / 402.247 N/A 18.458099365234375 32 14 0 10 8 1.3740132616894216 48.51966755014903 0.0 4 0.9303171727264726 4.647771103915215 19690.0 4.59134022593185 2.0 - - - - - - - 2404.0 293 1 ADAT1 adenosine deaminase, tRNA-specific 1 1869 238 B20140410_SF109_01 B20140410_SF109_01 TB496996.[MT7]-SAVQAK[MT7].2y4_1.heavy 446.279 / 589.379 8299.0 18.458099365234375 32 14 0 10 8 1.3740132616894216 48.51966755014903 0.0 4 0.9303171727264726 4.647771103915215 8299.0 23.399368777931883 1.0 - - - - - - - 636.875 31 8 ADAT1 adenosine deaminase, tRNA-specific 1 1871 238 B20140410_SF109_01 B20140410_SF109_01 TB496996.[MT7]-SAVQAK[MT7].2y5_1.heavy 446.279 / 660.416 13623.0 18.458099365234375 32 14 0 10 8 1.3740132616894216 48.51966755014903 0.0 4 0.9303171727264726 4.647771103915215 13623.0 67.83003481234923 0.0 - - - - - - - 662.2857142857143 27 7 ADAT1 adenosine deaminase, tRNA-specific 1 1873 238 B20140410_SF109_01 B20140410_SF109_01 TB496996.[MT7]-SAVQAK[MT7].2b4_1.heavy 446.279 / 530.305 8357.0 18.458099365234375 32 14 0 10 8 1.3740132616894216 48.51966755014903 0.0 4 0.9303171727264726 4.647771103915215 8357.0 6.838526244403046 0.0 - - - - - - - 623.2222222222222 16 9 ADAT1 adenosine deaminase, tRNA-specific 1 1875 239 B20140410_SF109_01 B20140410_SF109_01 TB238298.[MT7]-QWEEAR.2y4_1.heavy 481.744 / 504.241 25889.0 23.3533992767334 44 14 10 10 10 2.415597733051056 41.397621231285704 0.0 3 0.9389058419605453 4.967367203515474 25889.0 50.9175494772388 0.0 - - - - - - - 629.0 51 8 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1877 239 B20140410_SF109_01 B20140410_SF109_01 TB238298.[MT7]-QWEEAR.2b3_1.heavy 481.744 / 588.29 50835.0 23.3533992767334 44 14 10 10 10 2.415597733051056 41.397621231285704 0.0 3 0.9389058419605453 4.967367203515474 50835.0 15.639216336357531 0.0 - - - - - - - 2341.0 101 3 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1879 239 B20140410_SF109_01 B20140410_SF109_01 TB238298.[MT7]-QWEEAR.2y5_1.heavy 481.744 / 690.321 138985.0 23.3533992767334 44 14 10 10 10 2.415597733051056 41.397621231285704 0.0 3 0.9389058419605453 4.967367203515474 138985.0 87.23846038567909 0.0 - - - - - - - 419.0 277 1 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1881 239 B20140410_SF109_01 B20140410_SF109_01 TB238298.[MT7]-QWEEAR.2b4_1.heavy 481.744 / 717.332 118756.0 23.3533992767334 44 14 10 10 10 2.415597733051056 41.397621231285704 0.0 3 0.9389058419605453 4.967367203515474 118756.0 68.47662835111629 0.0 - - - - - - - 808.5714285714286 237 7 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 1883 240 B20140410_SF109_01 B20140410_SF109_01 TB497105.[MT7]-LVGLEAPSVR.2y8_1.heavy 592.86 / 828.457 216336.0 31.375900268554688 48 18 10 10 10 10.73877160237263 9.312052039351125 0.0 3 0.9899654149825095 12.309738513410183 216336.0 100.6912955887461 0.0 - - - - - - - 686.75 432 4 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1885 240 B20140410_SF109_01 B20140410_SF109_01 TB497105.[MT7]-LVGLEAPSVR.2y5_1.heavy 592.86 / 529.309 134146.0 31.375900268554688 48 18 10 10 10 10.73877160237263 9.312052039351125 0.0 3 0.9899654149825095 12.309738513410183 134146.0 29.505090644248774 0.0 - - - - - - - 1963.0 268 2 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1887 240 B20140410_SF109_01 B20140410_SF109_01 TB497105.[MT7]-LVGLEAPSVR.2y9_1.heavy 592.86 / 927.526 224057.0 31.375900268554688 48 18 10 10 10 10.73877160237263 9.312052039351125 0.0 3 0.9899654149825095 12.309738513410183 224057.0 113.80799258186973 0.0 - - - - - - - 262.0 448 1 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1889 240 B20140410_SF109_01 B20140410_SF109_01 TB497105.[MT7]-LVGLEAPSVR.2y6_1.heavy 592.86 / 658.352 112029.0 31.375900268554688 48 18 10 10 10 10.73877160237263 9.312052039351125 0.0 3 0.9899654149825095 12.309738513410183 112029.0 58.849999999999994 0.0 - - - - - - - 785.0 224 1 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1891 241 B20140410_SF109_01 B20140410_SF109_01 TB497109.[MT7]-LAIVLFTK[MT7].2y4_1.heavy 596.899 / 652.415 175739.0 38.35169982910156 46 16 10 10 10 5.155558148661066 19.396541968200026 0.0 3 0.9612522753053314 6.24923520392528 175739.0 317.9664566299441 0.0 - - - - - - - 755.0 351 10 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1893 241 B20140410_SF109_01 B20140410_SF109_01 TB497109.[MT7]-LAIVLFTK[MT7].2y5_1.heavy 596.899 / 751.483 151917.0 38.35169982910156 46 16 10 10 10 5.155558148661066 19.396541968200026 0.0 3 0.9612522753053314 6.24923520392528 151917.0 219.72315555632883 0.0 - - - - - - - 325.5 303 2 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1895 241 B20140410_SF109_01 B20140410_SF109_01 TB497109.[MT7]-LAIVLFTK[MT7].2b4_1.heavy 596.899 / 541.383 162982.0 38.35169982910156 46 16 10 10 10 5.155558148661066 19.396541968200026 0.0 3 0.9612522753053314 6.24923520392528 162982.0 146.2222794868091 0.0 - - - - - - - 260.2 325 5 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1897 241 B20140410_SF109_01 B20140410_SF109_01 TB497109.[MT7]-LAIVLFTK[MT7].2y3_1.heavy 596.899 / 539.331 146449.0 38.35169982910156 46 16 10 10 10 5.155558148661066 19.396541968200026 0.0 3 0.9612522753053314 6.24923520392528 146449.0 205.3646494432493 0.0 - - - - - - - 391.0 292 1 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1899 242 B20140410_SF109_01 B20140410_SF109_01 TB238408.[MT7]-SANIMHAK[MT7].3y3_1.heavy 387.221 / 499.311 52161.0 21.8855242729187 40 14 10 6 10 2.533590330783251 39.469680155072794 0.030500411987304688 3 0.9473640501784314 5.35546918844436 52161.0 17.956707095833544 0.0 - - - - - - - 3265.125 104 8 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1901 242 B20140410_SF109_01 B20140410_SF109_01 TB238408.[MT7]-SANIMHAK[MT7].3b4_1.heavy 387.221 / 530.305 67005.0 21.8855242729187 40 14 10 6 10 2.533590330783251 39.469680155072794 0.030500411987304688 3 0.9473640501784314 5.35546918844436 67005.0 139.81649617205449 0.0 - - - - - - - 808.25 134 8 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1903 242 B20140410_SF109_01 B20140410_SF109_01 TB238408.[MT7]-SANIMHAK[MT7].3b5_1.heavy 387.221 / 661.346 12024.0 21.8855242729187 40 14 10 6 10 2.533590330783251 39.469680155072794 0.030500411987304688 3 0.9473640501784314 5.35546918844436 12024.0 74.4618795180723 0.0 - - - - - - - 209.68421052631578 24 19 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1905 242 B20140410_SF109_01 B20140410_SF109_01 TB238408.[MT7]-SANIMHAK[MT7].3b3_1.heavy 387.221 / 417.221 74551.0 21.8855242729187 40 14 10 6 10 2.533590330783251 39.469680155072794 0.030500411987304688 3 0.9473640501784314 5.35546918844436 74551.0 54.1527239691594 0.0 - - - - - - - 815.1666666666666 149 6 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1907 243 B20140410_SF109_01 B20140410_SF109_01 TB238597.