Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48970.[MT7]-K[MT7]QEEAR.2y4_1.heavy 524.803 / 504.241 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRPM5;BTBD7;HGS transient receptor potential cation channel, subfamily M, member 5;BTB (POZ) domain containing 7;hepatocyte growth factor-regulated tyrosine kinase substrate 3 1 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48970.[MT7]-K[MT7]QEEAR.2b3_1.heavy 524.803 / 674.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRPM5;BTBD7;HGS transient receptor potential cation channel, subfamily M, member 5;BTB (POZ) domain containing 7;hepatocyte growth factor-regulated tyrosine kinase substrate 5 1 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48970.[MT7]-K[MT7]QEEAR.2y5_1.heavy 524.803 / 632.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRPM5;BTBD7;HGS transient receptor potential cation channel, subfamily M, member 5;BTB (POZ) domain containing 7;hepatocyte growth factor-regulated tyrosine kinase substrate 7 1 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48970.[MT7]-K[MT7]QEEAR.2b4_1.heavy 524.803 / 803.45 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRPM5;BTBD7;HGS transient receptor potential cation channel, subfamily M, member 5;BTB (POZ) domain containing 7;hepatocyte growth factor-regulated tyrosine kinase substrate 9 2 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49155.[MT7]-WLLYLVK[MT7].2y4_1.heavy 611.894 / 666.431 2199.0 48.25150108337402 33 13 4 6 10 0.9087052492763291 63.82866944878729 0.034000396728515625 3 0.9031314621242743 3.932794295700233 2199.0 10.97278787878788 0.0 - - - - - - - 233.0952380952381 4 21 ITGA6 integrin, alpha 6 11 2 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49155.[MT7]-WLLYLVK[MT7].2b3_1.heavy 611.894 / 557.357 1814.0 48.25150108337402 33 13 4 6 10 0.9087052492763291 63.82866944878729 0.034000396728515625 3 0.9031314621242743 3.932794295700233 1814.0 3.457818181818182 1.0 - - - - - - - 197.35294117647058 3 17 ITGA6 integrin, alpha 6 13 2 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49155.[MT7]-WLLYLVK[MT7].2y3_1.heavy 611.894 / 503.367 1539.0 48.25150108337402 33 13 4 6 10 0.9087052492763291 63.82866944878729 0.034000396728515625 3 0.9031314621242743 3.932794295700233 1539.0 5.596363636363637 0.0 - - - - - - - 297.5 3 22 ITGA6 integrin, alpha 6 15 2 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49155.[MT7]-WLLYLVK[MT7].2y6_1.heavy 611.894 / 892.599 1209.0 48.25150108337402 33 13 4 6 10 0.9087052492763291 63.82866944878729 0.034000396728515625 3 0.9031314621242743 3.932794295700233 1209.0 8.616872727272726 2.0 - - - - - - - 169.23076923076923 8 13 ITGA6 integrin, alpha 6 17 3 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48977.[MT7]-IPEGDLIR.2y5_1.heavy 528.812 / 573.336 13587.0 32.66173426310221 46 20 10 6 10 11.361789207704009 8.801430670109045 0.03369903564453125 3 0.9997246428074051 74.37109762281105 13587.0 10.019565592635212 0.0 - - - - - - - 1771.857142857143 27 7 GRK5 G protein-coupled receptor kinase 5 19 3 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48977.[MT7]-IPEGDLIR.2y3_1.heavy 528.812 / 401.287 N/A 32.66173426310221 46 20 10 6 10 11.361789207704009 8.801430670109045 0.03369903564453125 3 0.9997246428074051 74.37109762281105 20775.0 21.72969962216861 1.0 - - - - - - - 684.6666666666666 80 3 GRK5 G protein-coupled receptor kinase 5 21 3 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48977.[MT7]-IPEGDLIR.2y6_1.heavy 528.812 / 702.378 4424.0 32.66173426310221 46 20 10 6 10 11.361789207704009 8.801430670109045 0.03369903564453125 3 0.9997246428074051 74.37109762281105 4424.0 4.713333333333334 1.0 - - - - - - - 733.5714285714286 8 7 GRK5 G protein-coupled receptor kinase 5 23 3 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48977.[MT7]-IPEGDLIR.2y7_1.heavy 528.812 / 799.431 101899.0 32.66173426310221 46 20 10 6 10 11.361789207704009 8.801430670109045 0.03369903564453125 3 0.9997246428074051 74.37109762281105 101899.0 198.23931434599154 0.0 - - - - - - - 329.1666666666667 203 6 GRK5 G protein-coupled receptor kinase 5 25 4 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49294.[MT7]-SSEQILATLK[MT7].2b3_1.heavy 689.413 / 448.216 27503.0 35.03324890136719 42 16 10 6 10 2.980988509743797 33.54591930600718 0.0381011962890625 3 0.9639080945053277 6.476532129906566 27503.0 31.74511507991768 0.0 - - - - - - - 754.5714285714286 55 7 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 27 4 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49294.[MT7]-SSEQILATLK[MT7].2y9_1.heavy 689.413 / 1146.69 4827.0 35.03324890136719 42 16 10 6 10 2.980988509743797 33.54591930600718 0.0381011962890625 3 0.9639080945053277 6.476532129906566 4827.0 22.63208791208791 0.0 - - - - - - - 290.0625 9 16 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 29 4 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49294.[MT7]-SSEQILATLK[MT7].2y3_1.heavy 689.413 / 505.347 20400.0 35.03324890136719 42 16 10 6 10 2.980988509743797 33.54591930600718 0.0381011962890625 3 0.9639080945053277 6.476532129906566 20400.0 19.476761957257033 0.0 - - - - - - - 660.0 40 4 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 31 4 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49294.[MT7]-SSEQILATLK[MT7].2y7_1.heavy 689.413 / 930.61 8834.0 35.03324890136719 42 16 10 6 10 2.980988509743797 33.54591930600718 0.0381011962890625 3 0.9639080945053277 6.476532129906566 8834.0 4.956829100892245 1.0 - - - - - - - 287.0 17 13 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 33 5 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534785.[MT7]-MVDVGGQR.2y5_1.heavy 503.267 / 516.289 20776.0 23.864375591278076 43 18 10 7 8 3.204160590531369 24.832605898177896 0.027898788452148438 4 0.9839304733876166 9.722490592688436 20776.0 24.02109697209869 0.0 - - - - - - - 1255.75 41 8 GNA13;GNA11;GNA12;GNAQ;GNAZ;GNA14 guanine nucleotide binding protein (G protein), alpha 13;guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein) alpha 12;guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha z polypeptide;guanine nucleotide binding protein (G protein), alpha 14 35 5 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534785.[MT7]-MVDVGGQR.2b4_1.heavy 503.267 / 589.314 4243.0 23.864375591278076 43 18 10 7 8 3.204160590531369 24.832605898177896 0.027898788452148438 4 0.9839304733876166 9.722490592688436 4243.0 1.352296147963205 3.0 - - - - - - - 722.6666666666666 8 12 GNA13;GNA11;GNA12;GNAQ;GNAZ;GNA14 guanine nucleotide binding protein (G protein), alpha 13;guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein) alpha 12;guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha z polypeptide;guanine nucleotide binding protein (G protein), alpha 14 37 5 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534785.[MT7]-MVDVGGQR.2y6_1.heavy 503.267 / 631.316 11792.0 23.864375591278076 43 18 10 7 8 3.204160590531369 24.832605898177896 0.027898788452148438 4 0.9839304733876166 9.722490592688436 11792.0 11.71680152115777 0.0 - - - - - - - 1247.857142857143 23 7 GNA13;GNA11;GNA12;GNAQ;GNAZ;GNA14 guanine nucleotide binding protein (G protein), alpha 13;guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein) alpha 12;guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha z polypeptide;guanine nucleotide binding protein (G protein), alpha 14 39 5 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534785.[MT7]-MVDVGGQR.2y7_1.heavy 503.267 / 730.384 11230.0 23.864375591278076 43 18 10 7 8 3.204160590531369 24.832605898177896 0.027898788452148438 4 0.9839304733876166 9.722490592688436 11230.0 17.921606607801024 1.0 - - - - - - - 686.4285714285714 23 7 GNA13;GNA11;GNA12;GNAQ;GNAZ;GNA14 guanine nucleotide binding protein (G protein), alpha 13;guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide binding protein (G protein) alpha 12;guanine nucleotide binding protein (G protein), q polypeptide;guanine nucleotide binding protein (G protein), alpha z polypeptide;guanine nucleotide binding protein (G protein), alpha 14 41 6 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49542.[MT7]-SDYAQLLEDMQNAFR.3b4_1.heavy 648.98 / 581.269 12768.0 50.0679988861084 41 15 10 6 10 4.3854060828772905 22.802905388955317 0.03800201416015625 3 0.9534833747331264 5.699808089042904 12768.0 80.60626028488011 0.0 - - - - - - - 217.5 25 18 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 43 6 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49542.[MT7]-SDYAQLLEDMQNAFR.3b5_1.heavy 648.98 / 709.327 21009.0 50.0679988861084 41 15 10 6 10 4.3854060828772905 22.802905388955317 0.03800201416015625 3 0.9534833747331264 5.699808089042904 21009.0 464.9907665585919 0.0 - - - - - - - 203.47058823529412 42 17 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 45 6 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49542.[MT7]-SDYAQLLEDMQNAFR.3b3_1.heavy 648.98 / 510.232 8139.0 50.0679988861084 41 15 10 6 10 4.3854060828772905 22.802905388955317 0.03800201416015625 3 0.9534833747331264 5.699808089042904 8139.0 49.07979657180444 0.0 - - - - - - - 195.52631578947367 16 19 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 47 6 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49542.[MT7]-SDYAQLLEDMQNAFR.3y8_1.heavy 648.98 / 1010.44 12717.0 50.0679988861084 41 15 10 6 10 4.3854060828772905 22.802905388955317 0.03800201416015625 3 0.9534833747331264 5.699808089042904 12717.0 294.54355549116195 0.0 - - - - - - - 159.46666666666667 25 15 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 49 7 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536782.[MT7]-IAQEATVLK[MT7]DELTASLEEVRK[MT7].4y5_1.heavy 694.651 / 804.47 1211.0 46.785600662231445 40 14 10 6 10 2.262198711890922 36.38833801706431 0.030200958251953125 3 0.9365620271704186 4.873765685855569 1211.0 6.402569444444444 2.0 - - - - - - - 165.1818181818182 2 22 CTNNA3 catenin (cadherin-associated protein), alpha 3 51 7 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536782.[MT7]-IAQEATVLK[MT7]DELTASLEEVRK[MT7].4y9_1.heavy 694.651 / 1176.67 1154.0 46.785600662231445 40 14 10 6 10 2.262198711890922 36.38833801706431 0.030200958251953125 3 0.9365620271704186 4.873765685855569 1154.0 14.430104272539054 0.0 - - - - - - - 191.0625 2 16 CTNNA3 catenin (cadherin-associated protein), alpha 3 53 7 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536782.[MT7]-IAQEATVLK[MT7]DELTASLEEVRK[MT7].4b4_1.heavy 694.651 / 586.332 3115.0 46.785600662231445 40 14 10 6 10 2.262198711890922 36.38833801706431 0.030200958251953125 3 0.9365620271704186 4.873765685855569 3115.0 9.614373604990558 0.0 - - - - - - - 301.1666666666667 6 18 CTNNA3 catenin (cadherin-associated protein), alpha 3 55 7 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536782.[MT7]-IAQEATVLK[MT7]DELTASLEEVRK[MT7].4y7_1.heavy 694.651 / 1004.59 2076.0 46.785600662231445 40 14 10 6 10 2.262198711890922 36.38833801706431 0.030200958251953125 3 0.9365620271704186 4.873765685855569 2076.0 5.2796420651528875 0.0 - - - - - - - 157.8421052631579 4 19 CTNNA3 catenin (cadherin-associated protein), alpha 3 57 8 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49548.[MT7]-RLEAGMLDPPFVPDPR.3b6_1.heavy 652.016 / 802.436 4822.0 38.50054931640625 37 13 10 6 8 0.8923474540376183 71.2879436585422 0.038299560546875 4 0.9101986569205206 4.087107523868394 4822.0 0.0 3.0 - - - - - - - 0.0 10 0 GRK5 G protein-coupled receptor kinase 5 59 8 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49548.[MT7]-RLEAGMLDPPFVPDPR.3b5_1.heavy 652.016 / 671.396 3692.0 38.50054931640625 37 13 10 6 8 0.8923474540376183 71.2879436585422 0.038299560546875 4 0.9101986569205206 4.087107523868394 3692.0 0.0 2.0 - - - - - - - 0.0 7 0 GRK5 G protein-coupled receptor kinase 5 61 8 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49548.[MT7]-RLEAGMLDPPFVPDPR.3b8_1.heavy 652.016 / 1030.55 20721.0 38.50054931640625 37 13 10 6 8 0.8923474540376183 71.2879436585422 0.038299560546875 4 0.9101986569205206 4.087107523868394 20721.0 29.33946902654867 1.0 - - - - - - - 0.0 41 0 GRK5 G protein-coupled receptor kinase 5 63 8 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49548.[MT7]-RLEAGMLDPPFVPDPR.3b8_2.heavy 652.016 / 515.777 12809.0 38.50054931640625 37 13 10 6 8 0.8923474540376183 71.2879436585422 0.038299560546875 4 0.9101986569205206 4.087107523868394 12809.0 8.991966144590696 0.0 - - - - - - - 0.0 25 0 GRK5 G protein-coupled receptor kinase 5 65 9 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48172.[MT7]-GNEMSEVLR.2y5_1.heavy 589.801 / 603.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 67 9 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48172.[MT7]-GNEMSEVLR.2b4_1.heavy 589.801 / 576.257 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 69 9 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48172.[MT7]-GNEMSEVLR.2b6_1.heavy 589.801 / 792.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 71 9 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48172.[MT7]-GNEMSEVLR.2b5_1.heavy 589.801 / 663.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 73 10 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49095.[MT7]-RQHVNTK[MT7].2y5_1.heavy 585.851 / 742.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 75 10 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49095.[MT7]-RQHVNTK[MT7].2b6_1.heavy 585.851 / 880.487 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 77 10 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49095.[MT7]-RQHVNTK[MT7].2y3_1.heavy 585.851 / 506.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 79 10 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49095.[MT7]-RQHVNTK[MT7].2b5_1.heavy 585.851 / 779.439 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 81 11 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48314.[MT7]-ATVLTTERK[MT7].2y8_1.heavy 653.9 / 1091.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 83 11 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48314.[MT7]-ATVLTTERK[MT7].2y5_1.heavy 653.9 / 778.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 85 11 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48314.[MT7]-ATVLTTERK[MT7].2y6_1.heavy 653.9 / 891.538 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 87 11 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48314.[MT7]-ATVLTTERK[MT7].2y7_1.heavy 653.9 / 990.606 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 89 12 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49445.[MT7]-HVVQSISTQQEK[MT7].2b3_1.heavy 836.467 / 480.305 3636.0 20.93269920349121 43 13 10 10 10 1.0051493770794029 57.25791411247438 0.0 3 0.9137378267410248 4.17137908602148 3636.0 52.61027932960894 0.0 - - - - - - - 186.375 7 16 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 91 12 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49445.[MT7]-HVVQSISTQQEK[MT7].2y8_1.heavy 836.467 / 1064.57 3516.0 20.93269920349121 43 13 10 10 10 1.0051493770794029 57.25791411247438 0.0 3 0.9137378267410248 4.17137908602148 3516.0 39.87946308724832 0.0 - - - - - - - 144.25 7 12 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 93 12 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49445.[MT7]-HVVQSISTQQEK[MT7].2y9_1.heavy 836.467 / 1192.63 1311.0 20.93269920349121 43 13 10 10 10 1.0051493770794029 57.25791411247438 0.0 3 0.9137378267410248 4.17137908602148 1311.0 11.540054028720334 0.0 - - - - - - - 151.06666666666666 2 15 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 95 12 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49445.[MT7]-HVVQSISTQQEK[MT7].2y6_1.heavy 836.467 / 864.454 1490.0 20.93269920349121 43 13 10 10 10 1.0051493770794029 57.25791411247438 0.0 3 0.9137378267410248 4.17137908602148 1490.0 11.459217877094972 0.0 - - - - - - - 132.07142857142858 2 14 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 97 13 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534885.[MT7]-VLYVLK[MT7].2b3_1.heavy 511.846 / 520.325 38816.0 36.38019943237305 44 18 8 10 8 4.315170668922463 18.63979505654818 0.0 4 0.9858279035353851 10.354546356066123 38816.0 100.4148360994804 0.0 - - - - - - - 749.125 77 8 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 99 13 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534885.[MT7]-VLYVLK[MT7].2y4_1.heavy 511.846 / 666.431 51816.0 36.38019943237305 44 18 8 10 8 4.315170668922463 18.63979505654818 0.0 4 0.9858279035353851 10.354546356066123 51816.0 33.20297231801576 2.0 - - - - - - - 292.0 172 6 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 101 13 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534885.[MT7]-VLYVLK[MT7].2y5_1.heavy 511.846 / 779.515 57625.0 36.38019943237305 44 18 8 10 8 4.315170668922463 18.63979505654818 0.0 4 0.9858279035353851 10.354546356066123 57625.0 201.49483451195456 0.0 - - - - - - - 299.75 115 8 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 103 13 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534885.[MT7]-VLYVLK[MT7].2y3_1.heavy 511.846 / 503.367 63249.0 36.38019943237305 44 18 8 10 8 4.315170668922463 18.63979505654818 0.0 4 0.9858279035353851 10.354546356066123 63249.0 33.690611190897044 0.0 - - - - - - - 1419.8 126 5 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 105 14 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535837.[MT7]-ILLLGAGESGK[MT7].3b5_1.heavy 449.281 / 654.467 132251.0 37.38940143585205 40 14 10 6 10 1.6375077370790159 51.82653641381678 0.037998199462890625 3 0.9304698279424756 4.652931201159563 132251.0 421.6953589186918 0.0 - - - - - - - 270.14285714285717 264 21 GNA13;GNA12 guanine nucleotide binding protein (G protein), alpha 13;guanine nucleotide binding protein (G protein) alpha 12 107 14 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535837.[MT7]-ILLLGAGESGK[MT7].3b3_1.heavy 449.281 / 484.362 107459.0 37.38940143585205 40 14 10 6 10 1.6375077370790159 51.82653641381678 0.037998199462890625 3 0.9304698279424756 4.652931201159563 107459.0 204.71072109065597 0.0 - - - - - - - 348.90909090909093 214 11 GNA13;GNA12 guanine nucleotide binding protein (G protein), alpha 13;guanine nucleotide binding protein (G protein) alpha 12 109 14 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535837.[MT7]-ILLLGAGESGK[MT7].3y5_1.heavy 449.281 / 621.332 87905.0 37.38940143585205 40 14 10 6 10 1.6375077370790159 51.82653641381678 0.037998199462890625 3 0.9304698279424756 4.652931201159563 87905.0 299.40920004402255 1.0 - - - - - - - 669.3333333333334 175 12 GNA13;GNA12 guanine nucleotide binding protein (G protein), alpha 13;guanine nucleotide binding protein (G protein) alpha 12 111 14 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535837.[MT7]-ILLLGAGESGK[MT7].3b8_2.heavy 449.281 / 456.288 58138.0 37.38940143585205 40 14 10 6 10 1.6375077370790159 51.82653641381678 0.037998199462890625 3 0.9304698279424756 4.652931201159563 58138.0 87.92202560999408 0.0 - - - - - - - 803.2 116 10 GNA13;GNA12 guanine nucleotide binding protein (G protein), alpha 13;guanine nucleotide binding protein (G protein) alpha 12 113 15 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47846.[MT7]-AVVPSK[MT7].2b3_1.heavy 444.791 / 414.283 39959.0 23.485000610351562 33 11 2 10 10 1.5862604298135468 31.52067533190444 0.0 2 0.8524515633066914 3.1725208533990505 39959.0 16.797443563645682 0.0 - - - - - - - 1776.25 79 4 HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 115 15 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47846.[MT7]-AVVPSK[MT7].2y4_1.heavy 444.791 / 574.368 12776.0 23.485000610351562 33 11 2 10 10 1.5862604298135468 31.52067533190444 0.0 2 0.8524515633066914 3.1725208533990505 12776.0 9.653308934998414 1.0 - - - - - - - 1294.2857142857142 25 7 HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 117 15 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47846.[MT7]-AVVPSK[MT7].2y5_1.heavy 444.791 / 673.437 N/A 23.485000610351562 33 11 2 10 10 1.5862604298135468 31.52067533190444 0.0 2 0.8524515633066914 3.1725208533990505 1956.0 -0.24094159257092868 10.0 - - - - - - - 721.2666666666667 194 15 HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 119 15 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47846.[MT7]-AVVPSK[MT7].2y3_1.heavy 444.791 / 475.3 N/A 23.485000610351562 33 11 2 10 10 1.5862604298135468 31.52067533190444 0.0 2 0.8524515633066914 3.1725208533990505 2216.0 0.05679109200361923 22.0 - - - - - - - 1231.2222222222222 6 9 HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 121 16 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534472.[MT7]-IVIQK[MT7].2b3_1.heavy 444.81 / 470.346 19376.0 27.29640007019043 50 20 10 10 10 8.33159147830981 12.002508795628863 0.0 3 0.9972695402764943 23.61269808794552 19376.0 12.326347052682996 0.0 - - - - - - - 868.0 38 3 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 123 16 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534472.[MT7]-IVIQK[MT7].2y4_1.heavy 444.81 / 631.426 76354.0 27.29640007019043 50 20 10 10 10 8.33159147830981 12.002508795628863 0.0 3 0.9972695402764943 23.61269808794552 76354.0 32.09622593662207 0.0 - - - - - - - 919.0 152 1 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 125 16 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534472.[MT7]-IVIQK[MT7].2b4_1.heavy 444.81 / 598.404 6203.0 27.29640007019043 50 20 10 10 10 8.33159147830981 12.002508795628863 0.0 3 0.9972695402764943 23.61269808794552 6203.0 3.9915450489069015 0.0 - - - - - - - 851.0 12 9 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 127 16 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534472.[MT7]-IVIQK[MT7].2y3_1.heavy 444.81 / 532.357 73061.0 27.29640007019043 50 20 10 10 10 8.33159147830981 12.002508795628863 0.0 3 0.9972695402764943 23.61269808794552 73061.0 68.51029840224194 0.0 - - - - - - - 842.0 146 1 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 129 17 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48808.[MT7]-GISSLPR.2b3_1.heavy 437.267 / 402.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO7 LIM domain 7 131 17 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48808.[MT7]-GISSLPR.2y5_2.heavy 437.267 / 280.164 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO7 LIM domain 7 133 17 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48808.[MT7]-GISSLPR.2y5_1.heavy 437.267 / 559.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO7 LIM domain 7 135 17 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48808.[MT7]-GISSLPR.2b4_1.heavy 437.267 / 489.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO7 LIM domain 7 137 18 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48969.[MT7]-NQGSEPK[MT7].2y5_1.heavy 524.287 / 661.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 139 18 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48969.[MT7]-NQGSEPK[MT7].2b4_1.heavy 524.287 / 531.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 141 18 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48969.[MT7]-NQGSEPK[MT7].2b5_1.heavy 524.287 / 660.307 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 143 19 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534474.[MT7]-AAELAK[MT7].2y4_1.heavy 445.781 / 604.379 13012.0 20.96649932861328 46 20 10 10 6 8.522549045663782 11.733578705643161 0.0 5 0.9967267420754844 21.565211481868143 13012.0 23.008147304287654 2.0 - - - - - - - 759.7272727272727 48 11 NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 145 19 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534474.[MT7]-AAELAK[MT7].2y5_1.heavy 445.781 / 675.416 27933.0 20.96649932861328 46 20 10 10 6 8.522549045663782 11.733578705643161 0.0 5 0.9967267420754844 21.565211481868143 27933.0 34.907918891567455 1.0 - - - - - - - 298.2 55 5 NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 147 19 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534474.[MT7]-AAELAK[MT7].2b4_1.heavy 445.781 / 529.31 12713.0 20.96649932861328 46 20 10 10 6 8.522549045663782 11.733578705643161 0.0 5 0.9967267420754844 21.565211481868143 12713.0 13.006984915215828 1.0 - - - - - - - 1111.875 31 8 NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 149 19 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534474.[MT7]-AAELAK[MT7].2y3_1.heavy 445.781 / 475.336 22562.0 20.96649932861328 46 20 10 10 6 8.522549045663782 11.733578705643161 0.0 5 0.9967267420754844 21.565211481868143 22562.0 18.14500782847618 1.0 - - - - - - - 1283.25 50 8 NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 151 20 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535700.[MT7]-EDTEEHHLR.3y3_1.heavy 437.213 / 425.262 78637.0 15.8996000289917 50 20 10 10 10 7.050390866211327 14.183610795146889 0.0 3 0.9933293868333225 15.102115182000746 78637.0 116.68994722248993 0.0 - - - - - - - 1272.2 157 10 HNRNPA1L2;HNRNPA1;HNRNPA2B1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1;heterogeneous nuclear ribonucleoprotein A2/B1 153 20 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535700.[MT7]-EDTEEHHLR.3b4_1.heavy 437.213 / 619.269 27983.0 15.8996000289917 50 20 10 10 10 7.050390866211327 14.183610795146889 0.0 3 0.9933293868333225 15.102115182000746 27983.0 106.81413564781676 0.0 - - - - - - - 261.3888888888889 55 18 HNRNPA1L2;HNRNPA1;HNRNPA2B1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1;heterogeneous nuclear ribonucleoprotein A2/B1 155 20 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535700.[MT7]-EDTEEHHLR.3b5_1.heavy 437.213 / 748.312 25615.0 15.8996000289917 50 20 10 10 10 7.050390866211327 14.183610795146889 0.0 3 0.9933293868333225 15.102115182000746 25615.0 128.0504363252781 0.0 - - - - - - - 182.85 51 20 HNRNPA1L2;HNRNPA1;HNRNPA2B1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1;heterogeneous nuclear ribonucleoprotein A2/B1 157 20 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535700.[MT7]-EDTEEHHLR.3y4_1.heavy 437.213 / 562.321 17900.0 15.8996000289917 50 20 10 10 10 7.050390866211327 14.183610795146889 0.0 3 0.9933293868333225 15.102115182000746 17900.0 24.385908037534666 0.0 - - - - - - - 670.5454545454545 35 11 HNRNPA1L2;HNRNPA1;HNRNPA2B1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1;heterogeneous nuclear ribonucleoprotein A2/B1 159 21 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534477.[MT7]-NVPFK[MT7].2y4_1.heavy 446.778 / 634.404 28859.0 26.29462432861328 40 20 10 6 4 11.873379844670108 8.42220170736721 0.03730010986328125 7 0.9997809930721838 83.39221642311232 28859.0 54.03456065406707 0.0 - - - - - - - 150.0 57 1 GNA13;HSPA9;KY guanine nucleotide binding protein (G protein), alpha 13;heat shock 70kDa protein 9 (mortalin);kyphoscoliosis peptidase 161 21 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534477.