Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534276.[MT7]-IRGETLGIIGLGR.3y7_1.heavy 500.311 / 685.435 318665.0 36.86650085449219 44 14 10 10 10 1.8583293653601178 42.87863059424062 0.0 3 0.9303062572186135 4.647402781616154 318665.0 306.0521390682918 0.0 - - - - - - - 384.0 637 1 CTBP1 C-terminal binding protein 1 3 1 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534276.[MT7]-IRGETLGIIGLGR.3b8_1.heavy 500.311 / 984.596 42975.0 36.86650085449219 44 14 10 10 10 1.8583293653601178 42.87863059424062 0.0 3 0.9303062572186135 4.647402781616154 42975.0 126.15696300521512 0.0 - - - - - - - 192.0 85 9 CTBP1 C-terminal binding protein 1 5 1 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534276.[MT7]-IRGETLGIIGLGR.3y5_1.heavy 500.311 / 515.33 805403.0 36.86650085449219 44 14 10 10 10 1.8583293653601178 42.87863059424062 0.0 3 0.9303062572186135 4.647402781616154 805403.0 526.5422052163653 0.0 - - - - - - - 384.0 1610 3 CTBP1 C-terminal binding protein 1 7 1 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534276.[MT7]-IRGETLGIIGLGR.3b7_1.heavy 500.311 / 871.512 350512.0 36.86650085449219 44 14 10 10 10 1.8583293653601178 42.87863059424062 0.0 3 0.9303062572186135 4.647402781616154 350512.0 712.0896295300008 0.0 - - - - - - - 211.2 701 5 CTBP1 C-terminal binding protein 1 9 2 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534324.[MT7]-GGPNIITLADIVK[MT7].3y3_1.heavy 533.662 / 503.367 17353.0 44.30659866333008 48 18 10 10 10 3.7859384711758497 26.413530162031837 0.0 3 0.986080170650903 10.44817283721172 17353.0 43.500621345041054 0.0 - - - - - - - 683.0 34 7 CSNK2A1 casein kinase 2, alpha 1 polypeptide 11 2 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534324.[MT7]-GGPNIITLADIVK[MT7].3b5_1.heavy 533.662 / 583.332 64862.0 44.30659866333008 48 18 10 10 10 3.7859384711758497 26.413530162031837 0.0 3 0.986080170650903 10.44817283721172 64862.0 267.0646456193683 0.0 - - - - - - - 254.5 129 10 CSNK2A1 casein kinase 2, alpha 1 polypeptide 13 2 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534324.[MT7]-GGPNIITLADIVK[MT7].3y4_1.heavy 533.662 / 618.394 33627.0 44.30659866333008 48 18 10 10 10 3.7859384711758497 26.413530162031837 0.0 3 0.986080170650903 10.44817283721172 33627.0 106.66884130873302 0.0 - - - - - - - 244.16666666666666 67 12 CSNK2A1 casein kinase 2, alpha 1 polypeptide 15 2 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534324.[MT7]-GGPNIITLADIVK[MT7].3y5_1.heavy 533.662 / 689.431 17662.0 44.30659866333008 48 18 10 10 10 3.7859384711758497 26.413530162031837 0.0 3 0.986080170650903 10.44817283721172 17662.0 51.92918046820405 0.0 - - - - - - - 218.58333333333334 35 12 CSNK2A1 casein kinase 2, alpha 1 polypeptide 17 3 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534325.[MT7]-EVFEETGFDIK[MT7].3y3_1.heavy 534.615 / 519.326 133996.0 38.066200256347656 43 13 10 10 10 1.4417556567193468 47.93600848767882 0.0 3 0.9285694110439261 4.58987183129357 133996.0 60.17164506276375 0.0 - - - - - - - 859.3333333333334 267 3 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 19 3 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534325.[MT7]-EVFEETGFDIK[MT7].3b4_1.heavy 534.615 / 649.331 75667.0 38.066200256347656 43 13 10 10 10 1.4417556567193468 47.93600848767882 0.0 3 0.9285694110439261 4.58987183129357 75667.0 81.83993750910754 0.0 - - - - - - - 336.22222222222223 151 9 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 21 3 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534325.[MT7]-EVFEETGFDIK[MT7].3b5_1.heavy 534.615 / 778.374 36100.0 38.066200256347656 43 13 10 10 10 1.4417556567193468 47.93600848767882 0.0 3 0.9285694110439261 4.58987183129357 36100.0 87.72620004777883 0.0 - - - - - - - 746.6 72 10 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 23 3 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534325.[MT7]-EVFEETGFDIK[MT7].3b3_1.heavy 534.615 / 520.289 85715.0 38.066200256347656 43 13 10 10 10 1.4417556567193468 47.93600848767882 0.0 3 0.9285694110439261 4.58987183129357 85715.0 89.79697967791411 0.0 - - - - - - - 1733.5 171 8 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 25 4 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534279.[MT7]-DNIQAMVIVPTR.3b6_1.heavy 500.949 / 817.399 11471.0 36.1609992980957 42 20 6 10 6 8.984861985912602 11.129831505123882 0.0 5 0.995171603156013 17.753582010994485 11471.0 81.54587657247262 0.0 - - - - - - - 208.06666666666666 22 15 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 27 4 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534279.[MT7]-DNIQAMVIVPTR.3y6_1.heavy 500.949 / 684.44 27169.0 36.1609992980957 42 20 6 10 6 8.984861985912602 11.129831505123882 0.0 5 0.995171603156013 17.753582010994485 27169.0 45.21647566945004 1.0 - - - - - - - 679.125 81 8 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 29 4 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534279.[MT7]-DNIQAMVIVPTR.3b5_1.heavy 500.949 / 686.359 45986.0 36.1609992980957 42 20 6 10 6 8.984861985912602 11.129831505123882 0.0 5 0.995171603156013 17.753582010994485 45986.0 63.816603073072955 1.0 - - - - - - - 718.8571428571429 171 7 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 31 4 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534279.[MT7]-DNIQAMVIVPTR.3y5_1.heavy 500.949 / 585.372 53835.0 36.1609992980957 42 20 6 10 6 8.984861985912602 11.129831505123882 0.0 5 0.995171603156013 17.753582010994485 53835.0 76.24496937895725 0.0 - - - - - - - 369.3333333333333 107 3 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 33 5 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49932.[MT7]-ALLPMAQR.2b3_1.heavy 522.311 / 442.315 2758.0 36.999298095703125 43 17 10 10 6 1.3404088241998169 43.98753306589335 0.0 6 0.977345639934306 8.18395353623622 2758.0 4.276223634517197 8.0 - - - - - - - 739.8888888888889 7 9 TSNARE1 t-SNARE domain containing 1 35 5 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49932.[MT7]-ALLPMAQR.2y5_1.heavy 522.311 / 602.308 18164.0 36.999298095703125 43 17 10 10 6 1.3404088241998169 43.98753306589335 0.0 6 0.977345639934306 8.18395353623622 18164.0 31.0823164828671 0.0 - - - - - - - 786.9090909090909 36 11 TSNARE1 t-SNARE domain containing 1 37 5 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49932.[MT7]-ALLPMAQR.2y6_1.heavy 522.311 / 715.392 3899.0 36.999298095703125 43 17 10 10 6 1.3404088241998169 43.98753306589335 0.0 6 0.977345639934306 8.18395353623622 3899.0 10.24512012012012 0.0 - - - - - - - 689.75 7 8 TSNARE1 t-SNARE domain containing 1 39 5 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49932.[MT7]-ALLPMAQR.2y7_1.heavy 522.311 / 828.476 1331.0 36.999298095703125 43 17 10 10 6 1.3404088241998169 43.98753306589335 0.0 6 0.977345639934306 8.18395353623622 1331.0 1.709580257623124 1.0 - - - - - - - 248.46153846153845 2 13 TSNARE1 t-SNARE domain containing 1 41 6 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533872.[MT7]-NC[CAM]VNK[MT7].2y4_1.heavy 461.755 / 664.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 43 6 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533872.[MT7]-NC[CAM]VNK[MT7].2b4_1.heavy 461.755 / 632.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 45 6 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533872.[MT7]-NC[CAM]VNK[MT7].2y3_1.heavy 461.755 / 504.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 47 7 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49936.[MT7]-TPITVVK[MT7].2b3_1.heavy 523.347 / 456.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 49 7 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49936.[MT7]-TPITVVK[MT7].2y4_1.heavy 523.347 / 590.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 51 7 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49936.[MT7]-TPITVVK[MT7].2y3_1.heavy 523.347 / 489.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 53 7 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49936.[MT7]-TPITVVK[MT7].2y6_1.heavy 523.347 / 800.536 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 55 8 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534464.[MT7]-YLRIPDEIIDMVK[MT7].3y3_1.heavy 631.697 / 521.324 9050.0 45.95995044708252 35 9 10 6 10 1.0066432049136982 67.01614048501688 0.032199859619140625 3 0.8130864774117456 2.808877840929172 9050.0 18.784211374543368 0.0 - - - - - - - 630.6428571428571 18 14 LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 57 8 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534464.[MT7]-YLRIPDEIIDMVK[MT7].3b6_1.heavy 631.697 / 902.522 1600.0 45.95995044708252 35 9 10 6 10 1.0066432049136982 67.01614048501688 0.032199859619140625 3 0.8130864774117456 2.808877840929172 1600.0 4.343891402714932 0.0 - - - - - - - 152.38095238095238 3 21 LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 59 8 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534464.[MT7]-YLRIPDEIIDMVK[MT7].3y4_1.heavy 631.697 / 636.351 9216.0 45.95995044708252 35 9 10 6 10 1.0066432049136982 67.01614048501688 0.032199859619140625 3 0.8130864774117456 2.808877840929172 9216.0 32.01541115190846 0.0 - - - - - - - 270.6190476190476 18 21 LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 61 8 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534464.[MT7]-YLRIPDEIIDMVK[MT7].3b7_1.heavy 631.697 / 1031.56 4746.0 45.95995044708252 35 9 10 6 10 1.0066432049136982 67.01614048501688 0.032199859619140625 3 0.8130864774117456 2.808877840929172 4746.0 16.33586956521739 1.0 - - - - - - - 197.07142857142858 9 14 LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 63 9 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534465.[MT7]-YLRIPDEIIDMVK[MT7].4b7_1.heavy 474.024 / 1031.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 65 9 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534465.[MT7]-YLRIPDEIIDMVK[MT7].4b7_2.heavy 474.024 / 516.286 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 67 9 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534465.[MT7]-YLRIPDEIIDMVK[MT7].4b3_1.heavy 474.024 / 577.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 69 9 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534465.[MT7]-YLRIPDEIIDMVK[MT7].4b6_1.heavy 474.024 / 902.522 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 71 10 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49935.[MT7]-ATNPLNK[MT7].2y4_1.heavy 523.316 / 615.395 2721.0 26.406649589538574 23 -1 10 6 8 0.21785541618086685 157.49583625031676 0.039798736572265625 4 0.29702280116633734 1.3751162044039045 2721.0 4.1624202772017895 2.0 - - - - - - - 1255.111111111111 22 9 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 73 10 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49935.[MT7]-ATNPLNK[MT7].2b4_1.heavy 523.316 / 528.29 24628.0 26.406649589538574 23 -1 10 6 8 0.21785541618086685 157.49583625031676 0.039798736572265625 4 0.29702280116633734 1.3751162044039045 24628.0 54.089331232492995 0.0 - - - - - - - 688.5 49 8 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 75 10 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49935.[MT7]-ATNPLNK[MT7].2y3_1.heavy 523.316 / 518.342 43881.0 26.406649589538574 23 -1 10 6 8 0.21785541618086685 157.49583625031676 0.039798736572265625 4 0.29702280116633734 1.3751162044039045 43881.0 38.877379683807646 0.0 - - - - - - - 680.0 87 1 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 77 10 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49935.[MT7]-ATNPLNK[MT7].2y6_1.heavy 523.316 / 830.485 1973.0 26.406649589538574 23 -1 10 6 8 0.21785541618086685 157.49583625031676 0.039798736572265625 4 0.29702280116633734 1.3751162044039045 1973.0 1.782132067012526 4.0 - - - - - - - 272.0 40 3 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 79 11 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534132.[MT7]-INSSVTSLER.2y8_1.heavy 625.347 / 878.458 5141.0 28.75255012512207 43 20 10 7 6 11.148523585652136 8.969797590839512 0.029300689697265625 5 0.9943107509361159 16.354180266078487 5141.0 5.450021857923497 1.0 - - - - - - - 243.1818181818182 11 11 TSNARE1 t-SNARE domain containing 1 81 11 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534132.[MT7]-INSSVTSLER.2b4_1.heavy 625.347 / 546.3 2042.0 28.75255012512207 43 20 10 7 6 11.148523585652136 8.969797590839512 0.029300689697265625 5 0.9943107509361159 16.354180266078487 2042.0 0.19966042699093536 4.0 - - - - - - - 802.7 4 10 TSNARE1 t-SNARE domain containing 1 83 11 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534132.[MT7]-INSSVTSLER.2y9_1.heavy 625.347 / 992.501 21408.0 28.75255012512207 43 20 10 7 6 11.148523585652136 8.969797590839512 0.029300689697265625 5 0.9943107509361159 16.354180266078487 21408.0 49.262727272727275 0.0 - - - - - - - 730.5 42 8 TSNARE1 t-SNARE domain containing 1 85 11 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534132.[MT7]-INSSVTSLER.2y7_1.heavy 625.347 / 791.426 3591.0 28.75255012512207 43 20 10 7 6 11.148523585652136 8.969797590839512 0.029300689697265625 5 0.9943107509361159 16.354180266078487 3591.0 9.789026844697457 1.0 - - - - - - - 669.0 7 10 TSNARE1 t-SNARE domain containing 1 87 12 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50445.[MT7]-LNHQEVVEEDK[MT7].3y3_1.heavy 543.289 / 535.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 89 12 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50445.[MT7]-LNHQEVVEEDK[MT7].3b3_1.heavy 543.289 / 509.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 91 12 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50445.[MT7]-LNHQEVVEEDK[MT7].3y4_1.heavy 543.289 / 664.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 93 12 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50445.[MT7]-LNHQEVVEEDK[MT7].3y5_1.heavy 543.289 / 763.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 95 13 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534072.[MT7]-GYTIPLDK[MT7].2y4_1.heavy 597.852 / 616.379 65561.0 31.820600509643555 48 18 10 10 10 5.155807491298518 19.395603922134505 0.0 3 0.9860099348803762 10.421851502524975 65561.0 64.55882364292152 0.0 - - - - - - - 1161.4285714285713 131 7 SNW1 SNW domain containing 1 97 13 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534072.[MT7]-GYTIPLDK[MT7].2y5_1.heavy 597.852 / 729.463 6660.0 31.820600509643555 48 18 10 10 10 5.155807491298518 19.395603922134505 0.0 3 0.9860099348803762 10.421851502524975 6660.0 4.004325626929739 1.0 - - - - - - - 667.1428571428571 16 7 SNW1 SNW domain containing 1 99 13 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534072.[MT7]-GYTIPLDK[MT7].2b4_1.heavy 597.852 / 579.326 22056.0 31.820600509643555 48 18 10 10 10 5.155807491298518 19.395603922134505 0.0 3 0.9860099348803762 10.421851502524975 22056.0 22.16240789097747 0.0 - - - - - - - 1297.2857142857142 44 7 SNW1 SNW domain containing 1 101 13 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534072.[MT7]-GYTIPLDK[MT7].2y3_1.heavy 597.852 / 519.326 3373.0 31.820600509643555 48 18 10 10 10 5.155807491298518 19.395603922134505 0.0 3 0.9860099348803762 10.421851502524975 3373.0 1.465401680254347 1.0 - - - - - - - 828.6666666666666 6 12 SNW1 SNW domain containing 1 103 14 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534663.[MT7]-AQFETLQQLVQHYSER.4y4_1.heavy 531.027 / 554.257 22635.0 43.2599983215332 47 17 10 10 10 2.2184895098736703 31.802579013215066 0.0 3 0.97794417622629 8.29467270073812 22635.0 73.66138784696174 0.0 - - - - - - - 258.0 45 15 FYN FYN oncogene related to SRC, FGR, YES 105 14 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534663.[MT7]-AQFETLQQLVQHYSER.4y5_1.heavy 531.027 / 691.316 17213.0 43.2599983215332 47 17 10 10 10 2.2184895098736703 31.802579013215066 0.0 3 0.97794417622629 8.29467270073812 17213.0 97.27346511627906 0.0 - - - - - - - 236.5 34 12 FYN FYN oncogene related to SRC, FGR, YES 107 14 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534663.[MT7]-AQFETLQQLVQHYSER.4b4_1.heavy 531.027 / 620.316 26680.0 43.2599983215332 47 17 10 10 10 2.2184895098736703 31.802579013215066 0.0 3 0.97794417622629 8.29467270073812 26680.0 63.06540089708716 0.0 - - - - - - - 294.85714285714283 53 14 FYN FYN oncogene related to SRC, FGR, YES 109 14 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534663.[MT7]-AQFETLQQLVQHYSER.4y6_1.heavy 531.027 / 819.374 16438.0 43.2599983215332 47 17 10 10 10 2.2184895098736703 31.802579013215066 0.0 3 0.97794417622629 8.29467270073812 16438.0 195.16761332568265 0.0 - - - - - - - 161.25 32 8 FYN FYN oncogene related to SRC, FGR, YES 111 15 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534662.[MT7]-AQFETLQQLVQHYSER.3y7_1.heavy 707.7 / 918.443 123098.0 43.2599983215332 46 16 10 10 10 3.208147040180809 24.91467172191006 0.0 3 0.9686085312959165 6.947264940595791 123098.0 348.6349996382596 0.0 - - - - - - - 323.375 246 8 FYN FYN oncogene related to SRC, FGR, YES 113 15 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534662.[MT7]-AQFETLQQLVQHYSER.3y6_1.heavy 707.7 / 819.374 172062.0 43.2599983215332 46 16 10 10 10 3.208147040180809 24.91467172191006 0.0 3 0.9686085312959165 6.947264940595791 172062.0 431.1530394431555 0.0 - - - - - - - 280.1666666666667 344 12 FYN FYN oncogene related to SRC, FGR, YES 115 15 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534662.[MT7]-AQFETLQQLVQHYSER.3b4_1.heavy 707.7 / 620.316 97755.0 43.2599983215332 46 16 10 10 10 3.208147040180809 24.91467172191006 0.0 3 0.9686085312959165 6.947264940595791 97755.0 120.27835705996132 0.0 - - - - - - - 814.2222222222222 195 9 FYN FYN oncogene related to SRC, FGR, YES 117 15 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534662.[MT7]-AQFETLQQLVQHYSER.3b5_1.heavy 707.7 / 721.364 134046.0 43.2599983215332 46 16 10 10 10 3.208147040180809 24.91467172191006 0.0 3 0.9686085312959165 6.947264940595791 134046.0 280.00618989173137 0.0 - - - - - - - 642.4545454545455 268 11 FYN FYN oncogene related to SRC, FGR, YES 119 16 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533901.[MT7]-VELLAK[MT7].2y4_1.heavy 480.82 / 588.42 14193.0 31.34510040283203 38 20 0 10 8 24.599926984307025 4.065052715961018 0.0 4 0.9982517238627168 29.511688781422528 14193.0 11.992440550516529 0.0 - - - - - - - 1679.0 28 9 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 121 16 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533901.[MT7]-VELLAK[MT7].2b3_1.heavy 480.82 / 486.304 16531.0 31.34510040283203 38 20 0 10 8 24.599926984307025 4.065052715961018 0.0 4 0.9982517238627168 29.511688781422528 16531.0 20.56536727325215 1.0 - - - - - - - 784.6 33 5 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 123 16 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533901.[MT7]-VELLAK[MT7].2y5_1.heavy 480.82 / 717.463 21039.0 31.34510040283203 38 20 0 10 8 24.599926984307025 4.065052715961018 0.0 4 0.9982517238627168 29.511688781422528 21039.0 47.28825705731394 1.0 - - - - - - - 652.7272727272727 665 11 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 125 16 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533901.[MT7]-VELLAK[MT7].2b4_1.heavy 480.82 / 599.388 7097.0 31.34510040283203 38 20 0 10 8 24.599926984307025 4.065052715961018 0.0 4 0.9982517238627168 29.511688781422528 7097.0 8.086235861610113 0.0 - - - - - - - 1200.125 14 8 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 127 17 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50443.[MT7]-DISEVIALGVPNPR.2y8_1.heavy 812.463 / 823.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 129 17 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50443.[MT7]-DISEVIALGVPNPR.2y9_1.heavy 812.463 / 936.563 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 131 17 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50443.[MT7]-DISEVIALGVPNPR.2b4_1.heavy 812.463 / 589.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 133 17 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50443.[MT7]-DISEVIALGVPNPR.2b5_1.heavy 812.463 / 688.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 135 18 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534665.[MT7]-GGPNIITLADIVK[MT7]DPVSR.3b6_1.heavy 718.423 / 696.416 7928.0 43.20254898071289 43 17 10 6 10 5.413869649081594 18.471076417025287 0.0381011962890625 3 0.9799792570649082 8.707530932807888 7928.0 15.338208957829082 0.0 - - - - - - - 277.0 15 4 CSNK2A1 casein kinase 2, alpha 1 polypeptide 137 18 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534665.[MT7]-GGPNIITLADIVK[MT7]DPVSR.3b10_1.heavy 718.423 / 1096.61 5797.0 43.20254898071289 43 17 10 6 10 5.413869649081594 18.471076417025287 0.0381011962890625 3 0.9799792570649082 8.707530932807888 5797.0 19.155680354899495 0.0 - - - - - - - 216.46153846153845 11 13 CSNK2A1 casein kinase 2, alpha 1 polypeptide 139 18 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534665.[MT7]-GGPNIITLADIVK[MT7]DPVSR.3b5_1.heavy 718.423 / 583.332 14578.0 43.20254898071289 43 17 10 6 10 5.413869649081594 18.471076417025287 0.0381011962890625 3 0.9799792570649082 8.707530932807888 14578.0 26.074706474804728 0.0 - - - - - - - 341.0 29 11 CSNK2A1 casein kinase 2, alpha 1 polypeptide 141 18 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534665.[MT7]-GGPNIITLADIVK[MT7]DPVSR.3y10_1.heavy 718.423 / 1243.71 4263.0 43.20254898071289 43 17 10 6 10 5.413869649081594 18.471076417025287 0.0381011962890625 3 0.9799792570649082 8.707530932807888 4263.0 14.006924538432944 0.0 - - - - - - - 246.94736842105263 8 19 CSNK2A1 casein kinase 2, alpha 1 polypeptide 143 19 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50649.[MT7]-SIEEQLGTEIK[MT7]PIPSNIDK[MT7].3y6_1.heavy 848.481 / 817.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 145 19 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50649.[MT7]-SIEEQLGTEIK[MT7]PIPSNIDK[MT7].3b4_1.heavy 848.481 / 603.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 147 19 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50649.[MT7]-SIEEQLGTEIK[MT7]PIPSNIDK[MT7].3b5_1.heavy 848.481 / 731.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 149 19 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50649.[MT7]-SIEEQLGTEIK[MT7]PIPSNIDK[MT7].3y8_1.heavy 848.481 / 1027.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 151 20 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533903.[MT7]-DSYYDR.2b3_1.heavy 481.72 / 510.232 6409.0 20.180250644683838 42 20 8 6 8 10.471203489144344 9.550000637813172 0.03700065612792969 4 0.9977964366937501 26.28571664421439 6409.0 15.875717226170057 0.0 - - - - - - - 787.1428571428571 12 7 TRA2A transformer 2 alpha homolog (Drosophila) 153 20 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533903.[MT7]-DSYYDR.2y5_1.heavy 481.72 / 703.305 14566.0 20.180250644683838 42 20 8 6 8 10.471203489144344 9.550000637813172 0.03700065612792969 4 0.9977964366937501 26.28571664421439 14566.0 35.99108670732476 2.0 - - - - - - - 332.45454545454544 41 11 TRA2A transformer 2 alpha homolog (Drosophila) 155 20 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533903.[MT7]-DSYYDR.2b4_1.heavy 481.72 / 673.295 2754.0 20.180250644683838 42 20 8 6 8 10.471203489144344 9.550000637813172 0.03700065612792969 4 0.9977964366937501 26.28571664421439 2754.0 1.8720543806646526 0.0 - - - - - - - 295.2857142857143 5 14 TRA2A transformer 2 alpha homolog (Drosophila) 157 20 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533903.[MT7]-DSYYDR.2b5_1.heavy 481.72 / 788.322 6727.0 20.180250644683838 42 20 8 6 8 10.471203489144344 9.550000637813172 0.03700065612792969 4 0.9977964366937501 26.28571664421439 6727.0 37.12542452830189 0.0 - - - - - - - 221.35294117647058 13 17 TRA2A transformer 2 alpha homolog (Drosophila) 159 21 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50580.[MT7]-TPALVFEHVNNTDFK[MT7].3y7_1.heavy 674.03 / 981.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSNK2A1 casein kinase 2, alpha 1 polypeptide 161 21 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50580.[MT7]-TPALVFEHVNNTDFK[MT7].3y6_1.heavy 674.03 / 882.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSNK2A1 casein kinase 2, alpha 1 polypeptide 163 21 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50580.[MT7]-TPALVFEHVNNTDFK[MT7].3b4_1.heavy 674.03 / 527.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSNK2A1 casein kinase 2, alpha 1 polypeptide 165 21 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50580.[MT7]-TPALVFEHVNNTDFK[MT7].3y5_1.heavy 674.03 / 768.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSNK2A1 casein kinase 2, alpha 1 polypeptide 167 22 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534666.[MT7]-GGPNIITLADIVK[MT7]DPVSR.4y10_2.heavy 539.069 / 622.36 23962.0 43.212074279785156 36 10 10 6 10 1.8249053803688398 54.797361592406816 0.0381011962890625 3 0.8469091489151465 3.1130406739552416 23962.0 84.84153110047848 0.0 - - - - - - - 696.7142857142857 47 7 CSNK2A1 casein kinase 2, alpha 1 polypeptide 169 22 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534666.[MT7]-GGPNIITLADIVK[MT7]DPVSR.4y12_2.heavy 539.069 / 729.426 35258.0 43.212074279785156 36 10 10 6 10 1.8249053803688398 54.797361592406816 0.0381011962890625 3 0.8469091489151465 3.1130406739552416 35258.0 87.94975463651014 0.0 - - - - - - - 164.76923076923077 70 13 CSNK2A1 casein kinase 2, alpha 1 polypeptide 171 22 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534666.[MT7]-GGPNIITLADIVK[MT7]DPVSR.4b5_1.heavy 539.069 / 583.332 40307.0 43.212074279785156 36 10 10 6 10 1.8249053803688398 54.797361592406816 0.0381011962890625 3 0.8469091489151465 3.1130406739552416 40307.0 191.06482231879335 0.0 - - - - - - - 684.4285714285714 80 7 CSNK2A1 casein kinase 2, alpha 1 polypeptide 173 22 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534666.[MT7]-GGPNIITLADIVK[MT7]DPVSR.4b6_1.heavy 539.069 / 696.416 3851.0 43.212074279785156 36 10 10 6 10 1.8249053803688398 54.797361592406816 0.0381011962890625 3 0.8469091489151465 3.1130406739552416 3851.0 45.47156300552601 0.0 - - - - - - - 164.69230769230768 7 13 CSNK2A1 casein kinase 2, alpha 1 polypeptide 175 23 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50289.[MT7]-TSNEVQYDQR.2y9_1.heavy 692.335 / 1138.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 177 23 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50289.[MT7]-TSNEVQYDQR.2b4_1.heavy 692.335 / 576.275 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 179 23 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50289.[MT7]-TSNEVQYDQR.2b6_1.heavy 692.335 / 803.402 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 181 23 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50289.[MT7]-TSNEVQYDQR.2b5_1.heavy 692.335 / 675.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 183 24 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50589.[MT7]-YSEVFEAINITNNEK[MT7].2b8_1.heavy 1030.03 / 1083.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSNK2A1 casein kinase 2, alpha 1 polypeptide 185 24 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50589.[MT7]-YSEVFEAINITNNEK[MT7].2b3_1.heavy 1030.03 / 524.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSNK2A1 casein kinase 2, alpha 1 polypeptide 187 24 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50589.[MT7]-YSEVFEAINITNNEK[MT7].2y5_1.heavy 1030.03 / 749.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSNK2A1 casein kinase 2, alpha 1 polypeptide 189 24 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50589.[MT7]-YSEVFEAINITNNEK[MT7].2b4_1.heavy 1030.03 / 623.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSNK2A1 casein kinase 2, alpha 1 polypeptide 191 25 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533783.[MT7]-LQQIR.2b3_1.heavy 401.257 / 514.311 81246.0 23.309874534606934 47 20 10 7 10 47.381940491227155 2.1105087500271367 0.025699615478515625 3 0.9979793108503805 27.449817206104886 81246.0 27.51807778889884 0.0 - - - - - - - 996.0 162 1 ITPKA;DYTN;AXIN2 inositol 1,4,5-trisphosphate 3-kinase A;dystrotelin;axin 2 193 25 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533783.[MT7]-LQQIR.2y4_1.heavy 401.257 / 544.32 162230.0 23.309874534606934 47 20 10 7 10 47.381940491227155 2.1105087500271367 0.025699615478515625 3 0.9979793108503805 27.449817206104886 162230.0 80.98490008569259 0.0 - - - - - - - 1238.25 324 8 ITPKA;DYTN;AXIN2 inositol 1,4,5-trisphosphate 3-kinase A;dystrotelin;axin 2 195 25 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533783.[MT7]-LQQIR.2b4_1.heavy 401.257 / 627.395 26890.0 23.309874534606934 47 20 10 7 10 47.381940491227155 2.1105087500271367 0.025699615478515625 3 0.9979793108503805 27.449817206104886 26890.0 33.562183889432504 2.0 - - - - - - - 780.5555555555555 73 9 ITPKA;DYTN;AXIN2 inositol 1,4,5-trisphosphate 3-kinase A;dystrotelin;axin 2 197 25 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533783.[MT7]-LQQIR.2y3_1.heavy 401.257 / 416.262 30192.0 23.309874534606934 47 20 10 7 10 47.381940491227155 2.1105087500271367 0.025699615478515625 3 0.9979793108503805 27.449817206104886 30192.0 10.929920156369409 0.0 - - - - - - - 825.75 60 4 ITPKA;DYTN;AXIN2 inositol 1,4,5-trisphosphate 3-kinase A;dystrotelin;axin 2 199 26 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534266.[MT7]-QLLSELDEEK[MT7].3y3_1.heavy 497.943 / 549.3 19131.0 35.191200256347656 48 18 10 10 10 2.891402192617817 24.160543439304213 0.0 3 0.983866500778367 9.703143583665232 19131.0 29.899138074418588 0.0 - - - - - - - 829.9090909090909 38 11 SH3KBP1 SH3-domain kinase binding protein 1 201 26 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534266.[MT7]-QLLSELDEEK[MT7].3b4_1.heavy 497.943 / 586.368 8060.0 35.191200256347656 48 18 10 10 10 2.891402192617817 24.160543439304213 0.0 3 0.983866500778367 9.703143583665232 8060.0 10.604669723662859 1.0 - - - - - - - 777.0 16 13 SH3KBP1 SH3-domain kinase binding protein 1 203 26 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534266.[MT7]-QLLSELDEEK[MT7].3b5_1.heavy 497.943 / 715.411 17674.0 35.191200256347656 48 18 10 10 10 2.891402192617817 24.160543439304213 0.0 3 0.983866500778367 9.703143583665232 17674.0 25.72126408793182 0.0 - - - - - - - 744.6666666666666 35 9 SH3KBP1 SH3-domain kinase binding protein 1 205 26 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534266.[MT7]-QLLSELDEEK[MT7].3y4_1.heavy 497.943 / 664.327 23986.0 35.191200256347656 48 18 10 10 10 2.891402192617817 24.160543439304213 0.0 3 0.983866500778367 9.703143583665232 23986.0 40.05209619194184 0.0 - - - - - - - 339.6666666666667 47 6 SH3KBP1 SH3-domain kinase binding protein 1 207 27 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533782.[MT7]-ALGLQR.2y4_1.heavy 401.257 / 473.283 102830.0 24.53179931640625 50 20 10 10 10 15.782527067094458 6.336120925050938 0.0 3 0.9988253781653801 36.0056632095693 102830.0 76.74995127262235 0.0 - - - - - - - 1296.857142857143 205 7 CTBP1;AKAP17A C-terminal binding protein 1;A kinase (PRKA) anchor protein 17A 209 27 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533782.[MT7]-ALGLQR.2y5_1.heavy 401.257 / 586.367 195069.0 24.53179931640625 50 20 10 10 10 15.782527067094458 6.336120925050938 0.0 3 0.9988253781653801 36.0056632095693 195069.0 190.57910392579606 0.0 - - - - - - - 1754.142857142857 390 7 CTBP1;AKAP17A C-terminal binding protein 1;A kinase (PRKA) anchor protein 17A 211 27 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533782.[MT7]-ALGLQR.2b4_1.heavy 401.257 / 499.336 81240.0 24.53179931640625 50 20 10 10 10 15.782527067094458 6.336120925050938 0.0 3 0.9988253781653801 36.0056632095693 81240.0 44.99683987723233 0.0 - - - - - - - 1251.5 162 2 CTBP1;AKAP17A C-terminal binding protein 1;A kinase (PRKA) anchor protein 17A 213 27 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533782.[MT7]-ALGLQR.2b5_1.heavy 401.257 / 627.395 45101.0 24.53179931640625 50 20 10 10 10 15.782527067094458 6.336120925050938 0.0 3 0.9988253781653801 36.0056632095693 45101.0 44.30395136607146 0.0 - - - - - - - 1180.7142857142858 90 7 CTBP1;AKAP17A C-terminal binding protein 1;A kinase (PRKA) anchor protein 17A 215 28 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50018.[MT7]-TEALTSAK[MT7].2y4_1.heavy 554.826 / 550.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 217 28 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50018.[MT7]-TEALTSAK[MT7].2y5_1.heavy 554.826 / 663.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 219 28 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50018.[MT7]-TEALTSAK[MT7].2b4_1.heavy 554.826 / 559.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 221 28 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50018.[MT7]-TEALTSAK[MT7].2y7_1.heavy 554.826 / 863.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 223 29 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534335.[MT7]-LDDTVHVVIATPGR.3y7_1.heavy 546.309 / 713.43 180264.0 32.982975006103516 42 16 10 6 10 2.717176656004173 29.39050207869831 0.0384979248046875 3 0.9694688609551417 7.044978466598357 180264.0 254.52362512242897 0.0 - - - - - - - 232.0 360 2 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 225 29 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534335.[MT7]-LDDTVHVVIATPGR.3y6_1.heavy 546.309 / 614.362 167739.0 32.982975006103516 42 16 10 6 10 2.717176656004173 29.39050207869831 0.0384979248046875 3 0.9694688609551417 7.044978466598357 167739.0 261.49601598864126 0.0 - - - - - - - 1247.5555555555557 335 9 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 227 29 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534335.[MT7]-LDDTVHVVIATPGR.3b4_1.heavy 546.309 / 589.295 78953.0 32.982975006103516 42 16 10 6 10 2.717176656004173 29.39050207869831 0.0384979248046875 3 0.9694688609551417 7.044978466598357 78953.0 97.46020882040045 0.0 - - - - - - - 1774.25 157 8 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 229 29 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534335.[MT7]-LDDTVHVVIATPGR.3b5_1.heavy 546.309 / 688.363 128866.0 32.982975006103516 42 16 10 6 10 2.717176656004173 29.39050207869831 0.0384979248046875 3 0.9694688609551417 7.044978466598357 128866.0 209.17910107024716 0.0 - - - - - - - 649.5 257 6 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 231 30 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533787.[MT7]-DVFER.2b3_1.heavy 405.217 / 506.273 25504.0 25.774599075317383 45 15 10 10 10 2.5259374294620773 39.58926251838945 0.0 3 0.9538962517739393 5.725473605403143 25504.0 14.8522956715419 0.0 - - - - - - - 706.75 51 4 PLD5;MFAP1;CUL3 phospholipase D family, member 5;microfibrillar-associated protein 1;cullin 3 233 30 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533787.[MT7]-DVFER.2y4_1.heavy 405.217 / 550.298 42462.0 25.774599075317383 45 15 10 10 10 2.5259374294620773 39.58926251838945 0.0 3 0.9538962517739393 5.725473605403143 42462.0 59.74787224016839 0.0 - - - - - - - 394.0 84 1 PLD5;MFAP1;CUL3 phospholipase D family, member 5;microfibrillar-associated protein 1;cullin 3 235 30 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533787.[MT7]-DVFER.2b4_1.heavy 405.217 / 635.316 22546.0 25.774599075317383 45 15 10 10 10 2.5259374294620773 39.58926251838945 0.0 3 0.9538962517739393 5.725473605403143 22546.0 73.90963624269577 0.0 - - - - - - - 304.0 45 8 PLD5;MFAP1;CUL3 phospholipase D family, member 5;microfibrillar-associated protein 1;cullin 3 237 30 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533787.[MT7]-DVFER.2y3_1.heavy 405.217 / 451.23 18668.0 25.774599075317383 45 15 10 10 10 2.5259374294620773 39.58926251838945 0.0 3 0.9538962517739393 5.725473605403143 18668.0 21.204063879068634 1.0 - - - - - - - 1321.888888888889 51 9 PLD5;MFAP1;CUL3 phospholipase D family, member 5;microfibrillar-associated protein 1;cullin 3 239 31 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50013.[MT7]-K[MT7]QGIVK[MT7].2b3_1.heavy 552.877 / 602.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 241 31 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50013.[MT7]-K[MT7]QGIVK[MT7].2y4_1.heavy 552.877 / 560.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 243 31 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50013.[MT7]-K[MT7]QGIVK[MT7].2y5_1.heavy 552.877 / 688.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 245 31 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50013.[MT7]-K[MT7]QGIVK[MT7].2b4_1.heavy 552.877 / 715.471 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 247 32 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534331.[MT7]-DISEVIALGVPNPR.3y6_1.heavy 541.978 / 639.357 73994.0 40.777276039123535 43 17 10 6 10 2.1230246653460503 33.468173087879485 0.032100677490234375 3 0.9708942614154044 7.216290690906803 73994.0 105.81901513745265 0.0 - - - - - - - 698.1428571428571 147 7 SNW1 SNW domain containing 1 249 32 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534331.[MT7]-DISEVIALGVPNPR.3b4_1.heavy 541.978 / 589.295 48529.0 40.777276039123535 43 17 10 6 10 2.1230246653460503 33.468173087879485 0.032100677490234375 3 0.9708942614154044 7.216290690906803 48529.0 98.06902083333334 1.0 - - - - - - - 380.0 97 8 SNW1 SNW domain containing 1 251 32 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534331.[MT7]-DISEVIALGVPNPR.3b5_1.heavy 541.978 / 688.363 58859.0 40.777276039123535 43 17 10 6 10 2.1230246653460503 33.468173087879485 0.032100677490234375 3 0.9708942614154044 7.216290690906803 58859.0 129.610056753689 0.0 - - - - - - - 713.7272727272727 117 11 SNW1 SNW domain containing 1 253 32 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534331.[MT7]-DISEVIALGVPNPR.3y8_1.heavy 541.978 / 823.479 14494.0 40.777276039123535 43 17 10 6 10 2.1230246653460503 33.468173087879485 0.032100677490234375 3 0.9708942614154044 7.216290690906803 14494.0 21.25485179407176 1.0 - - - - - - - 641.0 28 8 SNW1 SNW domain containing 1 255 33 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533886.[MT7]-VFFLK[MT7].2b3_1.heavy 471.307 / 538.315 3143.0 39.235432942708336 39 17 10 6 6 2.9178174055654864 34.27219256738224 0.036098480224609375 5 0.9730454860443238 7.500086013456673 3143.0 3.217437854766099 3.0 - - - - - - - 732.7142857142857 14 7 HAPLN4;CCNB3 hyaluronan and proteoglycan link protein 4;cyclin B3 257 33 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533886.[MT7]-VFFLK[MT7].2y4_1.heavy 471.307 / 698.436 6617.0 39.235432942708336 39 17 10 6 6 2.9178174055654864 34.27219256738224 0.036098480224609375 5 0.9730454860443238 7.500086013456673 6617.0 33.3814605734767 0.0 - - - - - - - 161.35 13 20 HAPLN4;CCNB3 hyaluronan and proteoglycan link protein 4;cyclin B3 259 33 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533886.[MT7]-VFFLK[MT7].2y3_1.heavy 471.307 / 551.367 4549.0 39.235432942708336 39 17 10 6 6 2.9178174055654864 34.27219256738224 0.036098480224609375 5 0.9730454860443238 7.500086013456673 4549.0 6.122172171587067 0.0 - - - - - - - 752.0909090909091 9 11 HAPLN4;CCNB3 hyaluronan and proteoglycan link protein 4;cyclin B3 261 34 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534125.[MT7]-ATWLHQALR.3b4_1.heavy 413.907 / 616.357 217794.0 31.620899200439453 50 20 10 10 10 5.133786124887211 19.478801330508677 0.0 3 0.9944384854241445 16.5410984461733 217794.0 276.0765823174894 0.0 - - - - - - - 709.0 435 8 CTBP1 C-terminal binding protein 1 263 34 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534125.[MT7]-ATWLHQALR.3b3_1.heavy 413.907 / 503.273 374135.0 31.620899200439453 50 20 10 10 10 5.133786124887211 19.478801330508677 0.0 3 0.9944384854241445 16.5410984461733 374135.0 110.80193631804471 0.0 - - - - - - - 1269.5 748 2 CTBP1 C-terminal binding protein 1 265 34 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534125.[MT7]-ATWLHQALR.3y4_1.heavy 413.907 / 487.299 664667.0 31.620899200439453 50 20 10 10 10 5.133786124887211 19.478801330508677 0.0 3 0.9944384854241445 16.5410984461733 664667.0 406.5915492823518 0.0 - - - - - - - 2237.1428571428573 1329 7 CTBP1 C-terminal binding protein 1 267 34 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534125.[MT7]-ATWLHQALR.3y5_1.heavy 413.907 / 624.358 244119.0 31.620899200439453 50 20 10 10 10 5.133786124887211 19.478801330508677 0.0 3 0.9944384854241445 16.5410984461733 244119.0 386.49989903329754 0.0 - - - - - - - 708.75 488 8 CTBP1 C-terminal binding protein 1 269 35 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49846.[MT7]-IPDSLK[MT7].2y4_1.heavy 480.802 / 606.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1 C-terminal binding protein 1 271 35 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49846.[MT7]-IPDSLK[MT7].2y5_1.heavy 480.802 / 703.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1 C-terminal binding protein 1 273 35 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49846.