[MT7]-VDILINNAGVMR.2y8_1.heavy 729.915 / 874.456 13459.0 34.25859832763672 48 18 10 10 10 12.425357001008289 8.048058497786844 0.0 3 0.9857364268010648 10.321210392247462 13459.0 14.179946177268219 0.0 - - - - - - - 771.0 26 8 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1909 243 B20140410_SF109_01 B20140410_SF109_01 TB238597.[MT7]-VDILINNAGVMR.2y9_1.heavy 729.915 / 987.54 11917.0 34.25859832763672 48 18 10 10 10 12.425357001008289 8.048058497786844 0.0 3 0.9857364268010648 10.321210392247462 11917.0 25.915757575757574 0.0 - - - - - - - 771.0 23 8 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1911 243 B20140410_SF109_01 B20140410_SF109_01 TB238597.[MT7]-VDILINNAGVMR.2y10_1.heavy 729.915 / 1100.62 5187.0 34.25859832763672 48 18 10 10 10 12.425357001008289 8.048058497786844 0.0 3 0.9857364268010648 10.321210392247462 5187.0 17.253323510358584 0.0 - - - - - - - 280.3 10 10 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1913 243 B20140410_SF109_01 B20140410_SF109_01 TB238597.[MT7]-VDILINNAGVMR.2y7_1.heavy 729.915 / 761.372 11637.0 34.25859832763672 48 18 10 10 10 12.425357001008289 8.048058497786844 0.0 3 0.9857364268010648 10.321210392247462 11637.0 12.628730527396975 0.0 - - - - - - - 280.25 23 4 RDH13 retinol dehydrogenase 13 (all-trans/9-cis) 1915 244 B20140410_SF109_01 B20140410_SF109_01 TB376131.[MT7]-IWEQFNPTK[MT7].3y3_1.heavy 484.269 / 489.315 268076.0 33.167301177978516 48 18 10 10 10 2.572137333966595 30.363901426668708 0.0 3 0.9801087825558281 8.735930301037618 268076.0 202.40744732563934 0.0 - - - - - - - 808.0 536 1 PLD6 phospholipase D family, member 6 1917 244 B20140410_SF109_01 B20140410_SF109_01 TB376131.[MT7]-IWEQFNPTK[MT7].3b4_1.heavy 484.269 / 701.374 135924.0 33.167301177978516 48 18 10 10 10 2.572137333966595 30.363901426668708 0.0 3 0.9801087825558281 8.735930301037618 135924.0 386.018692759901 0.0 - - - - - - - 323.2 271 5 PLD6 phospholipase D family, member 6 1919 244 B20140410_SF109_01 B20140410_SF109_01 TB376131.[MT7]-IWEQFNPTK[MT7].3b5_1.heavy 484.269 / 848.442 17647.0 33.167301177978516 48 18 10 10 10 2.572137333966595 30.363901426668708 0.0 3 0.9801087825558281 8.735930301037618 17647.0 82.19602239684934 0.0 - - - - - - - 218.875 35 8 PLD6 phospholipase D family, member 6 1921 244 B20140410_SF109_01 B20140410_SF109_01 TB376131.[MT7]-IWEQFNPTK[MT7].3b3_1.heavy 484.269 / 573.315 96049.0 33.167301177978516 48 18 10 10 10 2.572137333966595 30.363901426668708 0.0 3 0.9801087825558281 8.735930301037618 96049.0 86.08017933502285 0.0 - - - - - - - 673.6 192 5 PLD6 phospholipase D family, member 6 1923 245 B20140410_SF109_01 B20140410_SF109_01 TB238415.[MT7]-GFGVQELK[MT7].3y3_1.heavy 389.232 / 533.341 143224.0 29.788000106811523 47 17 10 10 10 3.820651873017772 26.1735440243118 0.0 3 0.9770606727798721 8.132766733177458 143224.0 155.19150032545258 0.0 - - - - - - - 676.6666666666666 286 9 ADAT1 adenosine deaminase, tRNA-specific 1 1925 245 B20140410_SF109_01 B20140410_SF109_01 TB238415.[MT7]-GFGVQELK[MT7].3b4_1.heavy 389.232 / 505.289 246656.0 29.788000106811523 47 17 10 10 10 3.820651873017772 26.1735440243118 0.0 3 0.9770606727798721 8.132766733177458 246656.0 234.21654969785845 0.0 - - - - - - - 351.85714285714283 493 7 ADAT1 adenosine deaminase, tRNA-specific 1 1927 245 B20140410_SF109_01 B20140410_SF109_01 TB238415.[MT7]-GFGVQELK[MT7].3b5_1.heavy 389.232 / 633.348 53012.0 29.788000106811523 47 17 10 10 10 3.820651873017772 26.1735440243118 0.0 3 0.9770606727798721 8.132766733177458 53012.0 34.76191179471482 1.0 - - - - - - - 1240.7142857142858 106 7 ADAT1 adenosine deaminase, tRNA-specific 1 1929 245 B20140410_SF109_01 B20140410_SF109_01 TB238415.[MT7]-GFGVQELK[MT7].3b3_1.heavy 389.232 / 406.221 392212.0 29.788000106811523 47 17 10 10 10 3.820651873017772 26.1735440243118 0.0 3 0.9770606727798721 8.132766733177458 392212.0 272.02346121346824 0.0 - - - - - - - 259.0 784 1 ADAT1 adenosine deaminase, tRNA-specific 1 1931 246 B20140410_SF109_01 B20140410_SF109_01 TB497341.[MT7]-TLDFIDVLLLSEDK[MT7].3b6_1.heavy 637.031 / 849.447 114777.0 44.254398345947266 41 11 10 10 10 1.1377075892199089 57.648570438375266 0.0 3 0.8793253901974633 3.5163094693961416 114777.0 381.99220312499995 0.0 - - - - - - - 758.8571428571429 229 7 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1933 246 B20140410_SF109_01 B20140410_SF109_01 TB497341.[MT7]-TLDFIDVLLLSEDK[MT7].3b4_1.heavy 637.031 / 621.336 41010.0 44.254398345947266 41 11 10 10 10 1.1377075892199089 57.648570438375266 0.0 3 0.8793253901974633 3.5163094693961416 41010.0 75.57150297619047 0.0 - - - - - - - 277.3333333333333 82 9 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1935 246 B20140410_SF109_01 B20140410_SF109_01 TB497341.[MT7]-TLDFIDVLLLSEDK[MT7].3y4_1.heavy 637.031 / 622.316 144783.0 44.254398345947266 41 11 10 10 10 1.1377075892199089 57.648570438375266 0.0 3 0.8793253901974633 3.5163094693961416 144783.0 156.64643390132602 0.0 - - - - - - - 320.0 289 1 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1937 246 B20140410_SF109_01 B20140410_SF109_01 TB497341.[MT7]-TLDFIDVLLLSEDK[MT7].3b7_1.heavy 637.031 / 948.516 66921.0 44.254398345947266 41 11 10 10 10 1.1377075892199089 57.648570438375266 0.0 3 0.8793253901974633 3.5163094693961416 66921.0 151.86685267857143 0.0 - - - - - - - 243.2 133 10 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1939 247 B20140410_SF109_01 B20140410_SF109_01 TB497230.[MT7]-GC[CAM]TQDVVLPDSR.2b6_1.heavy 745.873 / 805.363 12618.0 26.526199340820312 46 16 10 10 10 2.6824420452666216 32.53533442954523 0.0 3 0.9634640533587091 6.436814007958794 12618.0 57.02365384615385 0.0 - - - - - - - 242.75 25 12 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1941 247 B20140410_SF109_01 B20140410_SF109_01 TB497230.[MT7]-GC[CAM]TQDVVLPDSR.2y6_1.heavy 745.873 / 686.383 7072.0 26.526199340820312 46 16 10 10 10 2.6824420452666216 32.53533442954523 0.0 3 0.9634640533587091 6.436814007958794 7072.0 13.724908703159379 0.0 - - - - - - - 318.8 14 10 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1943 247 B20140410_SF109_01 B20140410_SF109_01 TB497230.[MT7]-GC[CAM]TQDVVLPDSR.2b5_1.heavy 745.873 / 706.295 21492.0 26.526199340820312 46 16 10 10 10 2.6824420452666216 32.53533442954523 0.0 3 0.9634640533587091 6.436814007958794 21492.0 43.80810356729236 0.0 - - - - - - - 308.1111111111111 42 9 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1945 247 B20140410_SF109_01 B20140410_SF109_01 TB497230.