[MT7]-NVPFK[MT7].2b3_2.heavy 446.778 / 228.14 5397.0 26.29462432861328 40 20 10 6 4 11.873379844670108 8.42220170736721 0.03730010986328125 7 0.9997809930721838 83.39221642311232 5397.0 0.0 16.0 - - - - - - - 1836.5 25 2 GNA13;HSPA9;KY guanine nucleotide binding protein (G protein), alpha 13;heat shock 70kDa protein 9 (mortalin);kyphoscoliosis peptidase 163 21 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534477.[MT7]-NVPFK[MT7].2b4_1.heavy 446.778 / 602.342 2549.0 26.29462432861328 40 20 10 6 4 11.873379844670108 8.42220170736721 0.03730010986328125 7 0.9997809930721838 83.39221642311232 2549.0 0.8808277458109224 7.0 - - - - - - - 1229.0 9 10 GNA13;HSPA9;KY guanine nucleotide binding protein (G protein), alpha 13;heat shock 70kDa protein 9 (mortalin);kyphoscoliosis peptidase 165 21 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534477.[MT7]-NVPFK[MT7].2y3_1.heavy 446.778 / 535.336 182447.0 26.29462432861328 40 20 10 6 4 11.873379844670108 8.42220170736721 0.03730010986328125 7 0.9997809930721838 83.39221642311232 182447.0 161.11632585193854 0.0 - - - - - - - 375.0 364 1 GNA13;HSPA9;KY guanine nucleotide binding protein (G protein), alpha 13;heat shock 70kDa protein 9 (mortalin);kyphoscoliosis peptidase 167 22 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48701.[MT7]-ETESQLLPDVGAIVTC[CAM]K[MT7].3y3_1.heavy 716.72 / 552.293 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOSC1 exosome component 1 169 22 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48701.[MT7]-ETESQLLPDVGAIVTC[CAM]K[MT7].3b6_1.heavy 716.72 / 832.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOSC1 exosome component 1 171 22 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48701.[MT7]-ETESQLLPDVGAIVTC[CAM]K[MT7].3b5_1.heavy 716.72 / 719.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOSC1 exosome component 1 173 22 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48701.[MT7]-ETESQLLPDVGAIVTC[CAM]K[MT7].3b3_1.heavy 716.72 / 504.242 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOSC1 exosome component 1 175 23 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48804.[MT7]-SYLAK[MT7].2b3_1.heavy 435.27 / 508.289 13736.0 23.433650016784668 43 16 10 7 10 2.724462012010858 29.01348280937686 0.028598785400390625 3 0.964119697694412 6.495717725259247 13736.0 23.7669541774344 0.0 - - - - - - - 1216.2 27 10 VPS4A;PFKFB3;VPS4B vacuolar protein sorting 4 homolog A (S. cerevisiae);6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3;vacuolar protein sorting 4 homolog B (S. cerevisiae) 177 23 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48804.[MT7]-SYLAK[MT7].2y4_1.heavy 435.27 / 638.399 27956.0 23.433650016784668 43 16 10 7 10 2.724462012010858 29.01348280937686 0.028598785400390625 3 0.964119697694412 6.495717725259247 27956.0 44.3181304892892 0.0 - - - - - - - 1225.375 55 8 VPS4A;PFKFB3;VPS4B vacuolar protein sorting 4 homolog A (S. cerevisiae);6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3;vacuolar protein sorting 4 homolog B (S. cerevisiae) 179 23 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48804.[MT7]-SYLAK[MT7].2b4_1.heavy 435.27 / 579.326 6112.0 23.433650016784668 43 16 10 7 10 2.724462012010858 29.01348280937686 0.028598785400390625 3 0.964119697694412 6.495717725259247 6112.0 9.075332860316921 0.0 - - - - - - - 1225.25 12 8 VPS4A;PFKFB3;VPS4B vacuolar protein sorting 4 homolog A (S. cerevisiae);6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3;vacuolar protein sorting 4 homolog B (S. cerevisiae) 181 23 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48804.[MT7]-SYLAK[MT7].2y3_1.heavy 435.27 / 475.336 18274.0 23.433650016784668 43 16 10 7 10 2.724462012010858 29.01348280937686 0.028598785400390625 3 0.964119697694412 6.495717725259247 18274.0 10.180210167141976 1.0 - - - - - - - 2213.0 36 7 VPS4A;PFKFB3;VPS4B vacuolar protein sorting 4 homolog A (S. cerevisiae);6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3;vacuolar protein sorting 4 homolog B (S. cerevisiae) 183 24 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49531.[MT7]-LFIGGLSFETTDESLR.2b3_1.heavy 965.008 / 518.346 16778.0 45.67300033569336 34 8 10 6 10 1.161251166881765 51.02730769174971 0.03659820556640625 3 0.7948310448012433 2.676609400922105 16778.0 41.66995081967213 0.0 - - - - - - - 231.8 33 15 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 185 24 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49531.[MT7]-LFIGGLSFETTDESLR.2y4_1.heavy 965.008 / 504.278 7321.0 45.67300033569336 34 8 10 6 10 1.161251166881765 51.02730769174971 0.03659820556640625 3 0.7948310448012433 2.676609400922105 7321.0 32.60445355191257 0.0 - - - - - - - 226.05882352941177 14 17 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 187 24 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49531.[MT7]-LFIGGLSFETTDESLR.2y10_1.heavy 965.008 / 1184.54 8603.0 45.67300033569336 34 8 10 6 10 1.161251166881765 51.02730769174971 0.03659820556640625 3 0.7948310448012433 2.676609400922105 8603.0 25.056825136612023 0.0 - - - - - - - 260.94444444444446 17 18 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 189 24 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49531.[MT7]-LFIGGLSFETTDESLR.2b5_1.heavy 965.008 / 632.389 7382.0 45.67300033569336 34 8 10 6 10 1.161251166881765 51.02730769174971 0.03659820556640625 3 0.7948310448012433 2.676609400922105 7382.0 35.90153005464481 0.0 - - - - - - - 269.6842105263158 14 19 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 191 25 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47832.[MT7]-DEIAGAR.2b3_1.heavy 438.239 / 502.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 193 25 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47832.[MT7]-DEIAGAR.2y5_1.heavy 438.239 / 487.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 195 25 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47832.[MT7]-DEIAGAR.2y6_1.heavy 438.239 / 616.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 197 25 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47832.[MT7]-DEIAGAR.2b5_1.heavy 438.239 / 630.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 199 26 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536790.[MT7]-K[MT7]VTSVVFHPSQDLVFSASPDATIR.4b7_1.heavy 723.148 / 1049.66 7274.0 36.93980026245117 42 12 10 10 10 1.877903457542753 53.25087378605211 0.0 3 0.8898584803603771 3.6839833376762035 7274.0 13.623640661938534 1.0 - - - - - - - 310.0 21 9 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 201 26 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536790.[MT7]-K[MT7]VTSVVFHPSQDLVFSASPDATIR.4b12_2.heavy 723.148 / 807.448 35186.0 36.93980026245117 42 12 10 10 10 1.877903457542753 53.25087378605211 0.0 3 0.8898584803603771 3.6839833376762035 35186.0 47.169232663733354 0.0 - - - - - - - 676.5714285714286 70 7 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 203 26 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536790.[MT7]-K[MT7]VTSVVFHPSQDLVFSASPDATIR.4y6_1.heavy 723.148 / 672.367 38739.0 36.93980026245117 42 12 10 10 10 1.877903457542753 53.25087378605211 0.0 3 0.8898584803603771 3.6839833376762035 38739.0 43.1562106416013 0.0 - - - - - - - 317.0 77 4 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 205 26 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536790.[MT7]-K[MT7]VTSVVFHPSQDLVFSASPDATIR.4b6_1.heavy 723.148 / 902.591 7105.0 36.93980026245117 42 12 10 10 10 1.877903457542753 53.25087378605211 0.0 3 0.8898584803603771 3.6839833376762035 7105.0 16.011721040567195 0.0 - - - - - - - 319.55555555555554 14 9 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 207 27 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48405.[MT7]-HTTDVIYAAK[MT7].3b6_1.heavy 469.601 / 811.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 209 27 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48405.[MT7]-HTTDVIYAAK[MT7].3b4_1.heavy 469.601 / 599.291 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 211 27 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48405.[MT7]-HTTDVIYAAK[MT7].3b5_1.heavy 469.601 / 698.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 213 27 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48405.[MT7]-HTTDVIYAAK[MT7].3y4_1.heavy 469.601 / 596.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 215 28 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48597.[MT7]-LGTLQPALVLAQVPGR.2y12_1.heavy 889.044 / 1248.74 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 217 28 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48597.[MT7]-LGTLQPALVLAQVPGR.2b4_1.heavy 889.044 / 529.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 219 28 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48597.[MT7]-LGTLQPALVLAQVPGR.2b5_1.heavy 889.044 / 657.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 221 28 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48597.[MT7]-LGTLQPALVLAQVPGR.2y11_1.heavy 889.044 / 1120.68 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 223 29 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48402.[MT7]-DELTASLEEVR.2y8_1.heavy 703.368 / 904.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 225 29 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48402.[MT7]-DELTASLEEVR.2y6_1.heavy 703.368 / 732.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 227 29 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48402.[MT7]-DELTASLEEVR.2y10_1.heavy 703.368 / 1146.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 229 29 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48402.[MT7]-DELTASLEEVR.2y7_1.heavy 703.368 / 803.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 231 30 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47838.[MT7]-SDLQK[MT7].2b3_1.heavy 439.763 / 460.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3;PRIM1 catenin (cadherin-associated protein), alpha 3;primase, DNA, polypeptide 1 (49kDa) 233 30 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47838.[MT7]-SDLQK[MT7].2y4_1.heavy 439.763 / 647.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3;PRIM1 catenin (cadherin-associated protein), alpha 3;primase, DNA, polypeptide 1 (49kDa) 235 30 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47838.[MT7]-SDLQK[MT7].2b4_1.heavy 439.763 / 588.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3;PRIM1 catenin (cadherin-associated protein), alpha 3;primase, DNA, polypeptide 1 (49kDa) 237 30 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47838.[MT7]-SDLQK[MT7].2y3_1.heavy 439.763 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3;PRIM1 catenin (cadherin-associated protein), alpha 3;primase, DNA, polypeptide 1 (49kDa) 239 31 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48305.[MT7]-GGGFGGNDNFGR.2y8_1.heavy 649.803 / 836.365 662.0 31.446375370025635 30 10 10 6 4 0.796319811052445 81.24362445918217 0.03610038757324219 7 0.8464158087593291 3.1079013821686083 662.0 1.2592391304347825 11.0 - - - - - - - 0.0 1 0 HNRNPA1 heterogeneous nuclear ribonucleoprotein A1 241 31 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48305.[MT7]-GGGFGGNDNFGR.2y10_1.heavy 649.803 / 1040.45 2206.0 31.446375370025635 30 10 10 6 4 0.796319811052445 81.24362445918217 0.03610038757324219 7 0.8464158087593291 3.1079013821686083 2206.0 2.876530612244898 1.0 - - - - - - - 290.22222222222223 4 18 HNRNPA1 heterogeneous nuclear ribonucleoprotein A1 243 31 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48305.[MT7]-GGGFGGNDNFGR.2b7_1.heavy 649.803 / 691.328 662.0 31.446375370025635 30 10 10 6 4 0.796319811052445 81.24362445918217 0.03610038757324219 7 0.8464158087593291 3.1079013821686083 662.0 1.0507936507936506 29.0 - - - - - - - 264.85 3 20 HNRNPA1 heterogeneous nuclear ribonucleoprotein A1 245 31 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48305.[MT7]-GGGFGGNDNFGR.2b5_1.heavy 649.803 / 520.264 3455.0 31.446375370025635 30 10 10 6 4 0.796319811052445 81.24362445918217 0.03610038757324219 7 0.8464158087593291 3.1079013821686083 3455.0 5.965387107223842 0.0 - - - - - - - 716.9166666666666 6 12 HNRNPA1 heterogeneous nuclear ribonucleoprotein A1 247 32 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 1404170.0 30.805099487304688 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1404170.0 366.9004376763507 0.0 - - - - - - - 294.0 2808 2 249 32 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 444425.0 30.805099487304688 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 444425.0 153.46538295028404 0.0 - - - - - - - 1229.875 888 8 251 32 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 468361.0 30.805099487304688 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 468361.0 410.0865754518705 0.0 - - - - - - - 1725.5 936 8 253 33 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534892.[MT7]-LASFYER.2y4_1.heavy 515.278 / 614.293 8202.0 32.38210105895996 46 20 10 6 10 11.47048238493334 8.718029167749002 0.031200408935546875 3 0.997254340570285 23.547218714368093 8202.0 9.794648680860284 0.0 - - - - - - - 1208.6666666666667 16 12 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 255 33 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534892.[MT7]-LASFYER.2y5_1.heavy 515.278 / 701.325 18075.0 32.38210105895996 46 20 10 6 10 11.47048238493334 8.718029167749002 0.031200408935546875 3 0.997254340570285 23.547218714368093 18075.0 21.912374294851816 0.0 - - - - - - - 793.1111111111111 36 9 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 257 33 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534892.[MT7]-LASFYER.2b4_1.heavy 515.278 / 563.331 12075.0 32.38210105895996 46 20 10 6 10 11.47048238493334 8.718029167749002 0.031200408935546875 3 0.997254340570285 23.547218714368093 12075.0 11.652345440741346 0.0 - - - - - - - 1246.6666666666667 24 12 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 259 33 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534892.[MT7]-LASFYER.2y6_1.heavy 515.278 / 772.362 53922.0 32.38210105895996 46 20 10 6 10 11.47048238493334 8.718029167749002 0.031200408935546875 3 0.997254340570285 23.547218714368093 53922.0 74.46142121474516 0.0 - - - - - - - 753.9285714285714 107 14 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 261 34 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535849.[MT7]-IEVIEIMTDR.2y8_1.heavy 681.875 / 976.513 20971.0 42.89924907684326 46 20 10 6 10 5.065724721304819 19.740512069167906 0.037799835205078125 3 0.9940779436545375 16.029188742948822 20971.0 30.35018674136321 0.0 - - - - - - - 226.8 41 15 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 263 34 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535849.[MT7]-IEVIEIMTDR.2y9_1.heavy 681.875 / 1105.56 34510.0 42.89924907684326 46 20 10 6 10 5.065724721304819 19.740512069167906 0.037799835205078125 3 0.9940779436545375 16.029188742948822 34510.0 115.03333333333332 0.0 - - - - - - - 665.0 69 9 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 265 34 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535849.[MT7]-IEVIEIMTDR.2y6_1.heavy 681.875 / 764.361 14610.0 42.89924907684326 46 20 10 6 10 5.065724721304819 19.740512069167906 0.037799835205078125 3 0.9940779436545375 16.029188742948822 14610.0 40.553601953601955 0.0 - - - - - - - 679.0 29 9 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 267 34 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535849.[MT7]-IEVIEIMTDR.2y7_1.heavy 681.875 / 877.445 17003.0 42.89924907684326 46 20 10 6 10 5.065724721304819 19.740512069167906 0.037799835205078125 3 0.9940779436545375 16.029188742948822 17003.0 48.71494444444444 0.0 - - - - - - - 576.0 34 7 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 269 35 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48407.[MT7]-DWAGGFLDLK[MT7].2b8_1.heavy 705.387 / 1006.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 271 35 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48407.[MT7]-DWAGGFLDLK[MT7].2b3_1.heavy 705.387 / 517.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 273 35 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48407.[MT7]-DWAGGFLDLK[MT7].2b5_1.heavy 705.387 / 631.296 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 275 35 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48407.[MT7]-DWAGGFLDLK[MT7].2y7_1.heavy 705.387 / 893.521 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 277 36 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48085.[MT7]-GFWETYR.2b3_1.heavy 551.776 / 535.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 279 36 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48085.[MT7]-GFWETYR.2y5_1.heavy 551.776 / 754.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 281 36 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48085.[MT7]-GFWETYR.2b4_1.heavy 551.776 / 664.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 283 36 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48085.[MT7]-GFWETYR.2y6_1.heavy 551.776 / 901.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 285 37 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48304.[MT7]-ALEDSSFLK[MT7].2y5_1.heavy 649.366 / 725.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO7 LIM domain 7 287 37 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48304.[MT7]-ALEDSSFLK[MT7].2b4_1.heavy 649.366 / 573.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO7 LIM domain 7 289 37 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48304.[MT7]-ALEDSSFLK[MT7].2y6_1.heavy 649.366 / 840.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO7 LIM domain 7 291 37 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48304.[MT7]-ALEDSSFLK[MT7].2y7_1.heavy 649.366 / 969.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO7 LIM domain 7 293 38 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49433.[MT7]-FASK[MT7]PASEFVK[MT7].3y7_1.heavy 548.322 / 921.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 295 38 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49433.[MT7]-FASK[MT7]PASEFVK[MT7].3y3_1.heavy 548.322 / 537.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 297 38 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49433.[MT7]-FASK[MT7]PASEFVK[MT7].3b10_2.heavy 548.322 / 676.876 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 299 38 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49433.[MT7]-FASK[MT7]PASEFVK[MT7].3y5_1.heavy 548.322 / 753.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 301 39 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534896.[MT7]-ITWSIIR.2b3_1.heavy 516.82 / 545.32 2864.0 40.22320079803467 42 20 10 6 6 24.174678852054942 4.13655960486522 0.031597137451171875 5 0.9987745066553195 35.25027660308612 2864.0 2.3262665245626 1.0 - - - - - - - 672.2857142857143 5 14 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 303 39 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534896.[MT7]-ITWSIIR.2y5_1.heavy 516.82 / 674.398 12479.0 40.22320079803467 42 20 10 6 6 24.174678852054942 4.13655960486522 0.031597137451171875 5 0.9987745066553195 35.25027660308612 12479.0 33.434153324394664 1.0 - - - - - - - 282.7142857142857 47 14 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 305 39 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534896.[MT7]-ITWSIIR.2b4_1.heavy 516.82 / 632.352 6546.0 40.22320079803467 42 20 10 6 6 24.174678852054942 4.13655960486522 0.031597137451171875 5 0.9987745066553195 35.25027660308612 6546.0 19.764254088050315 1.0 - - - - - - - 720.8571428571429 33 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 307 39 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534896.[MT7]-ITWSIIR.2y6_1.heavy 516.82 / 775.446 53599.0 40.22320079803467 42 20 10 6 6 24.174678852054942 4.13655960486522 0.031597137451171875 5 0.9987745066553195 35.25027660308612 53599.0 162.84672 0.0 - - - - - - - 224.64705882352942 107 17 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 309 40 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534549.[MT7]-TQPEGLR.2y5_1.heavy 472.768 / 571.32 19786.0 19.692399978637695 45 20 10 5 10 20.438729324928715 4.892672064404315 0.04119873046875 3 0.9985568429692395 32.48279053509524 19786.0 54.89325112087296 0.0 - - - - - - - 647.8571428571429 39 7 LIMK1 LIM domain kinase 1 311 40 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534549.[MT7]-TQPEGLR.2b4_1.heavy 472.768 / 600.311 4004.0 19.692399978637695 45 20 10 5 10 20.438729324928715 4.892672064404315 0.04119873046875 3 0.9985568429692395 32.48279053509524 4004.0 6.616804440976388 3.0 - - - - - - - 316.375 21 8 LIMK1 LIM domain kinase 1 313 40 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534549.[MT7]-TQPEGLR.2y6_1.heavy 472.768 / 699.378 10482.0 19.692399978637695 45 20 10 5 10 20.438729324928715 4.892672064404315 0.04119873046875 3 0.9985568429692395 32.48279053509524 10482.0 47.5591067961165 0.0 - - - - - - - 265.0 20 10 LIMK1 LIM domain kinase 1 315 40 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534549.[MT7]-TQPEGLR.2b5_1.heavy 472.768 / 657.332 4358.0 19.692399978637695 45 20 10 5 10 20.438729324928715 4.892672064404315 0.04119873046875 3 0.9985568429692395 32.48279053509524 4358.0 11.89729926183799 0.0 - - - - - - - 294.4166666666667 8 12 LIMK1 LIM domain kinase 1 317 41 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48049.[MT7]-LRLQQLR.2b3_1.heavy 535.849 / 527.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - FBXO33;NDUFB6 F-box protein 33;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 319 41 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48049.[MT7]-LRLQQLR.2y5_1.heavy 535.849 / 657.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - FBXO33;NDUFB6 F-box protein 33;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 321 41 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48049.[MT7]-LRLQQLR.2b4_1.heavy 535.849 / 655.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - FBXO33;NDUFB6 F-box protein 33;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 323 41 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48049.[MT7]-LRLQQLR.2b5_1.heavy 535.849 / 783.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - FBXO33;NDUFB6 F-box protein 33;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 325 42 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 1020720.0 16.840200424194336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1020720.0 3301.3701053296704 0.0 - - - - - - - 253.66666666666666 2041 3 327 42 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 1599100.0 16.840200424194336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1599100.0 5119.19481741379 0.0 - - - - - - - 470.5 3198 2 329 42 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 812278.0 16.840200424194336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 812278.0 928.6789646760593 0.0 - - - - - - - 722.5 1624 8 331 43 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48832.[MT7]-EQLSK[MT7].2b3_1.heavy 446.771 / 515.295 9147.0 18.913799285888672 44 14 10 10 10 1.6605906218607547 40.4983589638794 0.0 3 0.9455345446006799 5.263936552206131 9147.0 10.216141978604433 0.0 - - - - - - - 1223.2727272727273 18 11 DNAH10;RWDD4;FAM151A;HAO2;PRKG2;AXIN2 dynein, axonemal, heavy chain 10;RWD domain containing 4;family with sequence similarity 151, member A;hydroxyacid oxidase 2 (long chain);protein kinase, cGMP-dependent, type II;axin 2 333 43 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48832.[MT7]-EQLSK[MT7].2y4_1.heavy 446.771 / 619.39 21906.0 18.913799285888672 44 14 10 10 10 1.6605906218607547 40.4983589638794 0.0 3 0.9455345446006799 5.263936552206131 21906.0 15.629571371464968 0.0 - - - - - - - 1240.0 43 7 DNAH10;RWDD4;FAM151A;HAO2;PRKG2;AXIN2 dynein, axonemal, heavy chain 10;RWD domain containing 4;family with sequence similarity 151, member A;hydroxyacid oxidase 2 (long chain);protein kinase, cGMP-dependent, type II;axin 2 335 43 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48832.[MT7]-EQLSK[MT7].2b4_1.heavy 446.771 / 602.327 18235.0 18.913799285888672 44 14 10 10 10 1.6605906218607547 40.4983589638794 0.0 3 0.9455345446006799 5.263936552206131 18235.0 27.572945693714452 0.0 - - - - - - - 1211.7 36 10 DNAH10;RWDD4;FAM151A;HAO2;PRKG2;AXIN2 dynein, axonemal, heavy chain 10;RWD domain containing 4;family with sequence similarity 151, member A;hydroxyacid oxidase 2 (long chain);protein kinase, cGMP-dependent, type II;axin 2 337 43 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48832.[MT7]-EQLSK[MT7].2y3_1.heavy 446.771 / 491.331 16895.0 18.913799285888672 44 14 10 10 10 1.6605906218607547 40.4983589638794 0.0 3 0.9455345446006799 5.263936552206131 16895.0 36.41840170278638 1.0 - - - - - - - 703.6923076923077 33 13 DNAH10;RWDD4;FAM151A;HAO2;PRKG2;AXIN2 dynein, axonemal, heavy chain 10;RWD domain containing 4;family with sequence similarity 151, member A;hydroxyacid oxidase 2 (long chain);protein kinase, cGMP-dependent, type II;axin 2 339 44 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534443.[MT7]-VTLEK[MT7].2b3_1.heavy 439.283 / 458.31 5716.0 24.956499099731445 44 20 10 6 8 5.298543308184013 18.873111756120256 0.03639984130859375 4 0.9910950273936515 13.06842550908494 5716.0 4.705796307802479 5.0 - - - - - - - 874.0 147 1 MAPKBP1;GLB1;USP10 mitogen-activated protein kinase binding protein 1;galactosidase, beta 1;ubiquitin specific peptidase 10 341 44 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534443.[MT7]-VTLEK[MT7].2y4_1.heavy 439.283 / 634.389 71546.0 24.956499099731445 44 20 10 6 8 5.298543308184013 18.873111756120256 0.03639984130859375 4 0.9910950273936515 13.06842550908494 71546.0 82.1571798044172 0.0 - - - - - - - 806.7 143 10 MAPKBP1;GLB1;USP10 mitogen-activated protein kinase binding protein 1;galactosidase, beta 1;ubiquitin specific peptidase 10 343 44 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534443.[MT7]-VTLEK[MT7].2b4_1.heavy 439.283 / 587.352 9078.0 24.956499099731445 44 20 10 6 8 5.298543308184013 18.873111756120256 0.03639984130859375 4 0.9910950273936515 13.06842550908494 9078.0 7.784267372908373 1.0 - - - - - - - 1235.625 56 8 MAPKBP1;GLB1;USP10 mitogen-activated protein kinase binding protein 1;galactosidase, beta 1;ubiquitin specific peptidase 10 345 44 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534443.[MT7]-VTLEK[MT7].2y3_1.heavy 439.283 / 533.341 16542.0 24.956499099731445 44 20 10 6 8 5.298543308184013 18.873111756120256 0.03639984130859375 4 0.9910950273936515 13.06842550908494 16542.0 16.606677822959025 0.0 - - - - - - - 1688.6666666666667 33 9 MAPKBP1;GLB1;USP10 mitogen-activated protein kinase binding protein 1;galactosidase, beta 1;ubiquitin specific peptidase 10 347 45 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49268.