[MT7]-IPDSLK[MT7].2y3_2.heavy 480.802 / 246.169 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1 C-terminal binding protein 1 275 35 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49846.[MT7]-IPDSLK[MT7].2y3_1.heavy 480.802 / 491.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1 C-terminal binding protein 1 277 36 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533882.[MT7]-DFIEK[MT7].2b3_1.heavy 470.273 / 520.289 22098.0 27.194549560546875 46 20 10 6 10 9.170361680114766 10.904695309547325 0.038700103759765625 3 0.9965063736999472 20.873612936387715 22098.0 24.77413669064748 0.0 - - - - - - - 816.5 44 8 UBXN2A;NDUFA2 UBX domain protein 2A;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa 279 36 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533882.[MT7]-DFIEK[MT7].2y4_1.heavy 470.273 / 680.41 62263.0 27.194549560546875 46 20 10 6 10 9.170361680114766 10.904695309547325 0.038700103759765625 3 0.9965063736999472 20.873612936387715 62263.0 117.44145422398466 0.0 - - - - - - - 339.55555555555554 124 9 UBXN2A;NDUFA2 UBX domain protein 2A;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa 281 36 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533882.[MT7]-DFIEK[MT7].2b4_1.heavy 470.273 / 649.331 16747.0 27.194549560546875 46 20 10 6 10 9.170361680114766 10.904695309547325 0.038700103759765625 3 0.9965063736999472 20.873612936387715 16747.0 23.049406604432036 0.0 - - - - - - - 375.0 33 5 UBXN2A;NDUFA2 UBX domain protein 2A;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa 283 36 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533882.[MT7]-DFIEK[MT7].2y3_1.heavy 470.273 / 533.341 39957.0 27.194549560546875 46 20 10 6 10 9.170361680114766 10.904695309547325 0.038700103759765625 3 0.9965063736999472 20.873612936387715 39957.0 21.64490690318746 0.0 - - - - - - - 833.6666666666666 79 3 UBXN2A;NDUFA2 UBX domain protein 2A;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa 285 37 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534124.[MT7]-IK[MT7]YDAIAR.3y6_1.heavy 413.255 / 708.367 21804.0 26.138200759887695 47 17 10 10 10 3.84683479830949 25.995397578275387 0.0 3 0.976743653240233 8.07693030774337 21804.0 78.94447753433599 0.0 - - - - - - - 253.0 43 14 SNW1 SNW domain containing 1 287 37 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534124.[MT7]-IK[MT7]YDAIAR.3y7_2.heavy 413.255 / 490.786 63677.0 26.138200759887695 47 17 10 10 10 3.84683479830949 25.995397578275387 0.0 3 0.976743653240233 8.07693030774337 63677.0 78.61358024691359 0.0 - - - - - - - 841.0 127 9 SNW1 SNW domain containing 1 289 37 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534124.[MT7]-IK[MT7]YDAIAR.3y4_1.heavy 413.255 / 430.277 112841.0 26.138200759887695 47 17 10 10 10 3.84683479830949 25.995397578275387 0.0 3 0.976743653240233 8.07693030774337 112841.0 57.275332083491634 0.0 - - - - - - - 694.0 225 1 SNW1 SNW domain containing 1 291 37 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534124.[MT7]-IK[MT7]YDAIAR.3y5_1.heavy 413.255 / 545.304 22290.0 26.138200759887695 47 17 10 10 10 3.84683479830949 25.995397578275387 0.0 3 0.976743653240233 8.07693030774337 22290.0 33.80925185185185 0.0 - - - - - - - 789.625 44 8 SNW1 SNW domain containing 1 293 38 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534672.[MT7]-VIFPYEAQNDDELTIK[MT7].3b6_1.heavy 728.387 / 893.489 15257.0 40.517601013183594 46 20 10 6 10 14.971454379570835 6.679377798890007 0.03079986572265625 3 0.9956341396815075 18.67107480785172 15257.0 35.17049577729121 0.0 - - - - - - - 739.0 30 10 SH3KBP1 SH3-domain kinase binding protein 1 295 38 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534672.[MT7]-VIFPYEAQNDDELTIK[MT7].3y3_1.heavy 728.387 / 505.347 52525.0 40.517601013183594 46 20 10 6 10 14.971454379570835 6.679377798890007 0.03079986572265625 3 0.9956341396815075 18.67107480785172 52525.0 47.01168688693856 0.0 - - - - - - - 1316.7142857142858 105 7 SH3KBP1 SH3-domain kinase binding protein 1 297 38 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534672.[MT7]-VIFPYEAQNDDELTIK[MT7].3b5_1.heavy 728.387 / 764.446 11443.0 40.517601013183594 46 20 10 6 10 14.971454379570835 6.679377798890007 0.03079986572265625 3 0.9956341396815075 18.67107480785172 11443.0 21.11077568134172 0.0 - - - - - - - 834.625 22 8 SH3KBP1 SH3-domain kinase binding protein 1 299 38 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534672.[MT7]-VIFPYEAQNDDELTIK[MT7].3b3_1.heavy 728.387 / 504.33 57293.0 40.517601013183594 46 20 10 6 10 14.971454379570835 6.679377798890007 0.03079986572265625 3 0.9956341396815075 18.67107480785172 57293.0 26.586829688673237 0.0 - - - - - - - 298.0 114 4 SH3KBP1 SH3-domain kinase binding protein 1 301 39 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534065.[MT7]-GSLLDFLK[MT7].2y4_1.heavy 590.863 / 666.394 24225.0 44.91640090942383 50 20 10 10 10 4.949530279710581 20.20393741400596 0.0 3 0.9907993087797816 12.856376865373413 24225.0 70.38883116883116 0.0 - - - - - - - 334.61538461538464 48 13 FYN;HCK;LYN;SRC;YES1 FYN oncogene related to SRC, FGR, YES;hemopoietic cell kinase;v-yes-1 Yamaguchi sarcoma viral related oncogene homolog;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 303 39 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534065.[MT7]-GSLLDFLK[MT7].2y5_1.heavy 590.863 / 779.478 12825.0 44.91640090942383 50 20 10 10 10 4.949530279710581 20.20393741400596 0.0 3 0.9907993087797816 12.856376865373413 12825.0 66.5475 0.0 - - - - - - - 195.0 25 15 FYN;HCK;LYN;SRC;YES1 FYN oncogene related to SRC, FGR, YES;hemopoietic cell kinase;v-yes-1 Yamaguchi sarcoma viral related oncogene homolog;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 305 39 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534065.[MT7]-GSLLDFLK[MT7].2y3_1.heavy 590.863 / 551.367 38924.0 44.91640090942383 50 20 10 10 10 4.949530279710581 20.20393741400596 0.0 3 0.9907993087797816 12.856376865373413 38924.0 79.00130370370371 0.0 - - - - - - - 716.6666666666666 77 9 FYN;HCK;LYN;SRC;YES1 FYN oncogene related to SRC, FGR, YES;hemopoietic cell kinase;v-yes-1 Yamaguchi sarcoma viral related oncogene homolog;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 307 39 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534065.[MT7]-GSLLDFLK[MT7].2b5_1.heavy 590.863 / 630.358 35324.0 44.91640090942383 50 20 10 10 10 4.949530279710581 20.20393741400596 0.0 3 0.9907993087797816 12.856376865373413 35324.0 70.31553882352941 0.0 - - - - - - - 279.54545454545456 70 11 FYN;HCK;LYN;SRC;YES1 FYN oncogene related to SRC, FGR, YES;hemopoietic cell kinase;v-yes-1 Yamaguchi sarcoma viral related oncogene homolog;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 309 40 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534677.[MT7]-ATTTTANTAPAYQPPAAYK[MT7].3y3_1.heavy 742.726 / 525.315 13763.0 27.293699264526367 46 16 10 10 10 5.274155123134231 18.960382784603 0.0 3 0.9678850638650632 6.868148167916387 13763.0 34.15569224041797 0.0 - - - - - - - 762.6666666666666 27 12 CLDN14 claudin 14 311 40 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534677.[MT7]-ATTTTANTAPAYQPPAAYK[MT7].3y6_1.heavy 742.726 / 790.458 124218.0 27.293699264526367 46 16 10 10 10 5.274155123134231 18.960382784603 0.0 3 0.9678850638650632 6.868148167916387 124218.0 99.8238069006697 0.0 - - - - - - - 768.6666666666666 248 3 CLDN14 claudin 14 313 40 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534677.[MT7]-ATTTTANTAPAYQPPAAYK[MT7].3b7_1.heavy 742.726 / 805.417 14322.0 27.293699264526367 46 16 10 10 10 5.274155123134231 18.960382784603 0.0 3 0.9678850638650632 6.868148167916387 14322.0 36.95594652059379 0.0 - - - - - - - 209.58333333333334 28 12 CLDN14 claudin 14 315 40 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534677.[MT7]-ATTTTANTAPAYQPPAAYK[MT7].3y5_1.heavy 742.726 / 693.405 30600.0 27.293699264526367 46 16 10 10 10 5.274155123134231 18.960382784603 0.0 3 0.9678850638650632 6.868148167916387 30600.0 27.731354446049096 0.0 - - - - - - - 748.7142857142857 61 7 CLDN14 claudin 14 317 41 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534676.[MT7]-RK[MT7]NPDLGFSDYAAAQLR.4y5_1.heavy 553.303 / 558.336 96217.0 31.942800521850586 50 20 10 10 10 7.62719037433288 13.110987807059505 0.0 3 0.9959181011000656 19.31005044233887 96217.0 81.44956872043423 0.0 - - - - - - - 2333.285714285714 192 7 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 319 41 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534676.[MT7]-RK[MT7]NPDLGFSDYAAAQLR.4b7_2.heavy 553.303 / 535.321 21778.0 31.942800521850586 50 20 10 10 10 7.62719037433288 13.110987807059505 0.0 3 0.9959181011000656 19.31005044233887 21778.0 8.25378793758893 0.0 - - - - - - - 1964.0 43 1 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 321 41 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534676.[MT7]-RK[MT7]NPDLGFSDYAAAQLR.4y6_1.heavy 553.303 / 629.373 41771.0 31.942800521850586 50 20 10 10 10 7.62719037433288 13.110987807059505 0.0 3 0.9959181011000656 19.31005044233887 41771.0 44.40793070141562 0.0 - - - - - - - 684.3333333333334 83 3 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 323 41 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534676.[MT7]-RK[MT7]NPDLGFSDYAAAQLR.4b10_2.heavy 553.303 / 709.885 110854.0 31.942800521850586 50 20 10 10 10 7.62719037433288 13.110987807059505 0.0 3 0.9959181011000656 19.31005044233887 110854.0 127.66298239717744 0.0 - - - - - - - 781.0 221 4 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 325 42 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50594.[MT7]-C[CAM]VVFHPFLDEILIGK[MT7].3b4_1.heavy 692.392 / 650.345 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 327 42 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50594.[MT7]-C[CAM]VVFHPFLDEILIGK[MT7].3b5_1.heavy 692.392 / 787.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 329 42 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50594.[MT7]-C[CAM]VVFHPFLDEILIGK[MT7].3y4_1.heavy 692.392 / 574.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 331 42 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50594.[MT7]-C[CAM]VVFHPFLDEILIGK[MT7].3b3_1.heavy 692.392 / 503.277 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 333 43 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1338370.0 30.81049919128418 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1338370.0 1979.784525664138 0.0 - - - - - - - 822.3333333333334 2676 3 335 43 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 412141.0 30.81049919128418 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 412141.0 505.29889737942364 0.0 - - - - - - - 274.0 824 3 337 43 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 456135.0 30.81049919128418 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 456135.0 275.081539303815 0.0 - - - - - - - 1736.111111111111 912 9 339 44 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51559.[MT7]-GIILTDNLTNQLIENVSIYR.3b6_1.heavy 811.787 / 757.458 17257.0 49.60767650604248 43 17 10 6 10 3.1318258380617774 26.24198711139421 0.030300140380859375 3 0.973162219648493 7.51645334886903 17257.0 30.891755446477177 0.0 - - - - - - - 715.7 34 10 LDLRAP1 low density lipoprotein receptor adaptor protein 1 341 44 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51559.[MT7]-GIILTDNLTNQLIENVSIYR.3b4_1.heavy 811.787 / 541.383 33219.0 49.60767650604248 43 17 10 6 10 3.1318258380617774 26.24198711139421 0.030300140380859375 3 0.973162219648493 7.51645334886903 33219.0 42.42286048239736 0.0 - - - - - - - 1169.857142857143 66 7 LDLRAP1 low density lipoprotein receptor adaptor protein 1 343 44 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51559.[MT7]-GIILTDNLTNQLIENVSIYR.3y8_1.heavy 811.787 / 993.536 47943.0 49.60767650604248 43 17 10 6 10 3.1318258380617774 26.24198711139421 0.030300140380859375 3 0.973162219648493 7.51645334886903 47943.0 53.5164083990306 0.0 - - - - - - - 713.4444444444445 95 9 LDLRAP1 low density lipoprotein receptor adaptor protein 1 345 44 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51559.[MT7]-GIILTDNLTNQLIENVSIYR.3b7_1.heavy 811.787 / 871.5 28860.0 49.60767650604248 43 17 10 6 10 3.1318258380617774 26.24198711139421 0.030300140380859375 3 0.973162219648493 7.51645334886903 28860.0 32.04325232217839 0.0 - - - - - - - 589.0 57 7 LDLRAP1 low density lipoprotein receptor adaptor protein 1 347 45 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50193.[MT7]-VMATTGGTNLR.2y8_1.heavy 632.844 / 819.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 349 45 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50193.[MT7]-VMATTGGTNLR.2y9_1.heavy 632.844 / 890.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 351 45 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50193.[MT7]-VMATTGGTNLR.2y10_1.heavy 632.844 / 1021.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 353 45 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50193.[MT7]-VMATTGGTNLR.2y7_1.heavy 632.844 / 718.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 355 46 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533789.[MT7]-VVSPK[MT7].2b3_1.heavy 409.273 / 430.278 14782.0 19.8169002532959 42 16 10 10 6 3.3959375314014206 22.429803944920163 0.0 5 0.9698000279886608 7.083697775001587 14782.0 16.571252362785266 2.0 - - - - - - - 1154.875 48 8 GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 357 46 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533789.[MT7]-VVSPK[MT7].2y4_1.heavy 409.273 / 574.368 49941.0 19.8169002532959 42 16 10 10 6 3.3959375314014206 22.429803944920163 0.0 5 0.9698000279886608 7.083697775001587 49941.0 12.557863639420539 0.0 - - - - - - - 317.0 99 1 GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 359 46 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533789.[MT7]-VVSPK[MT7].2y3_1.heavy 409.273 / 475.3 40439.0 19.8169002532959 42 16 10 10 6 3.3959375314014206 22.429803944920163 0.0 5 0.9698000279886608 7.083697775001587 40439.0 38.408234781204584 1.0 - - - - - - - 158.0 80 1 GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 361 47 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51020.[MT7]-RAIESLVK[MT7].2y5_1.heavy 602.387 / 719.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD4 SMAD family member 4 363 47 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51020.[MT7]-RAIESLVK[MT7].2b4_1.heavy 602.387 / 614.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD4 SMAD family member 4 365 47 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51020.[MT7]-RAIESLVK[MT7].2b6_1.heavy 602.387 / 814.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD4 SMAD family member 4 367 47 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51020.[MT7]-RAIESLVK[MT7].2b7_1.heavy 602.387 / 913.559 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD4 SMAD family member 4 369 48 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534258.[MT7]-HFPC[CAM]PSPESK[MT7].3y6_1.heavy 491.918 / 788.427 2731.0 23.17780065536499 47 20 10 7 10 4.721902044744453 15.722853653098541 0.027200698852539062 3 0.9963309804525495 20.36828585253666 2731.0 0.7967569161751947 1.0 - - - - - - - 227.61111111111111 7 18 TSNARE1 t-SNARE domain containing 1 371 48 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534258.[MT7]-HFPC[CAM]PSPESK[MT7].3y3_1.heavy 491.918 / 507.289 11035.0 23.17780065536499 47 20 10 7 10 4.721902044744453 15.722853653098541 0.027200698852539062 3 0.9963309804525495 20.36828585253666 11035.0 10.480258317202658 0.0 - - - - - - - 673.6666666666666 22 9 TSNARE1 t-SNARE domain containing 1 373 48 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534258.[MT7]-HFPC[CAM]PSPESK[MT7].3b4_1.heavy 491.918 / 686.32 9888.0 23.17780065536499 47 20 10 7 10 4.721902044744453 15.722853653098541 0.027200698852539062 3 0.9963309804525495 20.36828585253666 9888.0 0.4488968114994082 3.0 - - - - - - - 424.8888888888889 23 9 TSNARE1 t-SNARE domain containing 1 375 48 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534258.[MT7]-HFPC[CAM]PSPESK[MT7].3y4_1.heavy 491.918 / 604.342 47362.0 23.17780065536499 47 20 10 7 10 4.721902044744453 15.722853653098541 0.027200698852539062 3 0.9963309804525495 20.36828585253666 47362.0 20.934945374471738 1.0 - - - - - - - 741.4285714285714 94 7 TSNARE1 t-SNARE domain containing 1 377 49 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534342.[MT7]-DSLHTAQQETNK[MT7].3y3_1.heavy 553.956 / 506.306 31536.0 19.008100509643555 50 20 10 10 10 22.829371694999562 4.380322040220824 0.0 3 0.9991852585381475 43.23375627122863 31536.0 191.7386996461379 0.0 - - - - - - - 289.6666666666667 63 12 TSNARE1 t-SNARE domain containing 1 379 49 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534342.[MT7]-DSLHTAQQETNK[MT7].3b4_1.heavy 553.956 / 597.311 10881.0 19.008100509643555 50 20 10 10 10 22.829371694999562 4.380322040220824 0.0 3 0.9991852585381475 43.23375627122863 10881.0 232.61159999999998 0.0 - - - - - - - 174.6 21 15 TSNARE1 t-SNARE domain containing 1 381 49 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534342.[MT7]-DSLHTAQQETNK[MT7].3y4_1.heavy 553.956 / 635.348 20957.0 19.008100509643555 50 20 10 10 10 22.829371694999562 4.380322040220824 0.0 3 0.9991852585381475 43.23375627122863 20957.0 137.23080327675623 0.0 - - - - - - - 187.28571428571428 41 14 TSNARE1 t-SNARE domain containing 1 383 49 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534342.[MT7]-DSLHTAQQETNK[MT7].3y5_1.heavy 553.956 / 763.407 11486.0 19.008100509643555 50 20 10 10 10 22.829371694999562 4.380322040220824 0.0 3 0.9991852585381475 43.23375627122863 11486.0 65.2086770734784 0.0 - - - - - - - 225.0 22 15 TSNARE1 t-SNARE domain containing 1 385 50 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534345.[MT7]-QLYQTLTDYDIR.3y6_1.heavy 558.294 / 782.368 39219.0 38.877899169921875 46 20 10 6 10 19.48486482845967 5.132188541228143 0.0355987548828125 3 0.9966623723166242 21.356130131896048 39219.0 163.13430251604416 0.0 - - - - - - - 200.66666666666666 78 15 CSNK2A1 casein kinase 2, alpha 1 polypeptide 387 50 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534345.[MT7]-QLYQTLTDYDIR.3b4_1.heavy 558.294 / 677.374 16473.0 38.877899169921875 46 20 10 6 10 19.48486482845967 5.132188541228143 0.0355987548828125 3 0.9966623723166242 21.356130131896048 16473.0 30.20774561761109 0.0 - - - - - - - 585.4 32 15 CSNK2A1 casein kinase 2, alpha 1 polypeptide 389 50 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534345.[MT7]-QLYQTLTDYDIR.3y4_1.heavy 558.294 / 566.293 28515.0 38.877899169921875 46 20 10 6 10 19.48486482845967 5.132188541228143 0.0355987548828125 3 0.9966623723166242 21.356130131896048 28515.0 37.92201030927835 0.0 - - - - - - - 694.2 57 10 CSNK2A1 casein kinase 2, alpha 1 polypeptide 391 50 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534345.[MT7]-QLYQTLTDYDIR.3b3_1.heavy 558.294 / 549.315 32111.0 38.877899169921875 46 20 10 6 10 19.48486482845967 5.132188541228143 0.0355987548828125 3 0.9966623723166242 21.356130131896048 32111.0 29.565072700531665 0.0 - - - - - - - 1625.7777777777778 64 9 CSNK2A1 casein kinase 2, alpha 1 polypeptide 393 51 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51299.[MT7]-GVTQYYAYVTER.2y8_1.heavy 797.405 / 1064.5 17641.0 35.655999183654785 39 15 10 6 8 2.2848075767498224 34.75243590213074 0.037197113037109375 4 0.9595071821011549 6.112190524459708 17641.0 100.28094638403991 0.0 - - - - - - - 207.35714285714286 35 14 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 395 51 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51299.[MT7]-GVTQYYAYVTER.2b4_1.heavy 797.405 / 530.305 11126.0 35.655999183654785 39 15 10 6 8 2.2848075767498224 34.75243590213074 0.037197113037109375 4 0.9595071821011549 6.112190524459708 11126.0 51.7359 1.0 - - - - - - - 240.5 23 10 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 397 51 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51299.[MT7]-GVTQYYAYVTER.2y6_1.heavy 797.405 / 738.378 6114.0 35.655999183654785 39 15 10 6 8 2.2848075767498224 34.75243590213074 0.037197113037109375 4 0.9595071821011549 6.112190524459708 6114.0 42.60970099750623 0.0 - - - - - - - 237.875 12 16 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 399 51 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51299.[MT7]-GVTQYYAYVTER.2b5_1.heavy 797.405 / 693.369 8620.0 35.655999183654785 39 15 10 6 8 2.2848075767498224 34.75243590213074 0.037197113037109375 4 0.9595071821011549 6.112190524459708 8620.0 96.51302994011975 0.0 - - - - - - - 257.7142857142857 17 14 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 401 52 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534151.[MT7]-GFAFVYFER.2y8_1.heavy 640.333 / 1078.54 13358.0 43.71839904785156 46 16 10 10 10 2.6336478133719936 37.970149042808 0.0 3 0.9679098930943423 6.870819102441606 13358.0 28.40296391752577 0.0 - - - - - - - 195.9090909090909 26 11 TRA2A transformer 2 alpha homolog (Drosophila) 403 52 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534151.[MT7]-GFAFVYFER.2b4_1.heavy 640.333 / 567.305 15168.0 43.71839904785156 46 16 10 10 10 2.6336478133719936 37.970149042808 0.0 3 0.9679098930943423 6.870819102441606 15168.0 18.69603335149746 0.0 - - - - - - - 723.9 30 10 TRA2A transformer 2 alpha homolog (Drosophila) 405 52 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534151.[MT7]-GFAFVYFER.2y6_1.heavy 640.333 / 860.43 13875.0 43.71839904785156 46 16 10 10 10 2.6336478133719936 37.970149042808 0.0 3 0.9679098930943423 6.870819102441606 13875.0 41.736176590419646 0.0 - - - - - - - 265.9166666666667 27 12 TRA2A transformer 2 alpha homolog (Drosophila) 407 52 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534151.[MT7]-GFAFVYFER.2b5_1.heavy 640.333 / 666.373 10514.0 43.71839904785156 46 16 10 10 10 2.6336478133719936 37.970149042808 0.0 3 0.9679098930943423 6.870819102441606 10514.0 32.779966832504144 0.0 - - - - - - - 566.1428571428571 21 7 TRA2A transformer 2 alpha homolog (Drosophila) 409 53 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534346.[MT7]-IDLAGSSLSGILDK[MT7].3y6_1.heavy 559.661 / 776.463 13753.0 42.075199127197266 45 15 10 10 10 3.118450456277405 32.0672081862648 0.0 3 0.9585975146557514 6.044205930425671 13753.0 36.5318380477902 0.0 - - - - - - - 305.09090909090907 27 11 SH3KBP1 SH3-domain kinase binding protein 1 411 53 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534346.[MT7]-IDLAGSSLSGILDK[MT7].3y3_1.heavy 559.661 / 519.326 57221.0 42.075199127197266 45 15 10 10 10 3.118450456277405 32.0672081862648 0.0 3 0.9585975146557514 6.044205930425671 57221.0 34.924789025687126 0.0 - - - - - - - 841.8571428571429 114 7 SH3KBP1 SH3-domain kinase binding protein 1 413 53 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534346.[MT7]-IDLAGSSLSGILDK[MT7].3b4_1.heavy 559.661 / 557.341 14653.0 42.075199127197266 45 15 10 10 10 3.118450456277405 32.0672081862648 0.0 3 0.9585975146557514 6.044205930425671 14653.0 52.72412220957891 0.0 - - - - - - - 306.75 29 8 SH3KBP1 SH3-domain kinase binding protein 1 415 53 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534346.[MT7]-IDLAGSSLSGILDK[MT7].3b5_1.heavy 559.661 / 614.363 11706.0 42.075199127197266 45 15 10 10 10 3.118450456277405 32.0672081862648 0.0 3 0.9585975146557514 6.044205930425671 11706.0 20.68107286192217 0.0 - - - - - - - 275.45454545454544 23 11 SH3KBP1 SH3-domain kinase binding protein 1 417 54 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534255.[MT7]-IGSGFDNIDIK[MT7].3b6_1.heavy 489.608 / 721.364 26340.0 36.042999267578125 43 13 10 10 10 2.1819658500271113 45.83023148540913 0.0 3 0.9191840428743571 4.3116614795877375 26340.0 61.2538630650353 0.0 - - - - - - - 670.3333333333334 52 9 CTBP1 C-terminal binding protein 1 419 54 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534255.[MT7]-IGSGFDNIDIK[MT7].3y3_1.heavy 489.608 / 519.326 69771.0 36.042999267578125 43 13 10 10 10 2.1819658500271113 45.83023148540913 0.0 3 0.9191840428743571 4.3116614795877375 69771.0 69.56191251739243 0.0 - - - - - - - 2240.5714285714284 139 7 CTBP1 C-terminal binding protein 1 421 54 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534255.[MT7]-IGSGFDNIDIK[MT7].3b5_1.heavy 489.608 / 606.337 26340.0 36.042999267578125 43 13 10 10 10 2.1819658500271113 45.83023148540913 0.0 3 0.9191840428743571 4.3116614795877375 26340.0 39.4007960199005 0.0 - - - - - - - 316.0 52 7 CTBP1 C-terminal binding protein 1 423 54 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534255.[MT7]-IGSGFDNIDIK[MT7].3b7_1.heavy 489.608 / 835.407 25737.0 36.042999267578125 43 13 10 10 10 2.1819658500271113 45.83023148540913 0.0 3 0.9191840428743571 4.3116614795877375 25737.0 9.470935518441557 1.0 - - - - - - - 276.75 100 4 CTBP1 C-terminal binding protein 1 425 55 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 899236.0 16.913832982381184 24 -3 10 7 10 null 0.0 0.022998809814453125 3 0.0 0.0 899236.0 2567.257031946363 0.0 - - - - - - - 757.875 1798 8 427 55 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 1433520.0 16.913832982381184 24 -3 10 7 10 null 0.0 0.022998809814453125 3 0.0 0.0 1433520.0 3351.388847710123 0.0 - - - - - - - 801.7142857142857 2867 7 429 55 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 658328.0 16.913832982381184 24 -3 10 7 10 null 0.0 0.022998809814453125 3 0.0 0.0 658328.0 1429.1860939214023 0.0 - - - - - - - 775.2857142857143 1316 7 431 56 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534445.[MT7]-DNRAPSVTSATHSGYR.4y5_1.heavy 466.486 / 619.295 18605.0 20.15250015258789 45 17 10 10 8 4.659632852230228 21.46091831079293 0.0 4 0.9762571509624615 7.99342504335677 18605.0 26.76338182903232 0.0 - - - - - - - 1666.875 37 8 CLDN14 claudin 14 433 56 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534445.[MT7]-DNRAPSVTSATHSGYR.4y4_1.heavy 466.486 / 482.236 67752.0 20.15250015258789 45 17 10 10 8 4.659632852230228 21.46091831079293 0.0 4 0.9762571509624615 7.99342504335677 67752.0 69.98230749700069 0.0 - - - - - - - 645.0 135 1 CLDN14 claudin 14 435 56 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534445.[MT7]-DNRAPSVTSATHSGYR.4b4_1.heavy 466.486 / 601.317 7313.0 20.15250015258789 45 17 10 10 8 4.659632852230228 21.46091831079293 0.0 4 0.9762571509624615 7.99342504335677 7313.0 5.644322375597286 1.0 - - - - - - - 794.1538461538462 40 13 CLDN14 claudin 14 437 56 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534445.[MT7]-DNRAPSVTSATHSGYR.4b6_1.heavy 466.486 / 785.402 2581.0 20.15250015258789 45 17 10 10 8 4.659632852230228 21.46091831079293 0.0 4 0.9762571509624615 7.99342504335677 2581.0 26.819210891232125 0.0 - - - - - - - 188.27777777777777 5 18 CLDN14 claudin 14 439 57 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533893.[MT7]-AAGLC[CAM]C[CAM]R.2y5_1.heavy 476.235 / 665.286 6332.0 19.74449920654297 50 20 10 10 10 6.314172363426468 15.837388377173426 0.0 3 0.9929215314507793 14.66007543300126 6332.0 42.83565145774996 0.0 - - - - - - - 226.54545454545453 12 11 FYN FYN oncogene related to SRC, FGR, YES 441 57 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533893.[MT7]-AAGLC[CAM]C[CAM]R.2y3_1.heavy 476.235 / 495.18 3529.0 19.74449920654297 50 20 10 10 10 6.314172363426468 15.837388377173426 0.0 3 0.9929215314507793 14.66007543300126 3529.0 15.842679826765906 0.0 - - - - - - - 268.5882352941176 7 17 FYN FYN oncogene related to SRC, FGR, YES 443 57 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533893.[MT7]-AAGLC[CAM]C[CAM]R.2y6_1.heavy 476.235 / 736.323 16868.0 19.74449920654297 50 20 10 10 10 6.314172363426468 15.837388377173426 0.0 3 0.9929215314507793 14.66007543300126 16868.0 52.74111890387497 0.0 - - - - - - - 283.61538461538464 33 13 FYN FYN oncogene related to SRC, FGR, YES 445 57 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533893.[MT7]-AAGLC[CAM]C[CAM]R.2b5_1.heavy 476.235 / 617.32 3218.0 19.74449920654297 50 20 10 10 10 6.314172363426468 15.837388377173426 0.0 3 0.9929215314507793 14.66007543300126 3218.0 12.707780544842365 1.0 - - - - - - - 335.70588235294116 6 17 FYN FYN oncogene related to SRC, FGR, YES 447 58 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534252.[MT7]-IPDEIIDMVK[MT7].3y3_1.heavy 487.614 / 521.324 26885.0 43.845476150512695 44 20 10 6 8 6.372562717685543 15.692273961066498 0.03949737548828125 4 0.9950875561603567 17.60093029214303 26885.0 37.65519578313253 2.0 - - - - - - - 249.0 53 10 LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 449 58 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534252.[MT7]-IPDEIIDMVK[MT7].3b4_1.heavy 487.614 / 599.316 43314.0 43.845476150512695 44 20 10 6 8 6.372562717685543 15.692273961066498 0.03949737548828125 4 0.9950875561603567 17.60093029214303 43314.0 97.06510843373493 0.0 - - - - - - - 238.625 86 8 LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 451 58 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534252.[MT7]-IPDEIIDMVK[MT7].3b5_1.heavy 487.614 / 712.4 23483.0 43.845476150512695 44 20 10 6 8 6.372562717685543 15.692273961066498 0.03949737548828125 4 0.9950875561603567 17.60093029214303 23483.0 230.35031124497993 0.0 - - - - - - - 218.8181818181818 46 11 LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 453 58 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534252.[MT7]-IPDEIIDMVK[MT7].3y4_1.heavy 487.614 / 636.351 30038.0 43.845476150512695 44 20 10 6 8 6.372562717685543 15.692273961066498 0.03949737548828125 4 0.9950875561603567 17.60093029214303 30038.0 60.31726907630522 1.0 - - - - - - - 235.16666666666666 70 6 LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 455 59 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50973.[MT7]-GASQAGAPQGR.2b6_1.heavy 572.303 / 616.317 1698.0 14.837800025939941 45 15 10 10 10 2.1288523736923466 37.16377981260425 0.0 3 0.9503576434854893 5.515983771376246 1698.0 67.33492134831461 0.0 - - - - - - - 101.4 3 10 GSN gelsolin 457 59 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50973.[MT7]-GASQAGAPQGR.2y6_1.heavy 572.303 / 585.31 3694.0 14.837800025939941 45 15 10 10 10 2.1288523736923466 37.16377981260425 0.0 3 0.9503576434854893 5.515983771376246 3694.0 51.54021150033047 0.0 - - - - - - - 101.46666666666667 7 15 GSN gelsolin 459 59 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50973.[MT7]-GASQAGAPQGR.2y10_1.heavy 572.303 / 942.475 1549.0 14.837800025939941 45 15 10 10 10 2.1288523736923466 37.16377981260425 0.0 3 0.9503576434854893 5.515983771376246 1549.0 64.21098127340824 0.0 - - - - - - - 66.07142857142857 3 14 GSN gelsolin 461 59 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50973.[MT7]-GASQAGAPQGR.2y7_1.heavy 572.303 / 656.347 2740.0 14.837800025939941 45 15 10 10 10 2.1288523736923466 37.16377981260425 0.0 3 0.9503576434854893 5.515983771376246 2740.0 45.812406760456994 0.0 - - - - - - - 84.29411764705883 5 17 GSN gelsolin 463 60 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534158.[MT7]-EMVQEDQK[MT7].3y3_1.heavy 432.223 / 534.3 18516.0 20.18950080871582 50 20 10 10 10 9.468477994920049 10.561359497656454 0.0 3 0.9936607622057393 15.492237864673116 18516.0 15.528510048736406 0.0 - - - - - - - 406.8 37 5 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 465 60 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534158.[MT7]-EMVQEDQK[MT7].3b4_1.heavy 432.223 / 632.319 17285.0 20.18950080871582 50 20 10 10 10 9.468477994920049 10.561359497656454 0.0 3 0.9936607622057393 15.492237864673116 17285.0 43.56631999007526 0.0 - - - - - - - 1230.7142857142858 34 7 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 467 60 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534158.[MT7]-EMVQEDQK[MT7].3y4_1.heavy 432.223 / 663.343 9900.0 20.18950080871582 50 20 10 10 10 9.468477994920049 10.561359497656454 0.0 3 0.9936607622057393 15.492237864673116 9900.0 35.13420560747663 0.0 - - - - - - - 231.0 19 16 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 469 60 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534158.[MT7]-EMVQEDQK[MT7].3b3_1.heavy 432.223 / 504.261 57689.0 20.18950080871582 50 20 10 10 10 9.468477994920049 10.561359497656454 0.0 3 0.9936607622057393 15.492237864673116 57689.0 53.2463945022183 0.0 - - - - - - - 1773.7142857142858 115 7 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 471 61 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49813.[MT7]-ELLEK[MT7].2b3_1.heavy 460.289 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - MPHOSPH10;BAZ1A;PDE12;KIF1B;FLG;BRPF3;CCDC113;FLG2;NEDD9;NIN;PHEX;KIF1A;SNX16;NDST4;THOP1;BCAR1;TTC37;RB1CC1 M-phase phosphoprotein 10 (U3 small nucleolar ribonucleoprotein);bromodomain adjacent to zinc finger domain, 1A;phosphodiesterase 12;kinesin family member 1B;filaggrin;bromodomain and PHD finger containing, 3;coiled-coil domain containing 113;filaggrin family member 2;neural precursor cell expressed, developmentally down-regulated 9;ninein (GSK3B interacting protein);phosphate regulating endopeptidase homolog, X-linked;kinesin family member 1A;sorting nexin 16;N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4;thimet oligopeptidase 1;breast cancer anti-estrogen resistance 1;tetratricopeptide repeat domain 37;RB1-inducible coiled-coil 1 473 61 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49813.[MT7]-ELLEK[MT7].2y4_1.heavy 460.289 / 646.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - MPHOSPH10;BAZ1A;PDE12;KIF1B;FLG;BRPF3;CCDC113;FLG2;NEDD9;NIN;PHEX;KIF1A;SNX16;NDST4;THOP1;BCAR1;TTC37;RB1CC1 M-phase phosphoprotein 10 (U3 small nucleolar ribonucleoprotein);bromodomain adjacent to zinc finger domain, 1A;phosphodiesterase 12;kinesin family member 1B;filaggrin;bromodomain and PHD finger containing, 3;coiled-coil domain containing 113;filaggrin family member 2;neural precursor cell expressed, developmentally down-regulated 9;ninein (GSK3B interacting protein);phosphate regulating endopeptidase homolog, X-linked;kinesin family member 1A;sorting nexin 16;N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4;thimet oligopeptidase 1;breast cancer anti-estrogen resistance 1;tetratricopeptide repeat domain 37;RB1-inducible coiled-coil 1 475 61 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49813.[MT7]-ELLEK[MT7].2y3_1.heavy 460.289 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - MPHOSPH10;BAZ1A;PDE12;KIF1B;FLG;BRPF3;CCDC113;FLG2;NEDD9;NIN;PHEX;KIF1A;SNX16;NDST4;THOP1;BCAR1;TTC37;RB1CC1 M-phase phosphoprotein 10 (U3 small nucleolar ribonucleoprotein);bromodomain adjacent to zinc finger domain, 1A;phosphodiesterase 12;kinesin family member 1B;filaggrin;bromodomain and PHD finger containing, 3;coiled-coil domain containing 113;filaggrin family member 2;neural precursor cell expressed, developmentally down-regulated 9;ninein (GSK3B interacting protein);phosphate regulating endopeptidase homolog, X-linked;kinesin family member 1A;sorting nexin 16;N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4;thimet oligopeptidase 1;breast cancer anti-estrogen resistance 1;tetratricopeptide repeat domain 37;RB1-inducible coiled-coil 1 477 62 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50668.[MT7]-AAHGPSPGSGK[MT7]PQALALTPVEQVVAK[MT7].4y4_1.heavy 736.425 / 560.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 479 62 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50668.[MT7]-AAHGPSPGSGK[MT7]PQALALTPVEQVVAK[MT7].4b15_2.heavy 736.425 / 822.957 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 481 62 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50668.[MT7]-AAHGPSPGSGK[MT7]PQALALTPVEQVVAK[MT7].4b13_2.heavy 736.425 / 730.896 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 483 62 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50668.[MT7]-AAHGPSPGSGK[MT7]PQALALTPVEQVVAK[MT7].4b14_2.heavy 736.425 / 766.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 485 63 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533895.[MT7]-IQFQK[MT7].2b3_1.heavy 476.297 / 533.32 7403.0 27.71489906311035 40 20 4 10 6 21.09112199663814 4.741331448177091 0.0 5 0.9972141555176253 23.37669232414903 7403.0 7.140559191593139 3.0 - - - - - - - 1239.5 35 8 IGSF5 immunoglobulin superfamily, member 5 487 63 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533895.[MT7]-IQFQK[MT7].2y4_1.heavy 476.297 / 694.4 24934.0 27.71489906311035 40 20 4 10 6 21.09112199663814 4.741331448177091 0.0 5 0.9972141555176253 23.37669232414903 24934.0 58.28610642641577 0.0 - - - - - - - 775.3 49 10 IGSF5 immunoglobulin superfamily, member 5 489 63 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533895.[MT7]-IQFQK[MT7].2b4_1.heavy 476.297 / 661.379 4121.0 27.71489906311035 40 20 4 10 6 21.09112199663814 4.741331448177091 0.0 5 0.9972141555176253 23.37669232414903 4121.0 7.055601421333122 1.0 - - - - - - - 671.6153846153846 83 13 IGSF5 immunoglobulin superfamily, member 5 491 63 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533895.[MT7]-IQFQK[MT7].2y3_1.heavy 476.297 / 566.342 24445.0 27.71489906311035 40 20 4 10 6 21.09112199663814 4.741331448177091 0.0 5 0.9972141555176253 23.37669232414903 24445.0 32.82676812891674 0.0 - - - - - - - 1132.888888888889 48 9 IGSF5 immunoglobulin superfamily, member 5 493 64 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50021.[MT7]-VDYSITK[MT7].2b3_1.heavy 557.323 / 522.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRA2A transformer 2 alpha homolog (Drosophila) 495 64 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50021.[MT7]-VDYSITK[MT7].2y4_1.heavy 557.323 / 592.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRA2A transformer 2 alpha homolog (Drosophila) 497 64 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50021.[MT7]-VDYSITK[MT7].2y5_1.heavy 557.323 / 755.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRA2A transformer 2 alpha homolog (Drosophila) 499 64 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50021.[MT7]-VDYSITK[MT7].2y6_1.heavy 557.323 / 870.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRA2A transformer 2 alpha homolog (Drosophila) 501 65 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533897.[MT7]-VGQAVALR.2b4_1.heavy 479.302 / 500.295 16717.0 26.021099090576172 50 20 10 10 10 5.54536198628839 18.033087875464695 0.0 3 0.9943872376647778 16.465339931386715 16717.0 17.8061341076502 0.0 - - - - - - - 1182.875 33 8 CTBP1 C-terminal binding protein 1 503 65 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533897.[MT7]-VGQAVALR.2b6_1.heavy 479.302 / 670.4 13401.0 26.021099090576172 50 20 10 10 10 5.54536198628839 18.033087875464695 0.0 3 0.9943872376647778 16.465339931386715 13401.0 20.085074378732628 1.0 - - - - - - - 768.625 32 8 CTBP1 C-terminal binding protein 1 505 65 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533897.[MT7]-VGQAVALR.2b5_1.heavy 479.302 / 599.363 13263.0 26.021099090576172 50 20 10 10 10 5.54536198628839 18.033087875464695 0.0 3 0.9943872376647778 16.465339931386715 13263.0 13.576078159510534 1.0 - - - - - - - 1251.75 26 8 CTBP1 C-terminal binding protein 1 507 65 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533897.[MT7]-VGQAVALR.2y7_1.heavy 479.302 / 714.426 65970.0 26.021099090576172 50 20 10 10 10 5.54536198628839 18.033087875464695 0.0 3 0.9943872376647778 16.465339931386715 65970.0 120.96907058274493 0.0 - - - - - - - 770.6153846153846 131 13 CTBP1 C-terminal binding protein 1 509 66 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49810.[MT7]-QIEIK[MT7].2y4_1.heavy 459.797 / 646.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - GJA1 gap junction protein, alpha 1, 43kDa 511 66 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49810.[MT7]-QIEIK[MT7].2b3_1.heavy 459.797 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - GJA1 gap junction protein, alpha 1, 43kDa 513 66 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49810.[MT7]-QIEIK[MT7].2b4_1.heavy 459.797 / 628.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - GJA1 gap junction protein, alpha 1, 43kDa 515 66 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49810.[MT7]-QIEIK[MT7].2y3_1.heavy 459.797 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - GJA1 gap junction protein, alpha 1, 43kDa 517 67 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50020.[MT7]-SIIETMK[MT7].2y4_1.heavy 555.328 / 652.346 19690.0 35.08739980061849 25 5 10 6 4 0.35340558930781907 118.00850935006748 0.039897918701171875 9 0.6784935688258454 2.115329322445973 19690.0 50.19191790053715 0.0 - - - - - - - 301.3333333333333 39 3 SH3KBP1 SH3-domain kinase binding protein 1 519 67 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50020.