[MT7]-GC[CAM]TQDVVLPDSR.2y7_1.heavy 745.873 / 785.452 13589.0 26.526199340820312 46 16 10 10 10 2.6824420452666216 32.53533442954523 0.0 3 0.9634640533587091 6.436814007958794 13589.0 57.80075418173976 0.0 - - - - - - - 217.85714285714286 27 7 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1947 248 B20140410_SF109_01 B20140410_SF109_01 TB497232.[MT7]-SQISK[MT7]VELFR.3y7_1.heavy 498.968 / 1022.61 N/A 30.101600646972656 37 11 10 10 6 1.9183903498842534 52.127034524560415 0.0 6 0.870113228512522 3.3865931605217816 260.0 2.74 6.0 - - - - - - - 0.0 0 0 ADAT1 adenosine deaminase, tRNA-specific 1 1949 248 B20140410_SF109_01 B20140410_SF109_01 TB497232.[MT7]-SQISK[MT7]VELFR.3y5_1.heavy 498.968 / 663.382 12595.0 30.101600646972656 37 11 10 10 6 1.9183903498842534 52.127034524560415 0.0 6 0.870113228512522 3.3865931605217816 12595.0 10.922622366482138 1.0 - - - - - - - 766.0 25 10 ADAT1 adenosine deaminase, tRNA-specific 1 1951 248 B20140410_SF109_01 B20140410_SF109_01 TB497232.[MT7]-SQISK[MT7]VELFR.3b7_2.heavy 498.968 / 530.816 41420.0 30.101600646972656 37 11 10 10 6 1.9183903498842534 52.127034524560415 0.0 6 0.870113228512522 3.3865931605217816 41420.0 74.4390243902439 0.0 - - - - - - - 312.0 82 5 ADAT1 adenosine deaminase, tRNA-specific 1 1953 248 B20140410_SF109_01 B20140410_SF109_01 TB497232.[MT7]-SQISK[MT7]VELFR.3y4_1.heavy 498.968 / 564.314 12205.0 30.101600646972656 37 11 10 10 6 1.9183903498842534 52.127034524560415 0.0 6 0.870113228512522 3.3865931605217816 12205.0 11.42862865322503 3.0 - - - - - - - 805.0 59 5 ADAT1 adenosine deaminase, tRNA-specific 1 1955 249 B20140410_SF109_01 B20140410_SF109_01 TB497340.[MT7]-TLDFIDVLLLSEDK[MT7].2y4_1.heavy 955.042 / 622.316 2565.0 44.21260070800781 46 16 10 10 10 3.1314328111500935 31.934263332724235 0.0 3 0.9606065000365844 6.197463499504347 2565.0 4.446130773845232 1.0 - - - - - - - 222.52941176470588 6 17 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1957 249 B20140410_SF109_01 B20140410_SF109_01 TB497340.[MT7]-TLDFIDVLLLSEDK[MT7].2y5_1.heavy 955.042 / 735.401 2501.0 44.21260070800781 46 16 10 10 10 3.1314328111500935 31.934263332724235 0.0 3 0.9606065000365844 6.197463499504347 2501.0 8.062149046793762 0.0 - - - - - - - 212.25 5 16 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1959 249 B20140410_SF109_01 B20140410_SF109_01 TB497340.[MT7]-TLDFIDVLLLSEDK[MT7].2b6_1.heavy 955.042 / 849.447 3334.0 44.21260070800781 46 16 10 10 10 3.1314328111500935 31.934263332724235 0.0 3 0.9606065000365844 6.197463499504347 3334.0 11.165042573733222 0.0 - - - - - - - 753.625 6 8 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1961 249 B20140410_SF109_01 B20140410_SF109_01 TB497340.[MT7]-TLDFIDVLLLSEDK[MT7].2y7_1.heavy 955.042 / 961.569 2180.0 44.21260070800781 46 16 10 10 10 3.1314328111500935 31.934263332724235 0.0 3 0.9606065000365844 6.197463499504347 2180.0 11.634864600462087 0.0 - - - - - - - 225.94736842105263 4 19 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1963 250 B20140410_SF109_01 B20140410_SF109_01 TB376440.[MT7]-K[MT7]QNWFLGHLGLVTPTEEGLR.4b7_2.heavy 646.613 / 581.834 19884.0 35.83369827270508 46 16 10 10 10 6.764578824993631 14.782886353622192 0.0 3 0.9682176149996025 6.90418028339901 19884.0 17.41749033707865 0.0 - - - - - - - 347.5 39 2 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1965 250 B20140410_SF109_01 B20140410_SF109_01 TB376440.[MT7]-K[MT7]QNWFLGHLGLVTPTEEGLR.4y7_1.heavy 646.613 / 801.41 44913.0 35.83369827270508 46 16 10 10 10 6.764578824993631 14.782886353622192 0.0 3 0.9682176149996025 6.90418028339901 44913.0 51.580695558605846 0.0 - - - - - - - 417.0 89 3 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1967 250 B20140410_SF109_01 B20140410_SF109_01 TB376440.[MT7]-K[MT7]QNWFLGHLGLVTPTEEGLR.4y6_1.heavy 646.613 / 704.357 15156.0 35.83369827270508 46 16 10 10 10 6.764578824993631 14.782886353622192 0.0 3 0.9682176149996025 6.90418028339901 15156.0 12.49679769894535 0.0 - - - - - - - 913.4285714285714 30 7 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1969 250 B20140410_SF109_01 B20140410_SF109_01 TB376440.[MT7]-K[MT7]QNWFLGHLGLVTPTEEGLR.4b3_1.heavy 646.613 / 659.408 2920.0 35.83369827270508 46 16 10 10 10 6.764578824993631 14.782886353622192 0.0 3 0.9682176149996025 6.90418028339901 2920.0 3.116428627009897 7.0 - - - - - - - 231.66666666666666 5 3 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1971 251 B20140410_SF109_01 B20140410_SF109_01 TB376441.[MT7]-TLK[MT7]PWLGDGLLLSVGDK[MT7]WR.4y5_1.heavy 647.384 / 805.444 49747.0 38.48030090332031 48 18 10 10 10 6.808804188493373 14.686866773022537 0.0 3 0.980278075981618 8.773469568455127 49747.0 66.84482439376566 0.0 - - - - - - - 292.6666666666667 99 3 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1973 251 B20140410_SF109_01 B20140410_SF109_01 TB376441.[MT7]-TLK[MT7]PWLGDGLLLSVGDK[MT7]WR.4y8_1.heavy 647.384 / 1104.63 19047.0 38.48030090332031 48 18 10 10 10 6.808804188493373 14.686866773022537 0.0 3 0.980278075981618 8.773469568455127 19047.0 200.89348972111554 0.0 - - - - - - - 213.1 38 10 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1975 251 B20140410_SF109_01 B20140410_SF109_01 TB376441.[MT7]-TLK[MT7]PWLGDGLLLSVGDK[MT7]WR.4y7_1.heavy 647.384 / 991.544 45111.0 38.48030090332031 48 18 10 10 10 6.808804188493373 14.686866773022537 0.0 3 0.980278075981618 8.773469568455127 45111.0 157.70080654552513 0.0 - - - - - - - 284.90909090909093 90 11 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1977 251 B20140410_SF109_01 B20140410_SF109_01 TB376441.[MT7]-TLK[MT7]PWLGDGLLLSVGDK[MT7]WR.4b3_1.heavy 647.384 / 631.438 28821.0 38.48030090332031 48 18 10 10 10 6.808804188493373 14.686866773022537 0.0 3 0.980278075981618 8.773469568455127 28821.0 22.125409139636655 0.0 - - - - - - - 1217.142857142857 57 7 CYP4F8 cytochrome P450, family 4, subfamily F, polypeptide 8 1979 252 B20140410_SF109_01 B20140410_SF109_01 TB497349.[MT7]-LDSANLWVLVDC[CAM]ILR.2y4_1.heavy 966.031 / 561.318 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100132288;LOC100509396 hypothetical protein LOC100132288;tektin-4 like protein LOC389833-like 1981 252 B20140410_SF109_01 B20140410_SF109_01 TB497349.[MT7]-LDSANLWVLVDC[CAM]ILR.2y9_1.heavy 966.031 / 1173.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100132288;LOC100509396 hypothetical protein LOC100132288;tektin-4 like protein LOC389833-like 1983 252 B20140410_SF109_01 B20140410_SF109_01 TB497349.[MT7]-LDSANLWVLVDC[CAM]ILR.2b6_1.heavy 966.031 / 758.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100132288;LOC100509396 hypothetical protein LOC100132288;tektin-4 like protein LOC389833-like 1985 252 B20140410_SF109_01 B20140410_SF109_01 TB497349.