[MT7]-SRPVINIQK[MT7].3y3_1.heavy 448.285 / 532.357 20228.0 25.900299072265625 38 12 6 10 10 1.304941207486331 53.26762455659459 0.0 3 0.895001473268514 3.774812650930584 20228.0 22.832990863054555 0.0 - - - - - - - 787.3333333333334 40 9 ITGA6 integrin, alpha 6 349 45 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49268.[MT7]-SRPVINIQK[MT7].3b6_1.heavy 448.285 / 811.491 19047.0 25.900299072265625 38 12 6 10 10 1.304941207486331 53.26762455659459 0.0 3 0.895001473268514 3.774812650930584 19047.0 98.89792385507135 0.0 - - - - - - - 226.4 38 15 ITGA6 integrin, alpha 6 351 45 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49268.[MT7]-SRPVINIQK[MT7].3b4_1.heavy 448.285 / 584.364 14913.0 25.900299072265625 38 12 6 10 10 1.304941207486331 53.26762455659459 0.0 3 0.895001473268514 3.774812650930584 14913.0 27.694300058935383 0.0 - - - - - - - 698.5384615384615 29 13 ITGA6 integrin, alpha 6 353 45 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49268.[MT7]-SRPVINIQK[MT7].3y8_2.heavy 448.285 / 556.357 9893.0 25.900299072265625 38 12 6 10 10 1.304941207486331 53.26762455659459 0.0 3 0.895001473268514 3.774812650930584 9893.0 2.1236460330353277 2.0 - - - - - - - 1199.75 63 12 ITGA6 integrin, alpha 6 355 46 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534449.[MT7]-SSPSSK[MT7].2y4_1.heavy 440.753 / 562.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 357 46 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534449.[MT7]-SSPSSK[MT7].2y5_1.heavy 440.753 / 649.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 359 46 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534449.[MT7]-SSPSSK[MT7].2b4_1.heavy 440.753 / 503.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 361 46 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534449.[MT7]-SSPSSK[MT7].2y3_1.heavy 440.753 / 465.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 363 47 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48199.[MT7]-TMDFGLNVR.2y8_1.heavy 598.814 / 951.472 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 365 47 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48199.[MT7]-TMDFGLNVR.2y5_1.heavy 598.814 / 558.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 367 47 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48199.[MT7]-TMDFGLNVR.2y6_1.heavy 598.814 / 705.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 369 47 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48199.[MT7]-TMDFGLNVR.2b5_1.heavy 598.814 / 696.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 371 48 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47863.[MT7]-NIIQK[MT7].2b3_1.heavy 452.297 / 485.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLB1;JARID2 galactosidase, beta 1;jumonji, AT rich interactive domain 2 373 48 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47863.[MT7]-NIIQK[MT7].2y4_1.heavy 452.297 / 645.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLB1;JARID2 galactosidase, beta 1;jumonji, AT rich interactive domain 2 375 48 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47863.[MT7]-NIIQK[MT7].2y3_1.heavy 452.297 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLB1;JARID2 galactosidase, beta 1;jumonji, AT rich interactive domain 2 377 49 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535120.[MT7]-FIASTGMDR.2y8_1.heavy 571.293 / 850.409 23529.0 29.768800735473633 50 20 10 10 10 17.29912143388925 5.780640385823203 0.0 3 0.9986573306856157 33.67667712797567 23529.0 79.69452346869586 0.0 - - - - - - - 725.5714285714286 47 7 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 379 49 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535120.[MT7]-FIASTGMDR.2y5_1.heavy 571.293 / 579.255 4258.0 29.768800735473633 50 20 10 10 10 17.29912143388925 5.780640385823203 0.0 3 0.9986573306856157 33.67667712797567 4258.0 5.4103586320426205 0.0 - - - - - - - 717.2 8 15 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 381 49 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535120.[MT7]-FIASTGMDR.2y6_1.heavy 571.293 / 666.288 12026.0 29.768800735473633 50 20 10 10 10 17.29912143388925 5.780640385823203 0.0 3 0.9986573306856157 33.67667712797567 12026.0 22.90475893397941 0.0 - - - - - - - 672.4444444444445 24 9 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 383 49 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535120.[MT7]-FIASTGMDR.2y7_1.heavy 571.293 / 737.325 21213.0 29.768800735473633 50 20 10 10 10 17.29912143388925 5.780640385823203 0.0 3 0.9986573306856157 33.67667712797567 21213.0 23.85928208565281 0.0 - - - - - - - 706.3636363636364 42 11 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 385 50 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48056.[MT7]-RQQDLK[MT7].2b3_1.heavy 538.327 / 557.328 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 387 50 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48056.[MT7]-RQQDLK[MT7].2y5_1.heavy 538.327 / 775.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 389 50 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48056.[MT7]-RQQDLK[MT7].2b4_1.heavy 538.327 / 672.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 391 50 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48056.[MT7]-RQQDLK[MT7].2y3_1.heavy 538.327 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 393 51 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47867.[MT7]-VSSINSR.2y5_1.heavy 453.76 / 576.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOSC1 exosome component 1 395 51 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47867.[MT7]-VSSINSR.2b4_1.heavy 453.76 / 531.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOSC1 exosome component 1 397 51 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47867.[MT7]-VSSINSR.2y6_1.heavy 453.76 / 663.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOSC1 exosome component 1 399 51 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47867.[MT7]-VSSINSR.2b5_1.heavy 453.76 / 645.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOSC1 exosome component 1 401 52 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534544.[MT7]-FLENK[MT7].2y4_1.heavy 469.781 / 647.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 403 53 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536185.[MT7]-VFIGNLNTLVVK[MT7].3b6_1.heavy 535.671 / 788.479 17667.0 42.1070499420166 43 16 10 7 10 2.2277486554939774 38.31937508045101 0.02860260009765625 3 0.9603949813543733 6.180781383850142 17667.0 29.38385482512515 0.0 - - - - - - - 188.11764705882354 35 17 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 405 53 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536185.[MT7]-VFIGNLNTLVVK[MT7].3b4_1.heavy 535.671 / 561.352 21050.0 42.1070499420166 43 16 10 7 10 2.2277486554939774 38.31937508045101 0.02860260009765625 3 0.9603949813543733 6.180781383850142 21050.0 78.66331847041147 0.0 - - - - - - - 650.0 42 8 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 407 53 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536185.[MT7]-VFIGNLNTLVVK[MT7].3b5_1.heavy 535.671 / 675.395 41411.0 42.1070499420166 43 16 10 7 10 2.2277486554939774 38.31937508045101 0.02860260009765625 3 0.9603949813543733 6.180781383850142 41411.0 120.23140514184396 0.0 - - - - - - - 626.5 82 8 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 409 53 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536185.[MT7]-VFIGNLNTLVVK[MT7].3y4_1.heavy 535.671 / 602.436 22867.0 42.1070499420166 43 16 10 7 10 2.2277486554939774 38.31937508045101 0.02860260009765625 3 0.9603949813543733 6.180781383850142 22867.0 43.00594604863222 0.0 - - - - - - - 698.0 45 7 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 411 54 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48439.[MT7]-LPANHPLLTGQR.3y7_1.heavy 487.62 / 784.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 413 54 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48439.[MT7]-LPANHPLLTGQR.3y6_1.heavy 487.62 / 687.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 415 54 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48439.[MT7]-LPANHPLLTGQR.3b4_1.heavy 487.62 / 540.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 417 54 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48439.[MT7]-LPANHPLLTGQR.3y5_1.heavy 487.62 / 574.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 419 55 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535207.[MT7]-LAQLEEAK[MT7].2y4_1.heavy 595.355 / 620.337 25211.0 29.345500946044922 50 20 10 10 10 8.801046428260229 11.362285248138132 0.0 3 0.995028955572184 17.49679386040737 25211.0 73.7121619047619 0.0 - - - - - - - 739.2857142857143 50 7 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 421 55 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535207.[MT7]-LAQLEEAK[MT7].2y5_1.heavy 595.355 / 733.421 23786.0 29.345500946044922 50 20 10 10 10 8.801046428260229 11.362285248138132 0.0 3 0.995028955572184 17.49679386040737 23786.0 28.65064740306701 0.0 - - - - - - - 735.0 47 10 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 423 55 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535207.[MT7]-LAQLEEAK[MT7].2b5_1.heavy 595.355 / 699.416 12531.0 29.345500946044922 50 20 10 10 10 8.801046428260229 11.362285248138132 0.0 3 0.995028955572184 17.49679386040737 12531.0 26.971485714285713 0.0 - - - - - - - 742.5 25 10 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 425 55 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535207.[MT7]-LAQLEEAK[MT7].2y7_1.heavy 595.355 / 932.517 33840.0 29.345500946044922 50 20 10 10 10 8.801046428260229 11.362285248138132 0.0 3 0.995028955572184 17.49679386040737 33840.0 89.9392 0.0 - - - - - - - 691.6666666666666 67 9 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 427 56 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49561.[MT7]-NVPLDEIDLLIQETSR.2y8_1.heavy 1000.05 / 959.552 3878.0 50.172499656677246 39 16 10 3 10 3.1596065796505552 25.28793076062923 0.07600021362304688 3 0.9641638404201632 6.499741412138422 3878.0 6.534641220043572 0.0 - - - - - - - 180.46153846153845 7 13 LIMK1 LIM domain kinase 1 429 56 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49561.[MT7]-NVPLDEIDLLIQETSR.2y9_1.heavy 1000.05 / 1074.58 3980.0 50.172499656677246 39 16 10 3 10 3.1596065796505552 25.28793076062923 0.07600021362304688 3 0.9641638404201632 6.499741412138422 3980.0 21.636605204262285 0.0 - - - - - - - 156.4 7 15 LIMK1 LIM domain kinase 1 431 56 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49561.[MT7]-NVPLDEIDLLIQETSR.2b5_1.heavy 1000.05 / 683.385 5715.0 50.172499656677246 39 16 10 3 10 3.1596065796505552 25.28793076062923 0.07600021362304688 3 0.9641638404201632 6.499741412138422 5715.0 89.46029411764705 0.0 - - - - - - - 180.8181818181818 11 11 LIMK1 LIM domain kinase 1 433 56 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49561.[MT7]-NVPLDEIDLLIQETSR.2y7_1.heavy 1000.05 / 846.468 1990.0 50.172499656677246 39 16 10 3 10 3.1596065796505552 25.28793076062923 0.07600021362304688 3 0.9641638404201632 6.499741412138422 1990.0 1.7342047930283226 0.0 - - - - - - - 189.42857142857142 3 14 LIMK1 LIM domain kinase 1 435 57 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48825.[MT7]-IDPEK[MT7].2y4_1.heavy 445.265 / 632.337 25931.0 21.20319938659668 50 20 10 10 10 22.66588236725561 4.411917364596648 0.0 3 0.9970367731585829 22.665881778461635 25931.0 37.862958434709654 1.0 - - - - - - - 1732.4545454545455 53 11 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 437 57 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48825.[MT7]-IDPEK[MT7].2y3_1.heavy 445.265 / 517.31 134056.0 21.20319938659668 50 20 10 10 10 22.66588236725561 4.411917364596648 0.0 3 0.9970367731585829 22.665881778461635 134056.0 127.96593391455431 0.0 - - - - - - - 452.0 268 2 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 439 58 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49261.[MT7]-DEITFVSGAPR.2b3_1.heavy 668.355 / 502.263 5674.0 32.539350509643555 37 13 10 6 8 1.6639613947404441 47.391955341708545 0.031902313232421875 4 0.9090229237009055 4.060200450420272 5674.0 3.0758708189158015 1.0 - - - - - - - 694.9090909090909 11 11 ITGA6 integrin, alpha 6 441 58 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49261.[MT7]-DEITFVSGAPR.2y8_1.heavy 668.355 / 834.447 7013.0 32.539350509643555 37 13 10 6 8 1.6639613947404441 47.391955341708545 0.031902313232421875 4 0.9090229237009055 4.060200450420272 7013.0 16.439552373892354 0.0 - - - - - - - 267.6 14 5 ITGA6 integrin, alpha 6 443 58 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49261.[MT7]-DEITFVSGAPR.2y9_1.heavy 668.355 / 947.531 2837.0 32.539350509643555 37 13 10 6 8 1.6639613947404441 47.391955341708545 0.031902313232421875 4 0.9090229237009055 4.060200450420272 2837.0 7.504528679106535 0.0 - - - - - - - 275.9166666666667 5 12 ITGA6 integrin, alpha 6 445 58 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49261.[MT7]-DEITFVSGAPR.2y10_1.heavy 668.355 / 1076.57 4098.0 32.539350509643555 37 13 10 6 8 1.6639613947404441 47.391955341708545 0.031902313232421875 4 0.9090229237009055 4.060200450420272 4098.0 7.272278793870489 1.0 - - - - - - - 292.7142857142857 13 7 ITGA6 integrin, alpha 6 447 59 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49562.[MT7]-NVPLDEIDLLIQETSR.3b6_1.heavy 667.032 / 812.427 43699.0 50.17250061035156 44 14 10 10 10 1.3683354420700677 50.33179437484115 0.0 3 0.9367799204109337 4.88224814381005 43699.0 337.14183081415865 0.0 - - - - - - - 110.5 87 6 LIMK1 LIM domain kinase 1 449 59 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49562.[MT7]-NVPLDEIDLLIQETSR.3y6_1.heavy 667.032 / 733.384 79911.0 50.17250061035156 44 14 10 10 10 1.3683354420700677 50.33179437484115 0.0 3 0.9367799204109337 4.88224814381005 79911.0 -19.58602941176474 0.0 - - - - - - - 210.25 159 8 LIMK1 LIM domain kinase 1 451 59 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49562.[MT7]-NVPLDEIDLLIQETSR.3b5_1.heavy 667.032 / 683.385 48690.0 50.17250061035156 44 14 10 10 10 1.3683354420700677 50.33179437484115 0.0 3 0.9367799204109337 4.88224814381005 48690.0 115.47292207880119 0.0 - - - - - - - 216.625 97 8 LIMK1 LIM domain kinase 1 453 59 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49562.[MT7]-NVPLDEIDLLIQETSR.3b8_1.heavy 667.032 / 1040.54 71151.0 50.17250061035156 44 14 10 10 10 1.3683354420700677 50.33179437484115 0.0 3 0.9367799204109337 4.88224814381005 71151.0 489.9599021599161 0.0 - - - - - - - 210.25 142 8 LIMK1 LIM domain kinase 1 455 60 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535925.[MT7]-EHMGDILYK[MT7].3b6_1.heavy 465.251 / 827.384 6488.0 29.685174465179443 43 17 10 6 10 5.190084680030209 19.267508367400655 0.03849983215332031 3 0.978535515136481 8.408571742364671 6488.0 30.370218615614373 0.0 - - - - - - - 262.89473684210526 12 19 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 457 60 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535925.[MT7]-EHMGDILYK[MT7].3y3_1.heavy 465.251 / 567.362 26923.0 29.685174465179443 43 17 10 6 10 5.190084680030209 19.267508367400655 0.03849983215332031 3 0.978535515136481 8.408571742364671 26923.0 21.627799489144316 0.0 - - - - - - - 1704.7142857142858 53 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 459 60 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535925.[MT7]-EHMGDILYK[MT7].3b4_1.heavy 465.251 / 599.273 2909.0 29.685174465179443 43 17 10 6 10 5.190084680030209 19.267508367400655 0.03849983215332031 3 0.978535515136481 8.408571742364671 2909.0 3.4563419205770822 3.0 - - - - - - - 1294.909090909091 9 11 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 461 60 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535925.[MT7]-EHMGDILYK[MT7].3b5_1.heavy 465.251 / 714.3 36768.0 29.685174465179443 43 17 10 6 10 5.190084680030209 19.267508367400655 0.03849983215332031 3 0.978535515136481 8.408571742364671 36768.0 64.07292225201073 0.0 - - - - - - - 720.9333333333333 73 15 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 463 61 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 1555030.0 19.59079933166504 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1555030.0 13094.5015220883 0.0 - - - - - - - 796.2857142857143 3110 7 465 61 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 864661.0 19.59079933166504 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 864661.0 7500.607140421905 0.0 - - - - - - - 283.6666666666667 1729 6 467 61 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 947732.0 19.59079933166504 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 947732.0 15653.76481773142 0.0 - - - - - - - 645.2857142857143 1895 7 469 62 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49557.[MT7]-GFAFVTFDDHDSVDK[MT7].3b6_1.heavy 663.326 / 767.421 1687.0 38.19425010681152 40 14 10 6 10 1.2787549542022625 46.54730684893497 0.038303375244140625 3 0.9487627897975679 5.428722306843891 1687.0 0.9997037037037038 2.0 - - - - - - - 695.875 3 8 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 471 62 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49557.[MT7]-GFAFVTFDDHDSVDK[MT7].3b4_1.heavy 663.326 / 567.305 7085.0 38.19425010681152 40 14 10 6 10 1.2787549542022625 46.54730684893497 0.038303375244140625 3 0.9487627897975679 5.428722306843891 7085.0 7.887779973649538 0.0 - - - - - - - 674.875 14 8 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 473 62 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49557.[MT7]-GFAFVTFDDHDSVDK[MT7].3y4_1.heavy 663.326 / 592.342 7085.0 38.19425010681152 40 14 10 6 10 1.2787549542022625 46.54730684893497 0.038303375244140625 3 0.9487627897975679 5.428722306843891 7085.0 6.687357377533492 1.0 - - - - - - - 295.5 14 4 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 475 62 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49557.[MT7]-GFAFVTFDDHDSVDK[MT7].3y5_1.heavy 663.326 / 707.369 7170.0 38.19425010681152 40 14 10 6 10 1.2787549542022625 46.54730684893497 0.038303375244140625 3 0.9487627897975679 5.428722306843891 7170.0 8.199838988172655 0.0 - - - - - - - 720.9090909090909 14 11 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 477 63 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49419.[MT7]-TLQLDNNFEVK[MT7].2b4_1.heavy 804.945 / 600.384 6711.0 35.061574935913086 42 16 10 6 10 2.917490263300612 27.299434206374247 0.03710174560546875 3 0.9607044197449954 6.205231726912892 6711.0 72.13685899119926 0.0 - - - - - - - 253.0 13 8 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 479 63 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49419.[MT7]-TLQLDNNFEVK[MT7].2y3_1.heavy 804.945 / 519.326 2482.0 35.061574935913086 42 16 10 6 10 2.917490263300612 27.299434206374247 0.03710174560546875 3 0.9607044197449954 6.205231726912892 2482.0 14.43542449259592 0.0 - - - - - - - 221.88235294117646 4 17 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 481 63 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49419.[MT7]-TLQLDNNFEVK[MT7].2b5_1.heavy 804.945 / 715.411 10572.0 35.061574935913086 42 16 10 6 10 2.917490263300612 27.299434206374247 0.03710174560546875 3 0.9607044197449954 6.205231726912892 10572.0 32.56316002837742 0.0 - - - - - - - 724.0 21 8 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 483 63 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49419.[MT7]-TLQLDNNFEVK[MT7].2y7_1.heavy 804.945 / 1009.51 8182.0 35.061574935913086 42 16 10 6 10 2.917490263300612 27.299434206374247 0.03710174560546875 3 0.9607044197449954 6.205231726912892 8182.0 27.798893705350807 0.0 - - - - - - - 735.4285714285714 16 7 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 485 64 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48575.[MT7]-EDSQRPGAHLTVK[MT7].4b8_1.heavy 432.243 / 985.482 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 487 64 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48575.[MT7]-EDSQRPGAHLTVK[MT7].4b8_2.heavy 432.243 / 493.245 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 489 64 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48575.[MT7]-EDSQRPGAHLTVK[MT7].4y3_2.heavy 432.243 / 246.169 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 491 64 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48575.[MT7]-EDSQRPGAHLTVK[MT7].4y3_1.heavy 432.243 / 491.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 493 65 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47956.[MT7]-QAVEMK[MT7].2y4_1.heavy 497.286 / 650.366 N/A 23.55959987640381 37 10 10 7 10 1.461503645239839 34.21134128734573 0.029798507690429688 2 0.8269692977465463 2.9230072907854434 605.0 0.6487407218539294 32.0 - - - - - - - 298.2962962962963 3 27 HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 495 65 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47956.[MT7]-QAVEMK[MT7].2y5_1.heavy 497.286 / 721.404 2844.0 23.55959987640381 37 10 10 7 10 1.461503645239839 34.21134128734573 0.029798507690429688 2 0.8269692977465463 2.9230072907854434 2844.0 5.64099173553719 0.0 - - - - - - - 714.1 5 10 HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 497 65 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47956.[MT7]-QAVEMK[MT7].2y3_1.heavy 497.286 / 551.298 N/A 23.55959987640381 37 10 10 7 10 1.461503645239839 34.21134128734573 0.029798507690429688 2 0.8269692977465463 2.9230072907854434 847.0 -0.07777777777777778 24.0 - - - - - - - 682.1818181818181 6 11 HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 499 65 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47956.[MT7]-QAVEMK[MT7].2b5_1.heavy 497.286 / 703.357 3691.0 23.55959987640381 37 10 10 7 10 1.461503645239839 34.21134128734573 0.029798507690429688 2 0.8269692977465463 2.9230072907854434 3691.0 1.3625358314909175 2.0 - - - - - - - 699.3333333333334 9 9 HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 501 66 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47854.[MT7]-MLLTK[MT7].2b3_1.heavy 447.29 / 502.318 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK4;GRK5;VPS13C G protein-coupled receptor kinase 4;G protein-coupled receptor kinase 5;vacuolar protein sorting 13 homolog C (S. cerevisiae) 503 66 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47854.[MT7]-MLLTK[MT7].2y4_1.heavy 447.29 / 618.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK4;GRK5;VPS13C G protein-coupled receptor kinase 4;G protein-coupled receptor kinase 5;vacuolar protein sorting 13 homolog C (S. cerevisiae) 505 66 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47854.[MT7]-MLLTK[MT7].2y3_1.heavy 447.29 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK4;GRK5;VPS13C G protein-coupled receptor kinase 4;G protein-coupled receptor kinase 5;vacuolar protein sorting 13 homolog C (S. cerevisiae) 507 67 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48578.[MT7]-EQEHMINWVEK[MT7].3y3_1.heavy 577.631 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 509 67 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48578.[MT7]-EQEHMINWVEK[MT7].3b4_1.heavy 577.631 / 668.312 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 511 67 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48578.[MT7]-EQEHMINWVEK[MT7].3y4_1.heavy 577.631 / 705.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 513 67 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48578.[MT7]-EQEHMINWVEK[MT7].3b3_1.heavy 577.631 / 531.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 515 68 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535825.[MT7]-LEHWLETLR.3y6_1.heavy 447.586 / 817.457 6709.0 40.892273902893066 44 18 10 6 10 6.143633825558184 16.27701175548405 0.030498504638671875 3 0.9869556596736418 10.793892433065245 6709.0 136.2765625 0.0 - - - - - - - 127.83333333333333 13 6 LIMK1 LIM domain kinase 1 517 68 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535825.[MT7]-LEHWLETLR.3b3_1.heavy 447.586 / 524.295 54499.0 40.892273902893066 44 18 10 6 10 6.143633825558184 16.27701175548405 0.030498504638671875 3 0.9869556596736418 10.793892433065245 54499.0 106.06424318000309 0.0 - - - - - - - 251.33333333333334 108 15 LIMK1 LIM domain kinase 1 519 68 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535825.[MT7]-LEHWLETLR.3y4_1.heavy 447.586 / 518.293 75391.0 40.892273902893066 44 18 10 6 10 6.143633825558184 16.27701175548405 0.030498504638671875 3 0.9869556596736418 10.793892433065245 75391.0 121.38690111353446 0.0 - - - - - - - 685.4545454545455 150 11 LIMK1 LIM domain kinase 1 521 68 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535825.[MT7]-LEHWLETLR.3y5_1.heavy 447.586 / 631.377 63443.0 40.892273902893066 44 18 10 6 10 6.143633825558184 16.27701175548405 0.030498504638671875 3 0.9869556596736418 10.793892433065245 63443.0 145.2259074997933 0.0 - - - - - - - 167.23076923076923 126 13 LIMK1 LIM domain kinase 1 523 69 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536192.[MT7]-TLQLDNNFEVK[MT7].3y3_1.heavy 536.966 / 519.326 N/A 35.05229949951172 48 18 10 10 10 4.897657577755149 20.41792395903578 0.0 3 0.9884104593359854 11.452727419554115 57073.0 4.558104085921899 0.0 - - - - - - - 1381.0 114 1 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 525 69 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536192.[MT7]-TLQLDNNFEVK[MT7].3b4_1.heavy 536.966 / 600.384 28997.0 35.05229949951172 48 18 10 10 10 4.897657577755149 20.41792395903578 0.0 3 0.9884104593359854 11.452727419554115 28997.0 14.53096002046952 0.0 - - - - - - - 460.0 57 1 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 527 69 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536192.[MT7]-TLQLDNNFEVK[MT7].3b5_1.heavy 536.966 / 715.411 33415.0 35.05229949951172 48 18 10 10 10 4.897657577755149 20.41792395903578 0.0 3 0.9884104593359854 11.452727419554115 33415.0 44.1502862666111 0.0 - - - - - - - 736.125 66 8 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 529 69 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536192.[MT7]-TLQLDNNFEVK[MT7].3y4_1.heavy 536.966 / 666.394 29641.0 35.05229949951172 48 18 10 10 10 4.897657577755149 20.41792395903578 0.0 3 0.9884104593359854 11.452727419554115 29641.0 44.49753526336373 0.0 - - - - - - - 294.4 59 5 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 531 70 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536196.[MT7]-QDLLAYLEQIK[MT7].3b6_1.heavy 541.318 / 848.463 2584.0 47.29242420196533 42 16 10 6 10 2.1237396310003014 39.81727889671474 0.034297943115234375 3 0.9601674235361359 6.1629825348277825 2584.0 42.07302325581395 0.0 - - - - - - - 97.4 5 10 CTNNA3 catenin (cadherin-associated protein), alpha 3 533 70 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536196.