[MT7]-SIIETMK[MT7].2y5_1.heavy 555.328 / 765.43 14667.0 35.08739980061849 25 5 10 6 4 0.35340558930781907 118.00850935006748 0.039897918701171875 9 0.6784935688258454 2.115329322445973 14667.0 39.49374796372122 0.0 - - - - - - - 680.8888888888889 29 9 SH3KBP1 SH3-domain kinase binding protein 1 521 67 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50020.[MT7]-SIIETMK[MT7].2y3_1.heavy 555.328 / 523.303 2210.0 35.08739980061849 25 5 10 6 4 0.35340558930781907 118.00850935006748 0.039897918701171875 9 0.6784935688258454 2.115329322445973 2210.0 1.149004424778761 16.0 - - - - - - - 804.0 7 3 SH3KBP1 SH3-domain kinase binding protein 1 523 67 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50020.[MT7]-SIIETMK[MT7].2y6_1.heavy 555.328 / 878.514 N/A 35.08739980061849 25 5 10 6 4 0.35340558930781907 118.00850935006748 0.039897918701171875 9 0.6784935688258454 2.115329322445973 301.0 0.2568990042674253 23.0 - - - - - - - 255.54545454545453 2 11 SH3KBP1 SH3-domain kinase binding protein 1 525 68 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533898.[MT7]-VAAAMPVR.2y5_1.heavy 479.785 / 573.318 16376.0 26.376800537109375 50 20 10 10 10 10.544160674100393 9.483922247659775 0.0 3 0.9960124529545158 19.537322258218325 16376.0 9.217289789570444 0.0 - - - - - - - 1169.5714285714287 32 7 SNW1 SNW domain containing 1 527 68 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533898.[MT7]-VAAAMPVR.2y6_1.heavy 479.785 / 644.355 18735.0 26.376800537109375 50 20 10 10 10 10.544160674100393 9.483922247659775 0.0 3 0.9960124529545158 19.537322258218325 18735.0 45.793288050250155 0.0 - - - - - - - 797.9166666666666 37 12 SNW1 SNW domain containing 1 529 68 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533898.[MT7]-VAAAMPVR.2b5_1.heavy 479.785 / 588.33 15682.0 26.376800537109375 50 20 10 10 10 10.544160674100393 9.483922247659775 0.0 3 0.9960124529545158 19.537322258218325 15682.0 15.170264782994952 0.0 - - - - - - - 1189.5714285714287 31 7 SNW1 SNW domain containing 1 531 68 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533898.[MT7]-VAAAMPVR.2y7_1.heavy 479.785 / 715.392 69180.0 26.376800537109375 50 20 10 10 10 10.544160674100393 9.483922247659775 0.0 3 0.9960124529545158 19.537322258218325 69180.0 46.794942937890525 0.0 - - - - - - - 360.8 138 5 SNW1 SNW domain containing 1 533 69 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533899.[MT7]-QLLAGASR.2b3_1.heavy 480.291 / 499.336 10216.0 24.8427996635437 44 20 10 6 8 12.537678871281626 7.975957992436426 0.03560066223144531 4 0.9969784263832797 22.445865947335808 10216.0 11.908366847448198 1.0 - - - - - - - 403.0 29 3 TSNARE1 t-SNARE domain containing 1 535 69 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533899.[MT7]-QLLAGASR.2y6_1.heavy 480.291 / 574.331 22125.0 24.8427996635437 44 20 10 6 8 12.537678871281626 7.975957992436426 0.03560066223144531 4 0.9969784263832797 22.445865947335808 22125.0 24.905034532897126 0.0 - - - - - - - 423.3333333333333 44 3 TSNARE1 t-SNARE domain containing 1 537 69 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533899.[MT7]-QLLAGASR.2b5_1.heavy 480.291 / 627.395 7254.0 24.8427996635437 44 20 10 6 8 12.537678871281626 7.975957992436426 0.03560066223144531 4 0.9969784263832797 22.445865947335808 7254.0 15.695555487995552 0.0 - - - - - - - 613.2857142857143 14 7 TSNARE1 t-SNARE domain containing 1 539 69 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533899.[MT7]-QLLAGASR.2y7_1.heavy 480.291 / 687.415 34154.0 24.8427996635437 44 20 10 6 8 12.537678871281626 7.975957992436426 0.03560066223144531 4 0.9969784263832797 22.445865947335808 34154.0 79.88639569059877 0.0 - - - - - - - 665.0 68 7 TSNARE1 t-SNARE domain containing 1 541 70 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534761.[MT7]-DVATVAFC[CAM]DAQSTQEIHEK[MT7].4b4_1.heavy 610.053 / 531.289 42019.0 32.64390182495117 48 18 10 10 10 3.074972262627576 27.465705297117225 0.0 3 0.9805030126566585 8.824100780038421 42019.0 36.9291554323723 0.0 - - - - - - - 463.0 84 1 CTBP1 C-terminal binding protein 1 543 70 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534761.[MT7]-DVATVAFC[CAM]DAQSTQEIHEK[MT7].4b5_1.heavy 610.053 / 630.358 38965.0 32.64390182495117 48 18 10 10 10 3.074972262627576 27.465705297117225 0.0 3 0.9805030126566585 8.824100780038421 38965.0 39.50428391262746 0.0 - - - - - - - 1147.6 77 10 CTBP1 C-terminal binding protein 1 545 70 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534761.[MT7]-DVATVAFC[CAM]DAQSTQEIHEK[MT7].4y3_1.heavy 610.053 / 557.316 57753.0 32.64390182495117 48 18 10 10 10 3.074972262627576 27.465705297117225 0.0 3 0.9805030126566585 8.824100780038421 57753.0 36.402294395179915 0.0 - - - - - - - 1712.1 115 10 CTBP1 C-terminal binding protein 1 547 70 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534761.[MT7]-DVATVAFC[CAM]DAQSTQEIHEK[MT7].4b6_1.heavy 610.053 / 701.395 77189.0 32.64390182495117 48 18 10 10 10 3.074972262627576 27.465705297117225 0.0 3 0.9805030126566585 8.824100780038421 77189.0 103.6539765449888 0.0 - - - - - - - 1295.625 154 8 CTBP1 C-terminal binding protein 1 549 71 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534050.[MT7]-EVLEQVER.2y5_1.heavy 573.318 / 660.331 41289.0 27.71489906311035 48 18 10 10 10 6.2805355297253485 15.9222091056896 0.0 3 0.9894020357235132 11.977518314438102 41289.0 85.6227214202107 0.0 - - - - - - - 749.4545454545455 82 11 FYN;YES1 FYN oncogene related to SRC, FGR, YES;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 551 71 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534050.[MT7]-EVLEQVER.2b4_1.heavy 573.318 / 615.347 35980.0 27.71489906311035 48 18 10 10 10 6.2805355297253485 15.9222091056896 0.0 3 0.9894020357235132 11.977518314438102 35980.0 59.19916773514937 0.0 - - - - - - - 751.25 71 12 FYN;YES1 FYN oncogene related to SRC, FGR, YES;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 553 71 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534050.[MT7]-EVLEQVER.2y6_1.heavy 573.318 / 773.415 59873.0 27.71489906311035 48 18 10 10 10 6.2805355297253485 15.9222091056896 0.0 3 0.9894020357235132 11.977518314438102 59873.0 92.44532814510313 0.0 - - - - - - - 669.0 119 7 FYN;YES1 FYN oncogene related to SRC, FGR, YES;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 555 71 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534050.[MT7]-EVLEQVER.2y7_1.heavy 573.318 / 872.484 112341.0 27.71489906311035 48 18 10 10 10 6.2805355297253485 15.9222091056896 0.0 3 0.9894020357235132 11.977518314438102 112341.0 112.69022484870091 0.0 - - - - - - - 789.5 224 10 FYN;YES1 FYN oncogene related to SRC, FGR, YES;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 557 72 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50568.[MT7]-LPDDTTFPLPPPRPK[MT7].3y6_1.heavy 660.378 / 835.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 559 72 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50568.[MT7]-LPDDTTFPLPPPRPK[MT7].3b4_1.heavy 660.378 / 585.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 561 72 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50568.[MT7]-LPDDTTFPLPPPRPK[MT7].3y8_1.heavy 660.378 / 1045.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 563 72 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50568.[MT7]-LPDDTTFPLPPPRPK[MT7].3y5_1.heavy 660.378 / 738.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 565 73 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51542.[MT7]-AFGFNVLFYDPYLSDGVER.3b6_1.heavy 785.059 / 780.416 56132.0 51.8380012512207 42 12 10 10 10 1.2048225669843406 55.18069142455519 0.0 3 0.8980731352846795 3.832288934782189 56132.0 23.440885904609935 0.0 - - - - - - - 327.0 112 1 CTBP1 C-terminal binding protein 1 567 73 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51542.[MT7]-AFGFNVLFYDPYLSDGVER.3b4_1.heavy 785.059 / 567.305 15879.0 51.8380012512207 42 12 10 10 10 1.2048225669843406 55.18069142455519 0.0 3 0.8980731352846795 3.832288934782189 15879.0 21.00594881907408 0.0 - - - - - - - 265.0 31 6 CTBP1 C-terminal binding protein 1 569 73 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51542.[MT7]-AFGFNVLFYDPYLSDGVER.3b5_1.heavy 785.059 / 681.348 58593.0 51.8380012512207 42 12 10 10 10 1.2048225669843406 55.18069142455519 0.0 3 0.8980731352846795 3.832288934782189 58593.0 -0.6587183811129851 0.0 - - - - - - - 545.0 117 1 CTBP1 C-terminal binding protein 1 571 73 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51542.[MT7]-AFGFNVLFYDPYLSDGVER.3y9_1.heavy 785.059 / 1035.51 77434.0 51.8380012512207 42 12 10 10 10 1.2048225669843406 55.18069142455519 0.0 3 0.8980731352846795 3.832288934782189 77434.0 23.36976217778299 0.0 - - - - - - - 860.5 154 2 CTBP1 C-terminal binding protein 1 573 74 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534058.[MT7]-FLNELIK[MT7].2y5_1.heavy 582.865 / 760.469 17787.0 39.88052558898926 46 20 10 6 10 6.224941936985242 16.064406867131407 0.03350067138671875 3 0.9923304746380971 14.083161684113165 17787.0 37.493384192859324 0.0 - - - - - - - 843.5555555555555 35 9 GGA2;GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 2;golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 575 74 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534058.[MT7]-FLNELIK[MT7].2b4_1.heavy 582.865 / 648.347 15811.0 39.88052558898926 46 20 10 6 10 6.224941936985242 16.064406867131407 0.03350067138671875 3 0.9923304746380971 14.083161684113165 15811.0 36.397280813834705 0.0 - - - - - - - 287.27272727272725 31 11 GGA2;GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 2;golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 577 74 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534058.[MT7]-FLNELIK[MT7].2y3_1.heavy 582.865 / 517.383 15732.0 39.88052558898926 46 20 10 6 10 6.224941936985242 16.064406867131407 0.03350067138671875 3 0.9923304746380971 14.083161684113165 15732.0 18.436379562043797 0.0 - - - - - - - 1186.0 31 11 GGA2;GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 2;golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 579 74 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534058.[MT7]-FLNELIK[MT7].2y6_1.heavy 582.865 / 873.553 18973.0 39.88052558898926 46 20 10 6 10 6.224941936985242 16.064406867131407 0.03350067138671875 3 0.9923304746380971 14.083161684113165 18973.0 74.05073839662447 0.0 - - - - - - - 250.16666666666666 37 18 GGA2;GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 2;golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 581 75 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534248.[MT7]-NIEWFSIEK[MT7].3y3_1.heavy 485.269 / 533.341 35187.0 40.55692481994629 44 18 10 6 10 4.802299349001897 20.823358298308463 0.03189849853515625 3 0.9856025488309075 10.272996039119805 35187.0 50.455280799378286 0.0 - - - - - - - 692.8 70 10 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 583 75 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534248.[MT7]-NIEWFSIEK[MT7].3b4_1.heavy 485.269 / 687.358 25662.0 40.55692481994629 44 18 10 6 10 4.802299349001897 20.823358298308463 0.03189849853515625 3 0.9856025488309075 10.272996039119805 25662.0 53.42377576847639 0.0 - - - - - - - 245.9375 51 16 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 585 75 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534248.[MT7]-NIEWFSIEK[MT7].3y4_1.heavy 485.269 / 620.374 50694.0 40.55692481994629 44 18 10 6 10 4.802299349001897 20.823358298308463 0.03189849853515625 3 0.9856025488309075 10.272996039119805 50694.0 89.53578144853876 0.0 - - - - - - - 742.1428571428571 101 7 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 587 75 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534248.[MT7]-NIEWFSIEK[MT7].3b3_1.heavy 485.269 / 501.279 82023.0 40.55692481994629 44 18 10 6 10 4.802299349001897 20.823358298308463 0.03189849853515625 3 0.9856025488309075 10.272996039119805 82023.0 166.52512236832104 0.0 - - - - - - - 665.4545454545455 164 11 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 589 76 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50672.[MT7]-SLTTGETGYIPSNYVAPVDSIQAEEWYFGK[MT7].4y4_1.heavy 903.451 / 658.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - FYN FYN oncogene related to SRC, FGR, YES 591 76 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50672.[MT7]-SLTTGETGYIPSNYVAPVDSIQAEEWYFGK[MT7].4b8_1.heavy 903.451 / 891.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - FYN FYN oncogene related to SRC, FGR, YES 593 76 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50672.[MT7]-SLTTGETGYIPSNYVAPVDSIQAEEWYFGK[MT7].4y8_2.heavy 903.451 / 587.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - FYN FYN oncogene related to SRC, FGR, YES 595 76 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50672.[MT7]-SLTTGETGYIPSNYVAPVDSIQAEEWYFGK[MT7].4b19_2.heavy 903.451 / 1055.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - FYN FYN oncogene related to SRC, FGR, YES 597 77 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534149.[MT7]-RFHDEVGK[MT7].3y3_1.heavy 425.906 / 447.305 70804.0 18.817699432373047 48 18 10 10 10 6.334872617117901 15.785637067078987 0.0 3 0.9804288239368248 8.80730523796301 70804.0 79.29479856971577 0.0 - - - - - - - 1356.5714285714287 141 7 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 599 77 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534149.[MT7]-RFHDEVGK[MT7].3b4_1.heavy 425.906 / 700.365 9053.0 18.817699432373047 48 18 10 10 10 6.334872617117901 15.785637067078987 0.0 3 0.9804288239368248 8.80730523796301 9053.0 16.063830632623485 0.0 - - - - - - - 1224.6666666666667 18 9 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 601 77 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534149.[MT7]-RFHDEVGK[MT7].3b3_1.heavy 425.906 / 585.338 13088.0 18.817699432373047 48 18 10 10 10 6.334872617117901 15.785637067078987 0.0 3 0.9804288239368248 8.80730523796301 13088.0 55.79578338156263 0.0 - - - - - - - 298.11764705882354 26 17 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 603 77 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534149.[MT7]-RFHDEVGK[MT7].3y4_1.heavy 425.906 / 576.347 33753.0 18.817699432373047 48 18 10 10 10 6.334872617117901 15.785637067078987 0.0 3 0.9804288239368248 8.80730523796301 33753.0 38.24571526839782 0.0 - - - - - - - 1224.5555555555557 67 9 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 605 78 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49821.[MT7]-SPTGTPAR.2y5_1.heavy 465.76 / 501.278 4426.0 15.978599548339844 42 14 10 10 8 2.362992474393742 37.286306820510354 0.0 4 0.944763604218503 5.226730091957711 4426.0 8.14358382276049 0.0 - - - - - - - 262.2 8 20 TRA2A transformer 2 alpha homolog (Drosophila) 607 78 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49821.[MT7]-SPTGTPAR.2y6_1.heavy 465.76 / 602.326 4277.0 15.978599548339844 42 14 10 10 8 2.362992474393742 37.286306820510354 0.0 4 0.944763604218503 5.226730091957711 4277.0 27.056513864067455 1.0 - - - - - - - 266.2105263157895 42 19 TRA2A transformer 2 alpha homolog (Drosophila) 609 78 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49821.[MT7]-SPTGTPAR.2b5_1.heavy 465.76 / 588.311 2269.0 15.978599548339844 42 14 10 10 8 2.362992474393742 37.286306820510354 0.0 4 0.944763604218503 5.226730091957711 2269.0 12.695634312165485 0.0 - - - - - - - 196.13636363636363 4 22 TRA2A transformer 2 alpha homolog (Drosophila) 611 78 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49821.[MT7]-SPTGTPAR.2y7_1.heavy 465.76 / 699.378 48461.0 15.978599548339844 42 14 10 10 8 2.362992474393742 37.286306820510354 0.0 4 0.944763604218503 5.226730091957711 48461.0 199.04110950199498 0.0 - - - - - - - 207.76470588235293 96 17 TRA2A transformer 2 alpha homolog (Drosophila) 613 79 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534657.[MT7]-C[CAM]VVFHPFLDEILIGK[MT7].4b4_1.heavy 519.545 / 650.345 22492.0 46.30929946899414 28 5 10 3 10 0.6132567312081232 84.5264364453225 0.06040191650390625 3 0.6352497474619382 1.9777898249676196 22492.0 175.36519114688127 0.0 - - - - - - - 148.6315789473684 44 19 POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 615 79 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534657.[MT7]-C[CAM]VVFHPFLDEILIGK[MT7].4b5_1.heavy 519.545 / 787.404 12579.0 46.30929946899414 28 5 10 3 10 0.6132567312081232 84.5264364453225 0.06040191650390625 3 0.6352497474619382 1.9777898249676196 12579.0 121.50979531393972 0.0 - - - - - - - 153.1875 25 16 POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 617 79 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534657.[MT7]-C[CAM]VVFHPFLDEILIGK[MT7].4b9_2.heavy 519.545 / 630.322 33206.0 46.30929946899414 28 5 10 3 10 0.6132567312081232 84.5264364453225 0.06040191650390625 3 0.6352497474619382 1.9777898249676196 33206.0 190.61596667725652 0.0 - - - - - - - 271.7 66 20 POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 619 79 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534657.[MT7]-C[CAM]VVFHPFLDEILIGK[MT7].4b3_1.heavy 519.545 / 503.277 3838.0 46.30929946899414 28 5 10 3 10 0.6132567312081232 84.5264364453225 0.06040191650390625 3 0.6352497474619382 1.9777898249676196 3838.0 31.076763497652585 0.0 - - - - - - - 189.75 7 16 POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 621 80 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50032.[MT7]-GVQLEC[CAM]K[MT7].2y4_1.heavy 561.315 / 693.372 4595.0 27.67967462539673 40 17 10 3 10 3.6220262251333217 27.608855868049144 0.07169914245605469 3 0.9756630020579968 7.894854405621768 4595.0 7.837073608617594 0.0 - - - - - - - 686.2857142857143 9 7 SMAD4 SMAD family member 4 623 80 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50032.[MT7]-GVQLEC[CAM]K[MT7].2y5_1.heavy 561.315 / 821.431 418.0 27.67967462539673 40 17 10 3 10 3.6220262251333217 27.608855868049144 0.07169914245605469 3 0.9756630020579968 7.894854405621768 418.0 1.87754207085369 23.0 - - - - - - - 239.08695652173913 4 23 SMAD4 SMAD family member 4 625 80 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50032.[MT7]-GVQLEC[CAM]K[MT7].2b4_1.heavy 561.315 / 542.342 3342.0 27.67967462539673 40 17 10 3 10 3.6220262251333217 27.608855868049144 0.07169914245605469 3 0.9756630020579968 7.894854405621768 3342.0 4.403921801954951 1.0 - - - - - - - 746.0714285714286 6 14 SMAD4 SMAD family member 4 627 80 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50032.[MT7]-GVQLEC[CAM]K[MT7].2y3_1.heavy 561.315 / 580.288 5361.0 27.67967462539673 40 17 10 3 10 3.6220262251333217 27.608855868049144 0.07169914245605469 3 0.9756630020579968 7.894854405621768 5361.0 16.36211849192101 0.0 - - - - - - - 619.8 10 10 SMAD4 SMAD family member 4 629 81 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 1387040.0 19.66830062866211 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1387040.0 8943.86791564928 0.0 - - - - - - - 671.3333333333334 2774 3 631 81 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 773808.0 19.66830062866211 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 773808.0 2047.8396330914368 0.0 - - - - - - - 406.3333333333333 1547 3 633 81 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 889092.0 19.66830062866211 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 889092.0 3632.298399205561 0.0 - - - - - - - 282.6666666666667 1778 3 635 82 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534043.[MT7]-TSDVTSTK[MT7].2y4_1.heavy 563.813 / 580.342 7241.0 17.16900062561035 48 18 10 10 10 5.120457208920008 19.52950604211605 0.0 3 0.98742106408839 10.992187230752853 7241.0 12.477128129602356 0.0 - - - - - - - 221.30434782608697 14 23 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 637 82 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534043.[MT7]-TSDVTSTK[MT7].2y5_1.heavy 563.813 / 679.411 8335.0 17.16900062561035 48 18 10 10 10 5.120457208920008 19.52950604211605 0.0 3 0.98742106408839 10.992187230752853 8335.0 39.300117323679274 0.0 - - - - - - - 128.15 16 20 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 639 82 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534043.[MT7]-TSDVTSTK[MT7].2b4_1.heavy 563.813 / 547.284 N/A 17.16900062561035 48 18 10 10 10 5.120457208920008 19.52950604211605 0.0 3 0.98742106408839 10.992187230752853 5582.0 6.751439079259365 2.0 - - - - - - - 1203.5454545454545 11 11 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 641 82 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534043.[MT7]-TSDVTSTK[MT7].2y7_1.heavy 563.813 / 881.47 5695.0 17.16900062561035 48 18 10 10 10 5.120457208920008 19.52950604211605 0.0 3 0.98742106408839 10.992187230752853 5695.0 50.680765620809865 0.0 - - - - - - - 702.5 11 8 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 643 83 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534772.[MT7]-LIDWGLAEFYHPGQEYNVR.3b6_1.heavy 817.745 / 842.489 28779.0 46.597801208496094 42 16 10 6 10 32.07378364351709 3.1178111416927416 0.0316009521484375 3 0.9652443790756996 6.600607423665066 28779.0 99.1772338920851 0.0 - - - - - - - 274.1666666666667 57 18 CSNK2A1 casein kinase 2, alpha 1 polypeptide 645 83 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534772.[MT7]-LIDWGLAEFYHPGQEYNVR.3b5_1.heavy 817.745 / 729.405 17884.0 46.597801208496094 42 16 10 6 10 32.07378364351709 3.1178111416927416 0.0316009521484375 3 0.9652443790756996 6.600607423665066 17884.0 22.383560500695413 1.0 - - - - - - - 650.7777777777778 35 9 CSNK2A1 casein kinase 2, alpha 1 polypeptide 647 83 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534772.[MT7]-LIDWGLAEFYHPGQEYNVR.3b8_1.heavy 817.745 / 1042.57 24000.0 46.597801208496094 42 16 10 6 10 32.07378364351709 3.1178111416927416 0.0316009521484375 3 0.9652443790756996 6.600607423665066 24000.0 98.74650698602795 0.0 - - - - - - - 661.625 48 8 CSNK2A1 casein kinase 2, alpha 1 polypeptide 649 83 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534772.[MT7]-LIDWGLAEFYHPGQEYNVR.3y8_1.heavy 817.745 / 962.469 132332.0 46.597801208496094 42 16 10 6 10 32.07378364351709 3.1178111416927416 0.0316009521484375 3 0.9652443790756996 6.600607423665066 132332.0 290.8509792597546 0.0 - - - - - - - 331.3333333333333 264 9 CSNK2A1 casein kinase 2, alpha 1 polypeptide 651 84 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534040.[MT7]-YTDLVPK[MT7].2b3_1.heavy 562.334 / 524.247 23165.0 31.002649784088135 40 14 10 6 10 2.3373174530659857 42.7840898842494 0.03740119934082031 3 0.9453987532713205 5.257326158382261 23165.0 31.42382608695652 0.0 - - - - - - - 780.25 46 8 SNW1 SNW domain containing 1 653 84 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534040.[MT7]-YTDLVPK[MT7].2b4_1.heavy 562.334 / 637.331 15279.0 31.002649784088135 40 14 10 6 10 2.3373174530659857 42.7840898842494 0.03740119934082031 3 0.9453987532713205 5.257326158382261 15279.0 41.905709395827294 0.0 - - - - - - - 739.0 30 7 SNW1 SNW domain containing 1 655 84 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534040.[MT7]-YTDLVPK[MT7].2y6_1.heavy 562.334 / 816.495 6407.0 31.002649784088135 40 14 10 6 10 2.3373174530659857 42.7840898842494 0.03740119934082031 3 0.9453987532713205 5.257326158382261 6407.0 14.583334630629766 0.0 - - - - - - - 293.2857142857143 12 14 SNW1 SNW domain containing 1 657 84 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534040.[MT7]-YTDLVPK[MT7].2b5_1.heavy 562.334 / 736.4 11089.0 31.002649784088135 40 14 10 6 10 2.3373174530659857 42.7840898842494 0.03740119934082031 3 0.9453987532713205 5.257326158382261 11089.0 13.691156949358081 0.0 - - - - - - - 301.3333333333333 22 3 SNW1 SNW domain containing 1 659 85 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534776.[MT7]-LIDWGLAEFYHPGQEYNVR.4y4_1.heavy 613.561 / 551.294 5648.0 46.574100494384766 44 18 10 6 10 7.926620600294382 12.615716714924664 0.0316009521484375 3 0.9850228553770828 10.071735745747272 5648.0 19.199048797506627 0.0 - - - - - - - 235.45454545454547 11 22 CSNK2A1 casein kinase 2, alpha 1 polypeptide 661 85 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534776.[MT7]-LIDWGLAEFYHPGQEYNVR.4y8_1.heavy 613.561 / 962.469 53116.0 46.574100494384766 44 18 10 6 10 7.926620600294382 12.615716714924664 0.0316009521484375 3 0.9850228553770828 10.071735745747272 53116.0 336.5608408408408 0.0 - - - - - - - 190.9375 106 16 CSNK2A1 casein kinase 2, alpha 1 polypeptide 663 85 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534776.[MT7]-LIDWGLAEFYHPGQEYNVR.4b5_1.heavy 613.561 / 729.405 40524.0 46.574100494384766 44 18 10 6 10 7.926620600294382 12.615716714924664 0.0316009521484375 3 0.9850228553770828 10.071735745747272 40524.0 145.13860636825103 0.0 - - - - - - - 829.1428571428571 81 7 CSNK2A1 casein kinase 2, alpha 1 polypeptide 665 85 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534776.[MT7]-LIDWGLAEFYHPGQEYNVR.4y7_1.heavy 613.561 / 865.416 5441.0 46.574100494384766 44 18 10 6 10 7.926620600294382 12.615716714924664 0.0316009521484375 3 0.9850228553770828 10.071735745747272 5441.0 32.56196911196911 0.0 - - - - - - - 132.44444444444446 10 18 CSNK2A1 casein kinase 2, alpha 1 polypeptide 667 86 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51530.[MT7]-ILELLYSWTVGLPEEVK[MT7].3y7_1.heavy 759.771 / 915.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 669 86 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51530.[MT7]-ILELLYSWTVGLPEEVK[MT7].3b4_1.heavy 759.771 / 613.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 671 86 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51530.[MT7]-ILELLYSWTVGLPEEVK[MT7].3b3_1.heavy 759.771 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 673 86 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51530.[MT7]-ILELLYSWTVGLPEEVK[MT7].3y5_1.heavy 759.771 / 745.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 675 87 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50176.[MT7]-IYPSAYIK[MT7].3y3_1.heavy 414.916 / 567.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD4 SMAD family member 4 677 87 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50176.[MT7]-IYPSAYIK[MT7].3b4_1.heavy 414.916 / 605.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD4 SMAD family member 4 679 87 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50176.[MT7]-IYPSAYIK[MT7].3b5_1.heavy 414.916 / 676.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD4 SMAD family member 4 681 87 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50176.[MT7]-IYPSAYIK[MT7].3y4_1.heavy 414.916 / 638.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD4 SMAD family member 4 683 88 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534557.[MT7]-FQILNSSEGDWWEAR.3y7_1.heavy 661.322 / 919.406 25416.0 43.6067008972168 48 18 10 10 10 10.377739251597047 9.636010076530958 0.0 3 0.981398491126402 9.034679777414139 25416.0 6.9118254736333045 0.0 - - - - - - - 342.5 50 2 FYN FYN oncogene related to SRC, FGR, YES 685 88 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534557.[MT7]-FQILNSSEGDWWEAR.3y4_1.heavy 661.322 / 561.278 23020.0 43.6067008972168 48 18 10 10 10 10.377739251597047 9.636010076530958 0.0 3 0.981398491126402 9.034679777414139 23020.0 2.525464297877705 1.0 - - - - - - - 428.0 46 2 FYN FYN oncogene related to SRC, FGR, YES 687 88 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534557.[MT7]-FQILNSSEGDWWEAR.3b3_1.heavy 661.322 / 533.32 57593.0 43.6067008972168 48 18 10 10 10 10.377739251597047 9.636010076530958 0.0 3 0.981398491126402 9.034679777414139 57593.0 5.598270091004698 0.0 - - - - - - - 1711.75 115 4 FYN FYN oncogene related to SRC, FGR, YES 689 88 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534557.[MT7]-FQILNSSEGDWWEAR.3y5_1.heavy 661.322 / 747.357 22421.0 43.6067008972168 48 18 10 10 10 10.377739251597047 9.636010076530958 0.0 3 0.981398491126402 9.034679777414139 22421.0 35.08742051053916 0.0 - - - - - - - 325.2 44 5 FYN FYN oncogene related to SRC, FGR, YES 691 89 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534045.[MT7]-MVIDLEK[MT7].2y4_1.heavy 568.335 / 648.369 23472.0 34.875099182128906 50 20 10 10 10 13.036650004304038 7.670682266301933 0.0 3 0.9936957404524636 15.53520199210921 23472.0 36.988709040663245 0.0 - - - - - - - 681.2222222222222 46 9 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 693 89 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534045.[MT7]-MVIDLEK[MT7].2y5_1.heavy 568.335 / 761.453 18394.0 34.875099182128906 50 20 10 10 10 13.036650004304038 7.670682266301933 0.0 3 0.9936957404524636 15.53520199210921 18394.0 37.01650146530772 0.0 - - - - - - - 277.8 36 10 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 695 89 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534045.[MT7]-MVIDLEK[MT7].2b4_1.heavy 568.335 / 603.329 23088.0 34.875099182128906 50 20 10 10 10 13.036650004304038 7.670682266301933 0.0 3 0.9936957404524636 15.53520199210921 23088.0 41.45682368146498 0.0 - - - - - - - 728.1 46 10 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 697 89 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534045.[MT7]-MVIDLEK[MT7].2y3_1.heavy 568.335 / 533.341 36501.0 34.875099182128906 50 20 10 10 10 13.036650004304038 7.670682266301933 0.0 3 0.9936957404524636 15.53520199210921 36501.0 23.121221968468227 0.0 - - - - - - - 2251.375 73 8 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 699 90 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49878.[MT7]-LAFGC[CAM]QR.2y4_1.heavy 498.264 / 520.23 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRICKLE1 prickle homolog 1 (Drosophila) 701 90 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49878.[MT7]-LAFGC[CAM]QR.2y5_1.heavy 498.264 / 667.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRICKLE1 prickle homolog 1 (Drosophila) 703 90 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49878.[MT7]-LAFGC[CAM]QR.2y3_2.heavy 498.264 / 232.108 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRICKLE1 prickle homolog 1 (Drosophila) 705 90 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49878.[MT7]-LAFGC[CAM]QR.2y6_1.heavy 498.264 / 738.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRICKLE1 prickle homolog 1 (Drosophila) 707 91 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51320.[MT7]-HHQLLFGTGLLK[MT7].4b3_2.heavy 413.753 / 274.147 85149.0 35.11399841308594 44 14 10 10 10 24.204393170412366 4.1314813924870775 0.0 3 0.9490785251419958 5.445672543432044 85149.0 110.59251932101907 0.0 - - - - - - - 1229.5555555555557 170 9 TSNARE1 t-SNARE domain containing 1 709 91 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51320.[MT7]-HHQLLFGTGLLK[MT7].4b4_1.heavy 413.753 / 660.37 56189.0 35.11399841308594 44 14 10 10 10 24.204393170412366 4.1314813924870775 0.0 3 0.9490785251419958 5.445672543432044 56189.0 365.6920453349431 0.0 - - - - - - - 228.4375 112 16 TSNARE1 t-SNARE domain containing 1 711 91 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51320.[MT7]-HHQLLFGTGLLK[MT7].4b5_1.heavy 413.753 / 773.454 37908.0 35.11399841308594 44 14 10 10 10 24.204393170412366 4.1314813924870775 0.0 3 0.9490785251419958 5.445672543432044 37908.0 544.9275 0.0 - - - - - - - 181.55555555555554 75 9 TSNARE1 t-SNARE domain containing 1 713 91 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51320.[MT7]-HHQLLFGTGLLK[MT7].4b3_1.heavy 413.753 / 547.286 31654.0 35.11399841308594 44 14 10 10 10 24.204393170412366 4.1314813924870775 0.0 3 0.9490785251419958 5.445672543432044 31654.0 182.7064385026738 0.0 - - - - - - - 742.1428571428571 63 7 TSNARE1 t-SNARE domain containing 1 715 92 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 1037940.0 38.392799377441406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1037940.0 430.84128101646127 0.0 - - - - - - - 195.14285714285714 2075 7 717 92 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 489211.0 38.392799377441406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 489211.0 844.398760009954 0.0 - - - - - - - 237.22222222222223 978 9 719 92 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 742572.0 38.392799377441406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 742572.0 186.88919889722672 0.0 - - - - - - - 256.1666666666667 1485 6 721 93 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533941.[MT7]-IADFGLAR.2y5_1.heavy 503.794 / 563.33 120128.0 35.236300468444824 44 18 10 6 10 4.811952849667693 15.721978260395051 0.035198211669921875 3 0.9841646193644324 9.794298675689411 120128.0 115.81906093604965 0.0 - - - - - - - 322.3333333333333 240 3 FGFR1;FGFR3;FGFR2;FGFR4;FGR;ICK;CDK20;FYN;HCK;LCK;LYN;MAK;BLK;YES1 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4;Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;intestinal cell (MAK-like) kinase;cyclin-dependent kinase 20;FYN oncogene related to SRC, FGR, YES;hemopoietic cell kinase;lymphocyte-specific protein tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral related oncogene homolog;male germ cell-associated kinase;B lymphoid tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 723 93 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533941.[MT7]-IADFGLAR.2y6_1.heavy 503.794 / 678.357 31241.0 35.236300468444824 44 18 10 6 10 4.811952849667693 15.721978260395051 0.035198211669921875 3 0.9841646193644324 9.794298675689411 31241.0 46.317911921408616 0.0 - - - - - - - 701.0 62 8 FGFR1;FGFR3;FGFR2;FGFR4;FGR;ICK;CDK20;FYN;HCK;LCK;LYN;MAK;BLK;YES1 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4;Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;intestinal cell (MAK-like) kinase;cyclin-dependent kinase 20;FYN oncogene related to SRC, FGR, YES;hemopoietic cell kinase;lymphocyte-specific protein tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral related oncogene homolog;male germ cell-associated kinase;B lymphoid tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 725 93 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533941.[MT7]-IADFGLAR.2b5_1.heavy 503.794 / 648.347 36270.0 35.236300468444824 44 18 10 6 10 4.811952849667693 15.721978260395051 0.035198211669921875 3 0.9841646193644324 9.794298675689411 36270.0 66.47161797382931 0.0 - - - - - - - 338.6666666666667 72 6 FGFR1;FGFR3;FGFR2;FGFR4;FGR;ICK;CDK20;FYN;HCK;LCK;LYN;MAK;BLK;YES1 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4;Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;intestinal cell (MAK-like) kinase;cyclin-dependent kinase 20;FYN oncogene related to SRC, FGR, YES;hemopoietic cell kinase;lymphocyte-specific protein tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral related oncogene homolog;male germ cell-associated kinase;B lymphoid tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 727 93 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533941.[MT7]-IADFGLAR.2y7_1.heavy 503.794 / 749.394 121772.0 35.236300468444824 44 18 10 6 10 4.811952849667693 15.721978260395051 0.035198211669921875 3 0.9841646193644324 9.794298675689411 121772.0 127.61047980613893 0.0 - - - - - - - 362.75 243 4 FGFR1;FGFR3;FGFR2;FGFR4;FGR;ICK;CDK20;FYN;HCK;LCK;LYN;MAK;BLK;YES1 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4;Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;intestinal cell (MAK-like) kinase;cyclin-dependent kinase 20;FYN oncogene related to SRC, FGR, YES;hemopoietic cell kinase;lymphocyte-specific protein tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral related oncogene homolog;male germ cell-associated kinase;B lymphoid tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 729 94 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51425.[MT7]-VDHVQMIVLDEADK[MT7].3y6_1.heavy 634.008 / 834.432 31816.0 34.795101165771484 39 9 10 10 10 0.8333549399263901 70.07632256602719 0.0 3 0.8099808972694136 2.7850548995890527 31816.0 138.24243546431046 0.0 - - - - - - - 354.7692307692308 63 13 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 731 94 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51425.[MT7]-VDHVQMIVLDEADK[MT7].3b4_1.heavy 634.008 / 595.332 22589.0 34.795101165771484 39 9 10 10 10 0.8333549399263901 70.07632256602719 0.0 3 0.8099808972694136 2.7850548995890527 22589.0 43.59714492876837 0.0 - - - - - - - 751.5454545454545 45 11 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 733 94 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51425.[MT7]-VDHVQMIVLDEADK[MT7].3b5_1.heavy 634.008 / 723.391 15283.0 34.795101165771484 39 9 10 10 10 0.8333549399263901 70.07632256602719 0.0 3 0.8099808972694136 2.7850548995890527 15283.0 16.234342648848425 0.0 - - - - - - - 296.8181818181818 30 11 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 735 94 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51425.[MT7]-VDHVQMIVLDEADK[MT7].3y5_1.heavy 634.008 / 721.349 42390.0 34.795101165771484 39 9 10 10 10 0.8333549399263901 70.07632256602719 0.0 3 0.8099808972694136 2.7850548995890527 42390.0 64.11006154885052 0.0 - - - - - - - 713.0 84 12 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 737 95 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51327.[MT7]-ETLLEGMLFSLK[MT7].3b6_1.heavy 556.988 / 787.432 5189.0 50.2848014831543 40 16 6 10 8 1.7280683829110781 45.77574263597611 0.0 4 0.9647526872053739 6.554135209013713 5189.0 74.16398034733356 0.0 - - - - - - - 104.16666666666667 10 24 LDLRAP1 low density lipoprotein receptor adaptor protein 1 739 95 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51327.[MT7]-ETLLEGMLFSLK[MT7].3b4_1.heavy 556.988 / 601.368 2713.0 50.2848014831543 40 16 6 10 8 1.7280683829110781 45.77574263597611 0.0 4 0.9647526872053739 6.554135209013713 2713.0 23.848814565960765 2.0 - - - - - - - 123.14285714285714 16 28 LDLRAP1 low density lipoprotein receptor adaptor protein 1 741 95 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51327.[MT7]-ETLLEGMLFSLK[MT7].3y4_1.heavy 556.988 / 638.399 3582.0 50.2848014831543 40 16 6 10 8 1.7280683829110781 45.77574263597611 0.0 4 0.9647526872053739 6.554135209013713 3582.0 38.831285085305446 0.0 - - - - - - - 126.89285714285714 7 28 LDLRAP1 low density lipoprotein receptor adaptor protein 1 743 95 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51327.[MT7]-ETLLEGMLFSLK[MT7].3b7_1.heavy 556.988 / 918.472 1765.0 50.2848014831543 40 16 6 10 8 1.7280683829110781 45.77574263597611 0.0 4 0.9647526872053739 6.554135209013713 1765.0 43.41891569142584 0.0 - - - - - - - 105.28 3 25 LDLRAP1 low density lipoprotein receptor adaptor protein 1 745 96 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50811.[MT7]-HSESHSR.2y4_1.heavy 492.242 / 486.242 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRA2A transformer 2 alpha homolog (Drosophila) 747 96 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50811.[MT7]-HSESHSR.2y6_1.heavy 492.242 / 702.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRA2A transformer 2 alpha homolog (Drosophila) 749 97 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49971.[MT7]-SGWGFPK[MT7].2y4_1.heavy 533.8 / 592.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 751 97 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49971.[MT7]-SGWGFPK[MT7].2y5_1.heavy 533.8 / 778.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 753 97 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49971.[MT7]-SGWGFPK[MT7].2b4_1.heavy 533.8 / 532.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 755 97 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49971.[MT7]-SGWGFPK[MT7].2y6_1.heavy 533.8 / 835.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 757 98 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50680.[MT7]-RAITGR.2y4_1.heavy 409.26 / 446.272 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 759 98 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50680.[MT7]-RAITGR.2y5_1.heavy 409.26 / 517.309 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 761 98 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50680.[MT7]-RAITGR.2y3_1.heavy 409.26 / 333.188 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 763 98 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50680.[MT7]-RAITGR.2b5_1.heavy 409.26 / 643.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 765 99 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50047.[MT7]-EQQEWK[MT7].2b3_1.heavy 568.303 / 530.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 767 99 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50047.[MT7]-EQQEWK[MT7].2y5_1.heavy 568.303 / 862.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 769 99 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50047.[MT7]-EQQEWK[MT7].2b4_1.heavy 568.303 / 659.312 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 771 99 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50047.[MT7]-EQQEWK[MT7].2y3_1.heavy 568.303 / 606.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 773 100 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49978.[MT7]-GRGGIPGTGR.2y8_1.heavy 536.311 / 714.