[MT7]-LDSANLWVLVDC[CAM]ILR.2b5_1.heavy 966.031 / 645.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100132288;LOC100509396 hypothetical protein LOC100132288;tektin-4 like protein LOC389833-like 1987 253 B20140410_SF109_01 B20140410_SF109_01 TB497236.[MT7]-GRVEQIHQQK[MT7].3y3_1.heavy 504.295 / 547.332 50608.0 18.74839973449707 38 8 10 10 10 0.6670445695285732 86.16156026939126 0.0 3 0.7671427402408927 2.5061399292762716 50608.0 355.4588316677125 0.0 - - - - - - - 293.3125 101 16 APOA5 apolipoprotein A-V 1989 253 B20140410_SF109_01 B20140410_SF109_01 TB497236.[MT7]-GRVEQIHQQK[MT7].3b6_1.heavy 504.295 / 827.486 37550.0 18.74839973449707 38 8 10 10 10 0.6670445695285732 86.16156026939126 0.0 3 0.7671427402408927 2.5061399292762716 37550.0 267.8195364617959 0.0 - - - - - - - 201.6 75 20 APOA5 apolipoprotein A-V 1991 253 B20140410_SF109_01 B20140410_SF109_01 TB497236.[MT7]-GRVEQIHQQK[MT7].3b4_1.heavy 504.295 / 586.343 8665.0 18.74839973449707 38 8 10 10 10 0.6670445695285732 86.16156026939126 0.0 3 0.7671427402408927 2.5061399292762716 8665.0 25.210393858593307 0.0 - - - - - - - 297.55555555555554 17 18 APOA5 apolipoprotein A-V 1993 253 B20140410_SF109_01 B20140410_SF109_01 TB497236.[MT7]-GRVEQIHQQK[MT7].3b5_1.heavy 504.295 / 714.401 27500.0 18.74839973449707 38 8 10 10 10 0.6670445695285732 86.16156026939126 0.0 3 0.7671427402408927 2.5061399292762716 27500.0 251.99197120708746 0.0 - - - - - - - 144.4 55 20 APOA5 apolipoprotein A-V 1995 254 B20140410_SF109_01 B20140410_SF109_01 TB238519.[MT7]-GTLFLPSWVR.3y6_1.heavy 440.591 / 757.435 4975.0 39.02149963378906 46 16 10 10 10 1.9054338729138363 41.66575379656409 0.0 3 0.9618630675472776 6.299404791463922 4975.0 35.77243338557994 0.0 - - - - - - - 200.85714285714286 9 7 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1997 254 B20140410_SF109_01 B20140410_SF109_01 TB238519.[MT7]-GTLFLPSWVR.3b4_1.heavy 440.591 / 563.331 167633.0 39.02149963378906 46 16 10 10 10 1.9054338729138363 41.66575379656409 0.0 3 0.9618630675472776 6.299404791463922 167633.0 380.31118046681155 0.0 - - - - - - - 239.5 335 8 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 1999 254 B20140410_SF109_01 B20140410_SF109_01 TB238519.[MT7]-GTLFLPSWVR.3y4_1.heavy 440.591 / 547.299 83944.0 39.02149963378906 46 16 10 10 10 1.9054338729138363 41.66575379656409 0.0 3 0.9618630675472776 6.299404791463922 83944.0 678.6654387918745 0.0 - - - - - - - 212.88888888888889 167 9 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 2001 254 B20140410_SF109_01 B20140410_SF109_01 TB238519.[MT7]-GTLFLPSWVR.3y5_1.heavy 440.591 / 644.352 195189.0 39.02149963378906 46 16 10 10 10 1.9054338729138363 41.66575379656409 0.0 3 0.9618630675472776 6.299404791463922 195189.0 413.7034475357711 0.0 - - - - - - - 200.71428571428572 390 7 TCEANC transcription elongation factor A (SII) N-terminal and central domain containing 2003 255 B20140410_SF109_01 B20140410_SF109_01 TB376245.[MT7]-GPTLGSIETSDFTK[MT7].3b6_1.heavy 580.98 / 657.369 96247.0 31.670499801635742 48 18 10 10 10 4.42015804735206 22.623625428938226 0.0 3 0.9820657402198607 9.201728908946906 96247.0 60.367633007049264 0.0 - - - - - - - 1730.5 192 8 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 2005 255 B20140410_SF109_01 B20140410_SF109_01 TB376245.[MT7]-GPTLGSIETSDFTK[MT7].3y3_1.heavy 580.98 / 539.331 100598.0 31.670499801635742 48 18 10 10 10 4.42015804735206 22.623625428938226 0.0 3 0.9820657402198607 9.201728908946906 100598.0 27.25532284598495 0.0 - - - - - - - 1318.0 201 1 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 2007 255 B20140410_SF109_01 B20140410_SF109_01 TB376245.[MT7]-GPTLGSIETSDFTK[MT7].3b5_1.heavy 580.98 / 570.337 43377.0 31.670499801635742 48 18 10 10 10 4.42015804735206 22.623625428938226 0.0 3 0.9820657402198607 9.201728908946906 43377.0 14.407561019043808 0.0 - - - - - - - 791.0 86 1 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 2009 255 B20140410_SF109_01 B20140410_SF109_01 TB376245.[MT7]-GPTLGSIETSDFTK[MT7].3y4_1.heavy 580.98 / 654.358 67768.0 31.670499801635742 48 18 10 10 10 4.42015804735206 22.623625428938226 0.0 3 0.9820657402198607 9.201728908946906 67768.0 56.85133422579206 0.0 - - - - - - - 1199.9 135 10 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 2011 256 B20140410_SF109_01 B20140410_SF109_01 TB497346.[MT7]-ELFHPYAESLVSGIGR.3b4_1.heavy 640.343 / 671.363 218089.0 34.6963996887207 46 16 10 10 10 2.0565033043510383 38.644167858034976 0.0 3 0.9679208102705422 6.871994466539308 218089.0 168.07149606086722 0.0 - - - - - - - 946.0 436 4 APOA5 apolipoprotein A-V 2013 256 B20140410_SF109_01 B20140410_SF109_01 TB497346.[MT7]-ELFHPYAESLVSGIGR.3b3_1.heavy 640.343 / 534.304 242057.0 34.6963996887207 46 16 10 10 10 2.0565033043510383 38.644167858034976 0.0 3 0.9679208102705422 6.871994466539308 242057.0 121.80867084806086 0.0 - - - - - - - 701.0 484 1 APOA5 apolipoprotein A-V 2015 256 B20140410_SF109_01 B20140410_SF109_01 TB497346.[MT7]-ELFHPYAESLVSGIGR.3y8_1.heavy 640.343 / 788.463 132171.0 34.6963996887207 46 16 10 10 10 2.0565033043510383 38.644167858034976 0.0 3 0.9679208102705422 6.871994466539308 132171.0 111.1096720964866 0.0 - - - - - - - 350.0 264 2 APOA5 apolipoprotein A-V 2017 256 B20140410_SF109_01 B20140410_SF109_01 TB497346.[MT7]-ELFHPYAESLVSGIGR.3y10_1.heavy 640.343 / 988.542 147589.0 34.6963996887207 46 16 10 10 10 2.0565033043510383 38.644167858034976 0.0 3 0.9679208102705422 6.871994466539308 147589.0 417.19109068002945 0.0 - - - - - - - 336.0 295 5 APOA5 apolipoprotein A-V 2019 257 B20140410_SF109_01 B20140410_SF109_01 TB238515.[MT7]-ITQLYFLK[MT7].3y3_1.heavy 438.607 / 551.367 196726.0 36.68949890136719 50 20 10 10 10 6.162573828453093 16.22698612360505 0.0 3 0.9910013724466334 13.000139764385425 196726.0 464.04102129008726 0.0 - - - - - - - 334.4 393 5 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 2021 257 B20140410_SF109_01 B20140410_SF109_01 TB238515.[MT7]-ITQLYFLK[MT7].3b4_1.heavy 438.607 / 600.384 174713.0 36.68949890136719 50 20 10 10 10 6.162573828453093 16.22698612360505 0.0 3 0.9910013724466334 13.000139764385425 174713.0 402.998740227348 0.0 - - - - - - - 736.4285714285714 349 7 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 2023 257 B20140410_SF109_01 B20140410_SF109_01 TB238515.[MT7]-ITQLYFLK[MT7].3b5_1.heavy 438.607 / 763.447 25636.0 36.68949890136719 50 20 10 10 10 6.162573828453093 16.22698612360505 0.0 3 0.9910013724466334 13.000139764385425 25636.0 76.03353950285914 0.0 - - - - - - - 208.8 51 10 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 2025 257 B20140410_SF109_01 B20140410_SF109_01 TB238515.