[MT7]-QDLLAYLEQIK[MT7].3b4_1.heavy 541.318 / 614.363 5283.0 47.29242420196533 42 16 10 6 10 2.1237396310003014 39.81727889671474 0.034297943115234375 3 0.9601674235361359 6.1629825348277825 5283.0 54.5144347826087 0.0 - - - - - - - 192.58823529411765 10 17 CTNNA3 catenin (cadherin-associated protein), alpha 3 535 70 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536196.[MT7]-QDLLAYLEQIK[MT7].3b5_1.heavy 541.318 / 685.4 9246.0 47.29242420196533 42 16 10 6 10 2.1237396310003014 39.81727889671474 0.034297943115234375 3 0.9601674235361359 6.1629825348277825 9246.0 124.49846511627908 0.0 - - - - - - - 130.0 18 15 CTNNA3 catenin (cadherin-associated protein), alpha 3 537 70 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536196.[MT7]-QDLLAYLEQIK[MT7].3b3_1.heavy 541.318 / 501.279 3790.0 47.29242420196533 42 16 10 6 10 2.1237396310003014 39.81727889671474 0.034297943115234375 3 0.9601674235361359 6.1629825348277825 3790.0 15.84346541918914 0.0 - - - - - - - 283.94117647058823 7 17 CTNNA3 catenin (cadherin-associated protein), alpha 3 539 71 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47950.[MT7]-DSFPNFLAC[CAM]K[MT7].3b6_1.heavy 496.258 / 852.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 541 71 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47950.[MT7]-DSFPNFLAC[CAM]K[MT7].3y3_1.heavy 496.258 / 522.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 543 71 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47950.[MT7]-DSFPNFLAC[CAM]K[MT7].3b5_1.heavy 496.258 / 705.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 545 71 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47950.[MT7]-DSFPNFLAC[CAM]K[MT7].3b3_1.heavy 496.258 / 494.237 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 547 72 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48024.[MT7]-YYVGHK[MT7].2b3_1.heavy 527.8 / 570.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 549 72 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48024.[MT7]-YYVGHK[MT7].2y4_1.heavy 527.8 / 584.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 551 72 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48024.[MT7]-YYVGHK[MT7].2y5_1.heavy 527.8 / 747.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 553 72 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48024.[MT7]-YYVGHK[MT7].2b4_1.heavy 527.8 / 627.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 555 73 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534423.[MT7]-GLFPGGR.2b3_1.heavy 424.249 / 462.283 12080.0 29.83085060119629 36 20 4 6 6 14.126996076726913 7.078645697703699 0.035400390625 6 0.9968848640406087 22.106045610063816 12080.0 6.402801958234529 0.0 - - - - - - - 771.4285714285714 24 7 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 557 73 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534423.[MT7]-GLFPGGR.2y5_1.heavy 424.249 / 533.283 7053.0 29.83085060119629 36 20 4 6 6 14.126996076726913 7.078645697703699 0.035400390625 6 0.9968848640406087 22.106045610063816 7053.0 8.244619686209598 2.0 - - - - - - - 1232.7142857142858 21 7 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 559 73 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534423.[MT7]-GLFPGGR.2y6_1.heavy 424.249 / 646.367 4427.0 29.83085060119629 36 20 4 6 6 14.126996076726913 7.078645697703699 0.035400390625 6 0.9968848640406087 22.106045610063816 4427.0 3.9303883694068307 3.0 - - - - - - - 712.5 40 8 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 561 73 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534423.[MT7]-GLFPGGR.2b5_1.heavy 424.249 / 616.357 2026.0 29.83085060119629 36 20 4 6 6 14.126996076726913 7.078645697703699 0.035400390625 6 0.9968848640406087 22.106045610063816 2026.0 3.212257837001144 15.0 - - - - - - - 798.2142857142857 6 14 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 563 74 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 806241.0 38.36650085449219 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 806241.0 1618.2024331584846 0.0 - - - - - - - 372.1666666666667 1612 6 565 74 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 349620.0 38.36650085449219 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 349620.0 729.9755666015401 0.0 - - - - - - - 300.3 699 10 567 74 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 600151.0 38.36650085449219 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 600151.0 280.5588664795768 0.0 - - - - - - - 375.375 1200 8 569 75 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49196.[MT7]-GQGPGEVDPK[MT7].3b6_1.heavy 424.566 / 670.328 32976.0 20.76652479171753 24 0 10 6 8 0.3034952771601715 143.74385043054886 0.03529930114746094 4 0.36361201422137934 1.4560743564472431 32976.0 70.39001206378451 1.0 - - - - - - - 837.6666666666666 289 3 NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 571 75 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49196.[MT7]-GQGPGEVDPK[MT7].3b4_1.heavy 424.566 / 484.264 1700730.0 20.76652479171753 24 0 10 6 8 0.3034952771601715 143.74385043054886 0.03529930114746094 4 0.36361201422137934 1.4560743564472431 1700730.0 966.35395774436 0.0 - - - - - - - 1257.0 3401 2 NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 573 75 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49196.[MT7]-GQGPGEVDPK[MT7].3b5_1.heavy 424.566 / 541.285 105826.0 20.76652479171753 24 0 10 6 8 0.3034952771601715 143.74385043054886 0.03529930114746094 4 0.36361201422137934 1.4560743564472431 105826.0 88.43443215368737 1.0 - - - - - - - 1228.0 211 1 NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 575 75 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49196.[MT7]-GQGPGEVDPK[MT7].3y3_2.heavy 424.566 / 252.151 6139.0 20.76652479171753 24 0 10 6 8 0.3034952771601715 143.74385043054886 0.03529930114746094 4 0.36361201422137934 1.4560743564472431 6139.0 5.956131296060704 1.0 - - - - - - - 1303.0 40 7 NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 577 76 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49195.[MT7]-GQGPGEVDPK[MT7].2b8_1.heavy 636.345 / 884.423 56518.0 20.08370018005371 44 14 10 10 10 2.447105180053906 40.86461048551953 0.0 3 0.9394781365313825 4.9910411165210595 56518.0 393.16502628120895 0.0 - - - - - - - 253.66666666666666 113 12 NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 579 76 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49195.[MT7]-GQGPGEVDPK[MT7].2b6_1.heavy 636.345 / 670.328 4271.0 20.08370018005371 44 14 10 10 10 2.447105180053906 40.86461048551953 0.0 3 0.9394781365313825 4.9910411165210595 4271.0 48.74504098480208 0.0 - - - - - - - 203.0 8 15 NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 581 76 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49195.[MT7]-GQGPGEVDPK[MT7].2b7_1.heavy 636.345 / 769.396 2808.0 20.08370018005371 44 14 10 10 10 2.447105180053906 40.86461048551953 0.0 3 0.9394781365313825 4.9910411165210595 2808.0 34.788 0.0 - - - - - - - 165.0909090909091 5 11 NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 583 76 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49195.[MT7]-GQGPGEVDPK[MT7].2b5_1.heavy 636.345 / 541.285 819.0 20.08370018005371 44 14 10 10 10 2.447105180053906 40.86461048551953 0.0 3 0.9394781365313825 4.9910411165210595 819.0 1.423048780487805 3.0 - - - - - - - 217.1764705882353 2 17 NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 585 77 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49689.[MT7]-AK[MT7]EILQEEEDLAEIVQLVGK[MT7].4b4_1.heavy 672.386 / 730.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 587 77 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49689.[MT7]-AK[MT7]EILQEEEDLAEIVQLVGK[MT7].4b5_1.heavy 672.386 / 843.554 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 589 77 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49689.[MT7]-AK[MT7]EILQEEEDLAEIVQLVGK[MT7].4b3_1.heavy 672.386 / 617.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 591 77 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49689.[MT7]-AK[MT7]EILQEEEDLAEIVQLVGK[MT7].4b10_2.heavy 672.386 / 737.387 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 593 78 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536164.[MT7]-AFENLLGQALTK[MT7].3y3_1.heavy 531.647 / 505.347 44586.0 43.32500076293945 41 11 10 10 10 2.9294906329440127 34.13562715491747 0.0 3 0.8696629607358223 3.380605119027336 44586.0 136.4634552062111 0.0 - - - - - - - 627.25 89 8 LMO7 LIM domain 7 595 78 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536164.[MT7]-AFENLLGQALTK[MT7].3b4_1.heavy 531.647 / 606.3 36456.0 43.32500076293945 41 11 10 10 10 2.9294906329440127 34.13562715491747 0.0 3 0.8696629607358223 3.380605119027336 36456.0 203.80913385826773 0.0 - - - - - - - 218.0 72 14 LMO7 LIM domain 7 597 78 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536164.[MT7]-AFENLLGQALTK[MT7].3b5_1.heavy 531.647 / 719.385 54176.0 43.32500076293945 41 11 10 10 10 2.9294906329440127 34.13562715491747 0.0 3 0.8696629607358223 3.380605119027336 54176.0 339.122061260667 0.0 - - - - - - - 206.58333333333334 108 12 LMO7 LIM domain 7 599 78 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536164.[MT7]-AFENLLGQALTK[MT7].3y4_1.heavy 531.647 / 576.384 36583.0 43.32500076293945 41 11 10 10 10 2.9294906329440127 34.13562715491747 0.0 3 0.8696629607358223 3.380605119027336 36583.0 103.20141006812351 0.0 - - - - - - - 248.45454545454547 73 11 LMO7 LIM domain 7 601 79 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49690.[MT7]-ASVLLASVEEATWNLLDK[MT7]GEK[MT7].4b7_1.heavy 677.133 / 786.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 603 79 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49690.[MT7]-ASVLLASVEEATWNLLDK[MT7]GEK[MT7].4b4_1.heavy 677.133 / 515.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 605 79 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49690.[MT7]-ASVLLASVEEATWNLLDK[MT7]GEK[MT7].4b5_1.heavy 677.133 / 628.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 607 79 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49690.[MT7]-ASVLLASVEEATWNLLDK[MT7]GEK[MT7].4y6_1.heavy 677.133 / 977.587 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 609 80 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47802.[MT7]-SFSPPR.2y4_1.heavy 417.733 / 456.257 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 611 80 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47802.[MT7]-SFSPPR.2b3_1.heavy 417.733 / 466.242 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 613 80 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47802.[MT7]-SFSPPR.2y5_1.heavy 417.733 / 603.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 615 80 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47802.[MT7]-SFSPPR.2y3_1.heavy 417.733 / 369.224 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 617 81 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47801.[MT7]-NVANK[MT7].2b3_1.heavy 417.258 / 429.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 619 81 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47801.[MT7]-NVANK[MT7].2y4_1.heavy 417.258 / 575.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 621 81 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47801.[MT7]-NVANK[MT7].2b3_2.heavy 417.258 / 215.133 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 623 81 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47801.[MT7]-NVANK[MT7].2y3_1.heavy 417.258 / 476.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 625 82 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49039.[MT7]-TSLLASGAPR.2y9_1.heavy 558.828 / 871.5 7802.0 28.43459955851237 22 2 10 6 4 0.3686885031593528 135.15731469877966 0.03389930725097656 10 0.4482299020144951 1.5780380754021297 7802.0 20.41644859813084 1.0 - - - - - - - 229.28571428571428 32 7 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 627 82 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49039.[MT7]-TSLLASGAPR.2y6_1.heavy 558.828 / 558.299 N/A 28.43459955851237 22 2 10 6 4 0.3686885031593528 135.15731469877966 0.03389930725097656 10 0.4482299020144951 1.5780380754021297 179745.0 16.656001036268876 1.0 - - - - - - - 11014.0 359 1 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 629 82 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49039.[MT7]-TSLLASGAPR.2b7_1.heavy 558.828 / 774.448 120161.0 28.43459955851237 22 2 10 6 4 0.3686885031593528 135.15731469877966 0.03389930725097656 10 0.4482299020144951 1.5780380754021297 120161.0 113.0491559431756 0.0 - - - - - - - 273.0 240 7 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 631 82 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49039.[MT7]-TSLLASGAPR.2y7_1.heavy 558.828 / 671.383 1147.0 28.43459955851237 22 2 10 6 4 0.3686885031593528 135.15731469877966 0.03389930725097656 10 0.4482299020144951 1.5780380754021297 1147.0 0.5997385620915033 17.0 - - - - - - - 371.42857142857144 26 7 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 633 83 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49181.[MT7]-GHAVVGAVGAK[MT7].3y6_1.heavy 418.59 / 646.4 22394.0 20.574199676513672 48 18 10 10 10 3.762378219690239 26.578933366309226 0.0 3 0.9813402175401214 9.020517208361587 22394.0 81.31955252050375 0.0 - - - - - - - 287.52941176470586 44 17 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 635 83 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49181.[MT7]-GHAVVGAVGAK[MT7].3b6_1.heavy 418.59 / 665.385 22696.0 20.574199676513672 48 18 10 10 10 3.762378219690239 26.578933366309226 0.0 3 0.9813402175401214 9.020517208361587 22696.0 94.89730574636995 0.0 - - - - - - - 335.3888888888889 45 18 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 637 83 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49181.[MT7]-GHAVVGAVGAK[MT7].3b4_1.heavy 418.59 / 509.295 53783.0 20.574199676513672 48 18 10 10 10 3.762378219690239 26.578933366309226 0.0 3 0.9813402175401214 9.020517208361587 53783.0 54.02136243197643 0.0 - - - - - - - 1225.4 107 10 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 639 83 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49181.[MT7]-GHAVVGAVGAK[MT7].3y4_1.heavy 418.59 / 518.342 39175.0 20.574199676513672 48 18 10 10 10 3.762378219690239 26.578933366309226 0.0 3 0.9813402175401214 9.020517208361587 39175.0 52.19244695630042 0.0 - - - - - - - 1187.111111111111 78 9 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 641 84 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534434.[MT7]-QPVTK[MT7].2y4_1.heavy 430.776 / 588.384 81495.0 16.796074390411377 42 20 10 6 6 2.9612488117501488 33.769536556064764 0.03529930114746094 6 0.9935496243733004 15.358052343881106 81495.0 111.36373212630743 0.0 - - - - - - - 1295.5 162 8 GRK4;GRK5;GRK6;NACA;MBD3;MBD2 G protein-coupled receptor kinase 4;G protein-coupled receptor kinase 5;G protein-coupled receptor kinase 6;nascent polypeptide-associated complex alpha subunit;methyl-CpG binding domain protein 3;methyl-CpG binding domain protein 2 643 84 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534434.[MT7]-QPVTK[MT7].2y3_2.heavy 430.776 / 246.169 3683.0 16.796074390411377 42 20 10 6 6 2.9612488117501488 33.769536556064764 0.03529930114746094 6 0.9935496243733004 15.358052343881106 3683.0 1.3937278582930754 6.0 - - - - - - - 2278.3 25 10 GRK4;GRK5;GRK6;NACA;MBD3;MBD2 G protein-coupled receptor kinase 4;G protein-coupled receptor kinase 5;G protein-coupled receptor kinase 6;nascent polypeptide-associated complex alpha subunit;methyl-CpG binding domain protein 3;methyl-CpG binding domain protein 2 645 84 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534434.[MT7]-QPVTK[MT7].2b4_1.heavy 430.776 / 570.337 2398.0 16.796074390411377 42 20 10 6 6 2.9612488117501488 33.769536556064764 0.03529930114746094 6 0.9935496243733004 15.358052343881106 2398.0 0.7723027375201288 1.0 - - - - - - - 675.3846153846154 4 13 GRK4;GRK5;GRK6;NACA;MBD3;MBD2 G protein-coupled receptor kinase 4;G protein-coupled receptor kinase 5;G protein-coupled receptor kinase 6;nascent polypeptide-associated complex alpha subunit;methyl-CpG binding domain protein 3;methyl-CpG binding domain protein 2 647 84 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534434.[MT7]-QPVTK[MT7].2y3_1.heavy 430.776 / 491.331 4796.0 16.796074390411377 42 20 10 6 6 2.9612488117501488 33.769536556064764 0.03529930114746094 6 0.9935496243733004 15.358052343881106 4796.0 6.762735280283919 0.0 - - - - - - - 642.3 9 10 GRK4;GRK5;GRK6;NACA;MBD3;MBD2 G protein-coupled receptor kinase 4;G protein-coupled receptor kinase 5;G protein-coupled receptor kinase 6;nascent polypeptide-associated complex alpha subunit;methyl-CpG binding domain protein 3;methyl-CpG binding domain protein 2 649 85 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49678.[MT7]-TFHTGQPHLVPVPPLPEYGGK[MT7].4y4_1.heavy 640.604 / 568.321 105173.0 34.984798431396484 33 7 10 6 10 1.3797102647185038 47.32088722139802 0.0391998291015625 3 0.7213348837626004 2.281271732724542 105173.0 37.132416613350394 0.0 - - - - - - - 1839.0 210 1 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 651 85 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49678.[MT7]-TFHTGQPHLVPVPPLPEYGGK[MT7].4b8_2.heavy 640.604 / 525.766 32545.0 34.984798431396484 33 7 10 6 10 1.3797102647185038 47.32088722139802 0.0391998291015625 3 0.7213348837626004 2.281271732724542 32545.0 22.64344482877262 0.0 - - - - - - - 1323.8 65 5 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 653 85 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49678.[MT7]-TFHTGQPHLVPVPPLPEYGGK[MT7].4b10_2.heavy 640.604 / 631.842 82649.0 34.984798431396484 33 7 10 6 10 1.3797102647185038 47.32088722139802 0.0391998291015625 3 0.7213348837626004 2.281271732724542 82649.0 17.621078301377956 0.0 - - - - - - - 2023.0 165 1 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 655 85 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49678.[MT7]-TFHTGQPHLVPVPPLPEYGGK[MT7].4b6_1.heavy 640.604 / 816.412 21972.0 34.984798431396484 33 7 10 6 10 1.3797102647185038 47.32088722139802 0.0391998291015625 3 0.7213348837626004 2.281271732724542 21972.0 15.33444931302333 0.0 - - - - - - - 460.0 43 1 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 657 86 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536556.[MT7]-VLSAYVSRLPAAFAPLPR.3y17_2.heavy 691.409 / 915.025 48486.0 43.9822998046875 42 12 10 10 10 0.9261546971745657 63.31439427370009 0.0 3 0.8875422475408246 3.645113668894807 48486.0 334.70008371322 0.0 - - - - - - - 246.55555555555554 96 9 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 659 86 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536556.[MT7]-VLSAYVSRLPAAFAPLPR.3b4_1.heavy 691.409 / 515.331 7869.0 43.9822998046875 42 12 10 10 10 0.9261546971745657 63.31439427370009 0.0 3 0.8875422475408246 3.645113668894807 7869.0 24.784251968503938 0.0 - - - - - - - 680.9090909090909 15 11 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 661 86 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536556.[MT7]-VLSAYVSRLPAAFAPLPR.3y16_2.heavy 691.409 / 858.483 25639.0 43.9822998046875 42 12 10 10 10 0.9261546971745657 63.31439427370009 0.0 3 0.8875422475408246 3.645113668894807 25639.0 94.69249956611603 0.0 - - - - - - - 261.625 51 8 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 663 86 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536556.[MT7]-VLSAYVSRLPAAFAPLPR.3y9_1.heavy 691.409 / 939.541 15295.0 43.9822998046875 42 12 10 10 10 0.9261546971745657 63.31439427370009 0.0 3 0.8875422475408246 3.645113668894807 15295.0 84.30314960629921 1.0 - - - - - - - 662.8888888888889 30 9 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 665 87 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49676.[MT7]-HMLLLTNTFGAINYVATEVFR.3y6_1.heavy 852.125 / 722.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 667 87 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49676.[MT7]-HMLLLTNTFGAINYVATEVFR.3b4_1.heavy 852.125 / 639.377 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 669 87 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49676.[MT7]-HMLLLTNTFGAINYVATEVFR.3b3_1.heavy 852.125 / 526.293 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 671 87 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49676.[MT7]-HMLLLTNTFGAINYVATEVFR.3y9_1.heavy 852.125 / 1098.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 673 88 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49677.[MT7]-TFHTGQPHLVPVPPLPEYGGK[MT7].3b6_1.heavy 853.804 / 816.412 5792.0 34.974998474121094 41 11 10 10 10 1.049453076620928 62.28896946572359 0.0 3 0.8574254607471263 3.22879894301521 5792.0 5.041830772886659 0.0 - - - - - - - 250.9090909090909 11 11 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 675 88 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49677.[MT7]-TFHTGQPHLVPVPPLPEYGGK[MT7].3y6_1.heavy 853.804 / 794.417 8550.0 34.974998474121094 41 11 10 10 10 1.049453076620928 62.28896946572359 0.0 3 0.8574254607471263 3.22879894301521 8550.0 25.860872790607658 0.0 - - - - - - - 724.0 17 8 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 677 88 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49677.[MT7]-TFHTGQPHLVPVPPLPEYGGK[MT7].3y4_1.heavy 853.804 / 568.321 7079.0 34.974998474121094 41 11 10 10 10 1.049453076620928 62.28896946572359 0.0 3 0.8574254607471263 3.22879894301521 7079.0 11.541847826086956 1.0 - - - - - - - 341.7142857142857 14 7 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 679 88 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49677.[MT7]-TFHTGQPHLVPVPPLPEYGGK[MT7].3y9_1.heavy 853.804 / 1101.61 14526.0 34.974998474121094 41 11 10 10 10 1.049453076620928 62.28896946572359 0.0 3 0.8574254607471263 3.22879894301521 14526.0 4.9740559440559435 1.0 - - - - - - - 368.0 29 3 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 681 89 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49684.[MT7]-LLEPLIIQVTTLVNC[CAM]PQNPSSR.3b6_1.heavy 879.49 / 823.541 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 683 89 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49684.[MT7]-LLEPLIIQVTTLVNC[CAM]PQNPSSR.3b5_1.heavy 879.49 / 710.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 685 89 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49684.[MT7]-LLEPLIIQVTTLVNC[CAM]PQNPSSR.3b3_1.heavy 879.49 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 687 89 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49684.[MT7]-LLEPLIIQVTTLVNC[CAM]PQNPSSR.3y9_1.heavy 879.49 / 1059.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 689 90 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49683.[MT7]-VTSVVFHPSQDLVFSASPDATIR.3b4_1.heavy 873.13 / 531.326 7905.0 39.78519821166992 40 10 10 10 10 0.9655560565959115 66.60060689236715 0.0 3 0.8261417182614097 2.9158272380419956 7905.0 11.677901728799839 0.0 - - - - - - - 715.4 15 10 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 691 90 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49683.[MT7]-VTSVVFHPSQDLVFSASPDATIR.3b5_1.heavy 873.13 / 630.394 14856.0 39.78519821166992 40 10 10 10 10 0.9655560565959115 66.60060689236715 0.0 3 0.8261417182614097 2.9158272380419956 14856.0 46.7170790516275 0.0 - - - - - - - 1333.7142857142858 29 7 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 693 90 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49683.[MT7]-VTSVVFHPSQDLVFSASPDATIR.3y10_1.heavy 873.13 / 1064.54 23784.0 39.78519821166992 40 10 10 10 10 0.9655560565959115 66.60060689236715 0.0 3 0.8261417182614097 2.9158272380419956 23784.0 38.77288162799408 0.0 - - - - - - - 265.6 47 10 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 695 90 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49683.[MT7]-VTSVVFHPSQDLVFSASPDATIR.3y9_1.heavy 873.13 / 917.469 7973.0 39.78519821166992 40 10 10 10 10 0.9655560565959115 66.60060689236715 0.0 3 0.8261417182614097 2.9158272380419956 7973.0 32.931702564102565 0.0 - - - - - - - 671.7142857142857 15 7 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 697 91 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535136.[MT7]-ILDTFEK[MT7].2y4_1.heavy 577.339 / 668.374 17216.0 35.22849909464518 46 20 10 6 10 10.170027870346289 9.832814744940812 0.037197113037109375 3 0.9959149654605681 19.302632848878517 17216.0 24.22790520201806 2.0 - - - - - - - 749.75 34 16 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 699 91 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535136.[MT7]-ILDTFEK[MT7].2y3_1.heavy 577.339 / 567.326 7692.0 35.22849909464518 46 20 10 6 10 10.170027870346289 9.832814744940812 0.037197113037109375 3 0.9959149654605681 19.302632848878517 7692.0 7.260831916162028 0.0 - - - - - - - 366.0 15 1 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 701 91 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535136.[MT7]-ILDTFEK[MT7].2y6_1.heavy 577.339 / 896.485 14744.0 35.22849909464518 46 20 10 6 10 10.170027870346289 9.832814744940812 0.037197113037109375 3 0.9959149654605681 19.302632848878517 14744.0 22.235105930839076 0.0 - - - - - - - 709.625 29 8 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 703 92 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47930.[MT7]-SALNRK[MT7].2y5_1.heavy 488.811 / 745.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 705 92 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47930.[MT7]-SALNRK[MT7].2b4_1.heavy 488.811 / 530.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 707 92 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47930.[MT7]-SALNRK[MT7].2y3_1.heavy 488.811 / 561.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 709 92 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47930.[MT7]-SALNRK[MT7].2b5_1.heavy 488.811 / 686.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 711 93 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49575.[MT7]-TVPEELVK[MT7]PEELSK[MT7].3b6_1.heavy 677.396 / 813.447 6418.0 32.48432540893555 36 10 10 6 10 1.166368326855588 53.04559583712039 0.0323028564453125 3 0.8447193599611602 3.090414407260878 6418.0 11.58272428229665 0.0 - - - - - - - 688.6 12 10 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 713 93 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49575.[MT7]-TVPEELVK[MT7]PEELSK[MT7].3y6_1.heavy 677.396 / 846.469 39915.0 32.48432540893555 36 10 10 6 10 1.166368326855588 53.04559583712039 0.0323028564453125 3 0.8447193599611602 3.090414407260878 39915.0 63.446503434226486 0.0 - - - - - - - 726.8571428571429 79 7 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 715 93 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49575.