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 775 100 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49978.[MT7]-GRGGIPGTGR.2b4_1.heavy 536.311 / 472.275 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 777 100 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49978.[MT7]-GRGGIPGTGR.2b5_1.heavy 536.311 / 585.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 779 100 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49978.[MT7]-GRGGIPGTGR.2b9_1.heavy 536.311 / 897.502 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 781 101 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534171.[MT7]-GVFPDNFVK[MT7].3y3_1.heavy 437.583 / 537.352 15698.0 36.294349670410156 45 20 10 5 10 13.497664642674584 7.408689032311358 0.0410003662109375 3 0.9970224847123877 22.611405113400675 15698.0 25.45726986754967 1.0 - - - - - - - 285.3333333333333 43 6 SH3KBP1 SH3-domain kinase binding protein 1 783 101 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534171.[MT7]-GVFPDNFVK[MT7].3b6_1.heavy 437.583 / 774.39 19421.0 36.294349670410156 45 20 10 5 10 13.497664642674584 7.408689032311358 0.0410003662109375 3 0.9970224847123877 22.611405113400675 19421.0 55.14351488898586 0.0 - - - - - - - 231.6 38 10 SH3KBP1 SH3-domain kinase binding protein 1 785 101 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534171.[MT7]-GVFPDNFVK[MT7].3b5_1.heavy 437.583 / 660.347 23849.0 36.294349670410156 45 20 10 5 10 13.497664642674584 7.408689032311358 0.0410003662109375 3 0.9970224847123877 22.611405113400675 23849.0 27.021091081928375 0.0 - - - - - - - 289.5 47 8 SH3KBP1 SH3-domain kinase binding protein 1 787 101 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534171.[MT7]-GVFPDNFVK[MT7].3b3_1.heavy 437.583 / 448.268 80401.0 36.294349670410156 45 20 10 5 10 13.497664642674584 7.408689032311358 0.0410003662109375 3 0.9970224847123877 22.611405113400675 80401.0 19.452942627761534 1.0 - - - - - - - 805.0 166 1 SH3KBP1 SH3-domain kinase binding protein 1 789 102 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534566.[MT7]-LEDAYVFPGDGASHTK[MT7].3b4_1.heavy 665.674 / 573.3 48195.0 32.60609817504883 43 13 10 10 10 1.1590270777679692 53.053582737336576 0.0 3 0.9200608334780809 4.335569054919152 48195.0 95.66674624829467 0.0 - - - - - - - 692.2222222222222 96 9 POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 791 102 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534566.[MT7]-LEDAYVFPGDGASHTK[MT7].3b5_1.heavy 665.674 / 736.363 65421.0 32.60609817504883 43 13 10 10 10 1.1590270777679692 53.053582737336576 0.0 3 0.9200608334780809 4.335569054919152 65421.0 156.20780335344966 0.0 - - - - - - - 732.75 130 8 POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 793 102 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534566.[MT7]-LEDAYVFPGDGASHTK[MT7].3b3_1.heavy 665.674 / 502.263 31519.0 32.60609817504883 43 13 10 10 10 1.1590270777679692 53.053582737336576 0.0 3 0.9200608334780809 4.335569054919152 31519.0 29.23554282596836 0.0 - - - - - - - 321.0 63 2 POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 795 102 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534566.[MT7]-LEDAYVFPGDGASHTK[MT7].3y9_1.heavy 665.674 / 1013.51 49478.0 32.60609817504883 43 13 10 10 10 1.1590270777679692 53.053582737336576 0.0 3 0.9200608334780809 4.335569054919152 49478.0 133.0472378575143 0.0 - - - - - - - 264.8888888888889 98 9 POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 797 103 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50815.[MT7]-DYIC[CAM]K[MT7].2b3_1.heavy 493.765 / 536.284 2904.0 24.04603322347005 35 17 6 6 6 2.846108549595166 35.13569431995984 0.0316009521484375 6 0.9732279714496053 7.525719496495983 2904.0 5.301419878296146 5.0 - - - - - - - 747.0 15 11 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 799 103 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50815.[MT7]-DYIC[CAM]K[MT7].2y4_1.heavy 493.765 / 727.393 4712.0 24.04603322347005 35 17 6 6 6 2.846108549595166 35.13569431995984 0.0316009521484375 6 0.9732279714496053 7.525719496495983 4712.0 10.289787639193609 0.0 - - - - - - - 349.6666666666667 9 21 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 801 103 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50815.[MT7]-DYIC[CAM]K[MT7].2y3_1.heavy 493.765 / 564.33 3671.0 24.04603322347005 35 17 6 6 6 2.846108549595166 35.13569431995984 0.0316009521484375 6 0.9732279714496053 7.525719496495983 3671.0 6.077621048257401 0.0 - - - - - - - 697.3636363636364 7 11 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 803 104 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50142.[MT7]-LPANWEAK[MT7].2y4_1.heavy 608.85 / 677.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 805 104 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50142.[MT7]-LPANWEAK[MT7].2y5_1.heavy 608.85 / 791.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 807 104 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50142.[MT7]-LPANWEAK[MT7].2y6_1.heavy 608.85 / 862.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 809 104 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50142.[MT7]-LPANWEAK[MT7].2y7_1.heavy 608.85 / 959.507 N/A N/A - - - - - - - - - 0.0 - - - - - - - SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 811 105 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50243.[MT7]-DMYGDDLEAR.2y8_1.heavy 664.799 / 938.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 813 105 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50243.[MT7]-DMYGDDLEAR.2y5_1.heavy 664.799 / 603.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 815 105 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50243.[MT7]-DMYGDDLEAR.2y9_1.heavy 664.799 / 1069.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 817 105 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50243.[MT7]-DMYGDDLEAR.2b6_1.heavy 664.799 / 841.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 819 106 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49881.[MT7]-LGLAPNK[MT7].2b3_1.heavy 500.823 / 428.299 N/A 31.77989959716797 32 18 0 10 4 3.704080806256881 26.99725120226357 0.0 7 0.9838966308134123 9.712241353476406 3669.0 1.8309187456220126 9.0 - - - - - - - 1732.6666666666667 24 9 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 821 106 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49881.[MT7]-LGLAPNK[MT7].2y4_1.heavy 500.823 / 573.348 6588.0 31.77989959716797 32 18 0 10 4 3.704080806256881 26.99725120226357 0.0 7 0.9838966308134123 9.712241353476406 6588.0 -0.37857956830010486 3.0 - - - - - - - 1177.625 52 8 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 823 106 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49881.[MT7]-LGLAPNK[MT7].2y3_1.heavy 500.823 / 502.311 10674.0 31.77989959716797 32 18 0 10 4 3.704080806256881 26.99725120226357 0.0 7 0.9838966308134123 9.712241353476406 10674.0 12.93153778907234 3.0 - - - - - - - 1315.6666666666667 127 9 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 825 106 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49881.[MT7]-LGLAPNK[MT7].2y6_1.heavy 500.823 / 743.453 5921.0 31.77989959716797 32 18 0 10 4 3.704080806256881 26.99725120226357 0.0 7 0.9838966308134123 9.712241353476406 5921.0 16.985586259541986 0.0 - - - - - - - 327.7142857142857 11 14 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 827 107 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533945.[MT7]-GAYSLSIR.2y5_1.heavy 505.791 / 575.351 9492.0 30.230950355529785 43 17 10 6 10 2.1527805019783988 33.31342916851182 0.03289985656738281 3 0.9754397472240087 7.8587424986167616 9492.0 11.223949496554614 0.0 - - - - - - - 1240.3333333333333 18 9 FGR;FYN;YES1 Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;FYN oncogene related to SRC, FGR, YES;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 829 107 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533945.[MT7]-GAYSLSIR.2b4_1.heavy 505.791 / 523.263 8049.0 30.230950355529785 43 17 10 6 10 2.1527805019783988 33.31342916851182 0.03289985656738281 3 0.9754397472240087 7.8587424986167616 8049.0 11.073306713006469 0.0 - - - - - - - 718.1538461538462 16 13 FGR;FYN;YES1 Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;FYN oncogene related to SRC, FGR, YES;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 831 107 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533945.[MT7]-GAYSLSIR.2y6_1.heavy 505.791 / 738.414 6910.0 30.230950355529785 43 17 10 6 10 2.1527805019783988 33.31342916851182 0.03289985656738281 3 0.9754397472240087 7.8587424986167616 6910.0 8.292109222372254 0.0 - - - - - - - 694.1428571428571 13 7 FGR;FYN;YES1 Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;FYN oncogene related to SRC, FGR, YES;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 833 107 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533945.[MT7]-GAYSLSIR.2y7_1.heavy 505.791 / 809.452 8656.0 30.230950355529785 43 17 10 6 10 2.1527805019783988 33.31342916851182 0.03289985656738281 3 0.9754397472240087 7.8587424986167616 8656.0 25.067959209884155 0.0 - - - - - - - 721.125 17 8 FGR;FYN;YES1 Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;FYN oncogene related to SRC, FGR, YES;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 835 108 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533947.[MT7]-YTAEIK[MT7].2y4_1.heavy 506.799 / 604.379 26942.0 25.302600383758545 46 20 10 6 10 25.872391403020142 3.8651239633119796 0.03759956359863281 3 0.9991992268680713 43.60925204918034 26942.0 63.572826372972905 0.0 - - - - - - - 739.3333333333334 53 12 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 837 108 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533947.[MT7]-YTAEIK[MT7].2y5_1.heavy 506.799 / 705.426 54547.0 25.302600383758545 46 20 10 6 10 25.872391403020142 3.8651239633119796 0.03759956359863281 3 0.9991992268680713 43.60925204918034 54547.0 116.56966318234612 0.0 - - - - - - - 662.3333333333334 109 9 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 839 108 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533947.[MT7]-YTAEIK[MT7].2b4_1.heavy 506.799 / 609.3 23831.0 25.302600383758545 46 20 10 6 10 25.872391403020142 3.8651239633119796 0.03759956359863281 3 0.9991992268680713 43.60925204918034 23831.0 33.8582268782042 0.0 - - - - - - - 823.8888888888889 47 9 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 841 108 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533947.[MT7]-YTAEIK[MT7].2y3_1.heavy 506.799 / 533.341 15490.0 25.302600383758545 46 20 10 6 10 25.872391403020142 3.8651239633119796 0.03759956359863281 3 0.9991992268680713 43.60925204918034 15490.0 31.558584404014915 0.0 - - - - - - - 754.8 30 10 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 843 109 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533946.[MT7]-DSAAGPHGR.2y8_1.heavy 506.258 / 752.38 4380.0 13.46660041809082 50 20 10 10 10 11.668419010392356 8.570141328566967 0.0 3 0.9926148536290373 14.352090893087993 4380.0 26.53377337733773 0.0 - - - - - - - 125.52941176470588 8 17 TSNARE1 t-SNARE domain containing 1 845 109 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533946.[MT7]-DSAAGPHGR.2y5_1.heavy 506.258 / 523.274 1595.0 13.46660041809082 50 20 10 10 10 11.668419010392356 8.570141328566967 0.0 3 0.9926148536290373 14.352090893087993 1595.0 11.439472299597648 0.0 - - - - - - - 170.84615384615384 3 13 TSNARE1 t-SNARE domain containing 1 847 109 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533946.[MT7]-DSAAGPHGR.2y6_1.heavy 506.258 / 594.311 1729.0 13.46660041809082 50 20 10 10 10 11.668419010392356 8.570141328566967 0.0 3 0.9926148536290373 14.352090893087993 1729.0 34.61616123205628 0.0 - - - - - - - 100.83333333333333 3 18 TSNARE1 t-SNARE domain containing 1 849 109 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533946.[MT7]-DSAAGPHGR.2b5_1.heavy 506.258 / 546.264 1168.0 13.46660041809082 50 20 10 10 10 11.668419010392356 8.570141328566967 0.0 3 0.9926148536290373 14.352090893087993 1168.0 9.157202497319796 0.0 - - - - - - - 102.16666666666667 2 18 TSNARE1 t-SNARE domain containing 1 851 110 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533948.[MT7]-ILQAVNALGYC[CAM]R.3y7_1.heavy 507.949 / 853.398 9321.0 39.591548919677734 40 14 10 6 10 2.163354007420015 35.893083187518144 0.03530120849609375 3 0.9370188340777629 4.891599275763217 9321.0 49.13049896819521 0.0 - - - - - - - 191.26666666666668 18 15 TSNARE1 t-SNARE domain containing 1 853 110 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533948.[MT7]-ILQAVNALGYC[CAM]R.3b4_1.heavy 507.949 / 570.373 20474.0 39.591548919677734 40 14 10 6 10 2.163354007420015 35.893083187518144 0.03530120849609375 3 0.9370188340777629 4.891599275763217 20474.0 42.63118568617337 0.0 - - - - - - - 260.2 40 15 TSNARE1 t-SNARE domain containing 1 855 110 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533948.[MT7]-ILQAVNALGYC[CAM]R.3y4_1.heavy 507.949 / 555.234 43736.0 39.591548919677734 40 14 10 6 10 2.163354007420015 35.893083187518144 0.03530120849609375 3 0.9370188340777629 4.891599275763217 43736.0 139.7978867993931 0.0 - - - - - - - 770.0 87 9 TSNARE1 t-SNARE domain containing 1 857 110 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533948.[MT7]-ILQAVNALGYC[CAM]R.3y5_1.heavy 507.949 / 668.318 11551.0 39.591548919677734 40 14 10 6 10 2.163354007420015 35.893083187518144 0.03530120849609375 3 0.9370188340777629 4.891599275763217 11551.0 34.04753243203465 0.0 - - - - - - - 253.875 23 16 TSNARE1 t-SNARE domain containing 1 859 111 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534032.[MT7]-ESLQLIK[MT7].2b4_1.heavy 559.855 / 602.327 22244.0 32.064998626708984 48 18 10 10 10 4.714168964753299 21.21264654442295 0.0 3 0.9818900846606374 9.156859551766129 22244.0 49.952456676381175 0.0 - - - - - - - 615.5454545454545 44 11 FYN FYN oncogene related to SRC, FGR, YES 861 111 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534032.[MT7]-ESLQLIK[MT7].2y3_1.heavy 559.855 / 517.383 18023.0 32.064998626708984 48 18 10 10 10 4.714168964753299 21.21264654442295 0.0 3 0.9818900846606374 9.156859551766129 18023.0 9.044663767146202 0.0 - - - - - - - 2275.0 36 8 FYN FYN oncogene related to SRC, FGR, YES 863 111 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534032.[MT7]-ESLQLIK[MT7].2y6_1.heavy 559.855 / 845.558 14331.0 32.064998626708984 48 18 10 10 10 4.714168964753299 21.21264654442295 0.0 3 0.9818900846606374 9.156859551766129 14331.0 38.9253304217906 0.0 - - - - - - - 615.4285714285714 28 7 FYN FYN oncogene related to SRC, FGR, YES 865 111 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534032.[MT7]-ESLQLIK[MT7].2b5_1.heavy 559.855 / 715.411 15913.0 32.064998626708984 48 18 10 10 10 4.714168964753299 21.21264654442295 0.0 3 0.9818900846606374 9.156859551766129 15913.0 32.84698516165488 0.0 - - - - - - - 761.8 31 15 FYN FYN oncogene related to SRC, FGR, YES 867 112 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533842.[MT7]-SPSLAK[MT7].2y4_1.heavy 445.781 / 562.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - C9orf84;PDZD2;LDLRAP1 chromosome 9 open reading frame 84;PDZ domain containing 2;low density lipoprotein receptor adaptor protein 1 869 112 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533842.[MT7]-SPSLAK[MT7].2y5_1.heavy 445.781 / 659.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - C9orf84;PDZD2;LDLRAP1 chromosome 9 open reading frame 84;PDZ domain containing 2;low density lipoprotein receptor adaptor protein 1 871 112 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533842.[MT7]-SPSLAK[MT7].2y3_1.heavy 445.781 / 475.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - C9orf84;PDZD2;LDLRAP1 chromosome 9 open reading frame 84;PDZ domain containing 2;low density lipoprotein receptor adaptor protein 1 873 112 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533842.[MT7]-SPSLAK[MT7].2b5_1.heavy 445.781 / 600.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - C9orf84;PDZD2;LDLRAP1 chromosome 9 open reading frame 84;PDZ domain containing 2;low density lipoprotein receptor adaptor protein 1 875 113 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51617.[MT7]-VLNEAVGALMYHTITLTREDLEK[MT7].4b7_1.heavy 726.899 / 827.474 2150.0 50.065250396728516 37 16 6 7 8 2.5217602871582336 31.404661141937044 0.02610015869140625 4 0.9628599456704168 6.383924055214691 2150.0 8.586191796817982 1.0 - - - - - - - 192.3 4 30 CTBP1 C-terminal binding protein 1 877 113 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51617.[MT7]-VLNEAVGALMYHTITLTREDLEK[MT7].4y10_2.heavy 726.899 / 681.391 1952.0 50.065250396728516 37 16 6 7 8 2.5217602871582336 31.404661141937044 0.02610015869140625 4 0.9628599456704168 6.383924055214691 1952.0 2.7312569169960472 1.0 - - - - - - - 296.44444444444446 3 27 CTBP1 C-terminal binding protein 1 879 113 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51617.[MT7]-VLNEAVGALMYHTITLTREDLEK[MT7].4b4_1.heavy 726.899 / 600.347 3055.0 50.065250396728516 37 16 6 7 8 2.5217602871582336 31.404661141937044 0.02610015869140625 4 0.9628599456704168 6.383924055214691 3055.0 12.705359383855559 0.0 - - - - - - - 329.36 6 25 CTBP1 C-terminal binding protein 1 881 113 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51617.[MT7]-VLNEAVGALMYHTITLTREDLEK[MT7].4b5_1.heavy 726.899 / 671.385 3281.0 50.065250396728516 37 16 6 7 8 2.5217602871582336 31.404661141937044 0.02610015869140625 4 0.9628599456704168 6.383924055214691 3281.0 11.311010533640463 2.0 - - - - - - - 702.7692307692307 10 13 CTBP1 C-terminal binding protein 1 883 114 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49884.[MT7]-ALAQALK[MT7].2y4_1.heavy 501.831 / 603.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 885 114 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49884.[MT7]-ALAQALK[MT7].2y5_1.heavy 501.831 / 674.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 887 114 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49884.[MT7]-ALAQALK[MT7].2b4_1.heavy 501.831 / 528.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 889 114 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49884.[MT7]-ALAQALK[MT7].2y6_1.heavy 501.831 / 787.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 891 115 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50695.[MT7]-SVSQK[MT7].2y4_1.heavy 418.758 / 605.374 464.0 14.303000450134277 16 2 4 10 0 0.27646701974135574 139.9445264108099 0.0 22 0.4410136148848055 1.5666263874151274 464.0 1.8082241772564356 13.0 - - - - - - - 262.18518518518516 4 27 SNW1 SNW domain containing 1 893 115 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50695.[MT7]-SVSQK[MT7].2y4_2.heavy 418.758 / 303.191 2164.0 14.303000450134277 16 2 4 10 0 0.27646701974135574 139.9445264108099 0.0 22 0.4410136148848055 1.5666263874151274 2164.0 5.53539797083508 3.0 - - - - - - - 771.2777777777778 4 18 SNW1 SNW domain containing 1 895 115 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50695.[MT7]-SVSQK[MT7].2b4_1.heavy 418.758 / 546.3 N/A 14.303000450134277 16 2 4 10 0 0.27646701974135574 139.9445264108099 0.0 22 0.4410136148848055 1.5666263874151274 4019.0 3.453468110334444 6.0 - - - - - - - 1697.111111111111 13 9 SNW1 SNW domain containing 1 897 115 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50695.[MT7]-SVSQK[MT7].2y3_1.heavy 418.758 / 506.306 557.0 14.303000450134277 16 2 4 10 0 0.27646701974135574 139.9445264108099 0.0 22 0.4410136148848055 1.5666263874151274 557.0 3.6022020524142446 20.0 - - - - - - - 669.3529411764706 8 17 SNW1 SNW domain containing 1 899 116 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534164.[MT7]-ASQEGGDVLGAR.2y8_1.heavy 652.34 / 744.4 15112.0 24.09869956970215 45 15 10 10 10 2.178812179040683 36.5429358748964 0.0 3 0.9509944815056987 5.552008899026543 15112.0 47.01877729257642 0.0 - - - - - - - 247.94444444444446 30 18 LDLRAP1 low density lipoprotein receptor adaptor protein 1 901 116 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534164.[MT7]-ASQEGGDVLGAR.2y5_1.heavy 652.34 / 515.33 17860.0 24.09869956970215 45 15 10 10 10 2.178812179040683 36.5429358748964 0.0 3 0.9509944815056987 5.552008899026543 17860.0 41.01875709663087 0.0 - - - - - - - 699.6666666666666 35 9 LDLRAP1 low density lipoprotein receptor adaptor protein 1 903 116 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534164.[MT7]-ASQEGGDVLGAR.2b7_1.heavy 652.34 / 789.349 11277.0 24.09869956970215 45 15 10 10 10 2.178812179040683 36.5429358748964 0.0 3 0.9509944815056987 5.552008899026543 11277.0 64.00650803062274 0.0 - - - - - - - 232.23529411764707 22 17 LDLRAP1 low density lipoprotein receptor adaptor protein 1 905 116 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534164.[MT7]-ASQEGGDVLGAR.2y11_1.heavy 652.34 / 1088.53 30110.0 24.09869956970215 45 15 10 10 10 2.178812179040683 36.5429358748964 0.0 3 0.9509944815056987 5.552008899026543 30110.0 110.09546294317036 0.0 - - - - - - - 222.5 60 18 LDLRAP1 low density lipoprotein receptor adaptor protein 1 907 117 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534163.[MT7]-LYIIPGIPK[MT7].2b8_2.heavy 651.425 / 506.322 14290.0 41.72757625579834 40 14 10 6 10 1.886517044439239 46.81221347231924 0.038501739501953125 3 0.9476386019199045 5.369616533595999 14290.0 22.599474245161623 0.0 - - - - - - - 456.625 28 8 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 909 117 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534163.[MT7]-LYIIPGIPK[MT7].2b3_1.heavy 651.425 / 534.341 91995.0 41.72757625579834 40 14 10 6 10 1.886517044439239 46.81221347231924 0.038501739501953125 3 0.9476386019199045 5.369616533595999 91995.0 99.6916723068426 0.0 - - - - - - - 406.0 183 2 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 911 117 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534163.[MT7]-LYIIPGIPK[MT7].2y5_1.heavy 651.425 / 655.426 110426.0 41.72757625579834 40 14 10 6 10 1.886517044439239 46.81221347231924 0.038501739501953125 3 0.9476386019199045 5.369616533595999 110426.0 208.104971679931 0.0 - - - - - - - 788.7142857142857 220 7 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 913 117 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534163.[MT7]-LYIIPGIPK[MT7].2b4_1.heavy 651.425 / 647.425 63495.0 41.72757625579834 40 14 10 6 10 1.886517044439239 46.81221347231924 0.038501739501953125 3 0.9476386019199045 5.369616533595999 63495.0 84.95789279776832 0.0 - - - - - - - 707.4285714285714 126 7 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 915 118 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49983.[MT7]-VLDEWK[MT7].2y4_1.heavy 539.313 / 721.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 917 118 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49983.[MT7]-VLDEWK[MT7].2y5_1.heavy 539.313 / 834.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 919 118 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49983.[MT7]-VLDEWK[MT7].2b4_1.heavy 539.313 / 601.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 921 118 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49983.[MT7]-VLDEWK[MT7].2y3_1.heavy 539.313 / 606.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 923 119 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49985.[MT7]-WPDLHK[MT7].2y5_1.heavy 542.313 / 753.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD4 SMAD family member 4 925 119 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49985.[MT7]-WPDLHK[MT7].2y3_1.heavy 542.313 / 541.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD4 SMAD family member 4 927 120 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49986.[MT7]-SSHPEDLR.2y5_1.heavy 542.779 / 629.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 929 120 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49986.[MT7]-SSHPEDLR.2b6_1.heavy 542.779 / 797.355 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 931 120 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49986.[MT7]-SSHPEDLR.2y6_1.heavy 542.779 / 766.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 933 120 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49986.[MT7]-SSHPEDLR.2y7_1.heavy 542.779 / 853.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 935 121 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50059.[MT7]-LAETYLHR.2y5_1.heavy 573.823 / 689.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 937 121 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50059.[MT7]-LAETYLHR.2y6_1.heavy 573.823 / 818.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 939 121 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50059.[MT7]-LAETYLHR.2b5_1.heavy 573.823 / 722.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 941 121 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50059.[MT7]-LAETYLHR.2y7_1.heavy 573.823 / 889.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 943 122 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51518.[MT7]-GREGPVQFEEDPFGLDK[MT7].3b6_1.heavy 736.711 / 740.417 2459.0 37.325199127197266 38 13 10 5 10 2.313046990490889 43.23301705979497 0.042999267578125 3 0.9246835344322103 4.468411608767655 2459.0 6.33847428874067 0.0 - - - - - - - 650.5 4 8 SNW1 SNW domain containing 1 945 122 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51518.[MT7]-GREGPVQFEEDPFGLDK[MT7].3y6_1.heavy 736.711 / 820.469 20811.0 37.325199127197266 38 13 10 5 10 2.313046990490889 43.23301705979497 0.042999267578125 3 0.9246835344322103 4.468411608767655 20811.0 82.9770106591209 0.0 - - - - - - - 331.125 41 8 SNW1 SNW domain containing 1 947 122 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51518.[MT7]-GREGPVQFEEDPFGLDK[MT7].3y4_1.heavy 736.711 / 576.347 11162.0 37.325199127197266 38 13 10 5 10 2.313046990490889 43.23301705979497 0.042999267578125 3 0.9246835344322103 4.468411608767655 11162.0 21.6063574235028 0.0 - - - - - - - 331.0 22 8 SNW1 SNW domain containing 1 949 122 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51518.[MT7]-GREGPVQFEEDPFGLDK[MT7].3y5_1.heavy 736.711 / 723.416 6054.0 37.325199127197266 38 13 10 5 10 2.313046990490889 43.23301705979497 0.042999267578125 3 0.9246835344322103 4.468411608767655 6054.0 15.071625428245147 0.0 - - - - - - - 686.0 12 8 SNW1 SNW domain containing 1 951 123 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50806.[MT7]-FNDILGR.2b3_1.heavy 489.778 / 521.248 49376.0 34.59880065917969 47 17 10 10 10 4.939763268186889 20.243885095470258 0.0 3 0.9781999980369392 8.343378821982807 49376.0 56.782244973670736 0.0 - - - - - - - 1206.857142857143 98 7 CSNK2A1 casein kinase 2, alpha 1 polypeptide 953 123 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50806.[MT7]-FNDILGR.2y5_1.heavy 489.778 / 573.336 8926.0 34.59880065917969 47 17 10 10 10 4.939763268186889 20.243885095470258 0.0 3 0.9781999980369392 8.343378821982807 8926.0 12.8845420028887 5.0 - - - - - - - 1247.5714285714287 103 7 CSNK2A1 casein kinase 2, alpha 1 polypeptide 955 123 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50806.[MT7]-FNDILGR.2b4_1.heavy 489.778 / 634.332 14433.0 34.59880065917969 47 17 10 10 10 4.939763268186889 20.243885095470258 0.0 3 0.9781999980369392 8.343378821982807 14433.0 25.10974384717718 0.0 - - - - - - - 707.2222222222222 28 9 CSNK2A1 casein kinase 2, alpha 1 polypeptide 957 123 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50806.[MT7]-FNDILGR.2y6_1.heavy 489.778 / 687.378 37032.0 34.59880065917969 47 17 10 10 10 4.939763268186889 20.243885095470258 0.0 3 0.9781999980369392 8.343378821982807 37032.0 44.76376345028718 0.0 - - - - - - - 771.875 74 8 CSNK2A1 casein kinase 2, alpha 1 polypeptide 959 124 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50552.[MT7]-QSPQAPFAELADDEK[MT7].3y3_1.heavy 645.33 / 535.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 961 124 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50552.[MT7]-QSPQAPFAELADDEK[MT7].3b4_1.heavy 645.33 / 585.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 963 124 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50552.[MT7]-QSPQAPFAELADDEK[MT7].3b5_1.heavy 645.33 / 656.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 965 124 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50552.[MT7]-QSPQAPFAELADDEK[MT7].3y5_1.heavy 645.33 / 721.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 967 125 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534024.[MT7]-LEWELK[MT7].2y4_1.heavy 553.328 / 719.421 15657.0 36.999298095703125 40 20 0 10 10 7.757415151627318 12.890891881559597 0.0 3 0.9951149896138305 17.650323557404207 15657.0 27.817005076142134 0.0 - - - - - - - 369.0 31 12 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 969 125 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534024.[MT7]-LEWELK[MT7].2y5_1.heavy 553.328 / 848.463 16741.0 36.999298095703125 40 20 0 10 10 7.757415151627318 12.890891881559597 0.0 3 0.9951149896138305 17.650323557404207 16741.0 24.827992280204356 0.0 - - - - - - - 295.27272727272725 33 11 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 971 125 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534024.[MT7]-LEWELK[MT7].2b4_1.heavy 553.328 / 702.358 9355.0 36.999298095703125 40 20 0 10 10 7.757415151627318 12.890891881559597 0.0 3 0.9951149896138305 17.650323557404207 9355.0 19.744751693002257 0.0 - - - - - - - 775.375 18 8 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 973 125 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534024.[MT7]-LEWELK[MT7].2y3_1.heavy 553.328 / 533.341 9257.0 36.999298095703125 40 20 0 10 10 7.757415151627318 12.890891881559597 0.0 3 0.9951149896138305 17.650323557404207 9257.0 9.160442345125254 1.0 - - - - - - - 246.0 181 2 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 975 126 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533939.[MT7]-GGLVDEK[MT7].2y4_1.heavy 503.295 / 634.353 9351.0 22.488800048828125 50 20 10 10 10 9.278055235236375 10.778120787664434 0.0 3 0.9914417226110073 13.330884599911034 9351.0 39.44541099291588 0.0 - - - - - - - 730.0 18 7 CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 977 126 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533939.[MT7]-GGLVDEK[MT7].2y3_1.heavy 503.295 / 535.284 13336.0 22.488800048828125 50 20 10 10 10 9.278055235236375 10.778120787664434 0.0 3 0.9914417226110073 13.330884599911034 13336.0 32.07590857633829 0.0 - - - - - - - 656.2307692307693 26 13 CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 979 126 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533939.[MT7]-GGLVDEK[MT7].2y6_1.heavy 503.295 / 804.458 4752.0 22.488800048828125 50 20 10 10 10 9.278055235236375 10.778120787664434 0.0 3 0.9914417226110073 13.330884599911034 4752.0 32.11968358981734 0.0 - - - - - - - 184.6153846153846 9 26 CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 981 126 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533939.[MT7]-GGLVDEK[MT7].2b5_1.heavy 503.295 / 586.332 35307.0 22.488800048828125 50 20 10 10 10 9.278055235236375 10.778120787664434 0.0 3 0.9914417226110073 13.330884599911034 35307.0 57.35431434053339 0.0 - - - - - - - 1189.7142857142858 70 7 CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 983 127 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50153.[MT7]-ELQVFSAQR.2b3_1.heavy 611.339 / 515.295 4687.0 38.84526697794596 34 14 10 6 4 2.49718968938588 40.04501557292287 0.0355987548828125 8 0.9326063465168849 4.7269728037703445 4687.0 4.501539764297056 0.0 - - - - - - - 773.25 9 12 PRICKLE1 prickle homolog 1 (Drosophila) 985 127 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50153.[MT7]-ELQVFSAQR.2y8_1.heavy 611.339 / 948.526 N/A 38.84526697794596 34 14 10 6 4 2.49718968938588 40.04501557292287 0.0355987548828125 8 0.9326063465168849 4.7269728037703445 375.0 1.0472419928825623 27.0 - - - - - - - 260.27777777777777 3 18 PRICKLE1 prickle homolog 1 (Drosophila) 987 127 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50153.[MT7]-ELQVFSAQR.2y5_1.heavy 611.339 / 608.315 1875.0 38.84526697794596 34 14 10 6 4 2.49718968938588 40.04501557292287 0.0355987548828125 8 0.9326063465168849 4.7269728037703445 1875.0 2.8011890894656015 9.0 - - - - - - - 720.9230769230769 9 13 PRICKLE1 prickle homolog 1 (Drosophila) 989 127 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50153.[MT7]-ELQVFSAQR.2y6_1.heavy 611.339 / 707.383 1406.0 38.84526697794596 34 14 10 6 4 2.49718968938588 40.04501557292287 0.0355987548828125 8 0.9326063465168849 4.7269728037703445 1406.0 1.7146341463414634 7.0 - - - - - - - 663.1538461538462 3 13 PRICKLE1 prickle homolog 1 (Drosophila) 991 128 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50155.[MT7]-TIAASASSVK[MT7].2y4_1.heavy 611.866 / 564.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 993 128 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50155.[MT7]-TIAASASSVK[MT7].2y8_1.heavy 611.866 / 864.491 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 995 128 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50155.[MT7]-TIAASASSVK[MT7].2y6_1.heavy 611.866 / 722.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 997 128 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50155.[MT7]-TIAASASSVK[MT7].2y7_1.heavy 611.866 / 793.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 999 129 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50945.[MT7]-TAQNHPMLVELK[MT7].3y3_1.heavy 556.983 / 533.341 6890.0 30.993324756622314 37 16 10 3 8 2.8074402158333247 29.655506381084166 0.07470130920410156 4 0.9688590896537086 6.975304970517426 6890.0 3.9726569495656383 1.0 - - - - - - - 1369.5 13 10 LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1001 129 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50945.[MT7]-TAQNHPMLVELK[MT7].3b4_1.heavy 556.983 / 559.296 9962.0 30.993324756622314 37 16 10 3 8 2.8074402158333247 29.655506381084166 0.07470130920410156 4 0.9688590896537086 6.975304970517426 9962.0 10.568528833922603 0.0 - - - - - - - 1291.111111111111 19 9 LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1003 129 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50945.[MT7]-TAQNHPMLVELK[MT7].3y4_1.heavy 556.983 / 632.41 5977.0 30.993324756622314 37 16 10 3 8 2.8074402158333247 29.655506381084166 0.07470130920410156 4 0.9688590896537086 6.975304970517426 5977.0 8.915993089466742 1.0 - - - - - - - 755.3 13 10 LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1005 129 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50945.[MT7]-TAQNHPMLVELK[MT7].3y5_1.heavy 556.983 / 745.494 5977.0 30.993324756622314 37 16 10 3 8 2.8074402158333247 29.655506381084166 0.07470130920410156 4 0.9688590896537086 6.975304970517426 5977.0 3.8124025513819984 1.0 - - - - - - - 771.9 11 10 LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1007 130 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533933.[MT7]-AFLSFK[MT7].2y4_1.heavy 500.807 / 638.399 7401.0 37.02843221028646 41 18 10 5 8 3.1877334561240596 25.386440561234302 0.043701171875 4 0.9829878933335602 9.448561696235645 7401.0 12.079110797785663 0.0 - - - - - - - 740.0 14 10 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1009 130 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533933.[MT7]-AFLSFK[MT7].2y5_1.heavy 500.807 / 785.468 6118.0 37.02843221028646 41 18 10 5 8 3.1877334561240596 25.386440561234302 0.043701171875 4 0.9829878933335602 9.448561696235645 6118.0 8.13866009836005 1.0 - - - - - - - 197.375 14 8 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1011 130 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533933.[MT7]-AFLSFK[MT7].2b4_1.heavy 500.807 / 563.331 N/A 37.02843221028646 41 18 10 5 8 3.1877334561240596 25.386440561234302 0.043701171875 4 0.9829878933335602 9.448561696235645 1579.0 1.2612298033265774 17.0 - - - - - - - 329.0 9 3 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1013 130 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533933.[MT7]-AFLSFK[MT7].2y3_1.heavy 500.807 / 525.315 10854.0 37.02843221028646 41 18 10 5 8 3.1877334561240596 25.386440561234302 0.043701171875 4 0.9829878933335602 9.448561696235645 10854.0 1.2782133818919388 0.0 - - - - - - - 444.0 21 4 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1015 131 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50412.[MT7]-LAEALYIADRK[MT7].3y6_1.heavy 517.643 / 909.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 1017 131 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50412.[MT7]-LAEALYIADRK[MT7].3b4_1.heavy 517.643 / 529.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 1019 131 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50412.[MT7]-LAEALYIADRK[MT7].3y4_1.heavy 517.643 / 633.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 1021 131 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50412.[MT7]-LAEALYIADRK[MT7].3y5_1.heavy 517.643 / 746.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 1023 132 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 836582.0 35.48109817504883 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 836582.0 105.52711943641252 0.0 - - - - - - - 662.5 1673 8 1025 132 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 171864.0 35.48109817504883 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 171864.0 164.55751501112888 0.0 - - - - - - - 625.0 343 8 1027 132 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 284005.0 35.48109817504883 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 284005.0 62.50979360295976 0.0 - - - - - - - 700.0 568 7 1029 133 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50158.[MT7]-RGPGVAPEGSR.2b8_1.heavy 613.84 / 908.507 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 1031 133 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50158.[MT7]-RGPGVAPEGSR.2y5_1.heavy 613.84 / 545.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 1033 133 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50158.[MT7]-RGPGVAPEGSR.2b6_1.heavy 613.84 / 682.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 1035 133 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50158.[MT7]-RGPGVAPEGSR.2y10_1.heavy 613.84 / 926.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 1037 134 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534020.[MT7]-HHQLLFGTGLLK[MT7].3y6_1.heavy 551.334 / 732.474 31731.0 35.11399841308594 44 14 10 10 10 2.315207048592978 28.841367511205952 0.0 3 0.9407099860325077 5.043152527152206 31731.0 66.68108695652174 0.0 - - - - - - - 777.4444444444445 63 9 TSNARE1 t-SNARE domain containing 1 1039 134 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534020.[MT7]-HHQLLFGTGLLK[MT7].3b4_1.heavy 551.334 / 660.37 21187.0 35.11399841308594 44 14 10 10 10 2.315207048592978 28.841367511205952 0.0 3 0.9407099860325077 5.043152527152206 21187.0 25.992531953879748 0.0 - - - - - - - 788.2857142857143 42 7 TSNARE1 t-SNARE domain containing 1 1041 134 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534020.[MT7]-HHQLLFGTGLLK[MT7].3y4_1.heavy 551.334 / 574.404 30548.0 35.11399841308594 44 14 10 10 10 2.315207048592978 28.841367511205952 0.0 3 0.9407099860325077 5.043152527152206 30548.0 58.190198190244985 0.0 - - - - - - - 799.1111111111111 61 9 TSNARE1 t-SNARE domain containing 1 1043 134 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534020.[MT7]-HHQLLFGTGLLK[MT7].3b3_1.heavy 551.334 / 547.286 20792.0 35.11399841308594 44 14 10 10 10 2.315207048592978 28.841367511205952 0.0 3 0.9407099860325077 5.043152527152206 20792.0 24.6904976823572 0.0 - - - - - - - 717.8571428571429 41 7 TSNARE1 t-SNARE domain containing 1 1045 135 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534021.[MT7]-VQSVEQIR.2y4_1.heavy 551.82 / 545.304 29786.0 25.507200241088867 50 20 10 10 10 15.004855070386016 6.664509555801221 0.0 3 0.9971059862547825 22.93545084601376 29786.0 15.751929748597437 0.0 - - - - - - - 1313.3333333333333 59 9 CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 1047 135 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534021.[MT7]-VQSVEQIR.2y6_1.heavy 551.82 / 731.405 77335.0 25.507200241088867 50 20 10 10 10 15.004855070386016 6.664509555801221 0.0 3 0.9971059862547825 22.93545084601376 77335.0 148.47824137349193 0.0 - - - - - - - 695.5 154 10 CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 1049 135 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534021.[MT7]-VQSVEQIR.2b5_1.heavy 551.82 / 687.379 32082.0 25.507200241088867 50 20 10 10 10 15.004855070386016 6.664509555801221 0.0 3 0.9971059862547825 22.93545084601376 32082.0 63.19822648509966 0.0 - - - - - - - 348.8333333333333 64 6 CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 1051 135 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534021.