[MT7]-ITQLYFLK[MT7].3b3_1.heavy 438.607 / 487.3 247440.0 36.68949890136719 50 20 10 10 10 6.162573828453093 16.22698612360505 0.0 3 0.9910013724466334 13.000139764385425 247440.0 901.7338066574059 0.0 - - - - - - - 334.4 494 5 LOC100506434;LOC100508391 hypothetical protein LOC100506434;hypothetical protein LOC100508391 2027 258 B20140410_SF109_01 B20140410_SF109_01 TB376388.[MT7]-FPGVGVLPGVPTGAGVK[MT7]PK[MT7].4y8_2.heavy 553.091 / 523.334 36872.0 33.292301177978516 41 11 10 10 10 1.0813433500186873 61.44170448538641 0.0 3 0.8738004653112763 3.4368190989657434 36872.0 16.73712458255766 0.0 - - - - - - - 1257.0 73 2 ELN elastin 2029 258 B20140410_SF109_01 B20140410_SF109_01 TB376388.[MT7]-FPGVGVLPGVPTGAGVK[MT7]PK[MT7].4y9_2.heavy 553.091 / 571.86 239248.0 33.292301177978516 41 11 10 10 10 1.0813433500186873 61.44170448538641 0.0 3 0.8738004653112763 3.4368190989657434 239248.0 263.74714783836885 0.0 - - - - - - - 838.0 478 3 ELN elastin 2031 258 B20140410_SF109_01 B20140410_SF109_01 TB376388.[MT7]-FPGVGVLPGVPTGAGVK[MT7]PK[MT7].4b5_1.heavy 553.091 / 602.342 91621.0 33.292301177978516 41 11 10 10 10 1.0813433500186873 61.44170448538641 0.0 3 0.8738004653112763 3.4368190989657434 91621.0 57.156559132561355 0.0 - - - - - - - 838.0 183 1 ELN elastin 2033 258 B20140410_SF109_01 B20140410_SF109_01 TB376388.[MT7]-FPGVGVLPGVPTGAGVK[MT7]PK[MT7].4b6_1.heavy 553.091 / 701.41 89247.0 33.292301177978516 41 11 10 10 10 1.0813433500186873 61.44170448538641 0.0 3 0.8738004653112763 3.4368190989657434 89247.0 65.26169259350084 0.0 - - - - - - - 419.0 178 1 ELN elastin 2035 259 B20140410_SF109_01 B20140410_SF109_01 TB376384.[MT7]-LQAFRQDTYLQIAAFTR.3y7_1.heavy 729.399 / 806.452 97725.0 36.85765075683594 43 18 10 5 10 3.069064941814781 23.36688443251951 0.04850006103515625 3 0.988328848157682 11.412537309480985 97725.0 87.31387712380118 0.0 - - - - - - - 728.7777777777778 195 9 APOA5 apolipoprotein A-V 2037 259 B20140410_SF109_01 B20140410_SF109_01 TB376384.[MT7]-LQAFRQDTYLQIAAFTR.3y6_1.heavy 729.399 / 678.393 95948.0 36.85765075683594 43 18 10 5 10 3.069064941814781 23.36688443251951 0.04850006103515625 3 0.988328848157682 11.412537309480985 95948.0 51.46420172458845 0.0 - - - - - - - 410.0 191 1 APOA5 apolipoprotein A-V 2039 259 B20140410_SF109_01 B20140410_SF109_01 TB376384.[MT7]-LQAFRQDTYLQIAAFTR.3y5_1.heavy 729.399 / 565.309 146929.0 36.85765075683594 43 18 10 5 10 3.069064941814781 23.36688443251951 0.04850006103515625 3 0.988328848157682 11.412537309480985 146929.0 36.432213486153074 0.0 - - - - - - - 547.0 293 1 APOA5 apolipoprotein A-V 2041 259 B20140410_SF109_01 B20140410_SF109_01 TB376384.[MT7]-LQAFRQDTYLQIAAFTR.3b7_2.heavy 729.399 / 502.276 124103.0 36.85765075683594 43 18 10 5 10 3.069064941814781 23.36688443251951 0.04850006103515625 3 0.988328848157682 11.412537309480985 124103.0 88.71656674740818 0.0 - - - - - - - 1321.3333333333333 248 3 APOA5 apolipoprotein A-V 2043 260 B20140410_SF109_01 B20140410_SF109_01 TB376383.[MT7]-YLVPSDLTVGQFYFLIR.2b3_1.heavy 1088.1 / 520.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - GABARAP;GABARAPL1 GABA(A) receptor-associated protein;GABA(A) receptor-associated protein like 1 2045 260 B20140410_SF109_01 B20140410_SF109_01 TB376383.[MT7]-YLVPSDLTVGQFYFLIR.2y8_1.heavy 1088.1 / 1043.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - GABARAP;GABARAPL1 GABA(A) receptor-associated protein;GABA(A) receptor-associated protein like 1 2047 260 B20140410_SF109_01 B20140410_SF109_01 TB376383.[MT7]-YLVPSDLTVGQFYFLIR.2y9_1.heavy 1088.1 / 1142.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - GABARAP;GABARAPL1 GABA(A) receptor-associated protein;GABA(A) receptor-associated protein like 1 2049 260 B20140410_SF109_01 B20140410_SF109_01 TB376383.[MT7]-YLVPSDLTVGQFYFLIR.2b10_2.heavy 1088.1 / 595.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - GABARAP;GABARAPL1 GABA(A) receptor-associated protein;GABA(A) receptor-associated protein like 1 2051 261 B20140410_SF109_01 B20140410_SF109_01 TB376137.[MT7]-EQNVFYDFK[MT7].2b3_1.heavy 739.382 / 516.253 5429.0 33.95840072631836 32 12 2 10 8 0.9496953040991718 64.97027690935799 0.0 4 0.8963083102234429 3.79895558394935 5429.0 6.418388113139994 1.0 - - - - - - - 1206.3333333333333 33 9 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 2053 261 B20140410_SF109_01 B20140410_SF109_01 TB376137.[MT7]-EQNVFYDFK[MT7].2y5_1.heavy 739.382 / 863.442 6243.0 33.95840072631836 32 12 2 10 8 0.9496953040991718 64.97027690935799 0.0 4 0.8963083102234429 3.79895558394935 6243.0 9.858983059614639 0.0 - - - - - - - 751.6153846153846 12 13 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 2055 261 B20140410_SF109_01 B20140410_SF109_01 TB376137.[MT7]-EQNVFYDFK[MT7].2b4_1.heavy 739.382 / 615.322 5157.0 33.95840072631836 32 12 2 10 8 0.9496953040991718 64.97027690935799 0.0 4 0.8963083102234429 3.79895558394935 5157.0 5.251261698049385 0.0 - - - - - - - 203.5 10 2 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 2057 261 B20140410_SF109_01 B20140410_SF109_01 TB376137.[MT7]-EQNVFYDFK[MT7].2y3_1.heavy 739.382 / 553.31 2579.0 33.95840072631836 32 12 2 10 8 0.9496953040991718 64.97027690935799 0.0 4 0.8963083102234429 3.79895558394935 2579.0 0.011133851821530927 12.0 - - - - - - - 1298.857142857143 5 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 2059 262 B20140410_SF109_01 B20140410_SF109_01 TB376122.[MT7]-AFLDYAYTGK[MT7].3b6_1.heavy 479.594 / 825.426 42070.0 32.999698638916016 48 18 10 10 10 4.73380855089612 21.124639690185568 0.0 3 0.9847472798973527 9.980106020465387 42070.0 106.4308208955224 0.0 - - - - - - - 629.8 84 10 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 2061 262 B20140410_SF109_01 B20140410_SF109_01 TB376122.[MT7]-AFLDYAYTGK[MT7].3b4_1.heavy 479.594 / 591.326 192529.0 32.999698638916016 48 18 10 10 10 4.73380855089612 21.124639690185568 0.0 3 0.9847472798973527 9.980106020465387 192529.0 126.78053390655418 0.0 - - - - - - - 1313.2 385 5 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 2063 262 B20140410_SF109_01 B20140410_SF109_01 TB376122.[MT7]-AFLDYAYTGK[MT7].3b5_1.heavy 479.594 / 754.389 54664.0 32.999698638916016 48 18 10 10 10 4.73380855089612 21.124639690185568 0.0 3 0.9847472798973527 9.980106020465387 54664.0 66.15727449707981 0.0 - - - - - - - 689.1428571428571 109 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 2065 262 B20140410_SF109_01 B20140410_SF109_01 TB376122.