[MT7]-TVPEELVK[MT7]PEELSK[MT7].3b5_1.heavy 677.396 / 700.363 6652.0 32.48432540893555 36 10 10 6 10 1.166368326855588 53.04559583712039 0.0323028564453125 3 0.8447193599611602 3.090414407260878 6652.0 17.6908651087904 0.0 - - - - - - - 636.0 13 8 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 717 93 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49575.[MT7]-TVPEELVK[MT7]PEELSK[MT7].3y12_2.heavy 677.396 / 843.482 45863.0 32.48432540893555 36 10 10 6 10 1.166368326855588 53.04559583712039 0.0323028564453125 3 0.8447193599611602 3.090414407260878 45863.0 86.64220286956927 0.0 - - - - - - - 242.7 91 10 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 719 94 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534437.[MT7]-ATVLTTERK[MT7].3y6_1.heavy 436.269 / 891.538 1957.0 21.833374977111816 34 7 10 7 10 1.26145236352728 52.76808099340798 0.029499053955078125 3 0.7047321199066988 2.21277644436839 1957.0 41.34001594578433 0.0 - - - - - - - 153.6 3 15 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 721 94 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534437.[MT7]-ATVLTTERK[MT7].3b4_1.heavy 436.269 / 529.347 30559.0 21.833374977111816 34 7 10 7 10 1.26145236352728 52.76808099340798 0.029499053955078125 3 0.7047321199066988 2.21277644436839 30559.0 18.649251062386348 0.0 - - - - - - - 834.5 61 4 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 723 94 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534437.[MT7]-ATVLTTERK[MT7].3y8_2.heavy 436.269 / 546.331 81318.0 21.833374977111816 34 7 10 7 10 1.26145236352728 52.76808099340798 0.029499053955078125 3 0.7047321199066988 2.21277644436839 81318.0 99.0273972085617 0.0 - - - - - - - 1220.1 162 10 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 725 94 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534437.[MT7]-ATVLTTERK[MT7].3y5_1.heavy 436.269 / 778.454 30559.0 21.833374977111816 34 7 10 7 10 1.26145236352728 52.76808099340798 0.029499053955078125 3 0.7047321199066988 2.21277644436839 30559.0 99.49780595376001 0.0 - - - - - - - 209.1578947368421 61 19 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 727 95 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 780390.0 35.46670150756836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 780390.0 115.06206957712155 0.0 - - - - - - - 1331.8 1560 5 729 95 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 166844.0 35.46670150756836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 166844.0 350.92818547823504 0.0 - - - - - - - 1140.4444444444443 333 9 731 95 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 247214.0 35.46670150756836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 247214.0 58.19309327766285 0.0 - - - - - - - 185.0 494 1 733 96 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49577.[MT7]-GEPFHEYLDSMFFDR.3y7_1.heavy 678.644 / 917.382 7983.0 44.600101470947266 48 18 10 10 10 5.675803569721438 17.618650605434517 0.0 3 0.9860999594667381 10.455624801863602 7983.0 46.077987418140566 0.0 - - - - - - - 257.6666666666667 15 15 GRK5 G protein-coupled receptor kinase 5 735 96 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49577.[MT7]-GEPFHEYLDSMFFDR.3y6_1.heavy 678.644 / 802.355 4893.0 44.600101470947266 48 18 10 10 10 5.675803569721438 17.618650605434517 0.0 3 0.9860999594667381 10.455624801863602 4893.0 24.943949546708712 1.0 - - - - - - - 270.46666666666664 10 15 GRK5 G protein-coupled receptor kinase 5 737 96 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49577.[MT7]-GEPFHEYLDSMFFDR.3b4_1.heavy 678.644 / 575.295 15193.0 44.600101470947266 48 18 10 10 10 5.675803569721438 17.618650605434517 0.0 3 0.9860999594667381 10.455624801863602 15193.0 26.80921562174318 0.0 - - - - - - - 740.4 30 10 GRK5 G protein-coupled receptor kinase 5 739 96 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49577.[MT7]-GEPFHEYLDSMFFDR.3y9_1.heavy 678.644 / 1193.53 5150.0 44.600101470947266 48 18 10 10 10 5.675803569721438 17.618650605434517 0.0 3 0.9860999594667381 10.455624801863602 5150.0 23.08545201796813 0.0 - - - - - - - 240.4 10 15 GRK5 G protein-coupled receptor kinase 5 741 97 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48040.[MT7]-ILTGGADK[MT7].2y4_1.heavy 531.823 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 743 97 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48040.[MT7]-ILTGGADK[MT7].2y5_1.heavy 531.823 / 591.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 745 97 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48040.[MT7]-ILTGGADK[MT7].2y6_1.heavy 531.823 / 692.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 747 97 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48040.[MT7]-ILTGGADK[MT7].2y7_1.heavy 531.823 / 805.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 749 98 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48290.[MT7]-FSYLPIQK[MT7].2b3_1.heavy 642.384 / 542.273 101228.0 44.671600341796875 44 14 10 10 10 1.8163443412706264 46.4018033830515 0.0 3 0.9426182394487207 5.127155875171293 101228.0 93.36613665538127 0.0 - - - - - - - 670.5714285714286 202 7 ITGA6 integrin, alpha 6 751 98 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48290.[MT7]-FSYLPIQK[MT7].2y4_1.heavy 642.384 / 629.41 97739.0 44.671600341796875 44 14 10 10 10 1.8163443412706264 46.4018033830515 0.0 3 0.9426182394487207 5.127155875171293 97739.0 180.92876285874257 0.0 - - - - - - - 285.75 195 4 ITGA6 integrin, alpha 6 753 98 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48290.[MT7]-FSYLPIQK[MT7].2b4_1.heavy 642.384 / 655.357 N/A 44.671600341796875 44 14 10 10 10 1.8163443412706264 46.4018033830515 0.0 3 0.9426182394487207 5.127155875171293 157550.0 206.51389169642653 0.0 - - - - - - - 317.3333333333333 315 3 ITGA6 integrin, alpha 6 755 98 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48290.[MT7]-FSYLPIQK[MT7].2y3_1.heavy 642.384 / 532.357 1332.0 44.671600341796875 44 14 10 10 10 1.8163443412706264 46.4018033830515 0.0 3 0.9426182394487207 5.127155875171293 1332.0 0.840378548895899 4.0 - - - - - - - 287.3529411764706 2 17 ITGA6 integrin, alpha 6 757 99 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49025.[MT7]-GYTEVLK[MT7].2b4_1.heavy 549.326 / 595.284 5444.0 28.445899327596027 46 20 10 6 10 5.281331702659207 18.934618317885416 0.03389930725097656 3 0.9927887305612638 14.524298911693547 5444.0 15.007065425103004 0.0 - - - - - - - 752.1111111111111 10 18 PPP1R12A protein phosphatase 1, regulatory (inhibitor) subunit 12A 759 99 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49025.[MT7]-GYTEVLK[MT7].2y3_1.heavy 549.326 / 503.367 N/A 28.445899327596027 46 20 10 6 10 5.281331702659207 18.934618317885416 0.03389930725097656 3 0.9927887305612638 14.524298911693547 3025.0 1.1431270666036846 14.0 - - - - - - - 1856.0 9 11 PPP1R12A protein phosphatase 1, regulatory (inhibitor) subunit 12A 761 99 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49025.[MT7]-GYTEVLK[MT7].2y6_1.heavy 549.326 / 896.521 1588.0 28.445899327596027 46 20 10 6 10 5.281331702659207 18.934618317885416 0.03389930725097656 3 0.9927887305612638 14.524298911693547 1588.0 2.3334074833203005 0.0 - - - - - - - 264.6666666666667 3 24 PPP1R12A protein phosphatase 1, regulatory (inhibitor) subunit 12A 763 99 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49025.[MT7]-GYTEVLK[MT7].2b5_1.heavy 549.326 / 694.353 4159.0 28.445899327596027 46 20 10 6 10 5.281331702659207 18.934618317885416 0.03389930725097656 3 0.9927887305612638 14.524298911693547 4159.0 7.45279828775052 0.0 - - - - - - - 675.4666666666667 8 15 PPP1R12A protein phosphatase 1, regulatory (inhibitor) subunit 12A 765 100 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48005.[MT7]-EAYVHK[MT7].2b3_1.heavy 517.797 / 508.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 767 100 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48005.[MT7]-EAYVHK[MT7].2y5_1.heavy 517.797 / 761.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 769 100 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48005.[MT7]-EAYVHK[MT7].2b4_1.heavy 517.797 / 607.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 771 100 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48005.[MT7]-EAYVHK[MT7].2y3_1.heavy 517.797 / 527.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 773 101 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536561.[MT7]-ISDLGLAVK[MT7]IPEGDLIR.4y8_1.heavy 525.068 / 912.515 2325.0 42.04119873046875 46 18 10 10 8 6.970227542362101 14.34673393260725 0.0 4 0.9826623161674355 9.359170401977018 2325.0 26.202380952380953 0.0 - - - - - - - 113.33333333333333 4 15 GRK5 G protein-coupled receptor kinase 5 775 101 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536561.[MT7]-ISDLGLAVK[MT7]IPEGDLIR.4b5_1.heavy 525.068 / 630.358 25894.0 42.04119873046875 46 18 10 10 8 6.970227542362101 14.34673393260725 0.0 4 0.9826623161674355 9.359170401977018 25894.0 77.60811229000883 0.0 - - - - - - - 258.44444444444446 51 18 GRK5 G protein-coupled receptor kinase 5 777 101 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536561.[MT7]-ISDLGLAVK[MT7]IPEGDLIR.4y7_1.heavy 525.068 / 799.431 14016.0 42.04119873046875 46 18 10 10 8 6.970227542362101 14.34673393260725 0.0 4 0.9826623161674355 9.359170401977018 14016.0 67.59084932355384 0.0 - - - - - - - 203.71428571428572 28 21 GRK5 G protein-coupled receptor kinase 5 779 101 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536561.[MT7]-ISDLGLAVK[MT7]IPEGDLIR.4b6_1.heavy 525.068 / 743.442 4085.0 42.04119873046875 46 18 10 10 8 6.970227542362101 14.34673393260725 0.0 4 0.9826623161674355 9.359170401977018 4085.0 36.74338624338624 1.0 - - - - - - - 158.8095238095238 8 21 GRK5 G protein-coupled receptor kinase 5 781 102 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536664.[MT7]-ADLQDDTFIGNEPLTPEVR.3y7_1.heavy 758.717 / 811.467 73930.0 38.4239501953125 42 16 10 6 10 3.3548080029901275 29.807965138651863 0.038299560546875 3 0.9678596407180898 6.865416546113127 73930.0 112.02134076476716 0.0 - - - - - - - 763.7777777777778 147 9 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 783 102 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536664.[MT7]-ADLQDDTFIGNEPLTPEVR.3b6_1.heavy 758.717 / 802.37 18864.0 38.4239501953125 42 16 10 6 10 3.3548080029901275 29.807965138651863 0.038299560546875 3 0.9678596407180898 6.865416546113127 18864.0 32.37402301431378 0.0 - - - - - - - 687.4444444444445 37 9 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 785 102 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536664.[MT7]-ADLQDDTFIGNEPLTPEVR.3y4_1.heavy 758.717 / 500.283 44068.0 38.4239501953125 42 16 10 6 10 3.3548080029901275 29.807965138651863 0.038299560546875 3 0.9678596407180898 6.865416546113127 44068.0 40.88294916468648 0.0 - - - - - - - 796.5714285714286 88 7 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 787 102 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536664.[MT7]-ADLQDDTFIGNEPLTPEVR.3b7_1.heavy 758.717 / 903.418 21537.0 38.4239501953125 42 16 10 6 10 3.3548080029901275 29.807965138651863 0.038299560546875 3 0.9678596407180898 6.865416546113127 21537.0 49.63353432008351 0.0 - - - - - - - 695.0 43 10 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 789 103 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48298.[MT7]-HFTEFVPLR.2y8_1.heavy 645.36 / 1008.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 791 103 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48298.[MT7]-HFTEFVPLR.2y5_1.heavy 645.36 / 631.393 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 793 103 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48298.[MT7]-HFTEFVPLR.2y3_1.heavy 645.36 / 385.256 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 795 103 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48298.[MT7]-HFTEFVPLR.2y7_1.heavy 645.36 / 861.483 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 797 104 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534910.[MT7]-VLSAYVSR.2y5_1.heavy 519.807 / 595.32 28767.0 30.914100646972656 50 20 10 10 10 8.16713634799617 12.244193771117251 0.0 3 0.9970251148455587 22.621403381639606 28767.0 57.50746895938663 0.0 - - - - - - - 1181.7142857142858 57 7 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 799 104 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534910.[MT7]-VLSAYVSR.2b4_1.heavy 519.807 / 515.331 22911.0 30.914100646972656 50 20 10 10 10 8.16713634799617 12.244193771117251 0.0 3 0.9970251148455587 22.621403381639606 22911.0 9.65794454430647 0.0 - - - - - - - 2311.1428571428573 45 7 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 801 104 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534910.[MT7]-VLSAYVSR.2y6_1.heavy 519.807 / 682.352 74442.0 30.914100646972656 50 20 10 10 10 8.16713634799617 12.244193771117251 0.0 3 0.9970251148455587 22.621403381639606 74442.0 79.14573107601385 0.0 - - - - - - - 753.9 148 10 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 803 104 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534910.[MT7]-VLSAYVSR.2y7_1.heavy 519.807 / 795.436 143906.0 30.914100646972656 50 20 10 10 10 8.16713634799617 12.244193771117251 0.0 3 0.9970251148455587 22.621403381639606 143906.0 214.3825585284281 0.0 - - - - - - - 324.2857142857143 287 7 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 805 105 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536416.[MT7]-LFIGGLSFETTDESLR.3y6_1.heavy 643.674 / 720.352 36540.0 45.69129943847656 50 20 10 10 10 7.163039309229437 13.960554407561599 0.0 3 0.9943261853984005 16.37643038222766 36540.0 42.037464846025976 0.0 - - - - - - - 346.7142857142857 73 7 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 807 105 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536416.[MT7]-LFIGGLSFETTDESLR.3b5_1.heavy 643.674 / 632.389 70466.0 45.69129943847656 50 20 10 10 10 7.163039309229437 13.960554407561599 0.0 3 0.9943261853984005 16.37643038222766 70466.0 46.92131599711432 0.0 - - - - - - - 793.625 140 8 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 809 105 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536416.[MT7]-LFIGGLSFETTDESLR.3y4_1.heavy 643.674 / 504.278 45628.0 45.69129943847656 50 20 10 10 10 7.163039309229437 13.960554407561599 0.0 3 0.9943261853984005 16.37643038222766 45628.0 50.17556390420411 0.0 - - - - - - - 382.42857142857144 91 7 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 811 105 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536416.[MT7]-LFIGGLSFETTDESLR.3y8_1.heavy 643.674 / 950.443 37225.0 45.69129943847656 50 20 10 10 10 7.163039309229437 13.960554407561599 0.0 3 0.9943261853984005 16.37643038222766 37225.0 95.42212427706549 0.0 - - - - - - - 731.25 74 8 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 813 106 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536413.[MT7]-LAEMPADSGYPAYLGAR.3b9_1.heavy 642.656 / 1016.48 13163.0 36.96070098876953 45 20 10 5 10 12.577322450788383 7.9508178621699965 0.04180145263671875 3 0.9956533097074864 18.712231582646282 13163.0 45.949614918831635 0.0 - - - - - - - 310.46153846153845 26 13 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 815 106 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536413.[MT7]-LAEMPADSGYPAYLGAR.3y7_1.heavy 642.656 / 747.415 65816.0 36.96070098876953 45 20 10 5 10 12.577322450788383 7.9508178621699965 0.04180145263671875 3 0.9956533097074864 18.712231582646282 65816.0 86.9423089579085 0.0 - - - - - - - 689.5714285714286 131 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 817 106 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536413.[MT7]-LAEMPADSGYPAYLGAR.3y6_1.heavy 642.656 / 650.362 17375.0 36.96070098876953 45 20 10 5 10 12.577322450788383 7.9508178621699965 0.04180145263671875 3 0.9956533097074864 18.712231582646282 17375.0 34.519807175182 0.0 - - - - - - - 675.8 34 10 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 819 106 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536413.[MT7]-LAEMPADSGYPAYLGAR.3y5_1.heavy 642.656 / 579.325 13602.0 36.96070098876953 45 20 10 5 10 12.577322450788383 7.9508178621699965 0.04180145263671875 3 0.9956533097074864 18.712231582646282 13602.0 22.95929015842978 0.0 - - - - - - - 714.7142857142857 27 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 821 107 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47826.[MT7]-VSGNTSR.2b4_1.heavy 432.736 / 502.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 823 107 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47826.[MT7]-VSGNTSR.2b6_1.heavy 432.736 / 690.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 825 107 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47826.[MT7]-VSGNTSR.2y6_1.heavy 432.736 / 621.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 827 107 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47826.[MT7]-VSGNTSR.2b5_1.heavy 432.736 / 603.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 829 108 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47921.[MT7]-VFIYQR.2b3_1.heavy 485.286 / 504.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 831 108 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47921.[MT7]-VFIYQR.2y4_1.heavy 485.286 / 579.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 833 108 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47921.[MT7]-VFIYQR.2y5_1.heavy 485.286 / 726.393 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 835 108 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47921.[MT7]-VFIYQR.2y3_1.heavy 485.286 / 466.241 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 837 109 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47920.[MT7]-IQSPAGPR.2b3_1.heavy 485.284 / 473.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 839 109 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47920.[MT7]-IQSPAGPR.2y5_1.heavy 485.284 / 497.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 841 109 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47920.[MT7]-IQSPAGPR.2y6_1.heavy 485.284 / 584.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 843 109 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47920.[MT7]-IQSPAGPR.2y7_1.heavy 485.284 / 712.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 845 110 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47825.[MT7]-DTAGVTR.2y5_1.heavy 432.239 / 503.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12A protein phosphatase 1, regulatory (inhibitor) subunit 12A 847 110 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47825.[MT7]-DTAGVTR.2b4_1.heavy 432.239 / 489.242 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12A protein phosphatase 1, regulatory (inhibitor) subunit 12A 849 110 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47825.[MT7]-DTAGVTR.2y6_1.heavy 432.239 / 604.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12A protein phosphatase 1, regulatory (inhibitor) subunit 12A 851 110 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47825.[MT7]-DTAGVTR.2b5_1.heavy 432.239 / 588.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12A protein phosphatase 1, regulatory (inhibitor) subunit 12A 853 111 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534681.[MT7]-ESEALK[MT7].2y4_1.heavy 482.781 / 604.379 3591.0 19.754199981689453 50 20 10 10 10 10.286296116995265 9.721672297064986 0.0 3 0.9965540306555875 21.01753950012072 3591.0 3.1401351351351354 2.0 - - - - - - - 283.25 12 16 EVPL;CTNNA3 envoplakin;catenin (cadherin-associated protein), alpha 3 855 111 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534681.[MT7]-ESEALK[MT7].2b3_1.heavy 482.781 / 490.227 7712.0 19.754199981689453 50 20 10 10 10 10.286296116995265 9.721672297064986 0.0 3 0.9965540306555875 21.01753950012072 7712.0 20.024076416781988 0.0 - - - - - - - 673.7777777777778 15 9 EVPL;CTNNA3 envoplakin;catenin (cadherin-associated protein), alpha 3 857 111 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534681.[MT7]-ESEALK[MT7].2y5_1.heavy 482.781 / 691.411 15423.0 19.754199981689453 50 20 10 10 10 10.286296116995265 9.721672297064986 0.0 3 0.9965540306555875 21.01753950012072 15423.0 30.862487252124644 0.0 - - - - - - - 714.8571428571429 30 7 EVPL;CTNNA3 envoplakin;catenin (cadherin-associated protein), alpha 3 859 111 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534681.[MT7]-ESEALK[MT7].2b4_1.heavy 482.781 / 561.264 7241.0 19.754199981689453 50 20 10 10 10 10.286296116995265 9.721672297064986 0.0 3 0.9965540306555875 21.01753950012072 7241.0 24.11862412134784 0.0 - - - - - - - 726.0833333333334 14 12 EVPL;CTNNA3 envoplakin;catenin (cadherin-associated protein), alpha 3 861 112 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49671.[MT7]-IAQEATVLK[MT7]DELTASLEEVR.3b4_1.heavy 835.133 / 586.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 863 112 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49671.[MT7]-IAQEATVLK[MT7]DELTASLEEVR.3y4_1.heavy 835.133 / 532.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 865 112 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49671.[MT7]-IAQEATVLK[MT7]DELTASLEEVR.3y10_1.heavy 835.133 / 1146.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 867 112 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49671.[MT7]-IAQEATVLK[MT7]DELTASLEEVR.3y9_1.heavy 835.133 / 1017.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 869 113 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49670.[MT7]-IAQEATVLK[MT7]DELTASLEEVR.4y5_1.heavy 626.602 / 645.357 1767.0 49.412750244140625 42 16 10 6 10 3.03657790455851 27.41132644385864 0.031097412109375 3 0.9654604969725757 6.621346410649839 1767.0 15.47096153846154 1.0 - - - - - - - 133.71428571428572 3 21 CTNNA3 catenin (cadherin-associated protein), alpha 3 871 113 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49670.[MT7]-IAQEATVLK[MT7]DELTASLEEVR.4y4_1.heavy 626.602 / 532.273 6235.0 49.412750244140625 42 16 10 6 10 3.03657790455851 27.41132644385864 0.031097412109375 3 0.9654604969725757 6.621346410649839 6235.0 36.00112980769231 0.0 - - - - - - - 205.52380952380952 12 21 CTNNA3 catenin (cadherin-associated protein), alpha 3 873 113 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49670.[MT7]-IAQEATVLK[MT7]DELTASLEEVR.4y8_1.heavy 626.602 / 904.473 1819.0 49.412750244140625 42 16 10 6 10 3.03657790455851 27.41132644385864 0.031097412109375 3 0.9654604969725757 6.621346410649839 1819.0 22.562596153846155 0.0 - - - - - - - 110.5 3 16 CTNNA3 catenin (cadherin-associated protein), alpha 3 875 113 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49670.[MT7]-IAQEATVLK[MT7]DELTASLEEVR.4b4_1.heavy 626.602 / 586.332 4521.0 49.412750244140625 42 16 10 6 10 3.03657790455851 27.41132644385864 0.031097412109375 3 0.9654604969725757 6.621346410649839 4521.0 15.277005494505493 0.0 - - - - - - - 177.89473684210526 9 19 CTNNA3 catenin (cadherin-associated protein), alpha 3 877 114 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48289.[MT7]-YTQELTLK[MT7].2y4_1.heavy 642.376 / 618.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 879 114 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48289.[MT7]-YTQELTLK[MT7].2b4_1.heavy 642.376 / 666.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 881 114 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48289.[MT7]-YTQELTLK[MT7].2y3_1.heavy 642.376 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 883 114 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48289.[MT7]-YTQELTLK[MT7].2y7_1.heavy 642.376 / 976.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 885 115 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535027.[MT7]-VPPPPPIAR.2y8_1.heavy 544.341 / 844.504 127346.0 27.986099243164062 45 15 10 10 10 3.3398203781086613 29.941729997057493 0.0 3 0.9540162508109535 5.732997642164121 127346.0 100.24191954997303 0.0 - - - - - - - 455.0 254 1 HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 887 115 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535027.[MT7]-VPPPPPIAR.2y5_1.heavy 544.341 / 553.346 20642.0 27.986099243164062 45 15 10 10 10 3.3398203781086613 29.941729997057493 0.0 3 0.9540162508109535 5.732997642164121 20642.0 21.454862610101642 0.0 - - - - - - - 278.3333333333333 41 3 HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 889 115 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535027.[MT7]-VPPPPPIAR.2y6_1.heavy 544.341 / 650.398 56995.0 27.986099243164062 45 15 10 10 10 3.3398203781086613 29.941729997057493 0.0 3 0.9540162508109535 5.732997642164121 56995.0 33.898851280310076 0.0 - - - - - - - 379.0 113 1 HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 891 115 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535027.[MT7]-VPPPPPIAR.2y7_1.heavy 544.341 / 747.451 40298.0 27.986099243164062 45 15 10 10 10 3.3398203781086613 29.941729997057493 0.0 3 0.9540162508109535 5.732997642164121 40298.0 39.57512968521113 0.0 - - - - - - - 379.5 80 2 HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 893 116 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536147.[MT7]-VFYYLVQDLK[MT7].3y3_1.heavy 525.972 / 519.326 37092.0 47.985175132751465 35 11 10 6 8 0.7201014388597515 73.21452673706534 0.033298492431640625 4 0.8705354553181015 3.3922364199779733 37092.0 125.24443309107778 1.0 - - - - - - - 246.16666666666666 77 12 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 895 116 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536147.[MT7]-VFYYLVQDLK[MT7].3b4_1.heavy 525.972 / 717.373 34024.0 47.985175132751465 35 11 10 6 8 0.7201014388597515 73.21452673706534 0.033298492431640625 4 0.8705354553181015 3.3922364199779733 34024.0 256.9393582556003 0.0 - - - - - - - 261.7692307692308 68 13 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 897 116 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536147.[MT7]-VFYYLVQDLK[MT7].3y4_1.heavy 525.972 / 647.385 24709.0 47.985175132751465 35 11 10 6 8 0.7201014388597515 73.21452673706534 0.033298492431640625 4 0.8705354553181015 3.3922364199779733 24709.0 114.56759920921934 0.0 - - - - - - - 182.63636363636363 49 11 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 899 116 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536147.[MT7]-VFYYLVQDLK[MT7].3b3_1.heavy 525.972 / 554.31 27889.0 47.985175132751465 35 11 10 6 8 0.7201014388597515 73.21452673706534 0.033298492431640625 4 0.8705354553181015 3.3922364199779733 27889.0 328.54005984383 0.0 - - - - - - - 204.5 55 12 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 901 117 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 600566.0 23.514799118041992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 600566.0 406.7543923298416 0.0 - - - - - - - 1715.5714285714287 1201 7 903 117 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 865284.0 23.514799118041992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 865284.0 949.1613673327432 0.0 - - - - - - - 273.09090909090907 1730 11 905 117 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 2992840.0 23.514799118041992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2992840.0 1246.3553371838204 0.0 - - - - - - - 771.3333333333334 5985 9 907 118 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47820.