[MT7]-VQSVEQIR.2y7_1.heavy 551.82 / 859.463 170812.0 25.507200241088867 50 20 10 10 10 15.004855070386016 6.664509555801221 0.0 3 0.9971059862547825 22.93545084601376 170812.0 448.5507282787498 0.0 - - - - - - - 219.75 341 4 CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 1053 136 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533845.[MT7]-FVPDK[MT7].2y4_1.heavy 447.27 / 602.363 23121.0 26.099700927734375 48 18 10 10 10 2.976236592532814 33.599479373008705 0.0 3 0.9885746381573735 11.534878429757137 23121.0 54.79960535117057 0.0 - - - - - - - 716.5384615384615 46 13 SNW1 SNW domain containing 1 1055 136 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533845.[MT7]-FVPDK[MT7].2b4_1.heavy 447.27 / 603.326 18497.0 26.099700927734375 48 18 10 10 10 2.976236592532814 33.599479373008705 0.0 3 0.9885746381573735 11.534878429757137 18497.0 45.2777337155598 0.0 - - - - - - - 362.25 36 4 SNW1 SNW domain containing 1 1057 136 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533845.[MT7]-FVPDK[MT7].2y3_1.heavy 447.27 / 503.295 86204.0 26.099700927734375 48 18 10 10 10 2.976236592532814 33.599479373008705 0.0 3 0.9885746381573735 11.534878429757137 86204.0 81.65882042184111 0.0 - - - - - - - 448.5 172 2 SNW1 SNW domain containing 1 1059 137 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533936.[MT7]-ILDLIK[MT7].2y4_1.heavy 501.844 / 632.41 38799.0 40.46357345581055 44 18 10 6 10 5.950087947289666 16.806474271619994 0.0308990478515625 3 0.9898219688568959 12.222539164708827 38799.0 14.725187433272827 1.0 - - - - - - - 339.6666666666667 77 3 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1061 137 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533936.[MT7]-ILDLIK[MT7].2y5_1.heavy 501.844 / 745.494 74776.0 40.46357345581055 44 18 10 6 10 5.950087947289666 16.806474271619994 0.0308990478515625 3 0.9898219688568959 12.222539164708827 74776.0 135.6551325590477 0.0 - - - - - - - 326.5 149 6 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1063 137 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533936.[MT7]-ILDLIK[MT7].2b4_1.heavy 501.844 / 599.388 21398.0 40.46357345581055 44 18 10 6 10 5.950087947289666 16.806474271619994 0.0308990478515625 3 0.9898219688568959 12.222539164708827 21398.0 31.869361702127655 1.0 - - - - - - - 696.7777777777778 43 9 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1065 137 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533936.[MT7]-ILDLIK[MT7].2y3_1.heavy 501.844 / 517.383 56121.0 40.46357345581055 44 18 10 6 10 5.950087947289666 16.806474271619994 0.0308990478515625 3 0.9898219688568959 12.222539164708827 56121.0 70.96355521409896 0.0 - - - - - - - 1187.0 112 7 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1067 138 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534295.[MT7]-K[MT7]LPENWTDTR.3y6_1.heavy 516.619 / 792.364 22455.0 28.188899993896484 40 10 10 10 10 1.1331596251478164 58.64138872016105 0.0 3 0.8432390029181932 3.07538516033994 22455.0 59.233812949640296 0.0 - - - - - - - 274.11764705882354 44 17 LDLRAP1 low density lipoprotein receptor adaptor protein 1 1069 138 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534295.[MT7]-K[MT7]LPENWTDTR.3b5_1.heavy 516.619 / 870.529 15225.0 28.188899993896484 40 10 10 10 10 1.1331596251478164 58.64138872016105 0.0 3 0.8432390029181932 3.07538516033994 15225.0 17.516778523489933 0.0 - - - - - - - 1260.0 30 8 LDLRAP1 low density lipoprotein receptor adaptor protein 1 1071 138 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534295.[MT7]-K[MT7]LPENWTDTR.3y5_1.heavy 516.619 / 678.321 21412.0 28.188899993896484 40 10 10 10 10 1.1331596251478164 58.64138872016105 0.0 3 0.8432390029181932 3.07538516033994 21412.0 31.608228992593048 0.0 - - - - - - - 753.1666666666666 42 12 LDLRAP1 low density lipoprotein receptor adaptor protein 1 1073 138 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534295.[MT7]-K[MT7]LPENWTDTR.3b8_2.heavy 516.619 / 636.845 64027.0 28.188899993896484 40 10 10 10 10 1.1331596251478164 58.64138872016105 0.0 3 0.8432390029181932 3.07538516033994 64027.0 43.57387509399558 0.0 - - - - - - - 226.25 128 4 LDLRAP1 low density lipoprotein receptor adaptor protein 1 1075 139 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533851.[MT7]-RLAADGR.2y5_1.heavy 451.768 / 489.242 2323.0 16.15999984741211 45 17 10 10 8 4.021033497246308 24.869228288817336 0.0 4 0.9756215060963555 7.888104890010848 2323.0 7.097227214377407 1.0 - - - - - - - 667.9090909090909 5 11 SNW1 SNW domain containing 1 1077 139 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533851.[MT7]-RLAADGR.2b4_1.heavy 451.768 / 556.369 1401.0 16.15999984741211 45 17 10 10 8 4.021033497246308 24.869228288817336 0.0 4 0.9756215060963555 7.888104890010848 1401.0 3.168063051375195 1.0 - - - - - - - 751.8 7 10 SNW1 SNW domain containing 1 1079 139 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533851.[MT7]-RLAADGR.2y6_1.heavy 451.768 / 602.326 7038.0 16.15999984741211 45 17 10 10 8 4.021033497246308 24.869228288817336 0.0 4 0.9756215060963555 7.888104890010848 7038.0 23.964076655052263 0.0 - - - - - - - 225.27272727272728 14 22 SNW1 SNW domain containing 1 1081 139 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533851.[MT7]-RLAADGR.2b5_1.heavy 451.768 / 671.396 43358.0 16.15999984741211 45 17 10 10 8 4.021033497246308 24.869228288817336 0.0 4 0.9756215060963555 7.888104890010848 43358.0 61.23786477581595 0.0 - - - - - - - 700.625 86 8 SNW1 SNW domain containing 1 1083 140 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51507.[MT7]-GIDIQAVNVVINFDFPK[MT7].3b6_1.heavy 726.412 / 742.422 11116.0 49.12845039367676 37 11 10 6 10 1.4183945097493142 56.84017629439524 0.032299041748046875 3 0.865339435413358 3.32463243376192 11116.0 41.54039862754301 0.0 - - - - - - - 283.10526315789474 22 19 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1085 140 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51507.[MT7]-GIDIQAVNVVINFDFPK[MT7].3b4_1.heavy 726.412 / 543.326 4253.0 49.12845039367676 37 11 10 6 10 1.4183945097493142 56.84017629439524 0.032299041748046875 3 0.865339435413358 3.32463243376192 4253.0 10.839222241304775 0.0 - - - - - - - 337.57142857142856 8 21 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1087 140 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51507.[MT7]-GIDIQAVNVVINFDFPK[MT7].3b5_1.heavy 726.412 / 671.385 6927.0 49.12845039367676 37 11 10 6 10 1.4183945097493142 56.84017629439524 0.032299041748046875 3 0.865339435413358 3.32463243376192 6927.0 18.646284263373538 0.0 - - - - - - - 660.625 13 8 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1089 140 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51507.[MT7]-GIDIQAVNVVINFDFPK[MT7].3b7_1.heavy 726.412 / 841.49 4414.0 49.12845039367676 37 11 10 6 10 1.4183945097493142 56.84017629439524 0.032299041748046875 3 0.865339435413358 3.32463243376192 4414.0 26.29825027685493 0.0 - - - - - - - 203.17391304347825 8 23 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1091 141 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51123.[MT7]-RPSDSSRPK[MT7].2y8_1.heavy 659.378 / 1017.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 1093 141 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51123.[MT7]-RPSDSSRPK[MT7].2y5_1.heavy 659.378 / 718.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 1095 141 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51123.[MT7]-RPSDSSRPK[MT7].2b4_1.heavy 659.378 / 600.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 1097 141 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51123.[MT7]-RPSDSSRPK[MT7].2y3_1.heavy 659.378 / 544.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 1099 142 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51302.[MT7]-GGPNIITLADIVK[MT7].2y8_1.heavy 799.99 / 1016.65 4385.0 44.30659866333008 48 18 10 10 10 9.324940596354882 10.723928905143909 0.0 3 0.9866588086888757 10.672865701401538 4385.0 10.970549453983034 0.0 - - - - - - - 196.6 8 10 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1101 142 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51302.[MT7]-GGPNIITLADIVK[MT7].2y3_1.heavy 799.99 / 503.367 4915.0 44.30659866333008 48 18 10 10 10 9.324940596354882 10.723928905143909 0.0 3 0.9866588086888757 10.672865701401538 4915.0 12.977501945957966 0.0 - - - - - - - 637.1428571428571 9 7 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1103 142 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51302.[MT7]-GGPNIITLADIVK[MT7].2b5_1.heavy 799.99 / 583.332 11115.0 44.30659866333008 48 18 10 10 10 9.324940596354882 10.723928905143909 0.0 3 0.9866588086888757 10.672865701401538 11115.0 53.76885946243693 0.0 - - - - - - - 226.75 22 12 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1105 142 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51302.[MT7]-GGPNIITLADIVK[MT7].2y7_1.heavy 799.99 / 903.563 3478.0 44.30659866333008 48 18 10 10 10 9.324940596354882 10.723928905143909 0.0 3 0.9866588086888757 10.672865701401538 3478.0 12.50178563927146 0.0 - - - - - - - 219.9090909090909 6 11 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1107 143 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534194.[MT7]-IAEAYQMLK[MT7].3y3_1.heavy 452.26 / 535.339 50112.0 36.3661003112793 46 16 10 10 10 2.0568506841745826 38.37177307319436 0.0 3 0.9673444308309151 6.810747137838178 50112.0 107.32898254063818 0.0 - - - - - - - 1258.0 100 8 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1109 143 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534194.[MT7]-IAEAYQMLK[MT7].3b4_1.heavy 452.26 / 529.31 65709.0 36.3661003112793 46 16 10 10 10 2.0568506841745826 38.37177307319436 0.0 3 0.9673444308309151 6.810747137838178 65709.0 154.17432829161396 0.0 - - - - - - - 693.2222222222222 131 9 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1111 143 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534194.[MT7]-IAEAYQMLK[MT7].3b5_1.heavy 452.26 / 692.374 11773.0 36.3661003112793 46 16 10 10 10 2.0568506841745826 38.37177307319436 0.0 3 0.9673444308309151 6.810747137838178 11773.0 22.27271763158004 1.0 - - - - - - - 237.21428571428572 23 14 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1113 143 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534194.[MT7]-IAEAYQMLK[MT7].3b3_1.heavy 452.26 / 458.273 37836.0 36.3661003112793 46 16 10 10 10 2.0568506841745826 38.37177307319436 0.0 3 0.9673444308309151 6.810747137838178 37836.0 70.17814618896796 0.0 - - - - - - - 679.125 75 8 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1115 144 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534305.[MT7]-YLGMTLVEQPK[MT7].3b6_1.heavy 522.965 / 823.45 10859.0 37.477699279785156 48 18 10 10 10 4.212647897492361 23.738038980073895 0.0 3 0.9831383259599703 9.490735834534112 10859.0 50.079549689440995 0.0 - - - - - - - 254.76923076923077 21 13 LDLRAP1 low density lipoprotein receptor adaptor protein 1 1117 144 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534305.[MT7]-YLGMTLVEQPK[MT7].3b4_1.heavy 522.965 / 609.319 16657.0 37.477699279785156 48 18 10 10 10 4.212647897492361 23.738038980073895 0.0 3 0.9831383259599703 9.490735834534112 16657.0 40.41225891861762 0.0 - - - - - - - 325.53846153846155 33 13 LDLRAP1 low density lipoprotein receptor adaptor protein 1 1119 144 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534305.[MT7]-YLGMTLVEQPK[MT7].3b5_1.heavy 522.965 / 710.366 19602.0 37.477699279785156 48 18 10 10 10 4.212647897492361 23.738038980073895 0.0 3 0.9831383259599703 9.490735834534112 19602.0 63.56445652173913 0.0 - - - - - - - 297.2307692307692 39 13 LDLRAP1 low density lipoprotein receptor adaptor protein 1 1121 144 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534305.[MT7]-YLGMTLVEQPK[MT7].3y4_1.heavy 522.965 / 645.369 9295.0 37.477699279785156 48 18 10 10 10 4.212647897492361 23.738038980073895 0.0 3 0.9831383259599703 9.490735834534112 9295.0 19.495962732919253 0.0 - - - - - - - 749.1428571428571 18 7 LDLRAP1 low density lipoprotein receptor adaptor protein 1 1123 145 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50120.[MT7]-K[MT7]MEELK[MT7].3y3_1.heavy 403.913 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF800;THOC1 zinc finger protein 800;THO complex 1 1125 145 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50120.[MT7]-K[MT7]MEELK[MT7].3b3_1.heavy 403.913 / 677.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF800;THOC1 zinc finger protein 800;THO complex 1 1127 145 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50120.[MT7]-K[MT7]MEELK[MT7].3y4_1.heavy 403.913 / 662.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF800;THOC1 zinc finger protein 800;THO complex 1 1129 145 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50120.[MT7]-K[MT7]MEELK[MT7].3y5_1.heavy 403.913 / 793.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF800;THOC1 zinc finger protein 800;THO complex 1 1131 146 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50836.[MT7]-SSC[CAM]PQER.2y4_1.heavy 504.238 / 529.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 1133 146 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50836.[MT7]-SSC[CAM]PQER.2y5_1.heavy 504.238 / 689.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 1135 146 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50836.[MT7]-SSC[CAM]PQER.2b6_1.heavy 504.238 / 833.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 1137 146 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50836.[MT7]-SSC[CAM]PQER.2y6_1.heavy 504.238 / 776.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 1139 147 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534408.[MT7]-VLGTEDLYDYIDK[MT7].2y4_1.heavy 916.482 / 682.389 11305.0 41.32265090942383 44 18 10 6 10 3.523255630501735 28.3828397616892 0.0373992919921875 3 0.9802633152978966 8.770177334445957 11305.0 50.368811881188115 0.0 - - - - - - - 242.22222222222223 22 18 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1141 147 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534408.[MT7]-VLGTEDLYDYIDK[MT7].2y5_1.heavy 916.482 / 797.416 3634.0 41.32265090942383 44 18 10 6 10 3.523255630501735 28.3828397616892 0.0373992919921875 3 0.9802633152978966 8.770177334445957 3634.0 15.078230504868667 0.0 - - - - - - - 234.15 7 20 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1143 147 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534408.[MT7]-VLGTEDLYDYIDK[MT7].2b6_1.heavy 916.482 / 759.401 10659.0 41.32265090942383 44 18 10 6 10 3.523255630501735 28.3828397616892 0.0373992919921875 3 0.9802633152978966 8.770177334445957 10659.0 49.865123762376236 0.0 - - - - - - - 263.6666666666667 21 15 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1145 147 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534408.[MT7]-VLGTEDLYDYIDK[MT7].2b9_1.heavy 916.482 / 1150.57 7429.0 41.32265090942383 44 18 10 6 10 3.523255630501735 28.3828397616892 0.0373992919921875 3 0.9802633152978966 8.770177334445957 7429.0 24.001410891089108 0.0 - - - - - - - 280.4736842105263 14 19 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1147 148 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533854.[MT7]-EVASGAAR.2y5_1.heavy 452.752 / 461.247 34371.0 15.944199562072754 50 20 10 10 10 28.059139760870725 3.563901133542692 0.0 3 0.9974372325935345 24.3733362809648 34371.0 130.22064873417722 0.0 - - - - - - - 278.8333333333333 68 18 CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 1149 148 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533854.[MT7]-EVASGAAR.2b6_1.heavy 452.752 / 659.348 25562.0 15.944199562072754 50 20 10 10 10 28.059139760870725 3.563901133542692 0.0 3 0.9974372325935345 24.3733362809648 25562.0 65.16569867221006 0.0 - - - - - - - 698.2857142857143 51 7 CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 1151 148 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533854.[MT7]-EVASGAAR.2y6_1.heavy 452.752 / 532.284 61795.0 15.944199562072754 50 20 10 10 10 28.059139760870725 3.563901133542692 0.0 3 0.9974372325935345 24.3733362809648 61795.0 210.71355996896204 0.0 - - - - - - - 241.46666666666667 123 15 CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 1153 148 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533854.[MT7]-EVASGAAR.2y7_1.heavy 452.752 / 631.352 107701.0 15.944199562072754 50 20 10 10 10 28.059139760870725 3.563901133542692 0.0 3 0.9974372325935345 24.3733362809648 107701.0 354.43050689104894 0.0 - - - - - - - 769.2857142857143 215 7 CTBP1;CTBP2 C-terminal binding protein 1;C-terminal binding protein 2 1155 149 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 577367.0 23.53380012512207 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 577367.0 578.2432916660977 0.0 - - - - - - - 757.6 1154 15 1157 149 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 914563.0 23.53380012512207 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 914563.0 2403.7237183439775 0.0 - - - - - - - 275.48 1829 25 1159 149 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 2873320.0 23.53380012512207 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2873320.0 6794.262374936397 0.0 - - - - - - - 247.73333333333332 5746 15 1161 150 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534682.[MT7]-VLNEAVGALMY[MT7]HTITLTR.4y5_1.heavy 573.326 / 603.382 6326.0 45.02012538909912 44 18 10 6 10 4.279405985349996 23.36772915267617 0.034702301025390625 3 0.9801729682141791 8.750106348881957 6326.0 19.274798439226196 0.0 - - - - - - - 257.36842105263156 12 19 CTBP1 C-terminal binding protein 1 1163 150 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534682.[MT7]-VLNEAVGALMY[MT7]HTITLTR.4b4_1.heavy 573.326 / 600.347 12196.0 45.02012538909912 44 18 10 6 10 4.279405985349996 23.36772915267617 0.034702301025390625 3 0.9801729682141791 8.750106348881957 12196.0 43.721616139997934 0.0 - - - - - - - 331.2307692307692 24 13 CTBP1 C-terminal binding protein 1 1165 150 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534682.[MT7]-VLNEAVGALMY[MT7]HTITLTR.4b5_1.heavy 573.326 / 671.385 12000.0 45.02012538909912 44 18 10 6 10 4.279405985349996 23.36772915267617 0.034702301025390625 3 0.9801729682141791 8.750106348881957 12000.0 81.49120517772326 0.0 - - - - - - - 231.88888888888889 24 18 CTBP1 C-terminal binding protein 1 1167 150 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534682.[MT7]-VLNEAVGALMY[MT7]HTITLTR.4y6_1.heavy 573.326 / 704.43 6848.0 45.02012538909912 44 18 10 6 10 4.279405985349996 23.36772915267617 0.034702301025390625 3 0.9801729682141791 8.750106348881957 6848.0 30.297802078494797 0.0 - - - - - - - 254.05263157894737 13 19 CTBP1 C-terminal binding protein 1 1169 151 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534580.[MT7]-EVQGFESATFLGYFK[MT7].3b6_1.heavy 671.019 / 834.411 13441.0 45.756500244140625 43 13 10 10 10 2.6435134656487502 37.82844358443954 0.0 3 0.9150289644800672 4.203418684079429 13441.0 51.07509713869974 0.0 - - - - - - - 666.0 26 7 GSN gelsolin 1171 151 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534580.[MT7]-EVQGFESATFLGYFK[MT7].3b4_1.heavy 671.019 / 558.3 15621.0 45.756500244140625 43 13 10 10 10 2.6435134656487502 37.82844358443954 0.0 3 0.9150289644800672 4.203418684079429 15621.0 10.960587509086084 1.0 - - - - - - - 1665.0 31 10 GSN gelsolin 1173 151 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534580.[MT7]-EVQGFESATFLGYFK[MT7].3b5_1.heavy 671.019 / 705.369 11807.0 45.756500244140625 43 13 10 10 10 2.6435134656487502 37.82844358443954 0.0 3 0.9150289644800672 4.203418684079429 11807.0 18.410117234329846 0.0 - - - - - - - 716.4166666666666 23 12 GSN gelsolin 1175 151 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534580.[MT7]-EVQGFESATFLGYFK[MT7].3y4_1.heavy 671.019 / 658.368 61576.0 45.756500244140625 43 13 10 10 10 2.6435134656487502 37.82844358443954 0.0 3 0.9150289644800672 4.203418684079429 61576.0 137.14073983523093 0.0 - - - - - - - 1224.2222222222222 123 9 GSN gelsolin 1177 152 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50264.[MT7]-IAEAYQMLK[MT7].2b4_1.heavy 677.886 / 529.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1179 152 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50264.[MT7]-IAEAYQMLK[MT7].2y3_1.heavy 677.886 / 535.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1181 152 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50264.[MT7]-IAEAYQMLK[MT7].2y6_1.heavy 677.886 / 897.498 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1183 152 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50264.[MT7]-IAEAYQMLK[MT7].2y7_1.heavy 677.886 / 1026.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1185 153 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534582.[MT7]-TPALVFEHVNNTDFK[MT7].4b7_1.heavy 505.774 / 902.51 3800.0 36.28409957885742 47 17 10 10 10 2.4024940113330833 41.62341280697409 0.0 3 0.9708128836086873 7.2061742522568455 3800.0 9.12 0.0 - - - - - - - 644.4444444444445 7 9 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1187 153 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534582.[MT7]-TPALVFEHVNNTDFK[MT7].4b4_1.heavy 505.774 / 527.331 41698.0 36.28409957885742 47 17 10 10 10 2.4024940113330833 41.62341280697409 0.0 3 0.9708128836086873 7.2061742522568455 41698.0 8.8750649509295 0.0 - - - - - - - 1785.7142857142858 83 7 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1189 153 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534582.[MT7]-TPALVFEHVNNTDFK[MT7].4b14_2.heavy 505.774 / 865.437 1700.0 36.28409957885742 47 17 10 10 10 2.4024940113330833 41.62341280697409 0.0 3 0.9708128836086873 7.2061742522568455 1700.0 2.0453968253968253 3.0 - - - - - - - 237.5 8 8 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1191 153 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534582.[MT7]-TPALVFEHVNNTDFK[MT7].4y3_1.heavy 505.774 / 553.31 26999.0 36.28409957885742 47 17 10 10 10 2.4024940113330833 41.62341280697409 0.0 3 0.9708128836086873 7.2061742522568455 26999.0 32.458797777777775 0.0 - - - - - - - 800.0 53 5 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1193 154 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534284.[MT7]-ILQAVNALGYC[CAM]R.2y8_1.heavy 761.42 / 952.467 10704.0 39.58272361755371 43 17 10 6 10 10.64140890438335 9.397251895734271 0.03530120849609375 3 0.9796490160475257 8.636352769393685 10704.0 35.8776144397429 0.0 - - - - - - - 272.7647058823529 21 17 TSNARE1 t-SNARE domain containing 1 1195 154 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534284.[MT7]-ILQAVNALGYC[CAM]R.2y9_1.heavy 761.42 / 1023.5 15577.0 39.58272361755371 43 17 10 6 10 10.64140890438335 9.397251895734271 0.03530120849609375 3 0.9796490160475257 8.636352769393685 15577.0 56.19941567533858 0.0 - - - - - - - 274.625 31 16 TSNARE1 t-SNARE domain containing 1 1197 154 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534284.[MT7]-ILQAVNALGYC[CAM]R.2y10_1.heavy 761.42 / 1151.56 8307.0 39.58272361755371 43 17 10 6 10 10.64140890438335 9.397251895734271 0.03530120849609375 3 0.9796490160475257 8.636352769393685 8307.0 27.84845595216711 0.0 - - - - - - - 277.3529411764706 16 17 TSNARE1 t-SNARE domain containing 1 1199 154 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534284.[MT7]-ILQAVNALGYC[CAM]R.2y7_1.heavy 761.42 / 853.398 8387.0 39.58272361755371 43 17 10 6 10 10.64140890438335 9.397251895734271 0.03530120849609375 3 0.9796490160475257 8.636352769393685 8387.0 38.105409617794486 0.0 - - - - - - - 219.85 16 20 TSNARE1 t-SNARE domain containing 1 1201 155 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534280.[MT7]-VYTDVNTHRPR.3y10_2.heavy 501.271 / 629.818 53542.0 20.33769989013672 46 16 10 10 10 3.05773660272299 32.70392875270798 0.0 3 0.9678424107855631 6.863567093025868 53542.0 356.56031296387926 0.0 - - - - - - - 281.0 107 13 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1203 155 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534280.[MT7]-VYTDVNTHRPR.3b4_1.heavy 501.271 / 623.316 63154.0 20.33769989013672 46 16 10 10 10 3.05773660272299 32.70392875270798 0.0 3 0.9678424107855631 6.863567093025868 63154.0 195.367167071499 0.0 - - - - - - - 365.3 126 10 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1205 155 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534280.[MT7]-VYTDVNTHRPR.3y4_1.heavy 501.271 / 565.332 5102.0 20.33769989013672 46 16 10 10 10 3.05773660272299 32.70392875270798 0.0 3 0.9678424107855631 6.863567093025868 5102.0 24.41689460663038 0.0 - - - - - - - 711.625 10 8 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1207 155 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534280.[MT7]-VYTDVNTHRPR.3y9_2.heavy 501.271 / 548.286 23737.0 20.33769989013672 46 16 10 10 10 3.05773660272299 32.70392875270798 0.0 3 0.9678424107855631 6.863567093025868 23737.0 90.33785869962811 0.0 - - - - - - - 636.7142857142857 47 7 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1209 156 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50076.[MT7]-TASDFITK[MT7].2y4_1.heavy 585.834 / 652.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 1211 156 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50076.[MT7]-TASDFITK[MT7].2b4_1.heavy 585.834 / 519.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 1213 156 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50076.[MT7]-TASDFITK[MT7].2y3_1.heavy 585.834 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 1215 156 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50076.[MT7]-TASDFITK[MT7].2b5_1.heavy 585.834 / 666.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 1217 157 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534182.[MT7]-ARLEWELK[MT7].3b6_2.heavy 444.934 / 465.252 41664.0 32.914398193359375 34 12 4 10 8 0.9174621342302978 64.54875478899703 0.0 4 0.8950887916651684 3.7764118114970566 41664.0 55.49663760232515 0.0 - - - - - - - 370.2 83 5 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1219 157 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534182.[MT7]-ARLEWELK[MT7].3b6_1.heavy 444.934 / 929.496 N/A 32.914398193359375 34 12 4 10 8 0.9174621342302978 64.54875478899703 0.0 4 0.8950887916651684 3.7764118114970566 93.0 1.95 16.0 - - - - - - - 0.0 0 0 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1221 157 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534182.[MT7]-ARLEWELK[MT7].3y3_1.heavy 444.934 / 533.341 36850.0 32.914398193359375 34 12 4 10 8 0.9174621342302978 64.54875478899703 0.0 4 0.8950887916651684 3.7764118114970566 36850.0 46.31357269636251 1.0 - - - - - - - 1191.875 164 8 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1223 157 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534182.[MT7]-ARLEWELK[MT7].3b4_1.heavy 444.934 / 614.374 19073.0 32.914398193359375 34 12 4 10 8 0.9174621342302978 64.54875478899703 0.0 4 0.8950887916651684 3.7764118114970566 19073.0 26.629061158407914 0.0 - - - - - - - 771.6666666666666 38 9 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1225 158 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51112.[MT7]-LYIIPGIPK[MT7].3b4_1.heavy 434.619 / 647.425 102875.0 41.71795082092285 36 10 10 6 10 0.6501503185265394 77.70012237279963 0.038501739501953125 3 0.8231927796228191 2.8906489742138755 102875.0 1438.47906885759 0.0 - - - - - - - 178.4 205 5 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1227 158 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51112.[MT7]-LYIIPGIPK[MT7].3b3_1.heavy 434.619 / 534.341 94512.0 41.71795082092285 36 10 10 6 10 0.6501503185265394 77.70012237279963 0.038501739501953125 3 0.8231927796228191 2.8906489742138755 94512.0 1214.851256913906 0.0 - - - - - - - 162.25 189 4 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1229 158 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51112.[MT7]-LYIIPGIPK[MT7].3y5_1.heavy 434.619 / 655.426 20949.0 41.71795082092285 36 10 10 6 10 0.6501503185265394 77.70012237279963 0.038501739501953125 3 0.8231927796228191 2.8906489742138755 20949.0 112.05928897309586 0.0 - - - - - - - 203.08333333333334 41 12 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1231 158 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51112.[MT7]-LYIIPGIPK[MT7].3b8_2.heavy 434.619 / 506.322 34833.0 41.71795082092285 36 10 10 6 10 0.6501503185265394 77.70012237279963 0.038501739501953125 3 0.8231927796228191 2.8906489742138755 34833.0 144.79210235551238 0.0 - - - - - - - 221.54545454545453 69 11 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1233 159 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534289.[MT7]-LNDSIAEELNK[MT7].3b6_1.heavy 511.95 / 758.417 22224.0 34.10029983520508 44 16 10 10 8 3.0363517145471643 32.93426104785552 0.0 4 0.9675899158848124 6.836633490308785 22224.0 39.31178666666666 0.0 - - - - - - - 247.85714285714286 44 14 POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 1235 159 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534289.[MT7]-LNDSIAEELNK[MT7].3y3_1.heavy 511.95 / 518.342 39290.0 34.10029983520508 44 16 10 10 8 3.0363517145471643 32.93426104785552 0.0 4 0.9675899158848124 6.836633490308785 39290.0 8.315730600014401 1.0 - - - - - - - 1219.0 96 8 POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 1237 159 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534289.[MT7]-LNDSIAEELNK[MT7].3b4_1.heavy 511.95 / 574.295 44917.0 34.10029983520508 44 16 10 10 8 3.0363517145471643 32.93426104785552 0.0 4 0.9675899158848124 6.836633490308785 44917.0 42.913594047090186 0.0 - - - - - - - 1205.5714285714287 89 7 POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 1239 159 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534289.[MT7]-LNDSIAEELNK[MT7].3b5_1.heavy 511.95 / 687.379 20255.0 34.10029983520508 44 16 10 10 8 3.0363517145471643 32.93426104785552 0.0 4 0.9675899158848124 6.836633490308785 20255.0 21.382132331555987 0.0 - - - - - - - 750.125 40 8 POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 1241 160 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534286.[MT7]-VAFEFWQVSK[MT7].3b6_1.heavy 510.285 / 924.474 3157.0 43.22159957885742 46 16 10 10 10 2.2710984769369373 44.031556101817046 0.0 3 0.9606748932228961 6.202886262171607 3157.0 31.293070175438594 0.0 - - - - - - - 170.75 6 8 LDLRAP1 low density lipoprotein receptor adaptor protein 1 1243 160 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534286.[MT7]-VAFEFWQVSK[MT7].3b4_1.heavy 510.285 / 591.326 47531.0 43.22159957885742 46 16 10 10 10 2.2710984769369373 44.031556101817046 0.0 3 0.9606748932228961 6.202886262171607 47531.0 116.54170858515033 0.0 - - - - - - - 746.75 95 8 LDLRAP1 low density lipoprotein receptor adaptor protein 1 1245 160 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534286.[MT7]-VAFEFWQVSK[MT7].3b5_1.heavy 510.285 / 738.394 37376.0 43.22159957885742 46 16 10 10 10 2.2710984769369373 44.031556101817046 0.0 3 0.9606748932228961 6.202886262171607 37376.0 88.7359359124658 0.0 - - - - - - - 262.53846153846155 74 13 LDLRAP1 low density lipoprotein receptor adaptor protein 1 1247 160 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534286.[MT7]-VAFEFWQVSK[MT7].3y4_1.heavy 510.285 / 605.374 23552.0 43.22159957885742 46 16 10 10 10 2.2710984769369373 44.031556101817046 0.0 3 0.9606748932228961 6.202886262171607 23552.0 61.538752142895014 0.0 - - - - - - - 241.91666666666666 47 12 LDLRAP1 low density lipoprotein receptor adaptor protein 1 1249 161 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534007.[MT7]-LAPAQYIR.2y5_1.heavy 538.323 / 650.362 8591.0 31.452800750732422 46 20 10 6 10 19.671562661359143 5.083480235987048 0.0391998291015625 3 0.9986110741983854 33.11102057876224 8591.0 17.226212835910815 0.0 - - - - - - - 758.0 17 7 SNW1 SNW domain containing 1 1251 161 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534007.[MT7]-LAPAQYIR.2y6_1.heavy 538.323 / 747.415 104265.0 31.452800750732422 46 20 10 6 10 19.671562661359143 5.083480235987048 0.0391998291015625 3 0.9986110741983854 33.11102057876224 104265.0 225.9988961098356 0.0 - - - - - - - 312.85714285714283 208 7 SNW1 SNW domain containing 1 1253 161 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534007.[MT7]-LAPAQYIR.2b5_1.heavy 538.323 / 625.379 13560.0 31.452800750732422 46 20 10 6 10 19.671562661359143 5.083480235987048 0.0391998291015625 3 0.9986110741983854 33.11102057876224 13560.0 21.867857366935063 0.0 - - - - - - - 1131.0 27 7 SNW1 SNW domain containing 1 1255 161 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534007.[MT7]-LAPAQYIR.2y7_1.heavy 538.323 / 818.452 87168.0 31.452800750732422 46 20 10 6 10 19.671562661359143 5.083480235987048 0.0391998291015625 3 0.9986110741983854 33.11102057876224 87168.0 165.20030682460555 0.0 - - - - - - - 665.4 174 10 SNW1 SNW domain containing 1 1257 162 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534003.[MT7]-DDYIELR.2b3_1.heavy 534.278 / 538.227 18348.0 31.501800537109375 45 15 10 10 10 1.8951050106739178 45.16267249922615 0.0 3 0.9560346620090582 5.864122311895115 18348.0 8.879409916880057 1.0 - - - - - - - 1209.375 41 8 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1259 162 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534003.[MT7]-DDYIELR.2y5_1.heavy 534.278 / 693.393 16930.0 31.501800537109375 45 15 10 10 10 1.8951050106739178 45.16267249922615 0.0 3 0.9560346620090582 5.864122311895115 16930.0 27.55089208894607 0.0 - - - - - - - 667.1818181818181 33 11 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1261 162 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534003.[MT7]-DDYIELR.2y6_1.heavy 534.278 / 808.42 10675.0 31.501800537109375 45 15 10 10 10 1.8951050106739178 45.16267249922615 0.0 3 0.9560346620090582 5.864122311895115 10675.0 20.403562937321375 0.0 - - - - - - - 333.6666666666667 21 6 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1263 162 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534003.[MT7]-DDYIELR.2b5_1.heavy 534.278 / 780.353 17264.0 31.501800537109375 45 15 10 10 10 1.8951050106739178 45.16267249922615 0.0 3 0.9560346620090582 5.864122311895115 17264.0 47.05343665838966 0.0 - - - - - - - 679.0 34 7 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1265 163 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533918.[MT7]-ESETTK[MT7].2y4_1.heavy 491.768 / 622.353 828.0 14.615000247955322 46 20 10 6 10 19.222162623898058 5.202328268499532 0.03560066223144531 3 0.9994829580750615 54.27261851956151 828.0 6.274121479210577 0.0 - - - - - - - 0.0 1 0 FGR;FYN;SRC;YES1 Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;FYN oncogene related to SRC, FGR, YES;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 1267 163 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533918.[MT7]-ESETTK[MT7].2y5_1.heavy 491.768 / 709.385 4418.0 14.615000247955322 46 20 10 6 10 19.222162623898058 5.202328268499532 0.03560066223144531 3 0.9994829580750615 54.27261851956151 4418.0 77.25689058330157 0.0 - - - - - - - 108.10526315789474 8 19 FGR;FYN;SRC;YES1 Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;FYN oncogene related to SRC, FGR, YES;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 1269 163 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533918.[MT7]-ESETTK[MT7].2b4_1.heavy 491.768 / 591.274 430.0 14.615000247955322 46 20 10 6 10 19.222162623898058 5.202328268499532 0.03560066223144531 3 0.9994829580750615 54.27261851956151 430.0 2.0285714285714285 3.0 - - - - - - - 0.0 0 0 FGR;FYN;SRC;YES1 Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;FYN oncogene related to SRC, FGR, YES;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 1271 163 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533918.[MT7]-ESETTK[MT7].2y3_1.heavy 491.768 / 493.31 1994.0 14.615000247955322 46 20 10 6 10 19.222162623898058 5.202328268499532 0.03560066223144531 3 0.9994829580750615 54.27261851956151 1994.0 3.299811257162117 0.0 - - - - - - - 255.10526315789474 3 19 FGR;FYN;SRC;YES1 Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;FYN oncogene related to SRC, FGR, YES;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 1273 164 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533917.[MT7]-IFVWK[MT7].2b3_1.heavy 490.812 / 504.33 9471.0 39.343499501546226 46 20 10 6 10 6.171109029013809 16.204542737754995 0.03510284423828125 3 0.9959011609586018 19.27007851304911 9471.0 13.144420820882683 0.0 - - - - - - - 831.7 18 10 GSN gelsolin 1275 164 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533917.[MT7]-IFVWK[MT7].2y4_1.heavy 490.812 / 723.431 27012.0 39.343499501546226 46 20 10 6 10 6.171109029013809 16.204542737754995 0.03510284423828125 3 0.9959011609586018 19.27007851304911 27012.0 98.02828587002962 0.0 - - - - - - - 236.0 54 15 GSN gelsolin 1277 164 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533917.[MT7]-IFVWK[MT7].2b4_1.heavy 490.812 / 690.409 N/A 39.343499501546226 46 20 10 6 10 6.171109029013809 16.204542737754995 0.03510284423828125 3 0.9959011609586018 19.27007851304911 824.0 1.2801676962175599 13.0 - - - - - - - 833.75 3 8 GSN gelsolin 1279 164 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533917.[MT7]-IFVWK[MT7].2y3_1.heavy 490.812 / 576.363 14494.0 39.343499501546226 46 20 10 6 10 6.171109029013809 16.204542737754995 0.03510284423828125 3 0.9959011609586018 19.27007851304911 14494.0 25.707499518025838 1.0 - - - - - - - 288.25 28 8 GSN gelsolin 1281 165 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 540527.0 32.83700180053711 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 540527.0 828.8916999026728 0.0 - - - - - - - 254.625 1081 16 1283 165 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 537102.0 32.83700180053711 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 537102.0 611.3541700819404 0.0 - - - - - - - 624.625 1074 8 1285 165 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 1078680.0 32.83700180053711 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1078680.0 986.4145862552595 0.0 - - - - - - - 777.5 2157 10 1287 166 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533865.[MT7]-C[CAM]VTIQR.2b3_1.heavy 460.759 / 505.256 6383.0 21.46269989013672 46 18 10 10 8 4.214876164217541 23.72548945778202 0.0 4 0.9849759462377817 10.05596059127212 6383.0 6.693836583662142 2.0 - - - - - - - 706.0 23 14 SMAD4 SMAD family member 4 1289 166 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533865.[MT7]-C[CAM]VTIQR.2y4_1.heavy 460.759 / 517.309 10346.0 21.46269989013672 46 18 10 10 8 4.214876164217541 23.72548945778202 0.0 4 0.9849759462377817 10.05596059127212 10346.0 13.856596432232415 1.0 - - - - - - - 1241.111111111111 20 9 SMAD4 SMAD family member 4 1291 166 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533865.[MT7]-C[CAM]VTIQR.2y5_1.heavy 460.759 / 616.378 19560.0 21.46269989013672 46 18 10 10 8 4.214876164217541 23.72548945778202 0.0 4 0.9849759462377817 10.05596059127212 19560.0 68.47574324664218 0.0 - - - - - - - 257.2352941176471 39 17 SMAD4 SMAD family member 4 1293 166 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533865.[MT7]-C[CAM]VTIQR.2b4_1.heavy 460.759 / 618.34 6074.0 21.46269989013672 46 18 10 10 8 4.214876164217541 23.72548945778202 0.0 4 0.9849759462377817 10.05596059127212 6074.0 5.531169184499711 5.0 - - - - - - - 1189.3333333333333 18 9 SMAD4 SMAD family member 4 1295 167 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533913.[MT7]-DVVDLK[MT7].2y4_1.heavy 488.799 / 618.394 18183.0 28.08919906616211 48 18 10 10 10 7.110690972873589 14.063330888866878 0.0 3 0.9891129221715483 11.817126937701659 18183.0 31.091625 0.0 - - - - - - - 756.2857142857143 36 7 TSNARE1 t-SNARE domain containing 1 1297 167 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533913.[MT7]-DVVDLK[MT7].2y5_1.heavy 488.799 / 717.463 12958.0 28.08919906616211 48 18 10 10 10 7.110690972873589 14.063330888866878 0.0 3 0.9891129221715483 11.817126937701659 12958.0 19.485714285714288 1.0 - - - - - - - 781.7777777777778 25 9 TSNARE1 t-SNARE domain containing 1 1299 167 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533913.[MT7]-DVVDLK[MT7].2b4_1.heavy 488.799 / 573.3 61375.0 28.08919906616211 48 18 10 10 10 7.110690972873589 14.063330888866878 0.0 3 0.9891129221715483 11.817126937701659 61375.0 119.95648273276238 0.0 - - - - - - - 1224.142857142857 122 7 TSNARE1 t-SNARE domain containing 1 1301 167 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533913.[MT7]-DVVDLK[MT7].2y3_1.heavy 488.799 / 519.326 20899.0 28.08919906616211 48 18 10 10 10 7.110690972873589 14.063330888866878 0.0 3 0.9891129221715483 11.817126937701659 20899.0 34.73724124576811 0.0 - - - - - - - 673.3333333333334 41 6 TSNARE1 t-SNARE domain containing 1 1303 168 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50435.