[MT7]-AFLDYAYTGK[MT7].3y4_1.heavy 479.594 / 612.347 68196.0 32.999698638916016 48 18 10 10 10 4.73380855089612 21.124639690185568 0.0 3 0.9847472798973527 9.980106020465387 68196.0 74.66234591747147 0.0 - - - - - - - 402.0 136 1 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 2067 263 B20140410_SF109_01 B20140410_SF109_01 TB238422.[MT7]-ARIGDLDK[MT7].3y3_1.heavy 392.571 / 519.326 43071.0 24.076799392700195 45 15 10 10 10 2.629104124866181 38.03577007627643 0.0 3 0.9598613013906341 6.139277275434254 43071.0 46.36698386142797 0.0 - - - - - - - 841.7142857142857 86 7 GABARAP GABA(A) receptor-associated protein 2069 263 B20140410_SF109_01 B20140410_SF109_01 TB238422.[MT7]-ARIGDLDK[MT7].3b5_1.heavy 392.571 / 657.38 15339.0 24.076799392700195 45 15 10 10 10 2.629104124866181 38.03577007627643 0.0 3 0.9598613013906341 6.139277275434254 15339.0 47.26610423452769 1.0 - - - - - - - 245.45454545454547 30 11 GABARAP GABA(A) receptor-associated protein 2071 263 B20140410_SF109_01 B20140410_SF109_01 TB238422.[MT7]-ARIGDLDK[MT7].3b5_2.heavy 392.571 / 329.194 105531.0 24.076799392700195 45 15 10 10 10 2.629104124866181 38.03577007627643 0.0 3 0.9598613013906341 6.139277275434254 105531.0 53.79099857826624 0.0 - - - - - - - 982.0 211 2 GABARAP GABA(A) receptor-associated protein 2073 263 B20140410_SF109_01 B20140410_SF109_01 TB238422.[MT7]-ARIGDLDK[MT7].3y5_1.heavy 392.571 / 691.374 5890.0 24.076799392700195 45 15 10 10 10 2.629104124866181 38.03577007627643 0.0 3 0.9598613013906341 6.139277275434254 5890.0 17.687218833057905 0.0 - - - - - - - 356.90909090909093 11 11 GABARAP GABA(A) receptor-associated protein 2075 264 B20140410_SF109_01 B20140410_SF109_01 TB238425.[MT7]-K[MT7]PPIYK[MT7].3y3_1.heavy 393.26 / 567.362 N/A 23.01930046081543 26 8 0 10 8 0.5686035188444792 96.06870000613635 0.0 4 0.7667755039586616 2.5040821782161387 5845.0 5.088817316307573 2.0 - - - - - - - 1291.75 247 8 EPB49;ABLIM3;ABLIM1 erythrocyte membrane protein band 4.9 (dematin);actin binding LIM protein family, member 3;actin binding LIM protein 1 2077 264 B20140410_SF109_01 B20140410_SF109_01 TB238425.[MT7]-K[MT7]PPIYK[MT7].3y4_1.heavy 393.26 / 664.415 10229.0 23.01930046081543 26 8 0 10 8 0.5686035188444792 96.06870000613635 0.0 4 0.7667755039586616 2.5040821782161387 10229.0 36.23063832517553 0.0 - - - - - - - 216.69230769230768 20 13 EPB49;ABLIM3;ABLIM1 erythrocyte membrane protein band 4.9 (dematin);actin binding LIM protein family, member 3;actin binding LIM protein 1 2079 264 B20140410_SF109_01 B20140410_SF109_01 TB238425.[MT7]-K[MT7]PPIYK[MT7].3y5_1.heavy 393.26 / 761.468 2192.0 23.01930046081543 26 8 0 10 8 0.5686035188444792 96.06870000613635 0.0 4 0.7667755039586616 2.5040821782161387 2192.0 4.2019169329073485 3.0 - - - - - - - 268.42857142857144 4 14 EPB49;ABLIM3;ABLIM1 erythrocyte membrane protein band 4.9 (dematin);actin binding LIM protein family, member 3;actin binding LIM protein 1 2081 264 B20140410_SF109_01 B20140410_SF109_01 TB238425.[MT7]-K[MT7]PPIYK[MT7].3y5_2.heavy 393.26 / 381.237 20980.0 23.01930046081543 26 8 0 10 8 0.5686035188444792 96.06870000613635 0.0 4 0.7667755039586616 2.5040821782161387 20980.0 17.020671303949747 1.0 - - - - - - - 730.6666666666666 41 3 EPB49;ABLIM3;ABLIM1 erythrocyte membrane protein band 4.9 (dematin);actin binding LIM protein family, member 3;actin binding LIM protein 1 2083 265 B20140410_SF109_01 B20140410_SF109_01 TB238523.[MT7]-LRPLSGSEAPR.3y7_1.heavy 442.925 / 703.337 18259.0 24.55579948425293 41 13 10 10 8 0.8931393912438716 74.22276871844599 0.0 4 0.9030446002975087 3.9310027081794443 18259.0 50.71282715729377 0.0 - - - - - - - 225.0 36 7 APOA5 apolipoprotein A-V 2085 265 B20140410_SF109_01 B20140410_SF109_01 TB238523.[MT7]-LRPLSGSEAPR.3y6_1.heavy 442.925 / 616.305 17339.0 24.55579948425293 41 13 10 10 8 0.8931393912438716 74.22276871844599 0.0 4 0.9030446002975087 3.9310027081794443 17339.0 36.31138405797101 0.0 - - - - - - - 638.0 34 7 APOA5 apolipoprotein A-V 2087 265 B20140410_SF109_01 B20140410_SF109_01 TB238523.[MT7]-LRPLSGSEAPR.3b5_1.heavy 442.925 / 711.463 3021.0 24.55579948425293 41 13 10 10 8 0.8931393912438716 74.22276871844599 0.0 4 0.9030446002975087 3.9310027081794443 3021.0 6.642317350469599 1.0 - - - - - - - 704.5454545454545 8 11 APOA5 apolipoprotein A-V 2089 265 B20140410_SF109_01 B20140410_SF109_01 TB238523.[MT7]-LRPLSGSEAPR.3y9_1.heavy 442.925 / 913.474 N/A 24.55579948425293 41 13 10 10 8 0.8931393912438716 74.22276871844599 0.0 4 0.9030446002975087 3.9310027081794443 263.0 2.707633587786259 1.0 - - - - - - - 0.0 0 0 APOA5 apolipoprotein A-V 2091 266 B20140410_SF109_01 B20140410_SF109_01 TB376258.[MT7]-TEFENIIMQQVK[MT7].3b6_1.heavy 589.99 / 878.438 44992.0 36.0093994140625 46 16 10 10 10 5.7357593566131415 17.43448317522305 0.0 3 0.9667841545398566 6.752742736547634 44992.0 175.76225885425168 0.0 - - - - - - - 227.8181818181818 89 11 UGT2B11;UGT2B28 UDP glucuronosyltransferase 2 family, polypeptide B11;UDP glucuronosyltransferase 2 family, polypeptide B28 2093 266 B20140410_SF109_01 B20140410_SF109_01 TB376258.[MT7]-TEFENIIMQQVK[MT7].3b4_1.heavy 589.99 / 651.311 21033.0 36.0093994140625 46 16 10 10 10 5.7357593566131415 17.43448317522305 0.0 3 0.9667841545398566 6.752742736547634 21033.0 25.918316077966168 0.0 - - - - - - - 789.2222222222222 42 9 UGT2B11;UGT2B28 UDP glucuronosyltransferase 2 family, polypeptide B11;UDP glucuronosyltransferase 2 family, polypeptide B28 2095 266 B20140410_SF109_01 B20140410_SF109_01 TB376258.[MT7]-TEFENIIMQQVK[MT7].3b5_1.heavy 589.99 / 765.354 101266.0 36.0093994140625 46 16 10 10 10 5.7357593566131415 17.43448317522305 0.0 3 0.9667841545398566 6.752742736547634 101266.0 155.1783617525847 0.0 - - - - - - - 365.875 202 8 UGT2B11;UGT2B28 UDP glucuronosyltransferase 2 family, polypeptide B11;UDP glucuronosyltransferase 2 family, polypeptide B28 2097 266 B20140410_SF109_01 B20140410_SF109_01 TB376258.[MT7]-TEFENIIMQQVK[MT7].3y5_1.heavy 589.99 / 777.441 40395.0 36.0093994140625 46 16 10 10 10 5.7357593566131415 17.43448317522305 0.0 3 0.9667841545398566 6.752742736547634 40395.0 69.96799734748011 0.0 - - - - - - - 665.3333333333334 80 9 UGT2B11;UGT2B28 UDP glucuronosyltransferase 2 family, polypeptide B11;UDP glucuronosyltransferase 2 family, polypeptide B28 2099 267 B20140410_SF109_01 B20140410_SF109_01 TB376451.[MT7]-ARLQPYMAEAHELVGWNLEGLR.3b9_1.heavy 899.807 / 1204.63 4273.0 36.71335029602051 39 14 10 5 10 7.29656807816561 13.705073252073387 0.047702789306640625 3 0.9342447238145203 4.786169601715629 4273.0 16.7564135645953 0.0 - - - - - - - 252.75 8 12 APOA5 apolipoprotein A-V 2101 267 B20140410_SF109_01 B20140410_SF109_01 TB376451.