[MT7]-LSSMK[MT7].2b3_1.heavy 427.256 / 432.258 N/A 27.024700164794922 50 20 10 10 10 16.149368908360994 6.192192435967397 0.0 2 0.9941656711735387 16.14936836491653 1374.0 0.5534743202416919 30.0 - - - - - - - 1767.142857142857 53 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 909 118 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47820.[MT7]-LSSMK[MT7].2y4_1.heavy 427.256 / 596.319 127673.0 27.024700164794922 50 20 10 10 10 16.149368908360994 6.192192435967397 0.0 2 0.9941656711735387 16.14936836491653 127673.0 64.50861075428493 0.0 - - - - - - - 458.0 255 1 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 911 118 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47820.[MT7]-LSSMK[MT7].2b4_1.heavy 427.256 / 563.298 N/A 27.024700164794922 50 20 10 10 10 16.149368908360994 6.192192435967397 0.0 2 0.9941656711735387 16.14936836491653 4123.0 0.5537944929482874 3.0 - - - - - - - 783.0 8 8 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 913 118 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47820.[MT7]-LSSMK[MT7].2y3_1.heavy 427.256 / 509.287 16417.0 27.024700164794922 50 20 10 10 10 16.149368908360994 6.192192435967397 0.0 2 0.9941656711735387 16.14936836491653 16417.0 11.425076338537114 1.0 - - - - - - - 801.75 32 4 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 915 119 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534908.[MT7]-K[MT7]SDVEAIFSK[MT7].3b6_1.heavy 519.307 / 918.513 4813.0 32.11159896850586 35 13 6 10 6 2.894308977962275 34.550561381461264 0.0 5 0.9269710609762695 4.538744679042019 4813.0 24.903118804451143 0.0 - - - - - - - 152.66666666666666 9 15 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 917 119 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534908.[MT7]-K[MT7]SDVEAIFSK[MT7].3y3_1.heavy 519.307 / 525.315 34531.0 32.11159896850586 35 13 6 10 6 2.894308977962275 34.550561381461264 0.0 5 0.9269710609762695 4.538744679042019 34531.0 43.63865278093937 0.0 - - - - - - - 820.0666666666667 69 15 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 919 119 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534908.[MT7]-K[MT7]SDVEAIFSK[MT7].3b5_1.heavy 519.307 / 847.476 4355.0 32.11159896850586 35 13 6 10 6 2.894308977962275 34.550561381461264 0.0 5 0.9269710609762695 4.538744679042019 4355.0 13.213014154531624 0.0 - - - - - - - 267.3333333333333 8 18 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 921 119 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534908.[MT7]-K[MT7]SDVEAIFSK[MT7].3b3_1.heavy 519.307 / 619.365 6494.0 32.11159896850586 35 13 6 10 6 2.894308977962275 34.550561381461264 0.0 5 0.9269710609762695 4.538744679042019 6494.0 5.244307921225216 4.0 - - - - - - - 743.1818181818181 105 11 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 923 120 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48017.[MT7]-GSNYTSK[MT7].2y4_1.heavy 522.782 / 642.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 925 120 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48017.[MT7]-GSNYTSK[MT7].2y5_1.heavy 522.782 / 756.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 927 120 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48017.[MT7]-GSNYTSK[MT7].2b4_1.heavy 522.782 / 566.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 929 120 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48017.[MT7]-GSNYTSK[MT7].2y6_1.heavy 522.782 / 843.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 931 121 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534902.[MT7]-ATVLTTER.2y4_1.heavy 517.802 / 506.257 38546.0 24.03179931640625 48 18 10 10 10 4.525318067546525 22.097894226961294 0.0 3 0.9817808249538768 9.129277912692107 38546.0 29.4527277584825 0.0 - - - - - - - 1238.111111111111 77 9 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 933 121 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534902.[MT7]-ATVLTTER.2y5_1.heavy 517.802 / 619.341 60316.0 24.03179931640625 48 18 10 10 10 4.525318067546525 22.097894226961294 0.0 3 0.9817808249538768 9.129277912692107 60316.0 131.3522265625 0.0 - - - - - - - 742.4 120 10 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 935 121 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534902.[MT7]-ATVLTTER.2y6_1.heavy 517.802 / 718.409 26124.0 24.03179931640625 48 18 10 10 10 4.525318067546525 22.097894226961294 0.0 3 0.9817808249538768 9.129277912692107 26124.0 49.40304803938963 0.0 - - - - - - - 661.3333333333334 52 12 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 937 121 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534902.[MT7]-ATVLTTER.2y7_1.heavy 517.802 / 819.457 73122.0 24.03179931640625 48 18 10 10 10 4.525318067546525 22.097894226961294 0.0 3 0.9817808249538768 9.129277912692107 73122.0 532.80040625 0.0 - - - - - - - 738.9090909090909 146 11 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 939 122 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536400.[MT7]-EASIYTGITLSEYFR.3y7_1.heavy 631.995 / 915.457 15323.0 45.10892581939697 46 20 10 6 10 7.977124589850027 12.535845325424463 0.033298492431640625 3 0.9953691185531494 18.12853872502573 15323.0 228.73470376432078 0.0 - - - - - - - 281.85714285714283 30 14 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 941 122 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536400.[MT7]-EASIYTGITLSEYFR.3y6_1.heavy 631.995 / 814.409 9375.0 45.10892581939697 46 20 10 6 10 7.977124589850027 12.535845325424463 0.033298492431640625 3 0.9953691185531494 18.12853872502573 9375.0 27.048838581667034 0.0 - - - - - - - 267.3333333333333 18 15 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 943 122 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536400.[MT7]-EASIYTGITLSEYFR.3b4_1.heavy 631.995 / 545.305 15646.0 45.10892581939697 46 20 10 6 10 7.977124589850027 12.535845325424463 0.033298492431640625 3 0.9953691185531494 18.12853872502573 15646.0 23.25984836412224 0.0 - - - - - - - 1126.857142857143 31 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 945 122 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536400.[MT7]-EASIYTGITLSEYFR.3y5_1.heavy 631.995 / 701.325 22564.0 45.10892581939697 46 20 10 6 10 7.977124589850027 12.535845325424463 0.033298492431640625 3 0.9953691185531494 18.12853872502573 22564.0 42.01182930061564 0.0 - - - - - - - 757.4285714285714 45 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 947 123 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536579.[MT7]-FGHEFLEFEFRPDGK[MT7].4y4_1.heavy 536.527 / 560.316 34455.0 39.02827548980713 34 8 10 6 10 1.0026019223736555 67.25788806695064 0.035701751708984375 3 0.7843291125380308 2.6081516971583554 34455.0 34.071121860251374 0.0 - - - - - - - 698.0 68 8 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 949 123 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536579.[MT7]-FGHEFLEFEFRPDGK[MT7].4y8_2.heavy 536.527 / 570.302 91614.0 39.02827548980713 34 8 10 6 10 1.0026019223736555 67.25788806695064 0.035701751708984375 3 0.7843291125380308 2.6081516971583554 91614.0 66.96354224473656 0.0 - - - - - - - 326.5 183 2 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 951 123 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536579.[MT7]-FGHEFLEFEFRPDGK[MT7].4y9_2.heavy 536.527 / 634.823 85811.0 39.02827548980713 34 8 10 6 10 1.0026019223736555 67.25788806695064 0.035701751708984375 3 0.7843291125380308 2.6081516971583554 85811.0 89.27105519189786 0.0 - - - - - - - 338.5 171 6 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 953 123 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536579.[MT7]-FGHEFLEFEFRPDGK[MT7].4b4_1.heavy 536.527 / 615.301 52081.0 39.02827548980713 34 8 10 6 10 1.0026019223736555 67.25788806695064 0.035701751708984375 3 0.7843291125380308 2.6081516971583554 52081.0 29.28682037034512 0.0 - - - - - - - 290.0 104 1 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 955 124 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47815.[MT7]-MDVLAR.2b3_1.heavy 424.743 / 490.245 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 957 124 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47815.[MT7]-MDVLAR.2y4_1.heavy 424.743 / 458.309 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 959 124 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47815.[MT7]-MDVLAR.2y5_1.heavy 424.743 / 573.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 961 124 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47815.[MT7]-MDVLAR.2b4_1.heavy 424.743 / 603.329 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 963 125 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534699.[MT7]-DQELSPR.2b3_1.heavy 494.763 / 517.237 27147.0 19.817299842834473 43 18 10 5 10 3.9667753555948386 25.209393281864955 0.04099845886230469 3 0.9874041381032044 10.984783677204463 27147.0 42.19011609444759 0.0 - - - - - - - 684.75 54 8 NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 965 125 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534699.[MT7]-DQELSPR.2y5_1.heavy 494.763 / 601.33 14251.0 19.817299842834473 43 18 10 5 10 3.9667753555948386 25.209393281864955 0.04099845886230469 3 0.9874041381032044 10.984783677204463 14251.0 36.41082411646079 0.0 - - - - - - - 790.7142857142857 28 7 NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 967 125 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534699.[MT7]-DQELSPR.2b4_1.heavy 494.763 / 630.321 12013.0 19.817299842834473 43 18 10 5 10 3.9667753555948386 25.209393281864955 0.04099845886230469 3 0.9874041381032044 10.984783677204463 12013.0 48.64193764499882 0.0 - - - - - - - 622.5714285714286 24 7 NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 969 125 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534699.[MT7]-DQELSPR.2y6_1.heavy 494.763 / 729.389 30739.0 19.817299842834473 43 18 10 5 10 3.9667753555948386 25.209393281864955 0.04099845886230469 3 0.9874041381032044 10.984783677204463 30739.0 140.1848215839861 0.0 - - - - - - - 235.625 61 8 NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 971 126 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 476120.0 32.837999979654946 23 -3 10 6 10 null 0.0 0.035701751708984375 3 0.0 0.0 476120.0 770.7766770202148 0.0 - - - - - - - 730.0 952 7 973 126 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 440920.0 32.837999979654946 23 -3 10 6 10 null 0.0 0.035701751708984375 3 0.0 0.0 440920.0 391.30474470273543 0.0 - - - - - - - 1208.4285714285713 881 7 975 126 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 888193.0 32.837999979654946 23 -3 10 6 10 null 0.0 0.035701751708984375 3 0.0 0.0 888193.0 624.6374658325681 0.0 - - - - - - - 479.0 1776 1 977 127 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536157.[MT7]-VVLSAAATAAPSLK[MT7].3b6_1.heavy 529.662 / 685.437 133606.0 33.95899963378906 46 16 10 10 10 3.9062439461149374 25.600039674802634 0.0 3 0.9649807086652307 6.575565169550197 133606.0 274.7168808586762 0.0 - - - - - - - 831.4285714285714 267 7 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 979 127 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536157.[MT7]-VVLSAAATAAPSLK[MT7].3b4_1.heavy 529.662 / 543.362 42715.0 33.95899963378906 46 16 10 10 10 3.9062439461149374 25.600039674802634 0.0 3 0.9649807086652307 6.575565169550197 42715.0 61.843439946177014 0.0 - - - - - - - 873.0 85 4 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 981 127 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536157.[MT7]-VVLSAAATAAPSLK[MT7].3b5_1.heavy 529.662 / 614.399 105309.0 33.95899963378906 46 16 10 10 10 3.9062439461149374 25.600039674802634 0.0 3 0.9649807086652307 6.575565169550197 105309.0 126.50790938484934 0.0 - - - - - - - 806.0 210 1 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 983 127 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536157.[MT7]-VVLSAAATAAPSLK[MT7].3y4_1.heavy 529.662 / 588.384 355060.0 33.95899963378906 46 16 10 10 10 3.9062439461149374 25.600039674802634 0.0 3 0.9649807086652307 6.575565169550197 355060.0 385.53584679280107 0.0 - - - - - - - 1388.0 710 4 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 985 128 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535012.[MT7]-VLETEEVYSHK[MT7].3y3_1.heavy 541.294 / 515.306 35538.0 28.024700164794922 44 14 10 10 10 2.2348358056298894 35.58683799852719 0.0 3 0.944434319016709 5.211074169269097 35538.0 30.608679433998212 0.0 - - - - - - - 1341.375 71 8 GRK5 G protein-coupled receptor kinase 5 987 128 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535012.[MT7]-VLETEEVYSHK[MT7].3b6_1.heavy 541.294 / 845.437 22677.0 28.024700164794922 44 14 10 10 10 2.2348358056298894 35.58683799852719 0.0 3 0.944434319016709 5.211074169269097 22677.0 50.415086989508936 0.0 - - - - - - - 274.9230769230769 45 13 GRK5 G protein-coupled receptor kinase 5 989 128 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535012.[MT7]-VLETEEVYSHK[MT7].3b5_1.heavy 541.294 / 716.395 16057.0 28.024700164794922 44 14 10 10 10 2.2348358056298894 35.58683799852719 0.0 3 0.944434319016709 5.211074169269097 16057.0 60.48665747565323 0.0 - - - - - - - 837.0 32 8 GRK5 G protein-coupled receptor kinase 5 991 128 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535012.[MT7]-VLETEEVYSHK[MT7].3y4_1.heavy 541.294 / 678.369 20166.0 28.024700164794922 44 14 10 10 10 2.2348358056298894 35.58683799852719 0.0 3 0.944434319016709 5.211074169269097 20166.0 30.179778439256005 0.0 - - - - - - - 729.3333333333334 40 12 GRK5 G protein-coupled receptor kinase 5 993 129 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535252.[MT7]-DQDADNLDR.2b3_1.heavy 603.279 / 503.222 5778.0 19.127050399780273 43 20 9 6 8 9.511926471670781 10.513117431871283 0.0326995849609375 4 0.9972120958968149 23.368051710607187 5778.0 2.4243356643356644 1.0 - - - - - - - 249.28571428571428 13 14 CTNNA3 catenin (cadherin-associated protein), alpha 3 995 129 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535252.[MT7]-DQDADNLDR.2y4_1.heavy 603.279 / 517.273 5492.0 19.127050399780273 43 20 9 6 8 9.511926471670781 10.513117431871283 0.0326995849609375 4 0.9972120958968149 23.368051710607187 5492.0 21.318841734853947 0.0 - - - - - - - 245.0 10 14 CTNNA3 catenin (cadherin-associated protein), alpha 3 997 129 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535252.[MT7]-DQDADNLDR.2y6_1.heavy 603.279 / 703.337 5320.0 19.127050399780273 43 20 9 6 8 9.511926471670781 10.513117431871283 0.0326995849609375 4 0.9972120958968149 23.368051710607187 5320.0 28.97725874125874 0.0 - - - - - - - 228.75 10 16 CTNNA3 catenin (cadherin-associated protein), alpha 3 999 129 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535252.[MT7]-DQDADNLDR.2b5_1.heavy 603.279 / 689.286 3947.0 19.127050399780273 43 20 9 6 8 9.511926471670781 10.513117431871283 0.0326995849609375 4 0.9972120958968149 23.368051710607187 3947.0 21.322654079722966 0.0 - - - - - - - 182.3125 7 16 CTNNA3 catenin (cadherin-associated protein), alpha 3 1001 130 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536232.[MT7]-DVLDIEQFSTVK[MT7].3b6_1.heavy 561.313 / 829.442 17180.0 40.09049987792969 48 18 10 10 10 3.680911212152365 27.167186122244523 0.0 3 0.9828021779659111 9.397260430286403 17180.0 33.77394043190702 0.0 - - - - - - - 244.53333333333333 34 15 GRK5;GRK6 G protein-coupled receptor kinase 5;G protein-coupled receptor kinase 6 1003 130 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536232.[MT7]-DVLDIEQFSTVK[MT7].3b4_1.heavy 561.313 / 587.316 107356.0 40.09049987792969 48 18 10 10 10 3.680911212152365 27.167186122244523 0.0 3 0.9828021779659111 9.397260430286403 107356.0 96.10063100308702 0.0 - - - - - - - 351.0 214 6 GRK5;GRK6 G protein-coupled receptor kinase 5;G protein-coupled receptor kinase 6 1005 130 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536232.[MT7]-DVLDIEQFSTVK[MT7].3b5_1.heavy 561.313 / 700.4 26890.0 40.09049987792969 48 18 10 10 10 3.680911212152365 27.167186122244523 0.0 3 0.9828021779659111 9.397260430286403 26890.0 42.137157073633055 0.0 - - - - - - - 721.5 53 8 GRK5;GRK6 G protein-coupled receptor kinase 5;G protein-coupled receptor kinase 6 1007 130 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536232.[MT7]-DVLDIEQFSTVK[MT7].3y4_1.heavy 561.313 / 578.363 51539.0 40.09049987792969 48 18 10 10 10 3.680911212152365 27.167186122244523 0.0 3 0.9828021779659111 9.397260430286403 51539.0 143.4557893110905 0.0 - - - - - - - 724.3333333333334 103 9 GRK5;GRK6 G protein-coupled receptor kinase 5;G protein-coupled receptor kinase 6 1009 131 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536035.[MT7]-VGHSELVGEIIR.3y7_1.heavy 484.948 / 799.504 38752.0 32.89630126953125 48 18 10 10 10 5.177510397666701 19.314302110347484 0.0 3 0.9846628978771123 9.952543385950406 38752.0 156.86076175140892 0.0 - - - - - - - 248.85714285714286 77 21 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1011 131 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536035.[MT7]-VGHSELVGEIIR.3y6_1.heavy 484.948 / 686.42 104518.0 32.89630126953125 48 18 10 10 10 5.177510397666701 19.314302110347484 0.0 3 0.9846628978771123 9.952543385950406 104518.0 191.52966832504146 0.0 - - - - - - - 712.1428571428571 209 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1013 131 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536035.[MT7]-VGHSELVGEIIR.3b5_1.heavy 484.948 / 654.333 59977.0 32.89630126953125 48 18 10 10 10 5.177510397666701 19.314302110347484 0.0 3 0.9846628978771123 9.952543385950406 59977.0 101.13284128429528 0.0 - - - - - - - 769.5714285714286 119 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1015 131 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536035.[MT7]-VGHSELVGEIIR.3y5_1.heavy 484.948 / 587.351 258239.0 32.89630126953125 48 18 10 10 10 5.177510397666701 19.314302110347484 0.0 3 0.9846628978771123 9.952543385950406 258239.0 211.19499858231293 0.0 - - - - - - - 322.0 516 1 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1017 132 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536231.[MT7]-DELTASLEEVRK[MT7].3y7_1.heavy 559.98 / 1004.59 8235.0 32.37690099080404 44 18 10 6 10 4.421498842855777 22.616764937432745 0.031200408935546875 3 0.9849765834146472 10.056174373880104 8235.0 29.40476310920969 0.0 - - - - - - - 195.9090909090909 16 22 CTNNA3 catenin (cadherin-associated protein), alpha 3 1019 132 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536231.[MT7]-DELTASLEEVRK[MT7].3y8_1.heavy 559.98 / 1075.62 5490.0 32.37690099080404 44 18 10 6 10 4.421498842855777 22.616764937432745 0.031200408935546875 3 0.9849765834146472 10.056174373880104 5490.0 72.51412438625204 0.0 - - - - - - - 163.16666666666666 10 12 CTNNA3 catenin (cadherin-associated protein), alpha 3 1021 132 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536231.[MT7]-DELTASLEEVRK[MT7].3y5_1.heavy 559.98 / 804.47 5333.0 32.37690099080404 44 18 10 6 10 4.421498842855777 22.616764937432745 0.031200408935546875 3 0.9849765834146472 10.056174373880104 5333.0 23.95794618484336 0.0 - - - - - - - 296.7391304347826 10 23 CTNNA3 catenin (cadherin-associated protein), alpha 3 1023 132 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536231.[MT7]-DELTASLEEVRK[MT7].3y9_1.heavy 559.98 / 1176.67 N/A 32.37690099080404 44 18 10 6 10 4.421498842855777 22.616764937432745 0.031200408935546875 3 0.9849765834146472 10.056174373880104 0.0 0.0 21.0 - - - - - - - 0.0 0 0 CTNNA3 catenin (cadherin-associated protein), alpha 3 1025 133 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47907.[MT7]-ALLAAVTR.2y5_1.heavy 479.812 / 517.309 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 1027 133 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47907.[MT7]-ALLAAVTR.2b4_1.heavy 479.812 / 513.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 1029 133 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47907.[MT7]-ALLAAVTR.2y6_1.heavy 479.812 / 630.393 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 1031 133 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47907.[MT7]-ALLAAVTR.2y7_1.heavy 479.812 / 743.477 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 1033 134 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 592545.0 27.333799362182617 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 592545.0 569.5995710233678 0.0 - - - - - - - 4148.0 1185 1 1035 134 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 735799.0 27.333799362182617 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 735799.0 659.9971906103335 0.0 - - - - - - - 5991.0 1471 1 1037 134 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 1017720.0 27.333799362182617 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1017720.0 1488.7242569913706 0.0 - - - - - - - 6683.0 2035 1 1039 135 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534930.[MT7]-YIIGIGK[MT7].2y4_1.heavy 526.341 / 518.342 34217.0 34.58509826660156 46 20 6 10 10 8.69805147984002 11.496827793187453 0.0 3 0.9923946039225184 14.14248798718418 34217.0 7.9846856314027415 1.0 - - - - - - - 357.5 87 2 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1041 135 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534930.[MT7]-YIIGIGK[MT7].2y5_1.heavy 526.341 / 631.426 27070.0 34.58509826660156 46 20 6 10 10 8.69805147984002 11.496827793187453 0.0 3 0.9923946039225184 14.14248798718418 27070.0 79.1774238203878 0.0 - - - - - - - 268.0 54 3 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1043 135 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534930.[MT7]-YIIGIGK[MT7].2b4_1.heavy 526.341 / 591.362 9023.0 34.58509826660156 46 20 6 10 10 8.69805147984002 11.496827793187453 0.0 3 0.9923946039225184 14.14248798718418 9023.0 3.850128480708885 5.0 - - - - - - - 179.0 130 1 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1045 135 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534930.[MT7]-YIIGIGK[MT7].2y6_1.heavy 526.341 / 744.51 10542.0 34.58509826660156 46 20 6 10 10 8.69805147984002 11.496827793187453 0.0 3 0.9923946039225184 14.14248798718418 10542.0 20.15444135909599 0.0 - - - - - - - 633.4545454545455 21 11 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1047 136 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48507.[MT7]-RLNFITEYIK[MT7].3y3_1.heavy 528.983 / 567.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 1049 136 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48507.[MT7]-RLNFITEYIK[MT7].3b4_1.heavy 528.983 / 675.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 1051 136 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48507.[MT7]-RLNFITEYIK[MT7].3b3_1.heavy 528.983 / 528.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 1053 136 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48507.[MT7]-RLNFITEYIK[MT7].3y5_1.heavy 528.983 / 797.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 1055 137 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48505.[MT7]-ELIRFDEETQR.3b9_2.heavy 527.278 / 639.328 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 1057 137 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48505.[MT7]-ELIRFDEETQR.3y6_1.heavy 527.278 / 777.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 1059 137 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48505.[MT7]-ELIRFDEETQR.3b3_1.heavy 527.278 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 1061 137 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48505.[MT7]-ELIRFDEETQR.3y5_1.heavy 527.278 / 662.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 1063 138 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49646.[MT7]-EILQEEEDLAEIVQLVGK[MT7].2b8_1.heavy 1172.15 / 1130.53 2336.0 52.596500396728516 41 15 10 6 10 1.682227254630791 40.412669215302515 0.0337982177734375 3 0.9571072260873368 5.937527148148052 2336.0 -3.63377777777778 0.0 - - - - - - - 108.0 4 10 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1065 138 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49646.[MT7]-EILQEEEDLAEIVQLVGK[MT7].2b3_1.heavy 1172.15 / 500.32 2560.0 52.596500396728516 41 15 10 6 10 1.682227254630791 40.412669215302515 0.0337982177734375 3 0.9571072260873368 5.937527148148052 2560.0 -3.9822222222222265 0.0 - - - - - - - 78.75 5 4 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1067 138 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49646.[MT7]-EILQEEEDLAEIVQLVGK[MT7].2b4_1.heavy 1172.15 / 628.379 3548.0 52.596500396728516 41 15 10 6 10 1.682227254630791 40.412669215302515 0.0337982177734375 3 0.9571072260873368 5.937527148148052 3548.0 -3.1537777777777762 0.0 - - - - - - - 90.0 7 6 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1069 138 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49646.[MT7]-EILQEEEDLAEIVQLVGK[MT7].2b9_1.heavy 1172.15 / 1243.62 2156.0 52.596500396728516 41 15 10 6 10 1.682227254630791 40.412669215302515 0.0337982177734375 3 0.9571072260873368 5.937527148148052 2156.0 -4.79111111111111 0.0 - - - - - - - 134.7 4 10 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1071 139 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49648.[MT7]-EILQEEEDLAEIVQLVGK[MT7].3b6_1.heavy 781.768 / 886.464 27100.0 52.613399505615234 43 13 10 10 10 1.6596604116983005 47.93491269950003 0.0 3 0.9250680028229908 4.480008036077276 27100.0 -24.636363636363626 0.0 - - - - - - - 124.5 54 12 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1073 139 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49648.[MT7]-EILQEEEDLAEIVQLVGK[MT7].3b4_1.heavy 781.768 / 628.379 44053.0 52.613399505615234 43 13 10 10 10 1.6596604116983005 47.93491269950003 0.0 3 0.9250680028229908 4.480008036077276 44053.0 276.5377128805136 0.0 - - - - - - - 219.69230769230768 88 13 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1075 139 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49648.[MT7]-EILQEEEDLAEIVQLVGK[MT7].3b3_1.heavy 781.768 / 500.32 48138.0 52.613399505615234 43 13 10 10 10 1.6596604116983005 47.93491269950003 0.0 3 0.9250680028229908 4.480008036077276 48138.0 -29.174545454545466 0.0 - - - - - - - 246.84615384615384 96 13 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1077 139 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49648.[MT7]-EILQEEEDLAEIVQLVGK[MT7].3b8_1.heavy 781.768 / 1130.53 97198.0 52.613399505615234 43 13 10 10 10 1.6596604116983005 47.93491269950003 0.0 3 0.9250680028229908 4.480008036077276 97198.0 -22.090454545454577 0.0 - - - - - - - 270.8333333333333 194 12 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1079 140 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534933.