[MT7]-EVFEETGFDIK[MT7].2b3_1.heavy 801.419 / 520.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1305 168 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50435.[MT7]-EVFEETGFDIK[MT7].2b4_1.heavy 801.419 / 649.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1307 168 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50435.[MT7]-EVFEETGFDIK[MT7].2y3_1.heavy 801.419 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1309 168 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50435.[MT7]-EVFEETGFDIK[MT7].2y7_1.heavy 801.419 / 953.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1311 169 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533911.[MT7]-DPLTNK[MT7].2b3_1.heavy 488.289 / 470.273 N/A 22.753733952840168 32 20 0 6 6 9.066687656273073 11.02938623134457 0.030500411987304688 6 0.9913021703880006 13.223354282585943 12636.0 2.26110926824075 13.0 - - - - - - - 5958.0 256 1 LOC100510102;SH3KBP1;DHRS4L2;DHRS4L1 putative dehydrogenase/reductase SDR family member 4-like 2-like;SH3-domain kinase binding protein 1;dehydrogenase/reductase (SDR family) member 4 like 2;dehydrogenase/reductase (SDR family) member 4 like 1 1313 169 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533911.[MT7]-DPLTNK[MT7].2y4_1.heavy 488.289 / 619.39 1798.0 22.753733952840168 32 20 0 6 6 9.066687656273073 11.02938623134457 0.030500411987304688 6 0.9913021703880006 13.223354282585943 1798.0 1.6948360655737704 4.0 - - - - - - - 630.2727272727273 11 11 LOC100510102;SH3KBP1;DHRS4L2;DHRS4L1 putative dehydrogenase/reductase SDR family member 4-like 2-like;SH3-domain kinase binding protein 1;dehydrogenase/reductase (SDR family) member 4 like 2;dehydrogenase/reductase (SDR family) member 4 like 1 1315 169 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533911.[MT7]-DPLTNK[MT7].2y5_1.heavy 488.289 / 716.442 12225.0 22.753733952840168 32 20 0 6 6 9.066687656273073 11.02938623134457 0.030500411987304688 6 0.9913021703880006 13.223354282585943 12225.0 27.267866147290924 0.0 - - - - - - - 1160.9 24 10 LOC100510102;SH3KBP1;DHRS4L2;DHRS4L1 putative dehydrogenase/reductase SDR family member 4-like 2-like;SH3-domain kinase binding protein 1;dehydrogenase/reductase (SDR family) member 4 like 2;dehydrogenase/reductase (SDR family) member 4 like 1 1317 169 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533911.[MT7]-DPLTNK[MT7].2y3_1.heavy 488.289 / 506.306 4417.0 22.753733952840168 32 20 0 6 6 9.066687656273073 11.02938623134457 0.030500411987304688 6 0.9913021703880006 13.223354282585943 4417.0 8.2108841005954 1.0 - - - - - - - 764.125 10 16 LOC100510102;SH3KBP1;DHRS4L2;DHRS4L1 putative dehydrogenase/reductase SDR family member 4-like 2-like;SH3-domain kinase binding protein 1;dehydrogenase/reductase (SDR family) member 4 like 2;dehydrogenase/reductase (SDR family) member 4 like 1 1319 170 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534418.[MT7]-TEDDLSFHK[MT7]GEK[MT7].4b4_1.heavy 460.247 / 605.253 92126.0 23.27769947052002 45 18 10 7 10 1.4982373664917281 41.276531159248776 0.025800704956054688 3 0.9812331277418784 8.994662578584327 92126.0 30.23573903446466 0.0 - - - - - - - 782.6666666666666 184 9 FYN FYN oncogene related to SRC, FGR, YES 1321 170 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534418.[MT7]-TEDDLSFHK[MT7]GEK[MT7].4y7_2.heavy 460.247 / 560.821 34231.0 23.27769947052002 45 18 10 7 10 1.4982373664917281 41.276531159248776 0.025800704956054688 3 0.9812331277418784 8.994662578584327 34231.0 19.24388992085101 0.0 - - - - - - - 727.5555555555555 68 9 FYN FYN oncogene related to SRC, FGR, YES 1323 170 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534418.[MT7]-TEDDLSFHK[MT7]GEK[MT7].4y3_1.heavy 460.247 / 477.279 31259.0 23.27769947052002 45 18 10 7 10 1.4982373664917281 41.276531159248776 0.025800704956054688 3 0.9812331277418784 8.994662578584327 31259.0 17.604597195824244 0.0 - - - - - - - 385.0 62 4 FYN FYN oncogene related to SRC, FGR, YES 1325 170 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534418.[MT7]-TEDDLSFHK[MT7]GEK[MT7].4b3_1.heavy 460.247 / 490.227 25150.0 23.27769947052002 45 18 10 7 10 1.4982373664917281 41.276531159248776 0.025800704956054688 3 0.9812331277418784 8.994662578584327 25150.0 21.17551117999428 0.0 - - - - - - - 685.4615384615385 50 13 FYN FYN oncogene related to SRC, FGR, YES 1327 171 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50925.[MT7]-EDAANRK[MT7].2y5_1.heavy 546.306 / 703.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 1329 171 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50925.[MT7]-EDAANRK[MT7].2b4_1.heavy 546.306 / 531.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 1331 171 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50925.[MT7]-EDAANRK[MT7].2y6_1.heavy 546.306 / 818.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 1333 171 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50925.[MT7]-EDAANRK[MT7].2b5_1.heavy 546.306 / 645.296 N/A N/A - - - - - - - - - 0.0 - - - - - - - GSN gelsolin 1335 172 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51632.[MT7]-LASDTEDNDEALAEILQANDNLTQVINLYK[MT7].4y4_1.heavy 906.215 / 681.405 10732.0 52.27349853515625 39 9 10 10 10 0.7641684930191094 78.06568681534546 0.0 3 0.81870928327571 2.853538919146646 10732.0 -2.7032745591939538 0.0 - - - - - - - 296.1818181818182 21 11 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1337 172 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51632.[MT7]-LASDTEDNDEALAEILQANDNLTQVINLYK[MT7].4b7_1.heavy 906.215 / 876.407 4155.0 52.27349853515625 39 9 10 10 10 0.7641684930191094 78.06568681534546 0.0 3 0.81870928327571 2.853538919146646 4155.0 33.58832335329342 0.0 - - - - - - - 184.92857142857142 8 14 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1339 172 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51632.[MT7]-LASDTEDNDEALAEILQANDNLTQVINLYK[MT7].4b10_1.heavy 906.215 / 1234.52 4134.0 52.27349853515625 39 9 10 10 10 0.7641684930191094 78.06568681534546 0.0 3 0.81870928327571 2.853538919146646 4134.0 -0.052065491183878265 0.0 - - - - - - - 265.0769230769231 8 13 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1341 172 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51632.[MT7]-LASDTEDNDEALAEILQANDNLTQVINLYK[MT7].4b4_1.heavy 906.215 / 531.289 4802.0 52.27349853515625 39 9 10 10 10 0.7641684930191094 78.06568681534546 0.0 3 0.81870928327571 2.853538919146646 4802.0 25.363287750524563 0.0 - - - - - - - 254.08333333333334 9 12 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1343 173 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50135.[MT7]-IPPWQFER.2y4_1.heavy 608.833 / 579.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 1345 173 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50135.[MT7]-IPPWQFER.2y5_1.heavy 608.833 / 765.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 1347 173 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50135.[MT7]-IPPWQFER.2y6_1.heavy 608.833 / 862.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 1349 173 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50135.[MT7]-IPPWQFER.2y7_1.heavy 608.833 / 959.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 1351 174 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50924.[MT7]-GWGPDYPR.2y5_1.heavy 546.273 / 647.315 6809.0 29.061450004577637 41 15 10 6 10 3.123411676415684 32.016272704325814 0.03149986267089844 3 0.953049398071994 5.673195768693517 6809.0 8.536434327577185 0.0 - - - - - - - 721.9090909090909 13 11 SMAD4 SMAD family member 4 1353 174 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50924.[MT7]-GWGPDYPR.2y6_1.heavy 546.273 / 704.336 6596.0 29.061450004577637 41 15 10 6 10 3.123411676415684 32.016272704325814 0.03149986267089844 3 0.953049398071994 5.673195768693517 6596.0 17.69728264885605 0.0 - - - - - - - 700.125 13 8 SMAD4 SMAD family member 4 1355 174 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50924.[MT7]-GWGPDYPR.2b5_1.heavy 546.273 / 657.311 19362.0 29.061450004577637 41 15 10 6 10 3.123411676415684 32.016272704325814 0.03149986267089844 3 0.953049398071994 5.673195768693517 19362.0 51.012794002461675 0.0 - - - - - - - 709.0 38 10 SMAD4 SMAD family member 4 1357 174 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50924.[MT7]-GWGPDYPR.2y7_1.heavy 546.273 / 890.416 4752.0 29.061450004577637 41 15 10 6 10 3.123411676415684 32.016272704325814 0.03149986267089844 3 0.953049398071994 5.673195768693517 4752.0 0.0 2.0 - - - - - - - 237.85 9 20 SMAD4 SMAD family member 4 1359 175 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533986.[MT7]-DVWEIPR.2y4_1.heavy 529.791 / 514.298 25900.0 35.887699127197266 48 18 10 10 10 5.219988949165779 19.157128678592564 0.0 3 0.9892500706504685 11.89240642323536 25900.0 22.526503876702794 0.0 - - - - - - - 1778.7142857142858 51 7 FYN FYN oncogene related to SRC, FGR, YES 1361 175 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533986.[MT7]-DVWEIPR.2y5_1.heavy 529.791 / 700.378 55785.0 35.887699127197266 48 18 10 10 10 5.219988949165779 19.157128678592564 0.0 3 0.9892500706504685 11.89240642323536 55785.0 84.41253175727125 0.0 - - - - - - - 385.875 111 8 FYN FYN oncogene related to SRC, FGR, YES 1363 175 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533986.[MT7]-DVWEIPR.2b4_1.heavy 529.791 / 674.327 45923.0 35.887699127197266 48 18 10 10 10 5.219988949165779 19.157128678592564 0.0 3 0.9892500706504685 11.89240642323536 45923.0 95.2774813454194 0.0 - - - - - - - 315.3333333333333 91 6 FYN FYN oncogene related to SRC, FGR, YES 1365 175 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533986.[MT7]-DVWEIPR.2y6_1.heavy 529.791 / 799.446 46023.0 35.887699127197266 48 18 10 10 10 5.219988949165779 19.157128678592564 0.0 3 0.9892500706504685 11.89240642323536 46023.0 99.34340357545173 0.0 - - - - - - - 697.125 92 8 FYN FYN oncogene related to SRC, FGR, YES 1367 176 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50902.[MT7]-QDNK[MT7]K[MT7].2y4_1.heavy 532.825 / 792.482 N/A N/A - - - - - - - - - 0.0 - - - - - - - JAK1;ARHGEF7 Janus kinase 1;Rho guanine nucleotide exchange factor (GEF) 7 1369 176 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50902.[MT7]-QDNK[MT7]K[MT7].2y3_2.heavy 532.825 / 339.231 N/A N/A - - - - - - - - - 0.0 - - - - - - - JAK1;ARHGEF7 Janus kinase 1;Rho guanine nucleotide exchange factor (GEF) 7 1371 176 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50902.[MT7]-QDNK[MT7]K[MT7].2b4_1.heavy 532.825 / 774.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - JAK1;ARHGEF7 Janus kinase 1;Rho guanine nucleotide exchange factor (GEF) 7 1373 176 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50902.[MT7]-QDNK[MT7]K[MT7].2y3_1.heavy 532.825 / 677.455 N/A N/A - - - - - - - - - 0.0 - - - - - - - JAK1;ARHGEF7 Janus kinase 1;Rho guanine nucleotide exchange factor (GEF) 7 1375 177 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 619118.0 27.333599090576172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 619118.0 459.82080232043427 0.0 - - - - - - - 2721.0 1238 1 1377 177 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 817585.0 27.333599090576172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 817585.0 636.5398821788065 0.0 - - - - - - - 5442.0 1635 1 1379 177 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 1036670.0 27.333599090576172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1036670.0 2142.5375357264024 0.0 - - - - - - - 6768.0 2073 1 1381 178 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50705.[MT7]-GQPEK[MT7].2b4_1.heavy 423.75 / 556.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALS2CR11;SV2C;LSM4 amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 11;synaptic vesicle glycoprotein 2C;LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1383 178 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50705.[MT7]-GQPEK[MT7].2y3_1.heavy 423.75 / 517.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALS2CR11;SV2C;LSM4 amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 11;synaptic vesicle glycoprotein 2C;LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1385 179 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50336.[MT7]-NIEWFSIEK[MT7].2b3_1.heavy 727.4 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1387 179 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50336.[MT7]-NIEWFSIEK[MT7].2y4_1.heavy 727.4 / 620.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1389 179 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50336.[MT7]-NIEWFSIEK[MT7].2y5_1.heavy 727.4 / 767.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1391 179 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50336.[MT7]-NIEWFSIEK[MT7].2y3_1.heavy 727.4 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1393 180 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50504.[MT7]-STADTLPDLEEWK[MT7].3y3_1.heavy 598.312 / 606.337 N/A 44.88979975382487 22 2 10 6 4 0.3415168354595497 121.24984479074436 0.0399017333984375 8 0.4779212736596303 1.6273320152234225 344.0 1.5851398649579718 24.0 - - - - - - - 0.0 1 0 IGSF5 immunoglobulin superfamily, member 5 1395 180 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50504.[MT7]-STADTLPDLEEWK[MT7].3b4_1.heavy 598.312 / 519.253 1033.0 44.88979975382487 22 2 10 6 4 0.3415168354595497 121.24984479074436 0.0399017333984375 8 0.4779212736596303 1.6273320152234225 1033.0 1.8017441860465113 4.0 - - - - - - - 235.11111111111111 3 18 IGSF5 immunoglobulin superfamily, member 5 1397 180 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50504.[MT7]-STADTLPDLEEWK[MT7].3b5_1.heavy 598.312 / 620.301 639.0 44.88979975382487 22 2 10 6 4 0.3415168354595497 121.24984479074436 0.0399017333984375 8 0.4779212736596303 1.6273320152234225 639.0 1.9441392392589671 11.0 - - - - - - - 288.7391304347826 6 23 IGSF5 immunoglobulin superfamily, member 5 1399 180 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50504.[MT7]-STADTLPDLEEWK[MT7].3y4_1.heavy 598.312 / 735.379 4476.0 44.88979975382487 22 2 10 6 4 0.3415168354595497 121.24984479074436 0.0399017333984375 8 0.4779212736596303 1.6273320152234225 4476.0 21.59930232558139 0.0 - - - - - - - 233.75 8 20 IGSF5 immunoglobulin superfamily, member 5 1401 181 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50507.[MT7]-SIEVENDFLPVEK[MT7].2b8_1.heavy 903.99 / 1078.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3KBP1 SH3-domain kinase binding protein 1 1403 181 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50507.[MT7]-SIEVENDFLPVEK[MT7].2y4_1.heavy 903.99 / 616.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3KBP1 SH3-domain kinase binding protein 1 1405 181 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50507.[MT7]-SIEVENDFLPVEK[MT7].2y3_1.heavy 903.99 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3KBP1 SH3-domain kinase binding protein 1 1407 181 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50507.[MT7]-SIEVENDFLPVEK[MT7].2b7_1.heavy 903.99 / 931.449 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3KBP1 SH3-domain kinase binding protein 1 1409 182 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50701.[MT7]-GDHVK[MT7].2y4_1.heavy 422.25 / 642.369 880.0 14.084799766540527 42 12 10 10 10 1.0915059673153023 66.28414210146865 0.0 3 0.8914139500260991 3.7107767830444995 880.0 4.186238133647701 1.0 - - - - - - - 100.0 2 19 FGR;FYN Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;FYN oncogene related to SRC, FGR, YES 1411 182 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50701.[MT7]-GDHVK[MT7].2b3_1.heavy 422.25 / 454.217 1988.0 14.084799766540527 42 12 10 10 10 1.0915059673153023 66.28414210146865 0.0 3 0.8914139500260991 3.7107767830444995 1988.0 7.933333333333334 0.0 - - - - - - - 171.6818181818182 3 22 FGR;FYN Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;FYN oncogene related to SRC, FGR, YES 1413 182 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50701.[MT7]-GDHVK[MT7].2b4_1.heavy 422.25 / 553.285 1817.0 14.084799766540527 42 12 10 10 10 1.0915059673153023 66.28414210146865 0.0 3 0.8914139500260991 3.7107767830444995 1817.0 26.06987717025136 0.0 - - - - - - - 153.25 3 20 FGR;FYN Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;FYN oncogene related to SRC, FGR, YES 1415 182 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50701.[MT7]-GDHVK[MT7].2y3_1.heavy 422.25 / 527.342 5168.0 14.084799766540527 42 12 10 10 10 1.0915059673153023 66.28414210146865 0.0 3 0.8914139500260991 3.7107767830444995 5168.0 40.99761341920872 0.0 - - - - - - - 154.23809523809524 10 21 FGR;FYN Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;FYN oncogene related to SRC, FGR, YES 1417 183 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50228.[MT7]-GVFPDNFVK[MT7].2y4_1.heavy 655.871 / 651.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3KBP1 SH3-domain kinase binding protein 1 1419 183 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50228.[MT7]-GVFPDNFVK[MT7].2y5_1.heavy 655.871 / 766.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3KBP1 SH3-domain kinase binding protein 1 1421 183 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50228.[MT7]-GVFPDNFVK[MT7].2y6_1.heavy 655.871 / 863.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3KBP1 SH3-domain kinase binding protein 1 1423 183 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50228.[MT7]-GVFPDNFVK[MT7].2b5_1.heavy 655.871 / 660.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3KBP1 SH3-domain kinase binding protein 1 1425 184 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 376353.0 37.7932014465332 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 376353.0 112.61332989912731 0.0 - - - - - - - 1229.7142857142858 752 7 1427 184 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 932464.0 37.7932014465332 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 932464.0 218.8014496698594 0.0 - - - - - - - 737.8571428571429 1864 7 1429 184 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 870053.0 37.7932014465332 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 870053.0 151.91776985251695 0.0 - - - - - - - 679.5 1740 8 1431 185 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50719.[MT7]-IDDSK[MT7].2b3_1.heavy 433.247 / 488.247 16863.0 18.308399200439453 48 20 10 10 8 5.638367702339568 17.73562940184023 0.0 4 0.9928196269501515 14.555551208761367 16863.0 29.51068939733812 1.0 - - - - - - - 1288.75 33 8 TRA2A transformer 2 alpha homolog (Drosophila) 1433 185 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50719.[MT7]-IDDSK[MT7].2y4_1.heavy 433.247 / 608.301 17999.0 18.308399200439453 48 20 10 10 8 5.638367702339568 17.73562940184023 0.0 4 0.9928196269501515 14.555551208761367 17999.0 42.77931338028169 0.0 - - - - - - - 682.625 35 8 TRA2A transformer 2 alpha homolog (Drosophila) 1435 185 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50719.[MT7]-IDDSK[MT7].2y3_1.heavy 433.247 / 493.274 10529.0 18.308399200439453 48 20 10 10 8 5.638367702339568 17.73562940184023 0.0 4 0.9928196269501515 14.555551208761367 10529.0 5.492973999163762 1.0 - - - - - - - 717.7142857142857 25 7 TRA2A transformer 2 alpha homolog (Drosophila) 1437 186 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50324.[MT7]-LQQERPQLDR.2b3_1.heavy 713.898 / 514.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 1439 186 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50324.[MT7]-LQQERPQLDR.2y5_1.heavy 713.898 / 628.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 1441 186 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50324.[MT7]-LQQERPQLDR.2b4_1.heavy 713.898 / 643.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 1443 186 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50324.[MT7]-LQQERPQLDR.2b7_1.heavy 713.898 / 1024.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 1445 187 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51244.[MT7]-EAGRAPGDAVHK[MT7].3b9_1.heavy 499.279 / 969.487 1265.0 17.285200119018555 43 13 10 10 10 2.0283483522373675 38.74693886871124 0.0 3 0.9141909340253227 4.182540978521311 1265.0 1.1387485464533458 0.0 - - - - - - - 94.3076923076923 2 13 SMAD4 SMAD family member 4 1447 187 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51244.[MT7]-EAGRAPGDAVHK[MT7].3y7_1.heavy 499.279 / 867.481 1265.0 17.285200119018555 43 13 10 10 10 2.0283483522373675 38.74693886871124 0.0 3 0.9141909340253227 4.182540978521311 1265.0 9.02293474766956 0.0 - - - - - - - 116.55555555555556 2 27 SMAD4 SMAD family member 4 1449 187 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51244.[MT7]-EAGRAPGDAVHK[MT7].3y4_1.heavy 499.279 / 598.379 4735.0 17.285200119018555 43 13 10 10 10 2.0283483522373675 38.74693886871124 0.0 3 0.9141909340253227 4.182540978521311 4735.0 19.60583961104878 0.0 - - - - - - - 689.3333333333334 9 9 SMAD4 SMAD family member 4 1451 187 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51244.[MT7]-EAGRAPGDAVHK[MT7].3b8_1.heavy 499.279 / 898.45 2245.0 17.285200119018555 43 13 10 10 10 2.0283483522373675 38.74693886871124 0.0 3 0.9141909340253227 4.182540978521311 2245.0 41.74928028788485 0.0 - - - - - - - 119.0 4 23 SMAD4 SMAD family member 4 1453 188 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533973.[MT7]-AIESLVK[MT7].2y4_1.heavy 524.336 / 590.399 4846.0 30.882200241088867 40 18 6 10 6 3.966821211111037 25.209101867233322 0.0 6 0.9818067469566341 9.135799227019277 4846.0 6.218549067029442 1.0 - - - - - - - 1338.9 9 10 SMAD4;SREBF2 SMAD family member 4;sterol regulatory element binding transcription factor 2 1455 188 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533973.[MT7]-AIESLVK[MT7].2y5_1.heavy 524.336 / 719.442 3368.0 30.882200241088867 40 18 6 10 6 3.966821211111037 25.209101867233322 0.0 6 0.9818067469566341 9.135799227019277 3368.0 7.713438462791076 2.0 - - - - - - - 718.5 7 8 SMAD4;SREBF2 SMAD family member 4;sterol regulatory element binding transcription factor 2 1457 188 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533973.[MT7]-AIESLVK[MT7].2b4_1.heavy 524.336 / 545.305 N/A 30.882200241088867 40 18 6 10 6 3.966821211111037 25.209101867233322 0.0 6 0.9818067469566341 9.135799227019277 2300.0 1.9610231425091351 11.0 - - - - - - - 1760.142857142857 7 7 SMAD4;SREBF2 SMAD family member 4;sterol regulatory element binding transcription factor 2 1459 188 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533973.[MT7]-AIESLVK[MT7].2y6_1.heavy 524.336 / 832.526 2711.0 30.882200241088867 40 18 6 10 6 3.966821211111037 25.209101867233322 0.0 6 0.9818067469566341 9.135799227019277 2711.0 19.451353128313894 3.0 - - - - - - - 328.625 15 16 SMAD4;SREBF2 SMAD family member 4;sterol regulatory element binding transcription factor 2 1461 189 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49733.[MT7]-ALQSK[MT7].2b3_1.heavy 417.768 / 457.289 N/A 17.9443998336792 42 16 10 6 10 6.435000768608993 15.540013683885894 0.031198501586914062 2 0.9634435802437809 6.4350001857030215 929.0 1.0317583268783888 28.0 - - - - - - - 739.8 8 15 SH3KBP1 SH3-domain kinase binding protein 1 1463 189 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49733.[MT7]-ALQSK[MT7].2y4_1.heavy 417.768 / 619.39 42957.0 17.9443998336792 42 16 10 6 10 6.435000768608993 15.540013683885894 0.031198501586914062 2 0.9634435802437809 6.4350001857030215 42957.0 29.083054920605186 0.0 - - - - - - - 310.0 85 1 SH3KBP1 SH3-domain kinase binding protein 1 1465 189 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49733.[MT7]-ALQSK[MT7].2y3_1.heavy 417.768 / 506.306 41253.0 17.9443998336792 42 16 10 6 10 6.435000768608993 15.540013683885894 0.031198501586914062 2 0.9634435802437809 6.4350001857030215 41253.0 11.3412510875594 0.0 - - - - - - - 1859.0 82 1 SH3KBP1 SH3-domain kinase binding protein 1 1467 190 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533812.[MT7]-GTFLIR.2y4_1.heavy 425.767 / 548.356 25501.0 32.64390182495117 43 13 10 10 10 1.9827615851430518 39.118847719560975 0.0 3 0.9287124409119318 4.594530274523633 25501.0 37.544324058775004 0.0 - - - - - - - 856.4285714285714 51 7 FYN FYN oncogene related to SRC, FGR, YES 1469 190 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533812.[MT7]-GTFLIR.2b3_1.heavy 425.767 / 450.247 83481.0 32.64390182495117 43 13 10 10 10 1.9827615851430518 39.118847719560975 0.0 3 0.9287124409119318 4.594530274523633 83481.0 92.00834072884527 0.0 - - - - - - - 728.5714285714286 166 7 FYN FYN oncogene related to SRC, FGR, YES 1471 190 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533812.[MT7]-GTFLIR.2y5_1.heavy 425.767 / 649.403 48675.0 32.64390182495117 43 13 10 10 10 1.9827615851430518 39.118847719560975 0.0 3 0.9287124409119318 4.594530274523633 48675.0 77.0450122069436 0.0 - - - - - - - 715.8888888888889 97 9 FYN FYN oncogene related to SRC, FGR, YES 1473 190 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533812.[MT7]-GTFLIR.2b4_1.heavy 425.767 / 563.331 134393.0 32.64390182495117 43 13 10 10 10 1.9827615851430518 39.118847719560975 0.0 3 0.9287124409119318 4.594530274523633 134393.0 178.32469913727033 0.0 - - - - - - - 358.0 268 1 FYN FYN oncogene related to SRC, FGR, YES 1475 191 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51601.[MT7]-ALK[MT7]LPNLVDMAAQVAAGMAYIER.4b8_2.heavy 684.131 / 569.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - FYN FYN oncogene related to SRC, FGR, YES 1477 191 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51601.[MT7]-ALK[MT7]LPNLVDMAAQVAAGMAYIER.4b4_1.heavy 684.131 / 714.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - FYN FYN oncogene related to SRC, FGR, YES 1479 191 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51601.[MT7]-ALK[MT7]LPNLVDMAAQVAAGMAYIER.4b3_1.heavy 684.131 / 601.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - FYN FYN oncogene related to SRC, FGR, YES 1481 191 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51601.[MT7]-ALK[MT7]LPNLVDMAAQVAAGMAYIER.4b9_2.heavy 684.131 / 626.897 N/A N/A - - - - - - - - - 0.0 - - - - - - - FYN FYN oncogene related to SRC, FGR, YES 1483 192 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49772.[MT7]-DILTK[MT7].2b3_1.heavy 439.283 / 486.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCDC96;ATM;LOC651610 coiled-coil domain containing 96;ataxia telangiectasia mutated;serine-protein kinase ATM-like 1485 192 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49772.[MT7]-DILTK[MT7].2y4_1.heavy 439.283 / 618.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCDC96;ATM;LOC651610 coiled-coil domain containing 96;ataxia telangiectasia mutated;serine-protein kinase ATM-like 1487 192 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49772.[MT7]-DILTK[MT7].2y3_1.heavy 439.283 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCDC96;ATM;LOC651610 coiled-coil domain containing 96;ataxia telangiectasia mutated;serine-protein kinase ATM-like 1489 193 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533816.[MT7]-GGIPGTGR.2b3_1.heavy 429.749 / 372.236 49353.0 20.618050575256348 46 20 10 6 10 14.948829103519735 6.689487136919291 0.03890037536621094 3 0.9989394971522609 37.893791559857284 49353.0 16.43515018708969 0.0 - - - - - - - 1290.5 98 2 LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1491 193 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533816.[MT7]-GGIPGTGR.2y5_1.heavy 429.749 / 487.262 64030.0 20.618050575256348 46 20 10 6 10 14.948829103519735 6.689487136919291 0.03890037536621094 3 0.9989394971522609 37.893791559857284 64030.0 78.2297749830877 0.0 - - - - - - - 833.3333333333334 128 6 LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1493 193 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533816.[MT7]-GGIPGTGR.2b5_1.heavy 429.749 / 526.311 2903.0 20.618050575256348 46 20 10 6 10 14.948829103519735 6.689487136919291 0.03890037536621094 3 0.9989394971522609 37.893791559857284 2903.0 2.0212158808933003 2.0 - - - - - - - 733.0909090909091 5 11 LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1495 193 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533816.[MT7]-GGIPGTGR.2y7_1.heavy 429.749 / 657.368 7795.0 20.618050575256348 46 20 10 6 10 14.948829103519735 6.689487136919291 0.03890037536621094 3 0.9989394971522609 37.893791559857284 7795.0 23.962023492907797 0.0 - - - - - - - 286.8333333333333 15 12 LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1497 194 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50216.[MT7]-EMVQEDQK[MT7].2y4_1.heavy 647.831 / 663.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1499 194 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50216.[MT7]-EMVQEDQK[MT7].2b3_1.heavy 647.831 / 504.261 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1501 194 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50216.[MT7]-EMVQEDQK[MT7].2y5_1.heavy 647.831 / 791.402 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1503 194 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50216.[MT7]-EMVQEDQK[MT7].2y7_1.heavy 647.831 / 1021.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1505 195 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51499.[MT7]-VLNEAVGALMYHTITLTR.3y7_1.heavy 716.065 / 841.489 68169.0 48.77159881591797 43 13 10 10 10 2.3219434596456225 30.082571112631026 0.0 3 0.9212511668958266 4.368659814117409 68169.0 141.40763576772818 0.0 - - - - - - - 718.6666666666666 136 9 CTBP1 C-terminal binding protein 1 1507 195 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51499.[MT7]-VLNEAVGALMYHTITLTR.3y6_1.heavy 716.065 / 704.43 94107.0 48.77159881591797 43 13 10 10 10 2.3219434596456225 30.082571112631026 0.0 3 0.9212511668958266 4.368659814117409 94107.0 359.3397099711515 0.0 - - - - - - - 585.125 188 8 CTBP1 C-terminal binding protein 1 1509 195 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51499.[MT7]-VLNEAVGALMYHTITLTR.3b4_1.heavy 716.065 / 600.347 42516.0 48.77159881591797 43 13 10 10 10 2.3219434596456225 30.082571112631026 0.0 3 0.9212511668958266 4.368659814117409 42516.0 131.20774229002262 0.0 - - - - - - - 682.4 85 10 CTBP1 C-terminal binding protein 1 1511 195 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51499.[MT7]-VLNEAVGALMYHTITLTR.3b5_1.heavy 716.065 / 671.385 63167.0 48.77159881591797 43 13 10 10 10 2.3219434596456225 30.082571112631026 0.0 3 0.9212511668958266 4.368659814117409 63167.0 189.55037567000176 0.0 - - - - - - - 730.7272727272727 126 11 CTBP1 C-terminal binding protein 1 1513 196 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 603745.0 40.71173350016276 23 -3 10 6 10 null 0.0 0.031097412109375 3 0.0 0.0 603745.0 210.86149183869418 0.0 - - - - - - - 401.0 1207 2 1515 196 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 882212.0 40.71173350016276 23 -3 10 6 10 null 0.0 0.031097412109375 3 0.0 0.0 882212.0 260.3557348406343 0.0 - - - - - - - 1362.0 1764 2 1517 196 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 1150050.0 40.71173350016276 23 -3 10 6 10 null 0.0 0.031097412109375 3 0.0 0.0 1150050.0 286.9746580128312 0.0 - - - - - - - 961.0 2300 1 1519 197 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51609.[MT7]-LREEAILQMESNLLDVNQIIK[MT7].3b6_1.heavy 919.852 / 856.501 2072.0 47.65439987182617 43 13 10 10 10 2.671592215204644 37.430862176823645 0.0 3 0.920741883799822 4.354411164078625 2072.0 9.370854271356784 1.0 - - - - - - - 152.875 4 24 TSNARE1 t-SNARE domain containing 1 1521 197 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51609.[MT7]-LREEAILQMESNLLDVNQIIK[MT7].3b4_1.heavy 919.852 / 672.38 518.0 47.65439987182617 43 13 10 10 10 2.671592215204644 37.430862176823645 0.0 3 0.920741883799822 4.354411164078625 518.0 0.0 8.0 - - - - - - - 155.53333333333333 2 30 TSNARE1 t-SNARE domain containing 1 1523 197 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51609.[MT7]-LREEAILQMESNLLDVNQIIK[MT7].3b5_1.heavy 919.852 / 743.417 956.0 47.65439987182617 43 13 10 10 10 2.671592215204644 37.430862176823645 0.0 3 0.920741883799822 4.354411164078625 956.0 6.839925906780392 0.0 - - - - - - - 0.0 1 0 TSNARE1 t-SNARE domain containing 1 1525 197 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51609.[MT7]-LREEAILQMESNLLDVNQIIK[MT7].3b7_1.heavy 919.852 / 969.585 2231.0 47.65439987182617 43 13 10 10 10 2.671592215204644 37.430862176823645 0.0 3 0.920741883799822 4.354411164078625 2231.0 3.8620042227979487 1.0 - - - - - - - 140.32 6 25 TSNARE1 t-SNARE domain containing 1 1527 198 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 320534.0 35.7760009765625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 320534.0 335.29587390533777 0.0 - - - - - - - 641.375 641 8 1529 198 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 79882.0 35.7760009765625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 79882.0 176.894775455298 0.0 - - - - - - - 1178.4285714285713 159 7 1531 198 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 70727.0 35.7760009765625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 70727.0 54.68779649292446 0.0 - - - - - - - 1106.6 141 10 1533 199 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533960.[MT7]-GEDYEK[MT7].2y4_1.heavy 514.761 / 698.348 5682.0 17.895299911499023 48 18 10 10 10 2.596686493851645 28.921752965043567 0.0 3 0.9848127692791003 10.001655543172316 5682.0 41.096226415094335 0.0 - - - - - - - 188.96 11 25 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1535 199 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533960.[MT7]-GEDYEK[MT7].2b4_1.heavy 514.761 / 609.264 5404.0 17.895299911499023 48 18 10 10 10 2.596686493851645 28.921752965043567 0.0 3 0.9848127692791003 10.001655543172316 5404.0 33.73212018620398 0.0 - - - - - - - 200.3913043478261 10 23 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1537 199 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533960.[MT7]-GEDYEK[MT7].2y3_1.heavy 514.761 / 583.321 29125.0 17.895299911499023 48 18 10 10 10 2.596686493851645 28.921752965043567 0.0 3 0.9848127692791003 10.001655543172316 29125.0 122.43490566037735 0.0 - - - - - - - 772.0 58 7 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1539 199 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533960.[MT7]-GEDYEK[MT7].2b5_1.heavy 514.761 / 738.306 7311.0 17.895299911499023 48 18 10 10 10 2.596686493851645 28.921752965043567 0.0 3 0.9848127692791003 10.001655543172316 7311.0 37.99685867799575 0.0 - - - - - - - 134.28571428571428 14 21 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1541 200 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51605.[MT7]-ATQVDPC[CAM]NLQELFQEMSANVFR.3y7_1.heavy 914.443 / 824.408 576.0 52.19969940185547 50 20 10 10 10 10.090023159844755 9.910780026548384 0.0 3 0.9944790462320545 16.6018047541286 576.0 3.4379039086948517 0.0 - - - - - - - 0.0 1 0 TSNARE1 t-SNARE domain containing 1 1543 200 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51605.[MT7]-ATQVDPC[CAM]NLQELFQEMSANVFR.3y8_1.heavy 914.443 / 953.451 485.0 52.19969940185547 50 20 10 10 10 10.090023159844755 9.910780026548384 0.0 3 0.9944790462320545 16.6018047541286 485.0 3.5841194968553456 0.0 - - - - - - - 0.0 0 0 TSNARE1 t-SNARE domain containing 1 1545 200 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51605.[MT7]-ATQVDPC[CAM]NLQELFQEMSANVFR.3b4_1.heavy 914.443 / 544.321 576.0 52.19969940185547 50 20 10 10 10 10.090023159844755 9.910780026548384 0.0 3 0.9944790462320545 16.6018047541286 576.0 2.776060510348267 2.0 - - - - - - - 0.0 1 0 TSNARE1 t-SNARE domain containing 1 1547 200 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51605.[MT7]-ATQVDPC[CAM]NLQELFQEMSANVFR.3b5_1.heavy 914.443 / 659.348 1925.0 52.19969940185547 50 20 10 10 10 10.090023159844755 9.910780026548384 0.0 3 0.9944790462320545 16.6018047541286 1925.0 8.89683295252602 0.0 - - - - - - - 194.0 3 20 TSNARE1 t-SNARE domain containing 1 1549 201 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49763.[MT7]-GVDASK[MT7].2y4_1.heavy 432.755 / 564.311 4458.0 16.42917490005493 43 20 10 7 6 13.028705120752548 7.675359836083535 0.024900436401367188 5 0.9979785045546131 27.444340483469805 4458.0 2.9824647887323943 2.0 - - - - - - - 746.0 10 11 SH3KBP1 SH3-domain kinase binding protein 1 1551 201 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49763.[MT7]-GVDASK[MT7].2b4_1.heavy 432.755 / 487.263 5050.0 16.42917490005493 43 20 10 7 6 13.028705120752548 7.675359836083535 0.024900436401367188 5 0.9979785045546131 27.444340483469805 5050.0 8.781801767253087 1.0 - - - - - - - 732.1875 10 16 SH3KBP1 SH3-domain kinase binding protein 1 1553 201 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49763.[MT7]-GVDASK[MT7].2y3_1.heavy 432.755 / 449.284 12940.0 16.42917490005493 43 20 10 7 6 13.028705120752548 7.675359836083535 0.024900436401367188 5 0.9979785045546131 27.444340483469805 12940.0 28.59057997161483 0.0 - - - - - - - 1279.4285714285713 25 7 SH3KBP1 SH3-domain kinase binding protein 1 1555 201 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49763.[MT7]-GVDASK[MT7].2b5_1.heavy 432.755 / 574.295 2170.0 16.42917490005493 43 20 10 7 6 13.028705120752548 7.675359836083535 0.024900436401367188 5 0.9979785045546131 27.444340483469805 2170.0 -0.3142650253439536 5.0 - - - - - - - 1273.857142857143 8 7 SH3KBP1 SH3-domain kinase binding protein 1 1557 202 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533958.[MT7]-FLEEAK[MT7].2b3_1.heavy 512.799 / 534.304 8694.0 29.178199768066406 48 18 10 10 10 4.210788746255629 23.748519820407346 0.0 3 0.9852268674852206 10.141214332526712 8694.0 8.5405539343923 0.0 - - - - - - - 1292.4285714285713 19 7 SNW1 SNW domain containing 1 1559 202 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533958.[MT7]-FLEEAK[MT7].2y4_1.heavy 512.799 / 620.337 12653.0 29.178199768066406 48 18 10 10 10 4.210788746255629 23.748519820407346 0.0 3 0.9852268674852206 10.141214332526712 12653.0 11.936792452830188 0.0 - - - - - - - 1746.7142857142858 25 7 SNW1 SNW domain containing 1 1561 202 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533958.[MT7]-FLEEAK[MT7].2y5_1.heavy 512.799 / 733.421 16753.0 29.178199768066406 48 18 10 10 10 4.210788746255629 23.748519820407346 0.0 3 0.9852268674852206 10.141214332526712 16753.0 26.79468059228283 0.0 - - - - - - - 323.9166666666667 33 12 SNW1 SNW domain containing 1 1563 202 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533958.[MT7]-FLEEAK[MT7].2b4_1.heavy 512.799 / 663.347 7776.0 29.178199768066406 48 18 10 10 10 4.210788746255629 23.748519820407346 0.0 3 0.9852268674852206 10.141214332526712 7776.0 22.92290676142335 0.0 - - - - - - - 661.7272727272727 15 11 SNW1 SNW domain containing 1 1565 203 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533959.[MT7]-LFNQSK[MT7].2b3_1.heavy 512.805 / 519.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 1567 203 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533959.[MT7]-LFNQSK[MT7].2y4_1.heavy 512.805 / 620.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 1569 203 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533959.[MT7]-LFNQSK[MT7].2y5_1.heavy 512.805 / 767.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 1571 203 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533959.[MT7]-LFNQSK[MT7].2y3_1.heavy 512.805 / 506.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 1573 204 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533823.[MT7]-LLAHK[MT7].2b3_1.heavy 435.294 / 442.315 8342.0 21.662700653076172 48 18 10 10 10 5.762461808879225 17.35369418777104 0.0 3 0.9858693706756708 10.369764251255216 8342.0 16.29296875 0.0 - - - - - - - 726.6666666666666 16 15 F5;GGA3;EGFL6;GGA1 coagulation factor V (proaccelerin, labile factor);golgi-associated, gamma adaptin ear containing, ARF binding protein 3;EGF-like-domain, multiple 6;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1575 204 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533823.[MT7]-LLAHK[MT7].2y4_1.heavy 435.294 / 612.395 18167.0 21.662700653076172 48 18 10 10 10 5.762461808879225 17.35369418777104 0.0 3 0.9858693706756708 10.369764251255216 18167.0 20.670957629305764 0.0 - - - - - - - 726.6 36 10 F5;GGA3;EGFL6;GGA1 coagulation factor V (proaccelerin, labile factor);golgi-associated, gamma adaptin ear containing, ARF binding protein 3;EGF-like-domain, multiple 6;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1577 204 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533823.[MT7]-LLAHK[MT7].2y3_1.heavy 435.294 / 499.311 14943.0 21.662700653076172 48 18 10 10 10 5.762461808879225 17.35369418777104 0.0 3 0.9858693706756708 10.369764251255216 14943.0 19.477671648190114 0.0 - - - - - - - 760.2142857142857 29 14 F5;GGA3;EGFL6;GGA1 coagulation factor V (proaccelerin, labile factor);golgi-associated, gamma adaptin ear containing, ARF binding protein 3;EGF-like-domain, multiple 6;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1579 205 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50340.