[MT7]-ARLQPYMAEAHELVGWNLEGLR.3y8_1.heavy 899.807 / 944.495 12267.0 36.71335029602051 39 14 10 5 10 7.29656807816561 13.705073252073387 0.047702789306640625 3 0.9342447238145203 4.786169601715629 12267.0 22.74792346023326 0.0 - - - - - - - 303.2 24 5 APOA5 apolipoprotein A-V 2103 267 B20140410_SF109_01 B20140410_SF109_01 TB376451.[MT7]-ARLQPYMAEAHELVGWNLEGLR.3y10_1.heavy 899.807 / 1156.65 6340.0 36.71335029602051 39 14 10 5 10 7.29656807816561 13.705073252073387 0.047702789306640625 3 0.9342447238145203 4.786169601715629 6340.0 49.62939357607118 0.0 - - - - - - - 260.3333333333333 12 9 APOA5 apolipoprotein A-V 2105 267 B20140410_SF109_01 B20140410_SF109_01 TB376451.[MT7]-ARLQPYMAEAHELVGWNLEGLR.3y9_1.heavy 899.807 / 1043.56 7856.0 36.71335029602051 39 14 10 5 10 7.29656807816561 13.705073252073387 0.047702789306640625 3 0.9342447238145203 4.786169601715629 7856.0 26.63050847457627 0.0 - - - - - - - 258.375 15 16 APOA5 apolipoprotein A-V 2107 268 B20140410_SF109_01 B20140410_SF109_01 TB376456.[MT7]-GWEVVESDLYAMNFNPIISRK[MT7].4b8_1.heavy 689.863 / 1046.49 35041.0 40.29010009765625 46 16 10 10 10 2.442389501537681 32.4017190321584 0.0 3 0.9630683263963816 6.40202153179355 35041.0 83.99701800564446 0.0 - - - - - - - 802.7777777777778 70 9 NQO1 NAD(P)H dehydrogenase, quinone 1 2109 268 B20140410_SF109_01 B20140410_SF109_01 TB376456.[MT7]-GWEVVESDLYAMNFNPIISRK[MT7].4b4_1.heavy 689.863 / 616.321 87440.0 40.29010009765625 46 16 10 10 10 2.442389501537681 32.4017190321584 0.0 3 0.9630683263963816 6.40202153179355 87440.0 66.19632388398772 0.0 - - - - - - - 431.0 174 1 NQO1 NAD(P)H dehydrogenase, quinone 1 2111 268 B20140410_SF109_01 B20140410_SF109_01 TB376456.[MT7]-GWEVVESDLYAMNFNPIISRK[MT7].4y6_1.heavy 689.863 / 857.569 36874.0 40.29010009765625 46 16 10 10 10 2.442389501537681 32.4017190321584 0.0 3 0.9630683263963816 6.40202153179355 36874.0 41.90110801909508 0.0 - - - - - - - 728.0 73 8 NQO1 NAD(P)H dehydrogenase, quinone 1 2113 268 B20140410_SF109_01 B20140410_SF109_01 TB376456.[MT7]-GWEVVESDLYAMNFNPIISRK[MT7].4b3_1.heavy 689.863 / 517.253 49165.0 40.29010009765625 46 16 10 10 10 2.442389501537681 32.4017190321584 0.0 3 0.9630683263963816 6.40202153179355 49165.0 29.391396335093102 0.0 - - - - - - - 1744.6363636363637 98 11 NQO1 NAD(P)H dehydrogenase, quinone 1 2115 269 B20140410_SF109_01 B20140410_SF109_01 TB376455.[MT7]-AAGGGGPGGPGGSGDFLLIYLANLEAK[MT7].4b8_1.heavy 687.621 / 669.344 49461.0 43.18389892578125 41 14 9 10 8 1.9509363350144617 41.841417650621025 0.0 4 0.9413331695441374 5.070136136430738 49461.0 29.442459148967778 1.0 - - - - - - - 1329.0 258 2 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 2117 269 B20140410_SF109_01 B20140410_SF109_01 TB376455.[MT7]-AAGGGGPGGPGGSGDFLLIYLANLEAK[MT7].4y6_1.heavy 687.621 / 789.459 41552.0 43.18389892578125 41 14 9 10 8 1.9509363350144617 41.841417650621025 0.0 4 0.9413331695441374 5.070136136430738 41552.0 55.59711147464361 0.0 - - - - - - - 721.25 83 8 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 2119 269 B20140410_SF109_01 B20140410_SF109_01 TB376455.[MT7]-AAGGGGPGGPGGSGDFLLIYLANLEAK[MT7].4b9_1.heavy 687.621 / 726.365 77789.0 43.18389892578125 41 14 9 10 8 1.9509363350144617 41.841417650621025 0.0 4 0.9413331695441374 5.070136136430738 77789.0 82.21617397981284 0.0 - - - - - - - 305.57142857142856 155 7 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 2121 269 B20140410_SF109_01 B20140410_SF109_01 TB376455.[MT7]-AAGGGGPGGPGGSGDFLLIYLANLEAK[MT7].4b6_1.heavy 687.621 / 515.269 109877.0 43.18389892578125 41 14 9 10 8 1.9509363350144617 41.841417650621025 0.0 4 0.9413331695441374 5.070136136430738 109877.0 100.52144591329069 0.0 - - - - - - - 389.0 219 1 CBLC Cas-Br-M (murine) ecotropic retroviral transforming sequence c 2123 270 B20140410_SF109_01 B20140410_SF109_01 TB376251.[MT7]-SLLDVESYNPLSK[MT7].3b6_1.heavy 584.992 / 801.447 24685.0 36.14400100708008 41 11 10 10 10 1.0584687804567445 60.914485229108394 0.0 3 0.8533659859238855 3.182653983066686 24685.0 28.789239088668026 0.0 - - - - - - - 713.1428571428571 49 7 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 2125 270 B20140410_SF109_01 B20140410_SF109_01 TB376251.[MT7]-SLLDVESYNPLSK[MT7].3b4_1.heavy 584.992 / 573.336 60186.0 36.14400100708008 41 11 10 10 10 1.0584687804567445 60.914485229108394 0.0 3 0.8533659859238855 3.182653983066686 60186.0 47.3164691267978 0.0 - - - - - - - 416.0 120 1 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 2127 270 B20140410_SF109_01 B20140410_SF109_01 TB376251.[MT7]-SLLDVESYNPLSK[MT7].3b5_1.heavy 584.992 / 672.405 33976.0 36.14400100708008 41 11 10 10 10 1.0584687804567445 60.914485229108394 0.0 3 0.8533659859238855 3.182653983066686 33976.0 38.78911749209695 0.0 - - - - - - - 139.0 67 1 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 2129 270 B20140410_SF109_01 B20140410_SF109_01 TB376251.[MT7]-SLLDVESYNPLSK[MT7].3y4_1.heavy 584.992 / 588.384 96381.0 36.14400100708008 41 11 10 10 10 1.0584687804567445 60.914485229108394 0.0 3 0.8533659859238855 3.182653983066686 96381.0 95.12949328298869 0.0 - - - - - - - 416.0 192 1 KBTBD3 kelch repeat and BTB (POZ) domain containing 3 2131 271 B20140410_SF109_01 B20140410_SF109_01 TB376390.[MT7]-DTSEDLGLQC[CAM]DAVNLAFGR.3y6_1.heavy 742.359 / 677.373 35341.0 36.45600128173828 48 18 10 10 10 3.979066479864296 25.131522809694413 0.0 3 0.987926750980221 11.220504254336271 35341.0 38.4234998491498 0.0 - - - - - - - 759.0 70 6 LOC100509396 tektin-4 like protein LOC389833-like 2133 271 B20140410_SF109_01 B20140410_SF109_01 TB376390.[MT7]-DTSEDLGLQC[CAM]DAVNLAFGR.3b5_1.heavy 742.359 / 692.286 59777.0 36.45600128173828 48 18 10 10 10 3.979066479864296 25.131522809694413 0.0 3 0.987926750980221 11.220504254336271 59777.0 73.19632653061225 0.0 - - - - - - - 276.0 119 1 LOC100509396 tektin-4 like protein LOC389833-like 2135 271 B20140410_SF109_01 B20140410_SF109_01 TB376390.[MT7]-DTSEDLGLQC[CAM]DAVNLAFGR.3b7_1.heavy 742.359 / 862.391 72339.0 36.45600128173828 48 18 10 10 10 3.979066479864296 25.131522809694413 0.0 3 0.987926750980221 11.220504254336271 72339.0 73.81828761969754 0.0 - - - - - - - 1224.875 144 8 LOC100509396 tektin-4 like protein LOC389833-like 2137 271 B20140410_SF109_01 B20140410_SF109_01 TB376390.[MT7]-DTSEDLGLQC[CAM]DAVNLAFGR.3y10_1.heavy 742.359 / 1122.54 21950.0 36.45600128173828 48 18 10 10 10 3.979066479864296 25.131522809694413 0.0 3 0.987926750980221 11.220504254336271 21950.0 180.68985507246376 0.0 - - - - - - - 248.4 43 10 LOC100509396 tektin-4 like protein LOC389833-like 2139 272 B20140410_SF109_01 B20140410_SF109_01 TB497025.