[MT7]-ILDFMK[MT7].2y4_1.heavy 527.814 / 684.351 4714.0 40.54029846191406 48 18 10 10 10 5.484903369770885 18.231861759157518 0.0 3 0.9872561050017254 10.920662339826272 4714.0 20.1144761675421 0.0 - - - - - - - 235.5909090909091 9 22 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1081 140 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534933.[MT7]-ILDFMK[MT7].2y5_1.heavy 527.814 / 797.435 5724.0 40.54029846191406 48 18 10 10 10 5.484903369770885 18.231861759157518 0.0 3 0.9872561050017254 10.920662339826272 5724.0 46.49736096286209 0.0 - - - - - - - 223.21052631578948 11 19 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1083 140 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534933.[MT7]-ILDFMK[MT7].2b4_1.heavy 527.814 / 633.373 2088.0 40.54029846191406 48 18 10 10 10 5.484903369770885 18.231861759157518 0.0 3 0.9872561050017254 10.920662339826272 2088.0 5.784834151070893 0.0 - - - - - - - 639.75 4 8 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1085 140 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534933.[MT7]-ILDFMK[MT7].2y3_1.heavy 527.814 / 569.324 6869.0 40.54029846191406 48 18 10 10 10 5.484903369770885 18.231861759157518 0.0 3 0.9872561050017254 10.920662339826272 6869.0 8.121012145748987 1.0 - - - - - - - 696.0 13 9 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1087 141 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48211.[MT7]-EVAGLWIK[MT7].2b4_1.heavy 602.371 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - GM2A GM2 ganglioside activator 1089 141 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48211.[MT7]-EVAGLWIK[MT7].2y3_1.heavy 602.371 / 590.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - GM2A GM2 ganglioside activator 1091 141 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48211.[MT7]-EVAGLWIK[MT7].2y6_1.heavy 602.371 / 831.521 N/A N/A - - - - - - - - - 0.0 - - - - - - - GM2A GM2 ganglioside activator 1093 141 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48211.[MT7]-EVAGLWIK[MT7].2b5_1.heavy 602.371 / 614.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - GM2A GM2 ganglioside activator 1095 142 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48787.[MT7]-VSFAK[MT7].2b3_1.heavy 420.265 / 478.278 4929.0 26.17169952392578 47 20 9 10 8 6.526146394476489 15.322978363561786 0.0 4 0.9917828283362415 13.605150535782146 4929.0 6.088565965583173 1.0 - - - - - - - 1241.75 13 8 LIMK1 LIM domain kinase 1 1097 142 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48787.[MT7]-VSFAK[MT7].2y4_1.heavy 420.265 / 596.352 56311.0 26.17169952392578 47 20 9 10 8 6.526146394476489 15.322978363561786 0.0 4 0.9917828283362415 13.605150535782146 56311.0 69.6186160240068 0.0 - - - - - - - 756.0 112 8 LIMK1 LIM domain kinase 1 1099 142 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48787.[MT7]-VSFAK[MT7].2b4_1.heavy 420.265 / 549.315 4929.0 26.17169952392578 47 20 9 10 8 6.526146394476489 15.322978363561786 0.0 4 0.9917828283362415 13.605150535782146 4929.0 2.6189380906898228 9.0 - - - - - - - 2265.222222222222 130 9 LIMK1 LIM domain kinase 1 1101 142 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48787.[MT7]-VSFAK[MT7].2y3_1.heavy 420.265 / 509.32 8738.0 26.17169952392578 47 20 9 10 8 6.526146394476489 15.322978363561786 0.0 4 0.9917828283362415 13.605150535782146 8738.0 3.946223888591323 1.0 - - - - - - - 753.1666666666666 17 12 LIMK1 LIM domain kinase 1 1103 143 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535597.[MT7]-SDVEAIFSK[MT7].3b6_1.heavy 428.574 / 759.401 12139.0 34.974998474121094 43 13 10 10 10 1.0344445374012683 57.40107886530304 0.0 3 0.9235624462023878 4.435095829458924 12139.0 103.87632657621057 0.0 - - - - - - - 170.0625 24 16 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1105 143 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535597.[MT7]-SDVEAIFSK[MT7].3y3_1.heavy 428.574 / 525.315 163330.0 34.974998474121094 43 13 10 10 10 1.0344445374012683 57.40107886530304 0.0 3 0.9235624462023878 4.435095829458924 163330.0 201.80961314269163 0.0 - - - - - - - 1229.4285714285713 326 7 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1107 143 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535597.[MT7]-SDVEAIFSK[MT7].3b4_1.heavy 428.574 / 575.279 63864.0 34.974998474121094 43 13 10 10 10 1.0344445374012683 57.40107886530304 0.0 3 0.9235624462023878 4.435095829458924 63864.0 138.37449250655675 0.0 - - - - - - - 294.5 127 8 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1109 143 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535597.[MT7]-SDVEAIFSK[MT7].3b5_1.heavy 428.574 / 646.316 139596.0 34.974998474121094 43 13 10 10 10 1.0344445374012683 57.40107886530304 0.0 3 0.9235624462023878 4.435095829458924 139596.0 244.2081028703912 0.0 - - - - - - - 271.8 279 5 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1111 144 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48785.[MT7]-GGNFSGR.2b3_1.heavy 419.718 / 373.195 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 1113 144 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48785.[MT7]-GGNFSGR.2y5_1.heavy 419.718 / 580.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 1115 144 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48785.[MT7]-GGNFSGR.2b4_1.heavy 419.718 / 520.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 1117 144 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48785.[MT7]-GGNFSGR.2y6_1.heavy 419.718 / 637.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 1119 145 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49649.[MT7]-EILQEEEDLAEIVQLVGK[MT7].4y4_1.heavy 586.578 / 560.389 46503.0 52.613399505615234 48 18 10 10 10 2.550452011891682 26.727549582201952 0.0 3 0.9801926126807079 8.754458777196287 46503.0 -4.208416289592776 0.0 - - - - - - - 189.0 93 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1121 145 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49649.[MT7]-EILQEEEDLAEIVQLVGK[MT7].4b4_1.heavy 586.578 / 628.379 47694.0 52.613399505615234 48 18 10 10 10 2.550452011891682 26.727549582201952 0.0 3 0.9801926126807079 8.754458777196287 47694.0 390.07010172546995 0.0 - - - - - - - 260.1 95 10 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1123 145 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49649.[MT7]-EILQEEEDLAEIVQLVGK[MT7].4b5_1.heavy 586.578 / 757.421 28546.0 52.613399505615234 48 18 10 10 10 2.550452011891682 26.727549582201952 0.0 3 0.9801926126807079 8.754458777196287 28546.0 -2.7714563106796106 0.0 - - - - - - - 200.77777777777777 57 9 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1125 145 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49649.[MT7]-EILQEEEDLAEIVQLVGK[MT7].4b3_1.heavy 586.578 / 500.32 60401.0 52.613399505615234 48 18 10 10 10 2.550452011891682 26.727549582201952 0.0 3 0.9801926126807079 8.754458777196287 60401.0 -4.558566037735858 0.0 - - - - - - - 226.25 120 8 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1127 146 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536339.[MT7]-RTALVANTSNMPVAAR.3b4_1.heavy 606.004 / 586.379 14739.0 27.024700164794922 44 16 10 10 8 3.617061420523415 27.64675198286494 0.0 4 0.9603366915394694 6.17620758360574 14739.0 13.202735624321406 1.0 - - - - - - - 712.7142857142857 31 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1129 146 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536339.[MT7]-RTALVANTSNMPVAAR.3b5_1.heavy 606.004 / 685.448 13818.0 27.024700164794922 44 16 10 10 8 3.617061420523415 27.64675198286494 0.0 4 0.9603366915394694 6.17620758360574 13818.0 9.409028070511592 0.0 - - - - - - - 733.4444444444445 27 9 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1131 146 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536339.[MT7]-RTALVANTSNMPVAAR.3y8_1.heavy 606.004 / 845.43 11438.0 27.024700164794922 44 16 10 10 8 3.617061420523415 27.64675198286494 0.0 4 0.9603366915394694 6.17620758360574 11438.0 18.527796469403654 0.0 - - - - - - - 342.09090909090907 22 11 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1133 146 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536339.[MT7]-RTALVANTSNMPVAAR.3y5_1.heavy 606.004 / 513.314 67783.0 27.024700164794922 44 16 10 10 8 3.617061420523415 27.64675198286494 0.0 4 0.9603366915394694 6.17620758360574 67783.0 10.804625716638242 0.0 - - - - - - - 384.0 135 1 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1135 147 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49323.[MT7]-ALFYAAEILC[CAM]GLEDLHR.3b5_1.heavy 712.374 / 710.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 1137 147 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49323.[MT7]-ALFYAAEILC[CAM]GLEDLHR.3y4_1.heavy 712.374 / 540.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 1139 147 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49323.[MT7]-ALFYAAEILC[CAM]GLEDLHR.3y8_1.heavy 712.374 / 999.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 1141 147 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49323.[MT7]-ALFYAAEILC[CAM]GLEDLHR.3b7_1.heavy 712.374 / 910.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 1143 148 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48488.[MT7]-NAAFLGPGVLQATR.2y8_1.heavy 779.945 / 841.489 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1145 148 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48488.[MT7]-NAAFLGPGVLQATR.2b4_1.heavy 779.945 / 548.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1147 148 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48488.[MT7]-NAAFLGPGVLQATR.2y9_1.heavy 779.945 / 898.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1149 148 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48488.[MT7]-NAAFLGPGVLQATR.2y10_1.heavy 779.945 / 1011.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1151 149 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534504.[MT7]-LNEQK[MT7].2b3_1.heavy 460.276 / 501.279 5406.0 18.272767384847004 31 17 2 6 6 1.847508019772914 41.617576203779095 0.03910064697265625 6 0.9787208620105663 8.445244249152823 5406.0 8.917800618040467 0.0 - - - - - - - 1146.857142857143 10 7 ATP5F1;ARHGEF10L ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1;Rho guanine nucleotide exchange factor (GEF) 10-like 1153 149 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534504.[MT7]-LNEQK[MT7].2y4_1.heavy 460.276 / 662.359 10812.0 18.272767384847004 31 17 2 6 6 1.847508019772914 41.617576203779095 0.03910064697265625 6 0.9787208620105663 8.445244249152823 10812.0 4.8146406269726425 1.0 - - - - - - - 1231.0 50 7 ATP5F1;ARHGEF10L ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1;Rho guanine nucleotide exchange factor (GEF) 10-like 1155 149 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534504.[MT7]-LNEQK[MT7].2y3_1.heavy 460.276 / 548.316 2301.0 18.272767384847004 31 17 2 6 6 1.847508019772914 41.617576203779095 0.03910064697265625 6 0.9787208620105663 8.445244249152823 2301.0 4.452199428518519 4.0 - - - - - - - 1224.25 6 8 ATP5F1;ARHGEF10L ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1;Rho guanine nucleotide exchange factor (GEF) 10-like 1157 150 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 377858.0 37.752498626708984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 377858.0 129.0991111975412 0.0 - - - - - - - 693.4444444444445 755 9 1159 150 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 769404.0 37.752498626708984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 769404.0 232.93011650062547 0.0 - - - - - - - 683.8888888888889 1538 9 1161 150 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 754483.0 37.752498626708984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 754483.0 153.0585399195464 0.0 - - - - - - - 844.1428571428571 1508 7 1163 151 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48111.[MT7]-DPHDPHK[MT7].2y6_1.heavy 567.301 / 874.465 1058.0 14.270299911499023 47 17 10 10 10 3.5357513856357974 28.282531516852686 0.0 3 0.975990364103934 7.9487126015298015 1058.0 41.250391849529784 0.0 - - - - - - - 58.55555555555556 2 9 IRF3 interferon regulatory factor 3 1165 151 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48111.[MT7]-DPHDPHK[MT7].2y4_1.heavy 567.301 / 640.354 265.0 14.270299911499023 47 17 10 10 10 3.5357513856357974 28.282531516852686 0.0 3 0.975990364103934 7.9487126015298015 265.0 3.144067796610169 2.0 - - - - - - - 0.0 0 0 IRF3 interferon regulatory factor 3 1167 151 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48111.[MT7]-DPHDPHK[MT7].2b4_1.heavy 567.301 / 609.275 1793.0 14.270299911499023 47 17 10 10 10 3.5357513856357974 28.282531516852686 0.0 3 0.975990364103934 7.9487126015298015 1793.0 41.93796610169492 0.0 - - - - - - - 55.388888888888886 3 18 IRF3 interferon regulatory factor 3 1169 151 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48111.[MT7]-DPHDPHK[MT7].2y3_1.heavy 567.301 / 525.326 3352.0 14.270299911499023 47 17 10 10 10 3.5357513856357974 28.282531516852686 0.0 3 0.975990364103934 7.9487126015298015 3352.0 19.205204411861835 0.0 - - - - - - - 196.45454545454547 6 22 IRF3 interferon regulatory factor 3 1171 152 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536225.[MT7]-HVVQSISTQQEK[MT7].3y3_1.heavy 557.98 / 548.316 30663.0 20.93269920349121 48 18 10 10 10 2.4209546631413286 28.219364316338442 0.0 3 0.9810101503999533 8.941532024263488 30663.0 43.65548899038814 0.0 - - - - - - - 760.4 61 10 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1173 152 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536225.[MT7]-HVVQSISTQQEK[MT7].3y6_1.heavy 557.98 / 864.454 25593.0 20.93269920349121 48 18 10 10 10 2.4209546631413286 28.219364316338442 0.0 3 0.9810101503999533 8.941532024263488 25593.0 203.6491685128946 0.0 - - - - - - - 177.0 51 15 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1175 152 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536225.[MT7]-HVVQSISTQQEK[MT7].3b4_1.heavy 557.98 / 608.364 24265.0 20.93269920349121 48 18 10 10 10 2.4209546631413286 28.219364316338442 0.0 3 0.9810101503999533 8.941532024263488 24265.0 42.37585674188467 0.0 - - - - - - - 273.9230769230769 48 13 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1177 152 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536225.[MT7]-HVVQSISTQQEK[MT7].3b5_1.heavy 557.98 / 695.396 24084.0 20.93269920349121 48 18 10 10 10 2.4209546631413286 28.219364316338442 0.0 3 0.9810101503999533 8.941532024263488 24084.0 34.11346682336918 0.0 - - - - - - - 326.0 48 10 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1179 153 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535084.[MT7]-SVMEELK[MT7].2y4_1.heavy 562.317 / 662.384 8458.0 31.27560043334961 43 16 9 10 8 2.0422359172640543 34.08746327349873 0.0 4 0.9693222133876647 7.028033043620046 8458.0 4.216963169455008 0.0 - - - - - - - 703.8571428571429 16 7 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 1181 153 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535084.[MT7]-SVMEELK[MT7].2y5_1.heavy 562.317 / 793.425 7428.0 31.27560043334961 43 16 9 10 8 2.0422359172640543 34.08746327349873 0.0 4 0.9693222133876647 7.028033043620046 7428.0 13.796058890147224 0.0 - - - - - - - 711.0 14 9 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 1183 153 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535084.[MT7]-SVMEELK[MT7].2y3_1.heavy 562.317 / 533.341 N/A 31.27560043334961 43 16 9 10 8 2.0422359172640543 34.08746327349873 0.0 4 0.9693222133876647 7.028033043620046 6252.0 4.534744082980165 1.0 - - - - - - - 441.0 12 1 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 1185 153 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535084.[MT7]-SVMEELK[MT7].2y6_1.heavy 562.317 / 892.493 4928.0 31.27560043334961 43 16 9 10 8 2.0422359172640543 34.08746327349873 0.0 4 0.9693222133876647 7.028033043620046 4928.0 30.990566796995125 1.0 - - - - - - - 225.25 19 16 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 1187 154 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535081.[MT7]-ASLAETDK[MT7].2y4_1.heavy 561.816 / 636.332 4219.0 21.20319938659668 46 20 6 10 10 8.383055076818994 11.928825360639962 0.0 3 0.9968840836081954 22.10327558652433 4219.0 30.08770158403847 0.0 - - - - - - - 155.75 8 24 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1189 154 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535081.[MT7]-ASLAETDK[MT7].2y5_1.heavy 561.816 / 707.369 N/A 21.20319938659668 46 20 6 10 10 8.383055076818994 11.928825360639962 0.0 3 0.9968840836081954 22.10327558652433 6088.0 15.7669344365075 1.0 - - - - - - - 214.44444444444446 17 18 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1191 154 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535081.[MT7]-ASLAETDK[MT7].2y3_1.heavy 561.816 / 507.289 3918.0 21.20319938659668 46 20 6 10 10 8.383055076818994 11.928825360639962 0.0 3 0.9968840836081954 22.10327558652433 3918.0 7.309966777408637 1.0 - - - - - - - 717.2 7 10 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1193 154 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535081.[MT7]-ASLAETDK[MT7].2y7_1.heavy 561.816 / 907.485 5123.0 21.20319938659668 46 20 6 10 10 8.383055076818994 11.928825360639962 0.0 3 0.9968840836081954 22.10327558652433 5123.0 37.32958170773219 0.0 - - - - - - - 183.95 10 20 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1195 155 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536023.[MT7]-VDSLLENLEK[MT7].2y4_1.heavy 724.416 / 647.385 4199.0 40.16790008544922 46 20 10 6 10 10.750513789852127 9.301881003528809 0.0316009521484375 3 0.9971502123161998 23.112819409299682 4199.0 10.104630437213462 0.0 - - - - - - - 704.6 8 10 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1197 155 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536023.[MT7]-VDSLLENLEK[MT7].2y5_1.heavy 724.416 / 776.427 4674.0 40.16790008544922 46 20 10 6 10 10.750513789852127 9.301881003528809 0.0316009521484375 3 0.9971502123161998 23.112819409299682 4674.0 17.947888233869012 0.0 - - - - - - - 298.8235294117647 9 17 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1199 155 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536023.[MT7]-VDSLLENLEK[MT7].2b4_1.heavy 724.416 / 559.321 3793.0 40.16790008544922 46 20 10 6 10 10.750513789852127 9.301881003528809 0.0316009521484375 3 0.9971502123161998 23.112819409299682 3793.0 2.3577311577311577 2.0 - - - - - - - 1664.4285714285713 7 7 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1201 155 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536023.[MT7]-VDSLLENLEK[MT7].2y6_1.heavy 724.416 / 889.511 3590.0 40.16790008544922 46 20 10 6 10 10.750513789852127 9.301881003528809 0.0316009521484375 3 0.9971502123161998 23.112819409299682 3590.0 3.031147540983606 1.0 - - - - - - - 725.8571428571429 7 7 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1203 156 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536429.[MT7]-IFRPSDLIHGEVLGK[MT7].4b8_1.heavy 493.042 / 1086.64 N/A 36.99553426106771 38 13 10 5 10 0.7877405141432137 80.6976668603785 0.041797637939453125 3 0.9075149991303569 4.026440899257318 87.0 1.92 14.0 - - - - - - - 0.0 0 0 LIMK1 LIM domain kinase 1 1205 156 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536429.[MT7]-IFRPSDLIHGEVLGK[MT7].4b7_1.heavy 493.042 / 973.559 5308.0 36.99553426106771 38 13 10 5 10 0.7877405141432137 80.6976668603785 0.041797637939453125 3 0.9075149991303569 4.026440899257318 5308.0 29.28551724137931 0.0 - - - - - - - 223.71428571428572 10 7 LIMK1 LIM domain kinase 1 1207 156 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536429.[MT7]-IFRPSDLIHGEVLGK[MT7].4y6_1.heavy 493.042 / 746.453 10095.0 36.99553426106771 38 13 10 5 10 0.7877405141432137 80.6976668603785 0.041797637939453125 3 0.9075149991303569 4.026440899257318 10095.0 42.6426724137931 0.0 - - - - - - - 221.45454545454547 20 11 LIMK1 LIM domain kinase 1 1209 156 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536429.[MT7]-IFRPSDLIHGEVLGK[MT7].4b6_1.heavy 493.042 / 860.475 16621.0 36.99553426106771 38 13 10 5 10 0.7877405141432137 80.6976668603785 0.041797637939453125 3 0.9075149991303569 4.026440899257318 16621.0 88.60894362342638 0.0 - - - - - - - 174.0 33 10 LIMK1 LIM domain kinase 1 1211 157 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536425.[MT7]-GIVSK[MT7]DEITFVSGAPR.3y7_1.heavy 655.373 / 733.399 6548.0 33.95899963378906 45 15 10 10 10 2.8127538226855213 28.15372126977158 0.0 3 0.9599467935200549 6.145870255936532 6548.0 23.96281876790831 0.0 - - - - - - - 742.0 13 8 ITGA6 integrin, alpha 6 1213 157 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536425.[MT7]-GIVSK[MT7]DEITFVSGAPR.3y8_1.heavy 655.373 / 834.447 8906.0 33.95899963378906 45 15 10 10 10 2.8127538226855213 28.15372126977158 0.0 3 0.9599467935200549 6.145870255936532 8906.0 16.10389016018307 1.0 - - - - - - - 342.0833333333333 17 12 ITGA6 integrin, alpha 6 1215 157 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536425.[MT7]-GIVSK[MT7]DEITFVSGAPR.3b7_2.heavy 655.373 / 509.295 14232.0 33.95899963378906 45 15 10 10 10 2.8127538226855213 28.15372126977158 0.0 3 0.9599467935200549 6.145870255936532 14232.0 8.917883866876027 1.0 - - - - - - - 766.2222222222222 29 9 ITGA6 integrin, alpha 6 1217 157 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536425.[MT7]-GIVSK[MT7]DEITFVSGAPR.3y10_1.heavy 655.373 / 1076.57 4977.0 33.95899963378906 45 15 10 10 10 2.8127538226855213 28.15372126977158 0.0 3 0.9599467935200549 6.145870255936532 4977.0 12.462864157119476 0.0 - - - - - - - 573.7142857142857 9 7 ITGA6 integrin, alpha 6 1219 158 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535465.[MT7]-QVRPVTEK[MT7].3y3_1.heavy 415.59 / 521.305 61048.0 18.481199264526367 45 15 10 10 10 1.8893096510072145 42.025849856074245 0.0 3 0.9545277997262348 5.765404695417966 61048.0 50.211910837060586 0.0 - - - - - - - 1238.625 122 8 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1221 158 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535465.[MT7]-QVRPVTEK[MT7].3y7_2.heavy 415.59 / 486.802 52836.0 18.481199264526367 45 15 10 10 10 1.8893096510072145 42.025849856074245 0.0 3 0.9545277997262348 5.765404695417966 52836.0 75.3887353996428 0.0 - - - - - - - 1168.0 105 8 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1223 158 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535465.[MT7]-QVRPVTEK[MT7].3y4_1.heavy 415.59 / 620.374 9457.0 18.481199264526367 45 15 10 10 10 1.8893096510072145 42.025849856074245 0.0 3 0.9545277997262348 5.765404695417966 9457.0 9.064167209574661 1.0 - - - - - - - 761.2222222222222 92 9 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1225 158 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535465.[MT7]-QVRPVTEK[MT7].3y5_1.heavy 415.59 / 717.426 25314.0 18.481199264526367 45 15 10 10 10 1.8893096510072145 42.025849856074245 0.0 3 0.9545277997262348 5.765404695417966 25314.0 129.33002317290553 0.0 - - - - - - - 226.58823529411765 50 17 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1227 159 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534924.[MT7]-GVNVSALSR.2y8_1.heavy 523.807 / 845.484 26340.0 27.680200576782227 48 18 10 10 10 4.009602450669731 24.940128411807216 0.0 3 0.9834655566581227 9.584453548610245 26340.0 90.47525551736612 0.0 - - - - - - - 322.6 52 15 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1229 159 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534924.[MT7]-GVNVSALSR.2y5_1.heavy 523.807 / 533.304 63048.0 27.680200576782227 48 18 10 10 10 4.009602450669731 24.940128411807216 0.0 3 0.9834655566581227 9.584453548610245 63048.0 78.95686375254265 0.0 - - - - - - - 806.375 126 8 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1231 159 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534924.[MT7]-GVNVSALSR.2b4_1.heavy 523.807 / 514.311 37783.0 27.680200576782227 48 18 10 10 10 4.009602450669731 24.940128411807216 0.0 3 0.9834655566581227 9.584453548610245 37783.0 28.19730220551839 0.0 - - - - - - - 2292.8571428571427 75 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1233 159 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534924.[MT7]-GVNVSALSR.2y7_1.heavy 523.807 / 746.416 53986.0 27.680200576782227 48 18 10 10 10 4.009602450669731 24.940128411807216 0.0 3 0.9834655566581227 9.584453548610245 53986.0 123.01244730043227 0.0 - - - - - - - 751.0 107 9 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1235 160 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534709.[MT7]-AAVAGEDGR.2y8_1.heavy 495.26 / 774.374 37828.0 16.73430061340332 50 20 10 10 10 7.0160123259669165 14.253110649462611 0.0 3 0.9931501114116317 14.902955277699824 37828.0 48.70297246474144 0.0 - - - - - - - 739.25 75 8 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1237 160 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534709.[MT7]-AAVAGEDGR.2y5_1.heavy 495.26 / 533.231 18285.0 16.73430061340332 50 20 10 10 10 7.0160123259669165 14.253110649462611 0.0 3 0.9931501114116317 14.902955277699824 18285.0 32.817331441229406 0.0 - - - - - - - 309.84615384615387 36 13 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1239 160 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534709.[MT7]-AAVAGEDGR.2y6_1.heavy 495.26 / 604.268 41729.0 16.73430061340332 50 20 10 10 10 7.0160123259669165 14.253110649462611 0.0 3 0.9931501114116317 14.902955277699824 41729.0 169.44728164157993 0.0 - - - - - - - 335.54545454545456 83 11 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1241 160 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534709.[MT7]-AAVAGEDGR.2y7_1.heavy 495.26 / 703.337 17572.0 16.73430061340332 50 20 10 10 10 7.0160123259669165 14.253110649462611 0.0 3 0.9931501114116317 14.902955277699824 17572.0 87.72454010630096 0.0 - - - - - - - 232.26666666666668 35 15 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1243 161 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536511.[MT7]-TVPEELVK[MT7]PEELSK[MT7].4b4_1.heavy 508.299 / 571.321 84296.0 32.46817398071289 39 13 10 6 10 1.2831700561548085 51.95466208621038 0.0323028564453125 3 0.9249359307396094 4.476014446329589 84296.0 37.038504655039816 0.0 - - - - - - - 1271.2857142857142 168 7 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1245 161 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536511.[MT7]-TVPEELVK[MT7]PEELSK[MT7].4b5_1.heavy 508.299 / 700.363 75239.0 32.46817398071289 39 13 10 6 10 1.2831700561548085 51.95466208621038 0.0323028564453125 3 0.9249359307396094 4.476014446329589 75239.0 97.73010579026716 0.0 - - - - - - - 738.8 150 10 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1247 161 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536511.