[MT7]-IPDEIIDMVK[MT7].2y4_1.heavy 730.917 / 636.351 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1581 205 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50340.[MT7]-IPDEIIDMVK[MT7].2y5_1.heavy 730.917 / 749.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1583 205 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50340.[MT7]-IPDEIIDMVK[MT7].2y9_1.heavy 730.917 / 1203.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1585 205 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50340.[MT7]-IPDEIIDMVK[MT7].2y3_1.heavy 730.917 / 521.324 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1587 206 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533826.[MT7]-EAVEMR.2y4_1.heavy 439.73 / 534.27 3912.0 20.996500651041668 29 17 0 6 6 3.971807763744783 18.628150939762268 0.038700103759765625 5 0.9740692109845022 7.647360153256985 3912.0 6.044825227841693 2.0 - - - - - - - 375.0 175 2 SNW1 SNW domain containing 1 1589 206 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533826.[MT7]-EAVEMR.2b3_1.heavy 439.73 / 444.258 N/A 20.996500651041668 29 17 0 6 6 3.971807763744783 18.628150939762268 0.038700103759765625 5 0.9740692109845022 7.647360153256985 10129.0 3.148455242263864 2.0 - - - - - - - 735.0 20 7 SNW1 SNW domain containing 1 1591 206 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533826.[MT7]-EAVEMR.2y5_1.heavy 439.73 / 605.308 17525.0 20.996500651041668 29 17 0 6 6 3.971807763744783 18.628150939762268 0.038700103759765625 5 0.9740692109845022 7.647360153256985 17525.0 32.99539990885268 0.0 - - - - - - - 343.0 35 15 SNW1 SNW domain containing 1 1593 206 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533826.[MT7]-EAVEMR.2b4_1.heavy 439.73 / 573.3 22402.0 20.996500651041668 29 17 0 6 6 3.971807763744783 18.628150939762268 0.038700103759765625 5 0.9740692109845022 7.647360153256985 22402.0 36.395792447063954 0.0 - - - - - - - 692.9285714285714 44 14 SNW1 SNW domain containing 1 1595 207 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533827.[MT7]-GLC[CAM]LK[MT7].2y4_1.heavy 439.772 / 677.414 6757.0 27.421724796295166 44 20 10 6 8 5.215061638099996 14.951780378532515 0.03849983215332031 4 0.9947608856876411 17.04290567162186 6757.0 26.55802303007396 0.0 - - - - - - - 577.0 13 7 TTC39A;PPP1CA;PPP1CC;CDC25C tetratricopeptide repeat domain 39A;protein phosphatase 1, catalytic subunit, alpha isozyme;protein phosphatase 1, catalytic subunit, gamma isozyme;cell division cycle 25 homolog C (S. pombe) 1597 207 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533827.[MT7]-GLC[CAM]LK[MT7].2b3_1.heavy 439.772 / 475.246 6688.0 27.421724796295166 44 20 10 6 8 5.215061638099996 14.951780378532515 0.03849983215332031 4 0.9947608856876411 17.04290567162186 6688.0 4.886039110514856 2.0 - - - - - - - 1214.2857142857142 19 7 TTC39A;PPP1CA;PPP1CC;CDC25C tetratricopeptide repeat domain 39A;protein phosphatase 1, catalytic subunit, alpha isozyme;protein phosphatase 1, catalytic subunit, gamma isozyme;cell division cycle 25 homolog C (S. pombe) 1599 207 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533827.[MT7]-GLC[CAM]LK[MT7].2b4_1.heavy 439.772 / 588.33 3622.0 27.421724796295166 44 20 10 6 8 5.215061638099996 14.951780378532515 0.03849983215332031 4 0.9947608856876411 17.04290567162186 3622.0 4.0126824944921955 6.0 - - - - - - - 1219.0 18 8 TTC39A;PPP1CA;PPP1CC;CDC25C tetratricopeptide repeat domain 39A;protein phosphatase 1, catalytic subunit, alpha isozyme;protein phosphatase 1, catalytic subunit, gamma isozyme;cell division cycle 25 homolog C (S. pombe) 1601 207 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533827.[MT7]-GLC[CAM]LK[MT7].2y3_1.heavy 439.772 / 564.33 13933.0 27.421724796295166 44 20 10 6 8 5.215061638099996 14.951780378532515 0.03849983215332031 4 0.9947608856876411 17.04290567162186 13933.0 10.723096351301797 0.0 - - - - - - - 750.8888888888889 27 9 TTC39A;PPP1CA;PPP1CC;CDC25C tetratricopeptide repeat domain 39A;protein phosphatase 1, catalytic subunit, alpha isozyme;protein phosphatase 1, catalytic subunit, gamma isozyme;cell division cycle 25 homolog C (S. pombe) 1603 208 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50344.[MT7]-IGSGFDNIDIK[MT7].2b6_1.heavy 733.908 / 721.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1 C-terminal binding protein 1 1605 208 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50344.[MT7]-IGSGFDNIDIK[MT7].2y3_1.heavy 733.908 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1 C-terminal binding protein 1 1607 208 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50344.[MT7]-IGSGFDNIDIK[MT7].2b7_1.heavy 733.908 / 835.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1 C-terminal binding protein 1 1609 208 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50344.[MT7]-IGSGFDNIDIK[MT7].2b9_1.heavy 733.908 / 1063.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1 C-terminal binding protein 1 1611 209 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51098.[MT7]-LAEALYIADR.2b4_1.heavy 639.862 / 529.31 3996.0 38.28519916534424 37 16 10 3 8 3.929990941527678 25.445351271249418 0.07020187377929688 4 0.9660790893864954 6.681796938435263 3996.0 1.7108256880733943 1.0 - - - - - - - 1146.625 12 8 SNW1 SNW domain containing 1 1613 209 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51098.[MT7]-LAEALYIADR.2y9_1.heavy 639.862 / 1021.53 8446.0 38.28519916534424 37 16 10 3 8 3.929990941527678 25.445351271249418 0.07020187377929688 4 0.9660790893864954 6.681796938435263 8446.0 22.85364410736595 0.0 - - - - - - - 625.7777777777778 16 9 SNW1 SNW domain containing 1 1615 209 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51098.[MT7]-LAEALYIADR.2b5_1.heavy 639.862 / 642.394 2361.0 38.28519916534424 37 16 10 3 8 3.929990941527678 25.445351271249418 0.07020187377929688 4 0.9660790893864954 6.681796938435263 2361.0 4.111110638972636 8.0 - - - - - - - 726.6666666666666 8 12 SNW1 SNW domain containing 1 1617 209 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51098.[MT7]-LAEALYIADR.2y7_1.heavy 639.862 / 821.452 3633.0 38.28519916534424 37 16 10 3 8 3.929990941527678 25.445351271249418 0.07020187377929688 4 0.9660790893864954 6.681796938435263 3633.0 12.011859778904496 0.0 - - - - - - - 584.0 7 7 SNW1 SNW domain containing 1 1619 210 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51096.[MT7]-GEELSAAAIK[MT7].2b4_1.heavy 638.871 / 573.3 5419.0 28.314499855041504 46 20 10 6 10 117.06029891168292 0.8542605898815088 0.033199310302734375 3 0.9930898793181516 14.837787623425777 5419.0 8.014085301963094 0.0 - - - - - - - 795.1111111111111 10 9 LDLRAP1 low density lipoprotein receptor adaptor protein 1 1621 210 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51096.[MT7]-GEELSAAAIK[MT7].2b6_1.heavy 638.871 / 731.369 2015.0 28.314499855041504 46 20 10 6 10 117.06029891168292 0.8542605898815088 0.033199310302734375 3 0.9930898793181516 14.837787623425777 2015.0 5.800107434052759 0.0 - - - - - - - 677.25 4 8 LDLRAP1 low density lipoprotein receptor adaptor protein 1 1623 210 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51096.[MT7]-GEELSAAAIK[MT7].2y6_1.heavy 638.871 / 704.442 4725.0 28.314499855041504 46 20 10 6 10 117.06029891168292 0.8542605898815088 0.033199310302734375 3 0.9930898793181516 14.837787623425777 4725.0 17.228641726618704 0.0 - - - - - - - 781.625 9 8 LDLRAP1 low density lipoprotein receptor adaptor protein 1 1625 210 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51096.[MT7]-GEELSAAAIK[MT7].2b5_1.heavy 638.871 / 660.332 2710.0 28.314499855041504 46 20 10 6 10 117.06029891168292 0.8542605898815088 0.033199310302734375 3 0.9930898793181516 14.837787623425777 2710.0 11.452732628711844 0.0 - - - - - - - 280.2962962962963 5 27 LDLRAP1 low density lipoprotein receptor adaptor protein 1 1627 211 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49754.[MT7]-LHIGK[MT7].2y4_1.heavy 428.286 / 598.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD4 SMAD family member 4 1629 211 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49754.[MT7]-LHIGK[MT7].2y4_2.heavy 428.286 / 299.693 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD4 SMAD family member 4 1631 211 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49754.[MT7]-LHIGK[MT7].2y3_1.heavy 428.286 / 461.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMAD4 SMAD family member 4 1633 212 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51092.[MT7]-RFHDEVGK[MT7].2y4_1.heavy 638.356 / 576.347 1331.0 18.808549404144287 44 18 10 6 10 6.277115613175631 15.930883890381203 0.03660011291503906 3 0.987362638978007 10.96669458443658 1331.0 5.874958032981139 0.0 - - - - - - - 298.8888888888889 2 18 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1635 212 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51092.[MT7]-RFHDEVGK[MT7].2b4_1.heavy 638.356 / 700.365 2024.0 18.808549404144287 44 18 10 6 10 6.277115613175631 15.930883890381203 0.03660011291503906 3 0.987362638978007 10.96669458443658 2024.0 70.26716981132076 0.0 - - - - - - - 111.0 4 12 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1637 212 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51092.[MT7]-RFHDEVGK[MT7].2y6_1.heavy 638.356 / 828.433 320.0 18.808549404144287 44 18 10 6 10 6.277115613175631 15.930883890381203 0.03660011291503906 3 0.987362638978007 10.96669458443658 320.0 3.0316431924882625 3.0 - - - - - - - 0.0 0 0 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1639 212 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51092.[MT7]-RFHDEVGK[MT7].2y7_1.heavy 638.356 / 975.502 905.0 18.808549404144287 44 18 10 6 10 6.277115613175631 15.930883890381203 0.03660011291503906 3 0.987362638978007 10.96669458443658 905.0 8.77249853286385 0.0 - - - - - - - 0.0 1 0 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1641 213 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51185.[MT7]-FYMYEILK[MT7].2y4_1.heavy 697.885 / 646.426 4262.0 43.99810028076172 47 17 10 10 10 6.84330966435645 14.612812353188183 0.0 3 0.9752148157187355 7.822853259548985 4262.0 8.34198312236287 1.0 - - - - - - - 301.6363636363636 8 11 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1643 213 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51185.[MT7]-FYMYEILK[MT7].2b3_1.heavy 697.885 / 586.282 7419.0 43.99810028076172 47 17 10 10 10 6.84330966435645 14.612812353188183 0.0 3 0.9752148157187355 7.822853259548985 7419.0 22.3917372575444 0.0 - - - - - - - 330.3636363636364 14 11 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1645 213 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51185.[MT7]-FYMYEILK[MT7].2y3_1.heavy 697.885 / 517.383 5604.0 43.99810028076172 47 17 10 10 10 6.84330966435645 14.612812353188183 0.0 3 0.9752148157187355 7.822853259548985 5604.0 10.371560767318845 0.0 - - - - - - - 749.5 11 8 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1647 213 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51185.[MT7]-FYMYEILK[MT7].2y7_1.heavy 697.885 / 1103.59 6709.0 43.99810028076172 47 17 10 10 10 6.84330966435645 14.612812353188183 0.0 3 0.9752148157187355 7.822853259548985 6709.0 27.74590054249548 0.0 - - - - - - - 311.0625 13 16 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1649 214 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534230.[MT7]-NVIFEDEEK[MT7].3b6_1.heavy 470.917 / 862.443 16870.0 30.66900062561035 48 18 10 10 10 5.989421424373909 16.69610349892073 0.0 3 0.9870760218520509 10.844147488132261 16870.0 88.29882110640801 0.0 - - - - - - - 274.0 33 19 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1651 214 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534230.[MT7]-NVIFEDEEK[MT7].3y3_1.heavy 470.917 / 549.3 83643.0 30.66900062561035 48 18 10 10 10 5.989421424373909 16.69610349892073 0.0 3 0.9870760218520509 10.844147488132261 83643.0 85.69169927293353 0.0 - - - - - - - 1296.5555555555557 167 9 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1653 214 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534230.[MT7]-NVIFEDEEK[MT7].3b4_1.heavy 470.917 / 618.373 68664.0 30.66900062561035 48 18 10 10 10 5.989421424373909 16.69610349892073 0.0 3 0.9870760218520509 10.844147488132261 68664.0 73.39281693999953 0.0 - - - - - - - 765.8571428571429 137 7 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1655 214 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534230.[MT7]-NVIFEDEEK[MT7].3y4_1.heavy 470.917 / 664.327 84904.0 30.66900062561035 48 18 10 10 10 5.989421424373909 16.69610349892073 0.0 3 0.9870760218520509 10.844147488132261 84904.0 136.1429692211313 0.0 - - - - - - - 753.4444444444445 169 9 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1657 215 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49802.[MT7]-DLQNK[MT7].2b3_1.heavy 453.268 / 501.279 4222.0 17.439549446105957 35 18 6 7 4 16.163873146102446 6.186636030617002 0.029399871826171875 8 0.9853983079265924 10.200721807511588 4222.0 9.737523531280562 1.0 - - - - - - - 747.8823529411765 8 17 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1659 215 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49802.[MT7]-DLQNK[MT7].2y4_1.heavy 453.268 / 646.4 7648.0 17.439549446105957 35 18 6 7 4 16.163873146102446 6.186636030617002 0.029399871826171875 8 0.9853983079265924 10.200721807511588 7648.0 8.909570915105443 1.0 - - - - - - - 301.84615384615387 16 13 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1661 215 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49802.[MT7]-DLQNK[MT7].2b4_1.heavy 453.268 / 615.322 2732.0 17.439549446105957 35 18 6 7 4 16.163873146102446 6.186636030617002 0.029399871826171875 8 0.9853983079265924 10.200721807511588 2732.0 3.128758493004227 2.0 - - - - - - - 706.3333333333334 9 9 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1663 215 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB49802.[MT7]-DLQNK[MT7].2y3_1.heavy 453.268 / 533.316 3377.0 17.439549446105957 35 18 6 7 4 16.163873146102446 6.186636030617002 0.029399871826171875 8 0.9853983079265924 10.200721807511588 3377.0 2.162763037511436 4.0 - - - - - - - 722.7777777777778 22 9 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1665 216 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534759.[MT7]-GAALDVHESEPFSFSQGPLK[MT7].4y4_1.heavy 601.815 / 558.373 47897.0 36.9547004699707 39 9 10 10 10 0.8495233834625638 69.2019893834042 0.0 3 0.8173298056439963 2.842393551665177 47897.0 41.838469372995846 0.0 - - - - - - - 934.0 95 1 CTBP1 C-terminal binding protein 1 1667 216 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534759.[MT7]-GAALDVHESEPFSFSQGPLK[MT7].4b5_1.heavy 601.815 / 572.316 30624.0 36.9547004699707 39 9 10 10 10 0.8495233834625638 69.2019893834042 0.0 3 0.8173298056439963 2.842393551665177 30624.0 34.137509420479674 0.0 - - - - - - - 467.0 61 1 CTBP1 C-terminal binding protein 1 1669 216 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534759.[MT7]-GAALDVHESEPFSFSQGPLK[MT7].4y3_1.heavy 601.815 / 501.352 34639.0 36.9547004699707 39 9 10 10 10 0.8495233834625638 69.2019893834042 0.0 3 0.8173298056439963 2.842393551665177 34639.0 9.86501035651323 0.0 - - - - - - - 467.0 69 2 CTBP1 C-terminal binding protein 1 1671 216 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534759.[MT7]-GAALDVHESEPFSFSQGPLK[MT7].4b6_1.heavy 601.815 / 671.385 12231.0 36.9547004699707 39 9 10 10 10 0.8495233834625638 69.2019893834042 0.0 3 0.8173298056439963 2.842393551665177 12231.0 19.513733778798276 1.0 - - - - - - - 1317.5555555555557 24 9 CTBP1 C-terminal binding protein 1 1673 217 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51377.[MT7]-NPDLGFSDYAAAQLR.2b4_1.heavy 891.451 / 584.316 6787.0 37.52180099487305 40 10 10 10 10 1.0091564085016798 70.55281065645305 0.0 3 0.8348914777113178 2.994418984172474 6787.0 6.5859528196512755 1.0 - - - - - - - 286.75 21 12 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1675 217 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51377.[MT7]-NPDLGFSDYAAAQLR.2b5_1.heavy 891.451 / 641.338 4649.0 37.52180099487305 40 10 10 10 10 1.0091564085016798 70.55281065645305 0.0 3 0.8348914777113178 2.994418984172474 4649.0 16.87137096774194 0.0 - - - - - - - 285.64285714285717 9 14 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1677 217 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51377.[MT7]-NPDLGFSDYAAAQLR.2y11_1.heavy 891.451 / 1198.59 11343.0 37.52180099487305 40 10 10 10 10 1.0091564085016798 70.55281065645305 0.0 3 0.8348914777113178 2.994418984172474 11343.0 40.655913978494624 0.0 - - - - - - - 270.54545454545456 22 11 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1679 217 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51377.[MT7]-NPDLGFSDYAAAQLR.2y7_1.heavy 891.451 / 792.436 9297.0 37.52180099487305 40 10 10 10 10 1.0091564085016798 70.55281065645305 0.0 3 0.8348914777113178 2.994418984172474 9297.0 12.674516483949837 0.0 - - - - - - - 797.1428571428571 18 7 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1681 218 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534237.[MT7]-LQQERPQLDR.3b9_2.heavy 476.268 / 626.842 69570.0 22.82509994506836 46 16 10 10 10 3.3739903154549267 29.638496453869237 0.0 3 0.9609480402182387 6.224685107576283 69570.0 224.78349206349205 0.0 - - - - - - - 241.1764705882353 139 17 TSNARE1 t-SNARE domain containing 1 1683 218 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534237.[MT7]-LQQERPQLDR.3b3_1.heavy 476.268 / 514.311 38487.0 22.82509994506836 46 16 10 10 10 3.3739903154549267 29.638496453869237 0.0 3 0.9609480402182387 6.224685107576283 38487.0 56.31431168831169 0.0 - - - - - - - 1207.75 76 8 TSNARE1 t-SNARE domain containing 1 1685 218 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534237.[MT7]-LQQERPQLDR.3y9_2.heavy 476.268 / 585.305 96926.0 22.82509994506836 46 16 10 10 10 3.3739903154549267 29.638496453869237 0.0 3 0.9609480402182387 6.224685107576283 96926.0 237.40305922845153 0.0 - - - - - - - 367.6666666666667 193 9 TSNARE1 t-SNARE domain containing 1 1687 218 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534237.[MT7]-LQQERPQLDR.3y5_1.heavy 476.268 / 628.341 132472.0 22.82509994506836 46 16 10 10 10 3.3739903154549267 29.638496453869237 0.0 3 0.9609480402182387 6.224685107576283 132472.0 175.90965664346373 0.0 - - - - - - - 741.75 264 8 TSNARE1 t-SNARE domain containing 1 1689 219 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50893.[MT7]-LQVAGRK[MT7].2b3_1.heavy 530.347 / 485.32 N/A 20.33769989013672 35 15 4 10 6 2.1194158112639756 39.56191588633221 0.0 6 0.9591922885218417 6.088400239239889 1967.0 1.2980490131447522 20.0 - - - - - - - 767.7777777777778 9 9 SMAD4 SMAD family member 4 1691 219 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50893.[MT7]-LQVAGRK[MT7].2y4_1.heavy 530.347 / 575.375 2817.0 20.33769989013672 35 15 4 10 6 2.1194158112639756 39.56191588633221 0.0 6 0.9591922885218417 6.088400239239889 2817.0 11.966954887218044 3.0 - - - - - - - 327.6666666666667 6 12 SMAD4 SMAD family member 4 1693 219 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50893.[MT7]-LQVAGRK[MT7].2y5_1.heavy 530.347 / 674.443 2392.0 20.33769989013672 35 15 4 10 6 2.1194158112639756 39.56191588633221 0.0 6 0.9591922885218417 6.088400239239889 2392.0 7.84928320802005 2.0 - - - - - - - 248.13333333333333 14 15 SMAD4 SMAD family member 4 1695 219 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50893.[MT7]-LQVAGRK[MT7].2y6_1.heavy 530.347 / 802.502 4040.0 20.33769989013672 35 15 4 10 6 2.1194158112639756 39.56191588633221 0.0 6 0.9591922885218417 6.088400239239889 4040.0 26.62663411024787 0.0 - - - - - - - 751.8571428571429 8 7 SMAD4 SMAD family member 4 1697 220 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534235.[MT7]-HVVPNEVVVQR.3b6_1.heavy 473.944 / 820.443 12491.0 24.88719940185547 50 20 10 10 10 21.51479619124268 4.647964085325786 0.0 3 0.9956133915857336 18.62683431750449 12491.0 77.81556934504937 0.0 - - - - - - - 236.16666666666666 24 18 GSN gelsolin 1699 220 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534235.[MT7]-HVVPNEVVVQR.3b3_1.heavy 473.944 / 480.305 127105.0 24.88719940185547 50 20 10 10 10 21.51479619124268 4.647964085325786 0.0 3 0.9956133915857336 18.62683431750449 127105.0 79.05484451206948 0.0 - - - - - - - 997.0 254 2 GSN gelsolin 1701 220 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534235.[MT7]-HVVPNEVVVQR.3y4_1.heavy 473.944 / 501.314 145443.0 24.88719940185547 50 20 10 10 10 21.51479619124268 4.647964085325786 0.0 3 0.9956133915857336 18.62683431750449 145443.0 45.23553768143077 0.0 - - - - - - - 1761.0 290 2 GSN gelsolin 1703 220 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534235.[MT7]-HVVPNEVVVQR.3y5_1.heavy 473.944 / 600.383 46311.0 24.88719940185547 50 20 10 10 10 21.51479619124268 4.647964085325786 0.0 3 0.9956133915857336 18.62683431750449 46311.0 26.5235969188743 0.0 - - - - - - - 930.0 92 1 GSN gelsolin 1705 221 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 411224.0 44.171199798583984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 411224.0 952.8461725014487 0.0 - - - - - - - 619.4444444444445 822 9 1707 221 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 630798.0 44.171199798583984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 630798.0 473.44044855369725 0.0 - - - - - - - 758.0 1261 9 1709 221 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 663351.0 44.171199798583984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 663351.0 789.2450544301607 0.0 - - - - - - - 741.5555555555555 1326 9 1711 222 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51589.[MT7]-FVHSENQHLVSPEALDFLDK[MT7].4b8_2.heavy 654.094 / 562.274 10016.0 38.76217555999756 33 10 10 3 10 3.6280790939672993 21.476205463013564 0.07049942016601562 3 0.8498694560193675 3.1444042700588235 10016.0 0.0 1.0 - - - - - - - 322.8333333333333 20 6 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1713 222 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51589.[MT7]-FVHSENQHLVSPEALDFLDK[MT7].4b7_1.heavy 654.094 / 986.481 7154.0 38.76217555999756 33 10 10 3 10 3.6280790939672993 21.476205463013564 0.07049942016601562 3 0.8498694560193675 3.1444042700588235 7154.0 18.86601116267134 0.0 - - - - - - - 729.4166666666666 14 12 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1715 222 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51589.[MT7]-FVHSENQHLVSPEALDFLDK[MT7].4y3_1.heavy 654.094 / 519.326 27186.0 38.76217555999756 33 10 10 3 10 3.6280790939672993 21.476205463013564 0.07049942016601562 3 0.8498694560193675 3.1444042700588235 27186.0 16.707844037243273 0.0 - - - - - - - 421.0 54 1 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1717 222 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51589.[MT7]-FVHSENQHLVSPEALDFLDK[MT7].4b10_2.heavy 654.094 / 668.35 10353.0 38.76217555999756 33 10 10 3 10 3.6280790939672993 21.476205463013564 0.07049942016601562 3 0.8498694560193675 3.1444042700588235 10353.0 18.468726577237668 0.0 - - - - - - - 696.2727272727273 20 11 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1719 223 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51485.[MT7]-C[CAM]VVFHPFLDEILIGK[MT7].2y4_1.heavy 1038.08 / 574.404 999.0 46.339500427246094 40 12 10 10 8 1.214159698633137 53.08898792905497 0.0 4 0.8806337711114408 3.5359315559703646 999.0 -0.29210526315789465 1.0 - - - - - - - 148.27272727272728 2 22 POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 1721 223 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51485.[MT7]-C[CAM]VVFHPFLDEILIGK[MT7].2b3_1.heavy 1038.08 / 503.277 2420.0 46.339500427246094 40 12 10 10 8 1.214159698633137 53.08898792905497 0.0 4 0.8806337711114408 3.5359315559703646 2420.0 9.423525861548676 1.0 - - - - - - - 105.35714285714286 4 14 POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 1723 223 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51485.[MT7]-C[CAM]VVFHPFLDEILIGK[MT7].2y9_1.heavy 1038.08 / 1191.71 N/A 46.339500427246094 40 12 10 10 8 1.214159698633137 53.08898792905497 0.0 4 0.8806337711114408 3.5359315559703646 210.0 -0.13291139240506325 34.0 - - - - - - - 0.0 1 0 POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 1725 223 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51485.[MT7]-C[CAM]VVFHPFLDEILIGK[MT7].2b4_1.heavy 1038.08 / 650.345 3051.0 46.339500427246094 40 12 10 10 8 1.214159698633137 53.08898792905497 0.0 4 0.8806337711114408 3.5359315559703646 3051.0 0.8290760869565215 1.0 - - - - - - - 133.33333333333334 6 15 POLR3H polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) 1727 224 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51170.[MT7]-WTAPEAALYGR.2y8_1.heavy 689.865 / 876.457 23889.0 35.71179962158203 41 15 10 6 10 2.7301311722518404 30.131590731672013 0.037200927734375 3 0.9501424344593927 5.5039655408456 23889.0 35.515616872485154 0.0 - - - - - - - 602.2857142857143 47 7 FYN;SRC;YES1 FYN oncogene related to SRC, FGR, YES;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 1729 224 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51170.[MT7]-WTAPEAALYGR.2y9_1.heavy 689.865 / 947.495 12346.0 35.71179962158203 41 15 10 6 10 2.7301311722518404 30.131590731672013 0.037200927734375 3 0.9501424344593927 5.5039655408456 12346.0 30.742031872509955 0.0 - - - - - - - 209.08333333333334 24 12 FYN;SRC;YES1 FYN oncogene related to SRC, FGR, YES;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 1731 224 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51170.[MT7]-WTAPEAALYGR.2y6_1.heavy 689.865 / 650.362 3915.0 35.71179962158203 41 15 10 6 10 2.7301311722518404 30.131590731672013 0.037200927734375 3 0.9501424344593927 5.5039655408456 3915.0 2.5914234875444837 0.0 - - - - - - - 658.0 7 9 FYN;SRC;YES1 FYN oncogene related to SRC, FGR, YES;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 1733 224 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51170.[MT7]-WTAPEAALYGR.2y10_1.heavy 689.865 / 1048.54 29108.0 35.71179962158203 41 15 10 6 10 2.7301311722518404 30.131590731672013 0.037200927734375 3 0.9501424344593927 5.5039655408456 29108.0 101.21205013831715 0.0 - - - - - - - 631.0 58 7 FYN;SRC;YES1 FYN oncogene related to SRC, FGR, YES;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 1735 225 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51172.[MT7]-IRVDYSITK[MT7].3y3_1.heavy 461.613 / 505.347 15648.0 29.62689971923828 40 10 10 10 10 0.7272981395857645 72.26836816396928 0.0 3 0.8464244555400657 3.1079912473980227 15648.0 19.902666422117846 0.0 - - - - - - - 1254.5 31 12 TRA2A transformer 2 alpha homolog (Drosophila) 1737 225 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51172.[MT7]-IRVDYSITK[MT7].3b6_1.heavy 461.613 / 878.485 6971.0 29.62689971923828 40 10 10 10 10 0.7272981395857645 72.26836816396928 0.0 3 0.8464244555400657 3.1079912473980227 6971.0 47.88795977795978 0.0 - - - - - - - 192.53333333333333 13 15 TRA2A transformer 2 alpha homolog (Drosophila) 1739 225 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51172.[MT7]-IRVDYSITK[MT7].3b4_1.heavy 461.613 / 628.39 9789.0 29.62689971923828 40 10 10 10 10 0.7272981395857645 72.26836816396928 0.0 3 0.8464244555400657 3.1079912473980227 9789.0 23.325037118441745 0.0 - - - - - - - 716.8 19 15 TRA2A transformer 2 alpha homolog (Drosophila) 1741 225 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51172.[MT7]-IRVDYSITK[MT7].3b5_1.heavy 461.613 / 791.453 5414.0 29.62689971923828 40 10 10 10 10 0.7272981395857645 72.26836816396928 0.0 3 0.8464244555400657 3.1079912473980227 5414.0 17.152302468602702 0.0 - - - - - - - 270.6 10 20 TRA2A transformer 2 alpha homolog (Drosophila) 1743 226 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534220.[MT7]-FYMYEILK[MT7].3y3_1.heavy 465.593 / 517.383 22818.0 43.99810028076172 43 13 10 10 10 1.4247509277182995 45.97904355512591 0.0 3 0.9207189872608356 4.353773779836132 22818.0 118.01954922813036 0.0 - - - - - - - 188.73333333333332 45 15 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1745 226 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534220.[MT7]-FYMYEILK[MT7].3b4_1.heavy 465.593 / 749.345 15739.0 43.99810028076172 43 13 10 10 10 1.4247509277182995 45.97904355512591 0.0 3 0.9207189872608356 4.353773779836132 15739.0 364.08289156626506 0.0 - - - - - - - 175.88888888888889 31 9 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1747 226 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534220.[MT7]-FYMYEILK[MT7].3b5_1.heavy 465.593 / 878.388 11492.0 43.99810028076172 43 13 10 10 10 1.4247509277182995 45.97904355512591 0.0 3 0.9207189872608356 4.353773779836132 11492.0 206.57991342615975 0.0 - - - - - - - 178.28571428571428 22 7 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1749 226 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534220.[MT7]-FYMYEILK[MT7].3b3_1.heavy 465.593 / 586.282 19736.0 43.99810028076172 43 13 10 10 10 1.4247509277182995 45.97904355512591 0.0 3 0.9207189872608356 4.353773779836132 19736.0 149.16634251497007 0.0 - - - - - - - 136.71428571428572 39 14 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1751 227 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534604.[MT7]-YSEVFEAINITNNEK[MT7].3b6_1.heavy 687.024 / 899.427 40953.0 40.588826179504395 39 13 10 6 10 2.910880260562486 27.250955526980153 0.031902313232421875 3 0.9230410654623217 4.419849255365803 40953.0 23.550145513392167 0.0 - - - - - - - 262.0 81 7 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1753 227 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534604.[MT7]-YSEVFEAINITNNEK[MT7].3b4_1.heavy 687.024 / 623.316 77355.0 40.588826179504395 39 13 10 6 10 2.910880260562486 27.250955526980153 0.031902313232421875 3 0.9230410654623217 4.419849255365803 77355.0 20.297055319514122 0.0 - - - - - - - 650.1428571428571 154 7 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1755 227 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534604.[MT7]-YSEVFEAINITNNEK[MT7].3b3_1.heavy 687.024 / 524.247 27222.0 40.588826179504395 39 13 10 6 10 2.910880260562486 27.250955526980153 0.031902313232421875 3 0.9230410654623217 4.419849255365803 27222.0 19.198277085226824 0.0 - - - - - - - 287.2 54 5 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1757 227 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534604.[MT7]-YSEVFEAINITNNEK[MT7].3y5_1.heavy 687.024 / 749.391 61229.0 40.588826179504395 39 13 10 6 10 2.910880260562486 27.250955526980153 0.031902313232421875 3 0.9230410654623217 4.419849255365803 61229.0 32.60481384240801 0.0 - - - - - - - 399.0 122 3 CSNK2A1 casein kinase 2, alpha 1 polypeptide 1759 228 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51074.[MT7]-LLPPDFEK[MT7].2y4_1.heavy 623.868 / 682.353 1912.0 36.082000732421875 28 14 0 10 4 2.5432734702985997 39.3194051555373 0.0 7 0.9448411696215018 5.230438273420382 1912.0 2.2158940397350992 15.0 - - - - - - - 1710.2857142857142 207 7 SH3KBP1 SH3-domain kinase binding protein 1 1761 228 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51074.[MT7]-LLPPDFEK[MT7].2y5_1.heavy 623.868 / 779.406 5533.0 36.082000732421875 28 14 0 10 4 2.5432734702985997 39.3194051555373 0.0 7 0.9448411696215018 5.230438273420382 5533.0 5.0156647243877055 1.0 - - - - - - - 402.0 46 1 SH3KBP1 SH3-domain kinase binding protein 1 1763 228 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51074.[MT7]-LLPPDFEK[MT7].2y3_1.heavy 623.868 / 567.326 6539.0 36.082000732421875 28 14 0 10 4 2.5432734702985997 39.3194051555373 0.0 7 0.9448411696215018 5.230438273420382 6539.0 3.209517977199649 4.0 - - - - - - - 1710.5 28 2 SH3KBP1 SH3-domain kinase binding protein 1 1765 228 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51074.[MT7]-LLPPDFEK[MT7].2y6_1.heavy 623.868 / 876.458 17506.0 36.082000732421875 28 14 0 10 4 2.5432734702985997 39.3194051555373 0.0 7 0.9448411696215018 5.230438273420382 17506.0 56.518615525131686 0.0 - - - - - - - 101.0 35 1 SH3KBP1 SH3-domain kinase binding protein 1 1767 229 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51179.[MT7]-NIVFQSAVPK[MT7].2b4_1.heavy 695.918 / 618.373 3409.0 32.691500663757324 35 12 9 6 8 1.2950081402398046 53.90297871084324 0.038799285888671875 4 0.8901574393842817 3.689089078317342 3409.0 2.830935943573132 0.0 - - - - - - - 711.9090909090909 6 11 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1769 229 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51179.[MT7]-NIVFQSAVPK[MT7].2b6_1.heavy 695.918 / 833.464 2395.0 32.691500663757324 35 12 9 6 8 1.2950081402398046 53.90297871084324 0.038799285888671875 4 0.8901574393842817 3.689089078317342 2395.0 0.0 0.0 - - - - - - - 232.94117647058823 4 17 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1771 229 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51179.[MT7]-NIVFQSAVPK[MT7].2b7_1.heavy 695.918 / 904.501 2856.0 32.691500663757324 35 12 9 6 8 1.2950081402398046 53.90297871084324 0.038799285888671875 4 0.8901574393842817 3.689089078317342 2856.0 3.2819210501404186 2.0 - - - - - - - 304.0 9 10 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1773 229 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51179.[MT7]-NIVFQSAVPK[MT7].2b5_1.heavy 695.918 / 746.432 3685.0 32.691500663757324 35 12 9 6 8 1.2950081402398046 53.90297871084324 0.038799285888671875 4 0.8901574393842817 3.689089078317342 3685.0 11.84002832181911 1.0 - - - - - - - 679.5 7 8 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1775 230 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51382.[MT7]-SIEVENDFLPVEK[MT7].3y3_1.heavy 602.996 / 519.326 18702.0 38.451576232910156 44 18 10 6 10 6.226412376574927 16.060613070894732 0.032501220703125 3 0.9800119578007551 8.714674770949465 18702.0 20.08841927365679 0.0 - - - - - - - 366.3333333333333 37 3 SH3KBP1 SH3-domain kinase binding protein 1 1777 230 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51382.[MT7]-SIEVENDFLPVEK[MT7].3b4_1.heavy 602.996 / 573.336 29026.0 38.451576232910156 44 18 10 6 10 6.226412376574927 16.060613070894732 0.032501220703125 3 0.9800119578007551 8.714674770949465 29026.0 30.196928386597495 0.0 - - - - - - - 846.3333333333334 58 3 SH3KBP1 SH3-domain kinase binding protein 1 1779 230 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51382.[MT7]-SIEVENDFLPVEK[MT7].3y4_1.heavy 602.996 / 616.379 114750.0 38.451576232910156 44 18 10 6 10 6.226412376574927 16.060613070894732 0.032501220703125 3 0.9800119578007551 8.714674770949465 114750.0 60.326400739986525 0.0 - - - - - - - 1311.75 229 4 SH3KBP1 SH3-domain kinase binding protein 1 1781 230 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51382.[MT7]-SIEVENDFLPVEK[MT7].3b7_1.heavy 602.996 / 931.449 45697.0 38.451576232910156 44 18 10 6 10 6.226412376574927 16.060613070894732 0.032501220703125 3 0.9800119578007551 8.714674770949465 45697.0 117.98705322511393 0.0 - - - - - - - 319.55555555555554 91 9 SH3KBP1 SH3-domain kinase binding protein 1 1783 231 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51070.[MT7]-FRELHLMR.3y6_1.heavy 415.905 / 798.429 2885.0 29.679049491882324 39 13 10 6 10 2.6824352829282367 37.279557362083544 0.03470039367675781 3 0.9055036956650918 3.9826687096949303 2885.0 15.328822055137845 0.0 - - - - - - - 193.45454545454547 5 11 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1785 231 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51070.[MT7]-FRELHLMR.3y3_1.heavy 415.905 / 419.243 47155.0 29.679049491882324 39 13 10 6 10 2.6824352829282367 37.279557362083544 0.03470039367675781 3 0.9055036956650918 3.9826687096949303 47155.0 37.41564870000397 0.0 - - - - - - - 911.0 94 3 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1787 231 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51070.[MT7]-FRELHLMR.3b5_1.heavy 415.905 / 827.464 1215.0 29.679049491882324 39 13 10 6 10 2.6824352829282367 37.279557362083544 0.03470039367675781 3 0.9055036956650918 3.9826687096949303 1215.0 1.1013179571663922 3.0 - - - - - - - 164.66666666666666 2 12 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1789 231 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51070.[MT7]-FRELHLMR.3y4_1.heavy 415.905 / 556.302 13896.0 29.679049491882324 39 13 10 6 10 2.6824352829282367 37.279557362083544 0.03470039367675781 3 0.9055036956650918 3.9826687096949303 13896.0 18.874861724748317 0.0 - - - - - - - 1206.5555555555557 27 9 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1791 232 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50498.[MT7]-SLQSLGTPSDTQELR.2y8_1.heavy 888.466 / 945.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 1793 232 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50498.[MT7]-SLQSLGTPSDTQELR.2y5_1.heavy 888.466 / 646.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 1795 232 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50498.[MT7]-SLQSLGTPSDTQELR.2b4_1.heavy 888.466 / 560.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 1797 232 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50498.[MT7]-SLQSLGTPSDTQELR.2y10_1.heavy 888.466 / 1103.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 1799 233 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50395.[MT7]-VAFEFWQVSK[MT7].2y5_1.heavy 764.924 / 791.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDLRAP1 low density lipoprotein receptor adaptor protein 1 1801 233 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50395.[MT7]-VAFEFWQVSK[MT7].2b4_1.heavy 764.924 / 591.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDLRAP1 low density lipoprotein receptor adaptor protein 1 1803 233 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50395.[MT7]-VAFEFWQVSK[MT7].2y6_1.heavy 764.924 / 938.522 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDLRAP1 low density lipoprotein receptor adaptor protein 1 1805 233 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50395.[MT7]-VAFEFWQVSK[MT7].2b5_1.heavy 764.924 / 738.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - LDLRAP1 low density lipoprotein receptor adaptor protein 1 1807 234 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51592.[MT7]-TLK[MT7]PGTMSPESFLEEAQIMK[MT7].3y7_1.heavy 890.48 / 992.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - FYN FYN oncogene related to SRC, FGR, YES 1809 234 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51592.[MT7]-TLK[MT7]PGTMSPESFLEEAQIMK[MT7].3y3_1.heavy 890.48 / 535.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - FYN FYN oncogene related to SRC, FGR, YES 1811 234 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51592.[MT7]-TLK[MT7]PGTMSPESFLEEAQIMK[MT7].3b3_1.heavy 890.48 / 631.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - FYN FYN oncogene related to SRC, FGR, YES 1813 234 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51592.[MT7]-TLK[MT7]PGTMSPESFLEEAQIMK[MT7].3b8_1.heavy 890.48 / 1104.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - FYN FYN oncogene related to SRC, FGR, YES 1815 235 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50490.[MT7]-GLQTVHINENFAK[MT7].3y6_1.heavy 586.996 / 866.449 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 1817 235 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50490.[MT7]-GLQTVHINENFAK[MT7].3b4_1.heavy 586.996 / 544.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 1819 235 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50490.[MT7]-GLQTVHINENFAK[MT7].3b5_1.heavy 586.996 / 643.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 1821 235 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50490.[MT7]-GLQTVHINENFAK[MT7].3y4_1.heavy 586.996 / 623.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNW1 SNW domain containing 1 1823 236 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534118.[MT7]-GETLGIIGLGR.2y8_1.heavy 615.37 / 798.52 6560.0 38.40139961242676 40 14 10 6 10 1.2864457720597773 45.7597927395484 0.03440093994140625 3 0.9368084490346702 4.883361981650233 6560.0 11.233680613142354 0.0 - - - - - - - 803.2727272727273 13 11 CTBP1 C-terminal binding protein 1 1825 236 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534118.[MT7]-GETLGIIGLGR.2y9_1.heavy 615.37 / 899.567 8659.0 38.40139961242676 40 14 10 6 10 1.2864457720597773 45.7597927395484 0.03440093994140625 3 0.9368084490346702 4.883361981650233 8659.0 24.51071624713959 0.0 - - - - - - - 281.55555555555554 17 18 CTBP1 C-terminal binding protein 1 1827 236 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534118.