[MT7]-AADGPQK[MT7].2y4_1.heavy 487.779 / 573.348 40471.0 18.082799911499023 50 20 10 10 10 38.14401481750901 2.6216432768922275 0.0 3 0.9946590429361768 16.879490798971965 40471.0 73.91573289692053 0.0 - - - - - - - 717.7 80 10 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 2141 272 B20140410_SF109_01 B20140410_SF109_01 TB497025.[MT7]-AADGPQK[MT7].2y5_1.heavy 487.779 / 688.375 5482.0 18.082799911499023 50 20 10 10 10 38.14401481750901 2.6216432768922275 0.0 3 0.9946590429361768 16.879490798971965 5482.0 16.301003344481607 1.0 - - - - - - - 260.6923076923077 10 13 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 2143 272 B20140410_SF109_01 B20140410_SF109_01 TB497025.[MT7]-AADGPQK[MT7].2y3_1.heavy 487.779 / 516.326 4535.0 18.082799911499023 50 20 10 10 10 38.14401481750901 2.6216432768922275 0.0 3 0.9946590429361768 16.879490798971965 4535.0 10.388318408380503 1.0 - - - - - - - 291.85714285714283 9 14 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 2145 272 B20140410_SF109_01 B20140410_SF109_01 TB497025.[MT7]-AADGPQK[MT7].2y6_1.heavy 487.779 / 759.412 9171.0 18.082799911499023 50 20 10 10 10 38.14401481750901 2.6216432768922275 0.0 3 0.9946590429361768 16.879490798971965 9171.0 24.238481375358162 1.0 - - - - - - - 242.53333333333333 18 15 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 2147 273 B20140410_SF109_01 B20140410_SF109_01 TB497229.[MT7]-VC[CAM]HALAFLGMAR.3y7_1.heavy 497.268 / 765.408 77596.0 35.04669952392578 44 14 10 10 10 1.5835074661771955 42.30119937783226 0.0 3 0.9476807975501989 5.371800664361337 77596.0 144.45438065777174 0.0 - - - - - - - 322.0 155 10 TMEM155 transmembrane protein 155 2149 273 B20140410_SF109_01 B20140410_SF109_01 TB497229.[MT7]-VC[CAM]HALAFLGMAR.3y6_1.heavy 497.268 / 694.37 62889.0 35.04669952392578 44 14 10 10 10 1.5835074661771955 42.30119937783226 0.0 3 0.9476807975501989 5.371800664361337 62889.0 112.97769322193456 0.0 - - - - - - - 725.4545454545455 125 11 TMEM155 transmembrane protein 155 2151 273 B20140410_SF109_01 B20140410_SF109_01 TB497229.[MT7]-VC[CAM]HALAFLGMAR.3b4_1.heavy 497.268 / 612.304 52944.0 35.04669952392578 44 14 10 10 10 1.5835074661771955 42.30119937783226 0.0 3 0.9476807975501989 5.371800664361337 52944.0 24.617410563480203 0.0 - - - - - - - 280.0 105 1 TMEM155 transmembrane protein 155 2153 273 B20140410_SF109_01 B20140410_SF109_01 TB497229.[MT7]-VC[CAM]HALAFLGMAR.3b3_1.heavy 497.268 / 541.267 53645.0 35.04669952392578 44 14 10 10 10 1.5835074661771955 42.30119937783226 0.0 3 0.9476807975501989 5.371800664361337 53645.0 31.116321743726203 0.0 - - - - - - - 840.0 107 1 TMEM155 transmembrane protein 155 2155 274 B20140410_SF109_01 B20140410_SF109_01 TB497357.[MT7]-VFC[CAM]ELFPEVVEEIK[MT7].3b6_1.heavy 676.032 / 940.472 19647.0 42.05889892578125 43 13 10 10 10 1.051690315296001 58.921194007414215 0.0 3 0.9229092632552013 4.416019407197306 19647.0 35.29957446808511 0.0 - - - - - - - 716.75 39 8 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 2157 274 B20140410_SF109_01 B20140410_SF109_01 TB497357.[MT7]-VFC[CAM]ELFPEVVEEIK[MT7].3b4_1.heavy 676.032 / 680.319 30457.0 42.05889892578125 43 13 10 10 10 1.051690315296001 58.921194007414215 0.0 3 0.9229092632552013 4.416019407197306 30457.0 102.81106792144026 0.0 - - - - - - - 272.6 60 10 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 2159 274 B20140410_SF109_01 B20140410_SF109_01 TB497357.[MT7]-VFC[CAM]ELFPEVVEEIK[MT7].3b5_1.heavy 676.032 / 793.404 38166.0 42.05889892578125 43 13 10 10 10 1.051690315296001 58.921194007414215 0.0 3 0.9229092632552013 4.416019407197306 38166.0 74.96892857142856 0.0 - - - - - - - 698.2857142857143 76 7 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 2161 274 B20140410_SF109_01 B20140410_SF109_01 TB497357.[MT7]-VFC[CAM]ELFPEVVEEIK[MT7].3y4_1.heavy 676.032 / 662.384 32526.0 42.05889892578125 43 13 10 10 10 1.051690315296001 58.921194007414215 0.0 3 0.9229092632552013 4.416019407197306 32526.0 42.01275 0.0 - - - - - - - 250.66666666666666 65 3 UBE2J2 ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) 2163 275 B20140410_SF109_01 B20140410_SF109_01 TB376255.[MT7]-LIVVLEGASLETVK[MT7].3b4_1.heavy 587.032 / 569.414 396326.0 38.97589874267578 47 17 10 10 10 3.5173393982524286 28.430580241896607 0.0 3 0.9713836632520042 7.278036250982671 396326.0 106.08726262626261 0.0 - - - - - - - 2569.0 792 1 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 2165 275 B20140410_SF109_01 B20140410_SF109_01 TB376255.[MT7]-LIVVLEGASLETVK[MT7].3b5_1.heavy 587.032 / 682.498 172707.0 38.97589874267578 47 17 10 10 10 3.5173393982524286 28.430580241896607 0.0 3 0.9713836632520042 7.278036250982671 172707.0 186.21121236461033 0.0 - - - - - - - 467.0 345 4 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 2167 275 B20140410_SF109_01 B20140410_SF109_01 TB376255.[MT7]-LIVVLEGASLETVK[MT7].3y4_1.heavy 587.032 / 620.374 317855.0 38.97589874267578 47 17 10 10 10 3.5173393982524286 28.430580241896607 0.0 3 0.9713836632520042 7.278036250982671 317855.0 220.41070916034823 0.0 - - - - - - - 408.5 635 2 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 2169 275 B20140410_SF109_01 B20140410_SF109_01 TB376255.[MT7]-LIVVLEGASLETVK[MT7].3b7_1.heavy 587.032 / 868.562 85711.0 38.97589874267578 47 17 10 10 10 3.5173393982524286 28.430580241896607 0.0 3 0.9713836632520042 7.278036250982671 85711.0 191.3300582977448 0.0 - - - - - - - 292.1666666666667 171 6 EMG1 EMG1 nucleolar protein homolog (S. cerevisiae) 2171 276 B20140410_SF109_01 B20140410_SF109_01 TB376397.[MT7]-AQLLGGVDEAWALLQGLQSR.3b6_1.heavy 757.086 / 684.416 263914.0 45.03839874267578 41 11 10 10 10 0.93223600766568 67.61343162120176 0.0 3 0.8601799555357028 3.261237620129209 263914.0 402.79617261172615 0.0 - - - - - - - 784.75 527 8 APOA5 apolipoprotein A-V 2173 276 B20140410_SF109_01 B20140410_SF109_01 TB376397.[MT7]-AQLLGGVDEAWALLQGLQSR.3b4_1.heavy 757.086 / 570.373 398077.0 45.03839874267578 41 11 10 10 10 0.93223600766568 67.61343162120176 0.0 3 0.8601799555357028 3.261237620129209 398077.0 627.6595446518096 0.0 - - - - - - - 1255.0 796 8 APOA5 apolipoprotein A-V 2175 276 B20140410_SF109_01 B20140410_SF109_01 TB376397.[MT7]-AQLLGGVDEAWALLQGLQSR.3b8_1.heavy 757.086 / 898.511 234776.0 45.03839874267578 41 11 10 10 10 0.93223600766568 67.61343162120176 0.0 3 0.8601799555357028 3.261237620129209 234776.0 715.2939405709847 0.0 - - - - - - - 727.75 469 8 APOA5 apolipoprotein A-V 2177 276 B20140410_SF109_01 B20140410_SF109_01 TB376397.[MT7]-AQLLGGVDEAWALLQGLQSR.3y5_1.heavy 757.086 / 560.315 946253.0 45.03839874267578 41 11 10 10 10 0.93223600766568 67.61343162120176 0.0 3 0.8601799555357028 3.261237620129209 946253.0 1365.0596580968281 0.0 - - - - - - - 392.6666666666667 1892 3 APOA5 apolipoprotein A-V