[MT7]-GETLGIIGLGR.2b5_1.heavy 615.37 / 602.327 8484.0 38.40139961242676 40 14 10 6 10 1.2864457720597773 45.7597927395484 0.03440093994140625 3 0.9368084490346702 4.883361981650233 8484.0 9.16353648866998 0.0 - - - - - - - 1195.3333333333333 16 9 CTBP1 C-terminal binding protein 1 1829 236 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534118.[MT7]-GETLGIIGLGR.2y7_1.heavy 615.37 / 685.435 18718.0 38.40139961242676 40 14 10 6 10 1.2864457720597773 45.7597927395484 0.03440093994140625 3 0.9368084490346702 4.883361981650233 18718.0 23.770448659328252 0.0 - - - - - - - 776.25 37 8 CTBP1 C-terminal binding protein 1 1831 237 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534082.[MT7]-GFPHVIYAR.3y3_1.heavy 401.897 / 409.219 298174.0 30.559099197387695 48 18 10 10 10 3.177941320441131 24.830468716284777 0.0 3 0.9897694678129513 12.191083475355045 298174.0 200.5923979764326 0.0 - - - - - - - 881.0 596 1 SMAD4 SMAD family member 4 1833 237 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534082.[MT7]-GFPHVIYAR.3b4_1.heavy 401.897 / 583.311 157178.0 30.559099197387695 48 18 10 10 10 3.177941320441131 24.830468716284777 0.0 3 0.9897694678129513 12.191083475355045 157178.0 134.3251057202115 0.0 - - - - - - - 781.0 314 8 SMAD4 SMAD family member 4 1835 237 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534082.[MT7]-GFPHVIYAR.3y4_1.heavy 401.897 / 522.304 494848.0 30.559099197387695 48 18 10 10 10 3.177941320441131 24.830468716284777 0.0 3 0.9897694678129513 12.191083475355045 494848.0 300.11512693372305 0.0 - - - - - - - 827.6666666666666 989 3 SMAD4 SMAD family member 4 1837 237 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534082.[MT7]-GFPHVIYAR.3y5_1.heavy 401.897 / 621.372 262605.0 30.559099197387695 48 18 10 10 10 3.177941320441131 24.830468716284777 0.0 3 0.9897694678129513 12.191083475355045 262605.0 458.6345967587824 0.0 - - - - - - - 686.7142857142857 525 7 SMAD4 SMAD family member 4 1839 238 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534083.[MT7]-RAIESLVK[MT7].3b6_1.heavy 401.927 / 814.49 4798.0 27.758150100708008 37 11 10 6 10 1.4028043107526071 64.53261626684503 0.03459930419921875 3 0.8706063094981666 3.3931861033307036 4798.0 37.34218443427076 0.0 - - - - - - - 208.76470588235293 9 17 SMAD4 SMAD family member 4 1841 238 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534083.[MT7]-RAIESLVK[MT7].3b4_1.heavy 401.927 / 614.374 133376.0 27.758150100708008 37 11 10 6 10 1.4028043107526071 64.53261626684503 0.03459930419921875 3 0.8706063094981666 3.3931861033307036 133376.0 205.98754599448063 0.0 - - - - - - - 904.0 266 2 SMAD4 SMAD family member 4 1843 238 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534083.[MT7]-RAIESLVK[MT7].3b5_1.heavy 401.927 / 701.406 115574.0 27.758150100708008 37 11 10 6 10 1.4028043107526071 64.53261626684503 0.03459930419921875 3 0.8706063094981666 3.3931861033307036 115574.0 223.50562628099405 2.0 - - - - - - - 389.4 231 5 SMAD4 SMAD family member 4 1845 238 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534083.[MT7]-RAIESLVK[MT7].3y4_1.heavy 401.927 / 590.399 1252.0 27.758150100708008 37 11 10 6 10 1.4028043107526071 64.53261626684503 0.03459930419921875 3 0.8706063094981666 3.3931861033307036 1252.0 0.6311609943723695 16.0 - - - - - - - 757.1111111111111 193 9 SMAD4 SMAD family member 4 1847 239 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50495.[MT7]-LEWELK[MT7]EEEK[MT7].3y6_2.heavy 588.996 / 532.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1849 239 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50495.[MT7]-LEWELK[MT7]EEEK[MT7].3y3_1.heavy 588.996 / 549.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1851 239 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50495.[MT7]-LEWELK[MT7]EEEK[MT7].3y4_1.heavy 588.996 / 678.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1853 239 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50495.[MT7]-LEWELK[MT7]EEEK[MT7].3y8_2.heavy 588.996 / 689.877 N/A N/A - - - - - - - - - 0.0 - - - - - - - SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1855 240 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534086.[MT7]-GLFPDNFVR.2y4_1.heavy 604.831 / 535.299 37524.0 39.47140121459961 48 18 10 10 10 4.387352213532055 22.79279053356298 0.0 3 0.9813698365875269 9.027707402854869 37524.0 28.018725860806967 0.0 - - - - - - - 1662.4444444444443 75 9 SH3KBP1 SH3-domain kinase binding protein 1 1857 240 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534086.[MT7]-GLFPDNFVR.2y6_1.heavy 604.831 / 747.378 56367.0 39.47140121459961 48 18 10 10 10 4.387352213532055 22.79279053356298 0.0 3 0.9813698365875269 9.027707402854869 56367.0 39.766765115962556 0.0 - - - - - - - 283.0 112 2 SH3KBP1 SH3-domain kinase binding protein 1 1859 240 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534086.[MT7]-GLFPDNFVR.2b5_1.heavy 604.831 / 674.363 19005.0 39.47140121459961 48 18 10 10 10 4.387352213532055 22.79279053356298 0.0 3 0.9813698365875269 9.027707402854869 19005.0 17.176821937795875 0.0 - - - - - - - 669.0909090909091 38 11 SH3KBP1 SH3-domain kinase binding protein 1 1861 240 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534086.[MT7]-GLFPDNFVR.2y7_1.heavy 604.831 / 894.447 24585.0 39.47140121459961 48 18 10 10 10 4.387352213532055 22.79279053356298 0.0 3 0.9813698365875269 9.027707402854869 24585.0 40.03610506272816 0.0 - - - - - - - 774.1428571428571 49 7 SH3KBP1 SH3-domain kinase binding protein 1 1863 241 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534110.[MT7]-TIAASASSVK[MT7].3y3_1.heavy 408.246 / 477.315 113955.0 24.193500518798828 46 16 10 10 10 2.2875451533305373 35.05875110347519 0.0 3 0.9628783710038065 6.385518130293529 113955.0 73.03010701387839 0.0 - - - - - - - 2257.8571428571427 227 7 TSNARE1 t-SNARE domain containing 1 1865 241 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534110.[MT7]-TIAASASSVK[MT7].3b4_1.heavy 408.246 / 501.315 103261.0 24.193500518798828 46 16 10 10 10 2.2875451533305373 35.05875110347519 0.0 3 0.9628783710038065 6.385518130293529 103261.0 91.74889946542217 0.0 - - - - - - - 1834.5 206 8 TSNARE1 t-SNARE domain containing 1 1867 241 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534110.[MT7]-TIAASASSVK[MT7].3y4_1.heavy 408.246 / 564.347 84664.0 24.193500518798828 46 16 10 10 10 2.2875451533305373 35.05875110347519 0.0 3 0.9628783710038065 6.385518130293529 84664.0 201.95329264647268 0.0 - - - - - - - 713.1111111111111 169 9 TSNARE1 t-SNARE domain containing 1 1869 241 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534110.[MT7]-TIAASASSVK[MT7].3b3_1.heavy 408.246 / 430.278 105994.0 24.193500518798828 46 16 10 10 10 2.2875451533305373 35.05875110347519 0.0 3 0.9628783710038065 6.385518130293529 105994.0 66.26943524765636 0.0 - - - - - - - 713.0 211 2 TSNARE1 t-SNARE domain containing 1 1871 242 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534114.[MT7]-GVGFGDIFK[MT7].2y5_1.heavy 614.352 / 723.416 9596.0 40.0192985534668 47 17 10 10 10 3.8457013707115477 26.0030590938728 0.0 3 0.9753343827337414 7.841869897647278 9596.0 7.683162632283765 0.0 - - - - - - - 380.8 19 10 SH3KBP1 SH3-domain kinase binding protein 1 1873 242 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534114.[MT7]-GVGFGDIFK[MT7].2y3_1.heavy 614.352 / 551.367 14988.0 40.0192985534668 47 17 10 10 10 3.8457013707115477 26.0030590938728 0.0 3 0.9753343827337414 7.841869897647278 14988.0 17.409307929498826 0.0 - - - - - - - 1280.142857142857 29 7 SH3KBP1 SH3-domain kinase binding protein 1 1875 242 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534114.[MT7]-GVGFGDIFK[MT7].2b6_1.heavy 614.352 / 677.338 16733.0 40.0192985534668 47 17 10 10 10 3.8457013707115477 26.0030590938728 0.0 3 0.9753343827337414 7.841869897647278 16733.0 48.51873138915087 0.0 - - - - - - - 753.3 33 10 SH3KBP1 SH3-domain kinase binding protein 1 1877 242 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534114.[MT7]-GVGFGDIFK[MT7].2y7_1.heavy 614.352 / 927.506 12054.0 40.0192985534668 47 17 10 10 10 3.8457013707115477 26.0030590938728 0.0 3 0.9753343827337414 7.841869897647278 12054.0 44.71671930409666 0.0 - - - - - - - 227.4 24 15 SH3KBP1 SH3-domain kinase binding protein 1 1879 243 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51069.[MT7]-IYPSAYIK[MT7].2y4_1.heavy 621.87 / 638.399 4830.0 33.51649856567383 44 14 10 10 10 2.344805748167796 42.64745601128743 0.0 3 0.9312152656263512 4.678373957331373 4830.0 9.145940985278186 0.0 - - - - - - - 719.75 9 8 SMAD4 SMAD family member 4 1881 243 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51069.[MT7]-IYPSAYIK[MT7].2y3_1.heavy 621.87 / 567.362 4830.0 33.51649856567383 44 14 10 10 10 2.344805748167796 42.64745601128743 0.0 3 0.9312152656263512 4.678373957331373 4830.0 0.9674511767651478 1.0 - - - - - - - 402.3333333333333 9 3 SMAD4 SMAD family member 4 1883 243 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51069.[MT7]-IYPSAYIK[MT7].2y6_1.heavy 621.87 / 822.484 30743.0 33.51649856567383 44 14 10 10 10 2.344805748167796 42.64745601128743 0.0 3 0.9312152656263512 4.678373957331373 30743.0 80.96166841164049 0.0 - - - - - - - 270.3636363636364 61 11 SMAD4 SMAD family member 4 1885 243 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51069.[MT7]-IYPSAYIK[MT7].2y7_1.heavy 621.87 / 985.547 20619.0 33.51649856567383 44 14 10 10 10 2.344805748167796 42.64745601128743 0.0 3 0.9312152656263512 4.678373957331373 20619.0 83.09812499999998 0.0 - - - - - - - 332.9166666666667 41 12 SMAD4 SMAD family member 4 1887 244 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534215.[MT7]-LLEISAEDAER.2b3_1.heavy 695.371 / 500.32 131494.0 34.795101165771484 48 18 10 10 10 3.2411879102173926 24.64453715906527 0.0 3 0.9826915411579031 9.367091415208181 131494.0 98.7850476787995 0.0 - - - - - - - 810.5 262 2 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1889 244 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534215.[MT7]-LLEISAEDAER.2y8_1.heavy 695.371 / 890.421 77524.0 34.795101165771484 48 18 10 10 10 3.2411879102173926 24.64453715906527 0.0 3 0.9826915411579031 9.367091415208181 77524.0 129.5791938378913 0.0 - - - - - - - 803.8571428571429 155 7 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1891 244 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534215.[MT7]-LLEISAEDAER.2y10_1.heavy 695.371 / 1132.55 103842.0 34.795101165771484 48 18 10 10 10 3.2411879102173926 24.64453715906527 0.0 3 0.9826915411579031 9.367091415208181 103842.0 84.0921355677618 0.0 - - - - - - - 477.0 207 2 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1893 244 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534215.[MT7]-LLEISAEDAER.2y7_1.heavy 695.371 / 777.337 98692.0 34.795101165771484 48 18 10 10 10 3.2411879102173926 24.64453715906527 0.0 3 0.9826915411579031 9.367091415208181 98692.0 123.38890982425814 0.0 - - - - - - - 429.0 197 2 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 1895 245 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50722.[MT7]-QQPTPR.2y4_1.heavy 435.749 / 470.272 2165.0 14.623900413513184 39 13 10 10 6 2.221581847885814 45.01297131823696 0.0 5 0.9068126146044172 4.010994790514896 2165.0 3.5823741007194245 0.0 - - - - - - - 269.4736842105263 4 19 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1897 245 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50722.[MT7]-QQPTPR.2y5_1.heavy 435.749 / 598.331 1989.0 14.623900413513184 39 13 10 10 6 2.221581847885814 45.01297131823696 0.0 5 0.9068126146044172 4.010994790514896 1989.0 13.113612323491658 0.0 - - - - - - - 757.3333333333334 3 9 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1899 245 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50722.[MT7]-QQPTPR.2b4_1.heavy 435.749 / 599.327 1433.0 14.623900413513184 39 13 10 10 6 2.221581847885814 45.01297131823696 0.0 5 0.9068126146044172 4.010994790514896 1433.0 16.16717948717949 2.0 - - - - - - - 251.73333333333332 4 15 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1901 245 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50722.[MT7]-QQPTPR.2y3_1.heavy 435.749 / 373.219 N/A 14.623900413513184 39 13 10 10 6 2.221581847885814 45.01297131823696 0.0 5 0.9068126146044172 4.010994790514896 1258.0 2.3309526935968763 3.0 - - - - - - - 677.75 4 12 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1903 246 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534212.[MT7]-ERSTADTLPDLEEWK[MT7].3y7_1.heavy 693.36 / 1060.54 14727.0 36.69620132446289 40 10 10 10 10 2.486864824720043 40.21127284682931 0.0 3 0.8254953056310294 2.9102541545685017 14727.0 15.562391559063496 0.0 - - - - - - - 735.8888888888889 29 9 IGSF5 immunoglobulin superfamily, member 5 1905 246 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534212.[MT7]-ERSTADTLPDLEEWK[MT7].3y3_1.heavy 693.36 / 606.337 6227.0 36.69620132446289 40 10 10 10 10 2.486864824720043 40.21127284682931 0.0 3 0.8254953056310294 2.9102541545685017 6227.0 0.6490486003041811 2.0 - - - - - - - 762.5714285714286 13 7 IGSF5 immunoglobulin superfamily, member 5 1907 246 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534212.[MT7]-ERSTADTLPDLEEWK[MT7].3b6_1.heavy 693.36 / 804.397 4448.0 36.69620132446289 40 10 10 10 10 2.486864824720043 40.21127284682931 0.0 3 0.8254953056310294 2.9102541545685017 4448.0 7.5681467155545254 0.0 - - - - - - - 282.64285714285717 8 14 IGSF5 immunoglobulin superfamily, member 5 1909 246 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534212.[MT7]-ERSTADTLPDLEEWK[MT7].3b7_1.heavy 693.36 / 905.445 5436.0 36.69620132446289 40 10 10 10 10 2.486864824720043 40.21127284682931 0.0 3 0.8254953056310294 2.9102541545685017 5436.0 13.76028438978695 0.0 - - - - - - - 316.4 10 10 IGSF5 immunoglobulin superfamily, member 5 1911 247 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534211.[MT7]-FILHIPSEER.3b4_1.heavy 462.262 / 655.405 30586.0 35.70249938964844 50 20 10 10 10 10.022853742902315 9.97719836736269 0.0 3 0.9922208085300488 13.983413445664615 30586.0 110.26058637413607 0.0 - - - - - - - 245.33333333333334 61 9 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1913 247 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534211.[MT7]-FILHIPSEER.3y4_1.heavy 462.262 / 520.236 35500.0 35.70249938964844 50 20 10 10 10 10.022853742902315 9.97719836736269 0.0 3 0.9922208085300488 13.983413445664615 35500.0 45.30677015622459 0.0 - - - - - - - 1160.4285714285713 71 7 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1915 247 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534211.[MT7]-FILHIPSEER.3b3_1.heavy 462.262 / 518.346 126558.0 35.70249938964844 50 20 10 10 10 10.022853742902315 9.97719836736269 0.0 3 0.9922208085300488 13.983413445664615 126558.0 118.9248610805632 0.0 - - - - - - - 301.0 253 1 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1917 247 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534211.[MT7]-FILHIPSEER.3y5_1.heavy 462.262 / 617.289 203976.0 35.70249938964844 50 20 10 10 10 10.022853742902315 9.97719836736269 0.0 3 0.9922208085300488 13.983413445664615 203976.0 437.3584051834521 0.0 - - - - - - - 376.0 407 4 DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) 1919 248 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534210.[MT7]-TSNEVQYDQR.3b4_1.heavy 461.892 / 576.275 48070.0 19.825950145721436 46 20 10 6 10 5.06986032873936 19.72440925702294 0.03619956970214844 3 0.9923948877957762 14.142752265972721 48070.0 30.91742165088779 0.0 - - - - - - - 369.0 96 1 SNW1 SNW domain containing 1 1921 248 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534210.[MT7]-TSNEVQYDQR.3b5_1.heavy 461.892 / 675.343 8495.0 19.825950145721436 46 20 10 6 10 5.06986032873936 19.72440925702294 0.03619956970214844 3 0.9923948877957762 14.142752265972721 8495.0 7.773202614379084 0.0 - - - - - - - 202.25 16 12 SNW1 SNW domain containing 1 1923 248 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534210.[MT7]-TSNEVQYDQR.3y4_1.heavy 461.892 / 581.268 19682.0 19.825950145721436 46 20 10 6 10 5.06986032873936 19.72440925702294 0.03619956970214844 3 0.9923948877957762 14.142752265972721 19682.0 5.752830386920909 0.0 - - - - - - - 270.5 39 8 SNW1 SNW domain containing 1 1925 248 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534210.[MT7]-TSNEVQYDQR.3y5_1.heavy 461.892 / 709.326 23164.0 19.825950145721436 46 20 10 6 10 5.06986032873936 19.72440925702294 0.03619956970214844 3 0.9923948877957762 14.142752265972721 23164.0 11.411044969796533 0.0 - - - - - - - 201.63636363636363 46 11 SNW1 SNW domain containing 1 1927 249 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50485.[MT7]-K[MT7]LPATTATPDSSK[MT7].3y6_1.heavy 583.675 / 778.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3KBP1 SH3-domain kinase binding protein 1 1929 249 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50485.[MT7]-K[MT7]LPATTATPDSSK[MT7].3b4_1.heavy 583.675 / 698.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3KBP1 SH3-domain kinase binding protein 1 1931 249 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50485.[MT7]-K[MT7]LPATTATPDSSK[MT7].3y4_1.heavy 583.675 / 580.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3KBP1 SH3-domain kinase binding protein 1 1933 249 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50485.[MT7]-K[MT7]LPATTATPDSSK[MT7].3y5_1.heavy 583.675 / 677.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3KBP1 SH3-domain kinase binding protein 1 1935 250 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534207.[MT7]-SGAYLIPLLER.2y5_1.heavy 688.407 / 627.382 18049.0 43.855350494384766 42 16 10 6 10 2.404117267621292 33.301205098295355 0.03949737548828125 3 0.9682292307933349 6.905449059003767 18049.0 60.97391716566866 0.0 - - - - - - - 612.5 36 12 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1937 250 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534207.[MT7]-SGAYLIPLLER.2b4_1.heavy 688.407 / 523.263 10528.0 43.855350494384766 42 16 10 6 10 2.404117267621292 33.301205098295355 0.03949737548828125 3 0.9682292307933349 6.905449059003767 10528.0 23.41346876936133 0.0 - - - - - - - 299.5833333333333 21 12 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1939 250 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534207.[MT7]-SGAYLIPLLER.2y10_1.heavy 688.407 / 1144.67 7186.0 43.855350494384766 42 16 10 6 10 2.404117267621292 33.301205098295355 0.03949737548828125 3 0.9682292307933349 6.905449059003767 7186.0 9.681736526946109 0.0 - - - - - - - 250.8 14 10 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1941 250 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534207.[MT7]-SGAYLIPLLER.2b5_1.heavy 688.407 / 636.347 10946.0 43.855350494384766 42 16 10 6 10 2.404117267621292 33.301205098295355 0.03949737548828125 3 0.9682292307933349 6.905449059003767 10946.0 23.646587876358222 0.0 - - - - - - - 764.0 21 14 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1943 251 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51466.[MT7]-DVWEIPRESLQLIK[MT7].3y3_1.heavy 672.057 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - FYN FYN oncogene related to SRC, FGR, YES 1945 251 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51466.[MT7]-DVWEIPRESLQLIK[MT7].3b4_1.heavy 672.057 / 674.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - FYN FYN oncogene related to SRC, FGR, YES 1947 251 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51466.[MT7]-DVWEIPRESLQLIK[MT7].3b5_1.heavy 672.057 / 787.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - FYN FYN oncogene related to SRC, FGR, YES 1949 251 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51466.[MT7]-DVWEIPRESLQLIK[MT7].3y9_1.heavy 672.057 / 1227.75 N/A N/A - - - - - - - - - 0.0 - - - - - - - FYN FYN oncogene related to SRC, FGR, YES 1951 252 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534209.[MT7]-NLVC[CAM]TDLFTR.2y4_1.heavy 691.865 / 536.319 11077.0 38.03852558135986 42 16 10 6 10 2.1567593998014436 31.850491031313442 0.036899566650390625 3 0.9684977954743487 6.934979014809903 11077.0 22.29584208467016 0.0 - - - - - - - 755.2727272727273 22 11 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1953 252 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534209.[MT7]-NLVC[CAM]TDLFTR.2y8_1.heavy 691.865 / 1011.49 11613.0 38.03852558135986 42 16 10 6 10 2.1567593998014436 31.850491031313442 0.036899566650390625 3 0.9684977954743487 6.934979014809903 11613.0 19.164773743186405 0.0 - - - - - - - 795.1 23 10 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1955 252 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534209.[MT7]-NLVC[CAM]TDLFTR.2y9_1.heavy 691.865 / 1124.58 7772.0 38.03852558135986 42 16 10 6 10 2.1567593998014436 31.850491031313442 0.036899566650390625 3 0.9684977954743487 6.934979014809903 7772.0 13.412499999999998 0.0 - - - - - - - 764.4444444444445 15 9 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1957 252 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534209.[MT7]-NLVC[CAM]TDLFTR.2y7_1.heavy 691.865 / 912.424 12864.0 38.03852558135986 42 16 10 6 10 2.1567593998014436 31.850491031313442 0.036899566650390625 3 0.9684977954743487 6.934979014809903 12864.0 18.06252528092069 0.0 - - - - - - - 275.0 25 13 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1959 253 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50380.[MT7]-DNIQAMVIVPTR.2y8_1.heavy 750.92 / 886.518 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1961 253 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50380.[MT7]-DNIQAMVIVPTR.2y9_1.heavy 750.92 / 1014.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1963 253 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50380.[MT7]-DNIQAMVIVPTR.2b5_1.heavy 750.92 / 686.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1965 253 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50380.[MT7]-DNIQAMVIVPTR.2y7_1.heavy 750.92 / 815.481 N/A N/A - - - - - - - - - 0.0 - - - - - - - DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1967 254 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50638.[MT7]-DVATVAFC[CAM]DAQSTQEIHEK[MT7].3y3_1.heavy 813.068 / 557.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1 C-terminal binding protein 1 1969 254 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50638.[MT7]-DVATVAFC[CAM]DAQSTQEIHEK[MT7].3b6_1.heavy 813.068 / 701.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1 C-terminal binding protein 1 1971 254 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50638.[MT7]-DVATVAFC[CAM]DAQSTQEIHEK[MT7].3b4_1.heavy 813.068 / 531.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1 C-terminal binding protein 1 1973 254 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50638.[MT7]-DVATVAFC[CAM]DAQSTQEIHEK[MT7].3y8_1.heavy 813.068 / 1115.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1 C-terminal binding protein 1 1975 255 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51460.[MT7]-QILLYSATFPLSVQK[MT7].3y6_1.heavy 666.062 / 815.511 28354.0 44.31787395477295 40 15 10 5 10 1.7952139830268832 39.11273848373076 0.045101165771484375 3 0.9560833145937014 5.867393841289305 28354.0 104.209397148903 0.0 - - - - - - - 219.0 56 2 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1977 255 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51460.[MT7]-QILLYSATFPLSVQK[MT7].3b4_1.heavy 666.062 / 612.42 26678.0 44.31787395477295 40 15 10 5 10 1.7952139830268832 39.11273848373076 0.045101165771484375 3 0.9560833145937014 5.867393841289305 26678.0 49.04606460003947 0.0 - - - - - - - 291.5 53 2 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1979 255 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51460.[MT7]-QILLYSATFPLSVQK[MT7].3y4_1.heavy 666.062 / 605.374 20190.0 44.31787395477295 40 15 10 5 10 1.7952139830268832 39.11273848373076 0.045101165771484375 3 0.9560833145937014 5.867393841289305 20190.0 11.260775350582053 1.0 - - - - - - - 1785.625 44 8 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1981 255 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51460.[MT7]-QILLYSATFPLSVQK[MT7].3y5_1.heavy 666.062 / 718.458 6414.0 44.31787395477295 40 15 10 5 10 1.7952139830268832 39.11273848373076 0.045101165771484375 3 0.9560833145937014 5.867393841289305 6414.0 14.51438182445718 0.0 - - - - - - - 743.6 12 10 DDX6 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 1983 256 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50637.[MT7]-GAALDVHESEPFSFSQGPLK[MT7].3y7_1.heavy 802.084 / 920.532 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1 C-terminal binding protein 1 1985 256 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50637.[MT7]-GAALDVHESEPFSFSQGPLK[MT7].3b6_1.heavy 802.084 / 671.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1 C-terminal binding protein 1 1987 256 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50637.[MT7]-GAALDVHESEPFSFSQGPLK[MT7].3b5_1.heavy 802.084 / 572.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1 C-terminal binding protein 1 1989 256 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50637.[MT7]-GAALDVHESEPFSFSQGPLK[MT7].3y4_1.heavy 802.084 / 558.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTBP1 C-terminal binding protein 1 1991 257 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533998.[MT7]-LTDLSVK[MT7].2y4_1.heavy 532.334 / 590.399 41941.0 30.792799949645996 46 20 10 6 10 4.974739382026647 20.101555543048615 0.03539848327636719 3 0.9932874493046844 15.054812314125611 41941.0 41.49324292487399 0.0 - - - - - - - 1343.75 83 8 FYN FYN oncogene related to SRC, FGR, YES 1993 257 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533998.[MT7]-LTDLSVK[MT7].2y5_1.heavy 532.334 / 705.426 12542.0 30.792799949645996 46 20 10 6 10 4.974739382026647 20.101555543048615 0.03539848327636719 3 0.9932874493046844 15.054812314125611 12542.0 36.602483895356784 0.0 - - - - - - - 791.1428571428571 25 7 FYN FYN oncogene related to SRC, FGR, YES 1995 257 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533998.[MT7]-LTDLSVK[MT7].2b4_1.heavy 532.334 / 587.352 16288.0 30.792799949645996 46 20 10 6 10 4.974739382026647 20.101555543048615 0.03539848327636719 3 0.9932874493046844 15.054812314125611 16288.0 18.948227622881568 0.0 - - - - - - - 1233.2857142857142 32 7 FYN FYN oncogene related to SRC, FGR, YES 1997 257 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533998.[MT7]-LTDLSVK[MT7].2y6_1.heavy 532.334 / 806.474 31680.0 30.792799949645996 46 20 10 6 10 4.974739382026647 20.101555543048615 0.03539848327636719 3 0.9932874493046844 15.054812314125611 31680.0 46.15295085107607 0.0 - - - - - - - 1248.888888888889 63 9 FYN FYN oncogene related to SRC, FGR, YES 1999 258 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534098.[MT7]-LPANWEAK[MT7].3y3_1.heavy 406.236 / 491.295 92095.0 31.482200622558594 46 20 10 6 10 6.397458845525703 15.631206454722044 0.0391998291015625 3 0.990322366422743 12.535074348675055 92095.0 43.19557028472395 0.0 - - - - - - - 762.0 184 2 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 2001 258 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534098.[MT7]-LPANWEAK[MT7].3b4_1.heavy 406.236 / 540.326 144321.0 31.482200622558594 46 20 10 6 10 6.397458845525703 15.631206454722044 0.0391998291015625 3 0.990322366422743 12.535074348675055 144321.0 212.79476113114424 0.0 - - - - - - - 761.6666666666666 288 3 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 2003 258 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534098.[MT7]-LPANWEAK[MT7].3b5_1.heavy 406.236 / 726.406 22685.0 31.482200622558594 46 20 10 6 10 6.397458845525703 15.631206454722044 0.0391998291015625 3 0.990322366422743 12.535074348675055 22685.0 73.61792923645581 0.0 - - - - - - - 225.83333333333334 45 6 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 2005 258 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534098.[MT7]-LPANWEAK[MT7].3b3_1.heavy 406.236 / 426.283 71864.0 31.482200622558594 46 20 10 6 10 6.397458845525703 15.631206454722044 0.0391998291015625 3 0.990322366422743 12.535074348675055 71864.0 87.55705934007142 0.0 - - - - - - - 339.0 143 2 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 2007 259 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50388.[MT7]-MPEPTSSPTIGPR.2y8_1.heavy 757.394 / 814.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 2009 259 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50388.[MT7]-MPEPTSSPTIGPR.2y9_1.heavy 757.394 / 915.489 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 2011 259 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50388.[MT7]-MPEPTSSPTIGPR.2y6_1.heavy 757.394 / 640.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 2013 259 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB50388.[MT7]-MPEPTSSPTIGPR.2y10_1.heavy 757.394 / 1012.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSNARE1 t-SNARE domain containing 1 2015 260 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534100.[MT7]-SATVNLTVIR.2y9_1.heavy 609.37 / 986.599 15928.0 32.9541015625 45 15 10 10 10 3.623306158111564 27.59910303912025 0.0 3 0.9545967731155819 5.769815958880832 15928.0 100.06109377393588 0.0 - - - - - - - 701.2857142857143 31 7 IGSF5 immunoglobulin superfamily, member 5 2017 260 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534100.[MT7]-SATVNLTVIR.2y6_1.heavy 609.37 / 715.446 11113.0 32.9541015625 45 15 10 10 10 3.623306158111564 27.59910303912025 0.0 3 0.9545967731155819 5.769815958880832 11113.0 7.877086176477591 0.0 - - - - - - - 674.5714285714286 22 7 IGSF5 immunoglobulin superfamily, member 5 2019 260 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534100.[MT7]-SATVNLTVIR.2b5_1.heavy 609.37 / 617.338 5741.0 32.9541015625 45 15 10 10 10 3.623306158111564 27.59910303912025 0.0 3 0.9545967731155819 5.769815958880832 5741.0 5.47755881256149 0.0 - - - - - - - 1164.2857142857142 11 7 IGSF5 immunoglobulin superfamily, member 5 2021 260 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534100.[MT7]-SATVNLTVIR.2y7_1.heavy 609.37 / 814.515 7316.0 32.9541015625 45 15 10 10 10 3.623306158111564 27.59910303912025 0.0 3 0.9545967731155819 5.769815958880832 7316.0 22.6748596112311 0.0 - - - - - - - 767.2857142857143 14 7 IGSF5 immunoglobulin superfamily, member 5 2023 261 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51197.[MT7]-NVIFEDEEK[MT7].2y4_1.heavy 705.871 / 664.327 12257.0 30.659825325012207 44 18 10 6 10 5.0070919119031725 19.97167253156942 0.036701202392578125 3 0.989315749190221 11.928968642786186 12257.0 16.659189660159473 0.0 - - - - - - - 776.4 24 10 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 2025 261 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51197.[MT7]-NVIFEDEEK[MT7].2y5_1.heavy 705.871 / 793.37 11032.0 30.659825325012207 44 18 10 6 10 5.0070919119031725 19.97167253156942 0.036701202392578125 3 0.989315749190221 11.928968642786186 11032.0 38.32382815228781 0.0 - - - - - - - 744.4444444444445 22 9 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 2027 261 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51197.[MT7]-NVIFEDEEK[MT7].2y3_1.heavy 705.871 / 549.3 19939.0 30.659825325012207 44 18 10 6 10 5.0070919119031725 19.97167253156942 0.036701202392578125 3 0.989315749190221 11.928968642786186 19939.0 46.92479706988166 0.0 - - - - - - - 385.2142857142857 39 14 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 2029 261 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB51197.[MT7]-NVIFEDEEK[MT7].2y6_1.heavy 705.871 / 940.438 38325.0 30.659825325012207 44 18 10 6 10 5.0070919119031725 19.97167253156942 0.036701202392578125 3 0.989315749190221 11.928968642786186 38325.0 96.95836663336664 0.0 - - - - - - - 700.1428571428571 76 7 GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 1 2031 262 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534392.[MT7]-MAQAVTLTVAQAFK[MT7].3y3_1.heavy 589.674 / 509.32 29119.0 44.12770080566406 44 14 10 10 10 3.7009223158118982 27.0202915561772 0.0 3 0.9339857338452513 4.7766660694396235 29119.0 77.20180073840515 0.0 - - - - - - - 282.8181818181818 58 11 LDLRAP1 low density lipoprotein receptor adaptor protein 1 2033 262 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534392.[MT7]-MAQAVTLTVAQAFK[MT7].3b4_1.heavy 589.674 / 546.283 26566.0 44.12770080566406 44 14 10 10 10 3.7009223158118982 27.0202915561772 0.0 3 0.9339857338452513 4.7766660694396235 26566.0 57.136458919659134 0.0 - - - - - - - 654.0 53 10 LDLRAP1 low density lipoprotein receptor adaptor protein 1 2035 262 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534392.[MT7]-MAQAVTLTVAQAFK[MT7].3b5_1.heavy 589.674 / 645.351 30635.0 44.12770080566406 44 14 10 10 10 3.7009223158118982 27.0202915561772 0.0 3 0.9339857338452513 4.7766660694396235 30635.0 80.6408774373259 0.0 - - - - - - - 268.3636363636364 61 11 LDLRAP1 low density lipoprotein receptor adaptor protein 1 2037 262 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534392.[MT7]-MAQAVTLTVAQAFK[MT7].3y5_1.heavy 589.674 / 708.416 26725.0 44.12770080566406 44 14 10 10 10 3.7009223158118982 27.0202915561772 0.0 3 0.9339857338452513 4.7766660694396235 26725.0 149.33400291481053 0.0 - - - - - - - 227.07692307692307 53 13 LDLRAP1 low density lipoprotein receptor adaptor protein 1 2039 263 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533991.[MT7]-GEGDVWVR.2y4_1.heavy 531.278 / 559.335 12817.0 28.850975513458252 34 20 0 6 8 8.57774589155595 11.658074424708872 0.030500411987304688 4 0.9954732945946576 18.33611359321092 12817.0 9.885736117216272 0.0 - - - - - - - 766.4 25 10 SMAD4 SMAD family member 4 2041 263 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533991.[MT7]-GEGDVWVR.2b4_1.heavy 531.278 / 503.222 25635.0 28.850975513458252 34 20 0 6 8 8.57774589155595 11.658074424708872 0.030500411987304688 4 0.9954732945946576 18.33611359321092 25635.0 5.019843829641488 1.0 - - - - - - - 3448.0 206 2 SMAD4 SMAD family member 4 2043 263 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533991.[MT7]-GEGDVWVR.2y6_1.heavy 531.278 / 731.383 3971.0 28.850975513458252 34 20 0 6 8 8.57774589155595 11.658074424708872 0.030500411987304688 4 0.9954732945946576 18.33611359321092 3971.0 6.952286351615499 1.0 - - - - - - - 728.8461538461538 7 13 SMAD4 SMAD family member 4 2045 263 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB533991.[MT7]-GEGDVWVR.2b5_1.heavy 531.278 / 602.29 6966.0 28.850975513458252 34 20 0 6 8 8.57774589155595 11.658074424708872 0.030500411987304688 4 0.9954732945946576 18.33611359321092 6966.0 6.397099655931667 0.0 - - - - - - - 759.5 13 10 SMAD4 SMAD family member 4 2047 264 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534394.[MT7]-NPDLGFSDYAAAQLR.3y6_1.heavy 594.636 / 629.373 108478.0 37.566898345947266 50 20 10 10 10 5.756181092265976 17.372629247950577 0.0 3 0.99233514547948 14.087457557650376 108478.0 58.825796719583174 1.0 - - - - - - - 640.0 231 1 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 2049 264 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534394.[MT7]-NPDLGFSDYAAAQLR.3b5_1.heavy 594.636 / 641.338 101618.0 37.566898345947266 50 20 10 10 10 5.756181092265976 17.372629247950577 0.0 3 0.99233514547948 14.087457557650376 101618.0 96.57652940040924 0.0 - - - - - - - 805.0 203 5 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 2051 264 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534394.[MT7]-NPDLGFSDYAAAQLR.3b8_1.heavy 594.636 / 990.465 62654.0 37.566898345947266 50 20 10 10 10 5.756181092265976 17.372629247950577 0.0 3 0.99233514547948 14.087457557650376 62654.0 60.61312541177382 0.0 - - - - - - - 274.2857142857143 125 7 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 2053 264 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534394.[MT7]-NPDLGFSDYAAAQLR.3y5_1.heavy 594.636 / 558.336 140033.0 37.566898345947266 50 20 10 10 10 5.756181092265976 17.372629247950577 0.0 3 0.99233514547948 14.087457557650376 140033.0 51.31139669581589 0.0 - - - - - - - 1783.5 280 2 SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) 2055 265 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534202.[MT7]-GLLHIFYIPR.3y6_1.heavy 458.279 / 808.472 26439.0 42.82320022583008 44 14 10 10 10 1.6645828577824497 40.76119217418452 0.0 3 0.9328517647272117 4.735702474376466 26439.0 258.45252713972883 0.0 - - - - - - - 205.57142857142858 52 7 LY96 lymphocyte antigen 96 2057 265 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534202.[MT7]-GLLHIFYIPR.3b4_1.heavy 458.279 / 565.358 109144.0 42.82320022583008 44 14 10 10 10 1.6645828577824497 40.76119217418452 0.0 3 0.9328517647272117 4.735702474376466 109144.0 759.9418129364858 0.0 - - - - - - - 192.45454545454547 218 11 LY96 lymphocyte antigen 96 2059 265 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534202.[MT7]-GLLHIFYIPR.3y4_1.heavy 458.279 / 548.319 131007.0 42.82320022583008 44 14 10 10 10 1.6645828577824497 40.76119217418452 0.0 3 0.9328517647272117 4.735702474376466 131007.0 906.7419759504279 0.0 - - - - - - - 239.83333333333334 262 6 LY96 lymphocyte antigen 96 2061 265 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534202.[MT7]-GLLHIFYIPR.3y5_1.heavy 458.279 / 695.388 128126.0 42.82320022583008 44 14 10 10 10 1.6645828577824497 40.76119217418452 0.0 3 0.9328517647272117 4.735702474376466 128126.0 1009.0974645902251 0.0 - - - - - - - 197.83333333333334 256 6 LY96 lymphocyte antigen 96 2063 266 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534494.[MT7]-SLVATGNLLDLEETAK[MT7].3y7_1.heavy 654.705 / 949.496 53444.0 41.05329895019531 47 17 10 10 10 3.66728028792615 27.26816391134098 0.0 3 0.9717700736427387 7.327916177052096 53444.0 164.2173291629115 0.0 - - - - - - - 761.2222222222222 106 9 LDLRAP1 low density lipoprotein receptor adaptor protein 1 2065 266 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534494.[MT7]-SLVATGNLLDLEETAK[MT7].3b4_1.heavy 654.705 / 515.331 53283.0 41.05329895019531 47 17 10 10 10 3.66728028792615 27.26816391134098 0.0 3 0.9717700736427387 7.327916177052096 53283.0 52.64112485118818 0.0 - - - - - - - 806.0 106 8 LDLRAP1 low density lipoprotein receptor adaptor protein 1 2067 266 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534494.[MT7]-SLVATGNLLDLEETAK[MT7].3y4_1.heavy 654.705 / 592.342 64568.0 41.05329895019531 47 17 10 10 10 3.66728028792615 27.26816391134098 0.0 3 0.9717700736427387 7.327916177052096 64568.0 56.47476483770171 0.0 - - - - - - - 363.0 129 4 LDLRAP1 low density lipoprotein receptor adaptor protein 1 2069 266 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534494.[MT7]-SLVATGNLLDLEETAK[MT7].3b7_1.heavy 654.705 / 787.443 92942.0 41.05329895019531 47 17 10 10 10 3.66728028792615 27.26816391134098 0.0 3 0.9717700736427387 7.327916177052096 92942.0 116.72718707508594 0.0 - - - - - - - 702.1428571428571 185 7 LDLRAP1 low density lipoprotein receptor adaptor protein 1 2071 267 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534201.[MT7]-LIEDNEYTAR.2y8_1.heavy 684.35 / 997.422 22523.0 28.958899974822998 43 17 10 6 10 2.439832687957128 32.667165927817216 0.03159904479980469 3 0.9782980261909262 8.362270037774271 22523.0 82.38663107264894 0.0 - - - - - - - 334.2 45 15 FYN;LCK;SRC;YES1 FYN oncogene related to SRC, FGR, YES;lymphocyte-specific protein tyrosine kinase;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 2073 267 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534201.[MT7]-LIEDNEYTAR.2y9_1.heavy 684.35 / 1110.51 27182.0 28.958899974822998 43 17 10 6 10 2.439832687957128 32.667165927817216 0.03159904479980469 3 0.9782980261909262 8.362270037774271 27182.0 71.29480035265863 0.0 - - - - - - - 706.1 54 10 FYN;LCK;SRC;YES1 FYN oncogene related to SRC, FGR, YES;lymphocyte-specific protein tyrosine kinase;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 2075 267 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534201.[MT7]-LIEDNEYTAR.2y6_1.heavy 684.35 / 753.353 16309.0 28.958899974822998 43 17 10 6 10 2.439832687957128 32.667165927817216 0.03159904479980469 3 0.9782980261909262 8.362270037774271 16309.0 27.18961859138448 0.0 - - - - - - - 332.29411764705884 32 17 FYN;LCK;SRC;YES1 FYN oncogene related to SRC, FGR, YES;lymphocyte-specific protein tyrosine kinase;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 2077 267 C20140303_KEGG1700_set13_02 C20140303_KEGG1700_set13_02 TB534201.[MT7]-LIEDNEYTAR.2y7_1.heavy 684.35 / 868.38 9673.0 28.958899974822998 43 17 10 6 10 2.439832687957128 32.667165927817216 0.03159904479980469 3 0.9782980261909262 8.362270037774271 9673.0 24.330649257685764 0.0 - - - - - - - 767.75 19 8 FYN;LCK;SRC;YES1 FYN oncogene related to SRC, FGR, YES;lymphocyte-specific protein tyrosine kinase;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1