[MT7]-TVPEELVK[MT7]PEELSK[MT7].4y7_2.heavy 508.299 / 559.837 92082.0 32.46817398071289 39 13 10 6 10 1.2831700561548085 51.95466208621038 0.0323028564453125 3 0.9249359307396094 4.476014446329589 92082.0 187.0281560138617 0.0 - - - - - - - 787.1818181818181 184 11 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1249 161 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536511.[MT7]-TVPEELVK[MT7]PEELSK[MT7].4y6_1.heavy 508.299 / 846.469 69836.0 32.46817398071289 39 13 10 6 10 1.2831700561548085 51.95466208621038 0.0323028564453125 3 0.9249359307396094 4.476014446329589 69836.0 122.42130569369664 0.0 - - - - - - - 291.0 139 6 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1251 162 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49124.[MT7]-EPVLPPQK[MT7].2y4_1.heavy 598.368 / 613.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 1253 162 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49124.[MT7]-EPVLPPQK[MT7].2y5_1.heavy 598.368 / 726.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 1255 162 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49124.[MT7]-EPVLPPQK[MT7].2y3_1.heavy 598.368 / 516.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 1257 162 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49124.[MT7]-EPVLPPQK[MT7].2y7_1.heavy 598.368 / 922.584 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 1259 163 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536653.[MT7]-IFPGDTILETGEVIPPMK[MT7].3b6_1.heavy 749.085 / 775.411 10812.0 44.864949226379395 44 18 10 6 10 3.0105486106344306 25.983053732652955 0.035800933837890625 3 0.9852798640729401 10.159498640513638 10812.0 17.011888111888112 1.0 - - - - - - - 242.9090909090909 24 11 NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 1261 163 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536653.[MT7]-IFPGDTILETGEVIPPMK[MT7].3y3_1.heavy 749.085 / 519.308 29509.0 44.864949226379395 44 18 10 6 10 3.0105486106344306 25.983053732652955 0.035800933837890625 3 0.9852798640729401 10.159498640513638 29509.0 27.269609283455296 0.0 - - - - - - - 678.4444444444445 59 9 NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 1263 163 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536653.[MT7]-IFPGDTILETGEVIPPMK[MT7].3b5_1.heavy 749.085 / 674.363 9158.0 44.864949226379395 44 18 10 6 10 3.0105486106344306 25.983053732652955 0.035800933837890625 3 0.9852798640729401 10.159498640513638 9158.0 12.167057142857143 1.0 - - - - - - - 652.125 18 8 NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 1265 163 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536653.[MT7]-IFPGDTILETGEVIPPMK[MT7].3b7_1.heavy 749.085 / 888.495 17299.0 44.864949226379395 44 18 10 6 10 3.0105486106344306 25.983053732652955 0.035800933837890625 3 0.9852798640729401 10.159498640513638 17299.0 16.914898311233486 0.0 - - - - - - - 275.6666666666667 34 6 NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 1267 164 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534703.[MT7]-VVPTC[CAM]LR.2y4_1.heavy 494.79 / 549.281 4934.0 28.42329978942871 50 20 10 10 10 15.281557114911527 6.543835765428734 0.0 3 0.9958359065577683 19.118390049693755 4934.0 6.863759374774052 2.0 - - - - - - - 1269.7272727272727 9 11 IRF3 interferon regulatory factor 3 1269 164 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534703.[MT7]-VVPTC[CAM]LR.2y5_1.heavy 494.79 / 646.334 58223.0 28.42329978942871 50 20 10 10 10 15.281557114911527 6.543835765428734 0.0 3 0.9958359065577683 19.118390049693755 58223.0 90.44385958212864 0.0 - - - - - - - 1203.857142857143 116 7 IRF3 interferon regulatory factor 3 1271 164 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534703.[MT7]-VVPTC[CAM]LR.2b4_1.heavy 494.79 / 541.347 2277.0 28.42329978942871 50 20 10 10 10 15.281557114911527 6.543835765428734 0.0 3 0.9958359065577683 19.118390049693755 2277.0 2.5900377023730314 13.0 - - - - - - - 1358.6 56 10 IRF3 interferon regulatory factor 3 1273 164 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534703.[MT7]-VVPTC[CAM]LR.2y6_1.heavy 494.79 / 745.403 25278.0 28.42329978942871 50 20 10 10 10 15.281557114911527 6.543835765428734 0.0 3 0.9958359065577683 19.118390049693755 25278.0 40.21387996100822 0.0 - - - - - - - 809.6666666666666 50 9 IRF3 interferon regulatory factor 3 1275 165 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536657.[MT7]-IFPGDTILETGEVIPPMK[MT7].4b7_1.heavy 562.065 / 888.495 5227.0 44.900750160217285 46 20 10 6 10 151.79601515811126 0.6587788216695916 0.035800933837890625 3 0.9953695280164767 18.129340862082554 5227.0 5.030167364016737 1.0 - - - - - - - 177.5 10 14 NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 1277 165 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536657.[MT7]-IFPGDTILETGEVIPPMK[MT7].4b5_1.heavy 562.065 / 674.363 5801.0 44.900750160217285 46 20 10 6 10 151.79601515811126 0.6587788216695916 0.035800933837890625 3 0.9953695280164767 18.129340862082554 5801.0 7.861554921540655 0.0 - - - - - - - 233.58333333333334 11 12 NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 1279 165 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536657.[MT7]-IFPGDTILETGEVIPPMK[MT7].4y3_1.heavy 562.065 / 519.308 14151.0 44.900750160217285 46 20 10 6 10 151.79601515811126 0.6587788216695916 0.035800933837890625 3 0.9953695280164767 18.129340862082554 14151.0 17.76682748615141 0.0 - - - - - - - 669.25 28 8 NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 1281 165 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536657.[MT7]-IFPGDTILETGEVIPPMK[MT7].4b6_1.heavy 562.065 / 775.411 5928.0 44.900750160217285 46 20 10 6 10 151.79601515811126 0.6587788216695916 0.035800933837890625 3 0.9953695280164767 18.129340862082554 5928.0 17.85312681764452 0.0 - - - - - - - 244.16666666666666 11 12 NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 1283 166 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536325.[MT7]-LGTLQPALVLAQVPGR.3y7_1.heavy 593.032 / 740.441 33597.0 43.096500396728516 48 18 10 10 10 2.9175270438179357 27.058746442720203 0.0 3 0.9822220232996762 9.242206963964717 33597.0 47.19290220820189 1.0 - - - - - - - 245.06666666666666 67 15 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 1285 166 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536325.[MT7]-LGTLQPALVLAQVPGR.3y6_1.heavy 593.032 / 627.357 51410.0 43.096500396728516 48 18 10 10 10 2.9175270438179357 27.058746442720203 0.0 3 0.9822220232996762 9.242206963964717 51410.0 201.30180812504722 0.0 - - - - - - - 322.25 102 12 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 1287 166 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536325.[MT7]-LGTLQPALVLAQVPGR.3b4_1.heavy 593.032 / 529.347 19081.0 43.096500396728516 48 18 10 10 10 2.9175270438179357 27.058746442720203 0.0 3 0.9822220232996762 9.242206963964717 19081.0 57.46250768369047 0.0 - - - - - - - 724.2857142857143 38 7 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 1289 166 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536325.[MT7]-LGTLQPALVLAQVPGR.3b5_1.heavy 593.032 / 657.405 72836.0 43.096500396728516 48 18 10 10 10 2.9175270438179357 27.058746442720203 0.0 3 0.9822220232996762 9.242206963964717 72836.0 188.95255989956576 0.0 - - - - - - - 697.375 145 8 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 1291 167 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536116.[MT7]-NAAFLGPGVLQATR.3y7_1.heavy 520.299 / 744.436 96963.0 37.35147476196289 46 20 10 6 10 4.863180063559042 20.562676827313805 0.03790283203125 3 0.9919998940165812 13.78873866059519 96963.0 131.3976348773842 0.0 - - - - - - - 296.0 193 2 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1293 167 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536116.[MT7]-NAAFLGPGVLQATR.3b6_1.heavy 520.299 / 718.4 83921.0 37.35147476196289 46 20 10 6 10 4.863180063559042 20.562676827313805 0.03790283203125 3 0.9919998940165812 13.78873866059519 83921.0 174.86543133047212 0.0 - - - - - - - 726.0 167 7 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1295 167 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536116.[MT7]-NAAFLGPGVLQATR.3b4_1.heavy 520.299 / 548.295 192655.0 37.35147476196289 46 20 10 6 10 4.863180063559042 20.562676827313805 0.03790283203125 3 0.9919998940165812 13.78873866059519 192655.0 189.7613436090174 0.0 - - - - - - - 932.0 385 1 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1297 167 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536116.[MT7]-NAAFLGPGVLQATR.3y5_1.heavy 520.299 / 588.346 161830.0 37.35147476196289 46 20 10 6 10 4.863180063559042 20.562676827313805 0.03790283203125 3 0.9919998940165812 13.78873866059519 161830.0 131.08754944855326 0.0 - - - - - - - 932.0 323 3 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1299 168 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535192.[MT7]-EFQTSAISR.2b3_1.heavy 591.815 / 549.279 10381.0 26.152799606323242 46 20 10 6 10 16.85592880886546 5.932630656781399 0.037799835205078125 3 0.9994159614576363 51.06466371788443 10381.0 13.6969500492126 0.0 - - - - - - - 791.6666666666666 20 15 ATP5G3 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) 1301 168 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535192.[MT7]-EFQTSAISR.2y8_1.heavy 591.815 / 909.479 37267.0 26.152799606323242 46 20 10 6 10 16.85592880886546 5.932630656781399 0.037799835205078125 3 0.9994159614576363 51.06466371788443 37267.0 60.01010373833883 0.0 - - - - - - - 728.0 74 8 ATP5G3 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) 1303 168 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535192.[MT7]-EFQTSAISR.2y6_1.heavy 591.815 / 634.352 15683.0 26.152799606323242 46 20 10 6 10 16.85592880886546 5.932630656781399 0.037799835205078125 3 0.9994159614576363 51.06466371788443 15683.0 48.991871651785715 0.0 - - - - - - - 737.5 31 8 ATP5G3 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) 1305 168 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535192.[MT7]-EFQTSAISR.2y7_1.heavy 591.815 / 762.41 14264.0 26.152799606323242 46 20 10 6 10 16.85592880886546 5.932630656781399 0.037799835205078125 3 0.9994159614576363 51.06466371788443 14264.0 98.43142941470865 0.0 - - - - - - - 250.71428571428572 28 14 ATP5G3 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) 1307 169 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536628.[MT7]-NSYPDVAVGSLSDSVTIFR.3b5_1.heavy 724.375 / 721.327 9087.0 43.096500396728516 46 16 10 10 10 2.1940665368719854 37.65097375948346 0.0 3 0.9617042006261618 6.286240526754315 9087.0 18.821302003081662 0.0 - - - - - - - 683.125 18 16 ITGA6 integrin, alpha 6 1309 169 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536628.[MT7]-NSYPDVAVGSLSDSVTIFR.3b3_1.heavy 724.375 / 509.248 8325.0 43.096500396728516 46 16 10 10 10 2.1940665368719854 37.65097375948346 0.0 3 0.9617042006261618 6.286240526754315 8325.0 19.83013436393845 0.0 - - - - - - - 715.7368421052631 16 19 ITGA6 integrin, alpha 6 1311 169 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536628.[MT7]-NSYPDVAVGSLSDSVTIFR.3y8_1.heavy 724.375 / 924.479 9278.0 43.096500396728516 46 16 10 10 10 2.1940665368719854 37.65097375948346 0.0 3 0.9617042006261618 6.286240526754315 9278.0 33.270449969034765 0.0 - - - - - - - 683.0833333333334 18 12 ITGA6 integrin, alpha 6 1313 169 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536628.[MT7]-NSYPDVAVGSLSDSVTIFR.3b7_1.heavy 724.375 / 891.433 8388.0 43.096500396728516 46 16 10 10 10 2.1940665368719854 37.65097375948346 0.0 3 0.9617042006261618 6.286240526754315 8388.0 47.38889763779528 0.0 - - - - - - - 690.5333333333333 16 15 ITGA6 integrin, alpha 6 1315 170 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535984.[MT7]-FTMVQVWPVR.2b3_1.heavy 703.89 / 524.266 16141.0 43.2681999206543 46 20 10 6 10 6.734069201360176 14.849862246708359 0.03780364990234375 3 0.9916446776621589 13.49204906109825 16141.0 27.976271043938436 0.0 - - - - - - - 654.4 32 10 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1317 170 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535984.[MT7]-FTMVQVWPVR.2b4_1.heavy 703.89 / 623.334 15633.0 43.2681999206543 46 20 10 6 10 6.734069201360176 14.849862246708359 0.03780364990234375 3 0.9916446776621589 13.49204906109825 15633.0 44.187223142171604 0.0 - - - - - - - 677.5555555555555 31 9 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1319 170 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535984.[MT7]-FTMVQVWPVR.2y9_1.heavy 703.89 / 1115.6 28215.0 43.2681999206543 46 20 10 6 10 6.734069201360176 14.849862246708359 0.03780364990234375 3 0.9916446776621589 13.49204906109825 28215.0 100.2708998776969 0.0 - - - - - - - 231.27272727272728 56 11 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1321 170 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535984.[MT7]-FTMVQVWPVR.2y6_1.heavy 703.89 / 784.446 12773.0 43.2681999206543 46 20 10 6 10 6.734069201360176 14.849862246708359 0.03780364990234375 3 0.9916446776621589 13.49204906109825 12773.0 58.54282249550266 0.0 - - - - - - - 321.8125 25 16 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1323 171 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536056.[MT7]-RIIDDSEITK[MT7].3y3_1.heavy 493.287 / 505.347 106081.0 26.51325035095215 34 8 10 6 10 1.4514496316138803 54.01274632891085 0.03459930419921875 3 0.7962052715687837 2.6859514575174175 106081.0 94.77057875733296 0.0 - - - - - - - 803.8571428571429 212 7 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 1325 171 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536056.[MT7]-RIIDDSEITK[MT7].3b4_1.heavy 493.287 / 642.406 27376.0 26.51325035095215 34 8 10 6 10 1.4514496316138803 54.01274632891085 0.03459930419921875 3 0.7962052715687837 2.6859514575174175 27376.0 27.521758142780335 0.0 - - - - - - - 750.75 54 8 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 1327 171 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536056.[MT7]-RIIDDSEITK[MT7].3b5_1.heavy 493.287 / 757.432 44029.0 26.51325035095215 34 8 10 6 10 1.4514496316138803 54.01274632891085 0.03459930419921875 3 0.7962052715687837 2.6859514575174175 44029.0 122.40037628580654 0.0 - - - - - - - 701.0 88 9 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 1329 171 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536056.[MT7]-RIIDDSEITK[MT7].3b7_1.heavy 493.287 / 973.507 20684.0 26.51325035095215 34 8 10 6 10 1.4514496316138803 54.01274632891085 0.03459930419921875 3 0.7962052715687837 2.6859514575174175 20684.0 132.90377192982456 0.0 - - - - - - - 213.75 41 16 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 1331 172 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535051.[MT7]-VDLVLEK[MT7].2y4_1.heavy 552.349 / 632.41 20359.0 34.0015983581543 50 20 10 10 10 12.555678720134312 7.964523641373509 0.0 3 0.9978327742515245 26.50524531603222 20359.0 36.85337573385519 0.0 - - - - - - - 724.0 40 8 GM2A GM2 ganglioside activator 1333 172 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535051.[MT7]-VDLVLEK[MT7].2b4_1.heavy 552.349 / 571.357 21722.0 34.0015983581543 50 20 10 10 10 12.555678720134312 7.964523641373509 0.0 3 0.9978327742515245 26.50524531603222 21722.0 31.0242011945966 1.0 - - - - - - - 828.7272727272727 43 11 GM2A GM2 ganglioside activator 1335 172 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535051.[MT7]-VDLVLEK[MT7].2y3_1.heavy 552.349 / 533.341 38844.0 34.0015983581543 50 20 10 10 10 12.555678720134312 7.964523641373509 0.0 3 0.9978327742515245 26.50524531603222 38844.0 52.43797505502568 1.0 - - - - - - - 1181.75 77 8 GM2A GM2 ganglioside activator 1337 172 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535051.[MT7]-VDLVLEK[MT7].2y6_1.heavy 552.349 / 860.521 21892.0 34.0015983581543 50 20 10 10 10 12.555678720134312 7.964523641373509 0.0 3 0.9978327742515245 26.50524531603222 21892.0 61.84643726538505 0.0 - - - - - - - 704.5454545454545 43 11 GM2A GM2 ganglioside activator 1339 173 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534951.[MT7]-ITLEVAK[MT7].2y4_1.heavy 531.344 / 590.363 18215.0 31.959624767303467 46 20 10 6 10 11.555824397174524 8.653644825586884 0.03249931335449219 3 0.9978063759496604 26.345221143897476 18215.0 20.706522955122416 0.0 - - - - - - - 1273.857142857143 36 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1341 173 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534951.[MT7]-ITLEVAK[MT7].2y5_1.heavy 531.344 / 703.447 9755.0 31.959624767303467 46 20 10 6 10 11.555824397174524 8.653644825586884 0.03249931335449219 3 0.9978063759496604 26.345221143897476 9755.0 7.894349660639058 0.0 - - - - - - - 1208.4285714285713 19 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1343 173 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534951.[MT7]-ITLEVAK[MT7].2b4_1.heavy 531.344 / 601.368 13718.0 31.959624767303467 46 20 10 6 10 11.555824397174524 8.653644825586884 0.03249931335449219 3 0.9978063759496604 26.345221143897476 13718.0 14.000241770448046 0.0 - - - - - - - 1654.857142857143 27 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1345 173 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534951.[MT7]-ITLEVAK[MT7].2y6_1.heavy 531.344 / 804.495 25074.0 31.959624767303467 46 20 10 6 10 11.555824397174524 8.653644825586884 0.03249931335449219 3 0.9978063759496604 26.345221143897476 25074.0 28.467952442515468 0.0 - - - - - - - 203.0 50 3 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1347 174 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535054.[MT7]-NVVVFDK[MT7].2y4_1.heavy 554.834 / 652.379 65567.0 30.64287519454956 46 20 10 6 10 5.19214261879553 15.318256666788441 0.03230094909667969 3 0.9917007385712009 13.537604710520522 65567.0 85.75793205818738 0.0 - - - - - - - 1261.857142857143 131 7 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1349 174 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535054.[MT7]-NVVVFDK[MT7].2y5_1.heavy 554.834 / 751.447 40158.0 30.64287519454956 46 20 10 6 10 5.19214261879553 15.318256666788441 0.03230094909667969 3 0.9917007385712009 13.537604710520522 40158.0 59.67855541718555 0.0 - - - - - - - 685.0769230769231 80 13 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1351 174 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535054.[MT7]-NVVVFDK[MT7].2y3_1.heavy 554.834 / 553.31 51621.0 30.64287519454956 46 20 10 6 10 5.19214261879553 15.318256666788441 0.03230094909667969 3 0.9917007385712009 13.537604710520522 51621.0 71.80160168598525 0.0 - - - - - - - 1195.375 103 8 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1353 174 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535054.[MT7]-NVVVFDK[MT7].2y6_1.heavy 554.834 / 850.516 22634.0 30.64287519454956 46 20 10 6 10 5.19214261879553 15.318256666788441 0.03230094909667969 3 0.9917007385712009 13.537604710520522 22634.0 155.02739726027397 0.0 - - - - - - - 261.2631578947368 45 19 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1355 175 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 521231.0 40.6196657816569 23 -3 10 6 10 null 0.0 0.033802032470703125 3 0.0 0.0 521231.0 211.807727299374 0.0 - - - - - - - 765.0 1042 2 1357 175 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 843845.0 40.6196657816569 23 -3 10 6 10 null 0.0 0.033802032470703125 3 0.0 0.0 843845.0 277.68148848209984 0.0 - - - - - - - 1243.0 1687 2 1359 175 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 947220.0 40.6196657816569 23 -3 10 6 10 null 0.0 0.033802032470703125 3 0.0 0.0 947220.0 270.07328996093895 0.0 - - - - - - - 1338.0 1894 1 1361 176 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48382.[MT7]-RHYLFDVQR.3y6_1.heavy 459.922 / 777.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1363 176 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48382.[MT7]-RHYLFDVQR.3b3_1.heavy 459.922 / 601.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1365 176 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48382.[MT7]-RHYLFDVQR.3y4_1.heavy 459.922 / 517.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1367 176 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48382.[MT7]-RHYLFDVQR.3y5_1.heavy 459.922 / 664.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1369 177 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535988.[MT7]-DWAGGFLDLK[MT7].3b6_1.heavy 470.594 / 778.364 14921.0 43.32500076293945 43 13 10 10 10 1.8940924193109439 40.98426218216013 0.0 3 0.924289620496718 4.4566216102478275 14921.0 145.56364430204798 0.0 - - - - - - - 182.05882352941177 29 17 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1371 177 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535988.[MT7]-DWAGGFLDLK[MT7].3y3_1.heavy 470.594 / 519.326 55322.0 43.32500076293945 43 13 10 10 10 1.8940924193109439 40.98426218216013 0.0 3 0.924289620496718 4.4566216102478275 55322.0 197.32717305754034 0.0 - - - - - - - 704.4285714285714 110 7 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1373 177 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535988.[MT7]-DWAGGFLDLK[MT7].3b4_1.heavy 470.594 / 574.274 14162.0 43.32500076293945 43 13 10 10 10 1.8940924193109439 40.98426218216013 0.0 3 0.924289620496718 4.4566216102478275 14162.0 92.39275479061389 0.0 - - - - - - - 221.22222222222223 28 18 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1375 177 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535988.[MT7]-DWAGGFLDLK[MT7].3b5_1.heavy 470.594 / 631.296 25606.0 43.32500076293945 43 13 10 10 10 1.8940924193109439 40.98426218216013 0.0 3 0.924289620496718 4.4566216102478275 25606.0 153.14981012658228 0.0 - - - - - - - 194.46153846153845 51 13 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1377 178 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48386.[MT7]-EAFNMIDQNR.2y5_1.heavy 691.336 / 645.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL12B;MYL9;MYL12A;LOC391722 myosin, light chain 12B, regulatory;myosin, light chain 9, regulatory;myosin, light chain 12A, regulatory, non-sarcomeric;calcium-dependent protein kinase 7-like 1379 178 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48386.[MT7]-EAFNMIDQNR.2y9_1.heavy 691.336 / 1108.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL12B;MYL9;MYL12A;LOC391722 myosin, light chain 12B, regulatory;myosin, light chain 9, regulatory;myosin, light chain 12A, regulatory, non-sarcomeric;calcium-dependent protein kinase 7-like 1381 178 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48386.[MT7]-EAFNMIDQNR.2b5_1.heavy 691.336 / 737.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL12B;MYL9;MYL12A;LOC391722 myosin, light chain 12B, regulatory;myosin, light chain 9, regulatory;myosin, light chain 12A, regulatory, non-sarcomeric;calcium-dependent protein kinase 7-like 1383 178 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48386.[MT7]-EAFNMIDQNR.2y7_1.heavy 691.336 / 890.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - MYL12B;MYL9;MYL12A;LOC391722 myosin, light chain 12B, regulatory;myosin, light chain 9, regulatory;myosin, light chain 12A, regulatory, non-sarcomeric;calcium-dependent protein kinase 7-like 1385 179 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 294785.0 35.719398498535156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 294785.0 444.2262175251698 0.0 - - - - - - - 239.2 589 10 1387 179 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 76661.0 35.719398498535156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 76661.0 72.83624853880046 0.0 - - - - - - - 689.125 153 8 1389 179 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 73995.0 35.719398498535156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 73995.0 90.9216597151612 0.0 - - - - - - - 1149.0 147 8 1391 180 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48762.[MT7]-GFGFVTYATVEEVDAAMNARPHK[MT7].4y8_1.heavy 700.36 / 1068.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPA1 heterogeneous nuclear ribonucleoprotein A1 1393 180 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48762.[MT7]-GFGFVTYATVEEVDAAMNARPHK[MT7].4b4_1.heavy 700.36 / 553.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPA1 heterogeneous nuclear ribonucleoprotein A1 1395 180 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48762.[MT7]-GFGFVTYATVEEVDAAMNARPHK[MT7].4b5_1.heavy 700.36 / 652.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPA1 heterogeneous nuclear ribonucleoprotein A1 1397 180 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48762.[MT7]-GFGFVTYATVEEVDAAMNARPHK[MT7].4y3_1.heavy 700.36 / 525.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPA1 heterogeneous nuclear ribonucleoprotein A1 1399 181 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48766.[MT7]-SAHLLPEHIFDGEGLASSFGYDVAVVDLNK[MT7].4b7_1.heavy 872.954 / 892.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 1401 181 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48766.[MT7]-SAHLLPEHIFDGEGLASSFGYDVAVVDLNK[MT7].4b4_1.heavy 872.954 / 553.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 1403 181 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48766.[MT7]-SAHLLPEHIFDGEGLASSFGYDVAVVDLNK[MT7].4b14_2.heavy 872.954 / 824.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 1405 181 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48766.[MT7]-SAHLLPEHIFDGEGLASSFGYDVAVVDLNK[MT7].4b5_1.heavy 872.954 / 666.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 1407 182 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535689.[MT7]-GLVMVAGELK[MT7].3b4_1.heavy 435.6 / 545.324 38765.0 37.255648612976074 46 20 10 6 10 17.117084011812413 5.842116562084436 0.037799835205078125 3 0.9988325201330202 36.11564772502967 38765.0 73.89933947965338 0.0 - - - - - - - 710.7142857142857 77 7 LIMK1 LIM domain kinase 1 1409 182 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535689.[MT7]-GLVMVAGELK[MT7].3b5_1.heavy 435.6 / 644.392 15695.0 37.255648612976074 46 20 10 6 10 17.117084011812413 5.842116562084436 0.037799835205078125 3 0.9988325201330202 36.11564772502967 15695.0 58.612959207459205 0.0 - - - - - - - 268.8 31 15 LIMK1 LIM domain kinase 1 1411 182 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535689.[MT7]-GLVMVAGELK[MT7].3y4_1.heavy 435.6 / 590.363 22984.0 37.255648612976074 46 20 10 6 10 17.117084011812413 5.842116562084436 0.037799835205078125 3 0.9988325201330202 36.11564772502967 22984.0 72.29918446601941 0.0 - - - - - - - 288.0 45 14 LIMK1 LIM domain kinase 1 1413 182 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535689.[MT7]-GLVMVAGELK[MT7].3y5_1.heavy 435.6 / 661.4 11835.0 37.255648612976074 46 20 10 6 10 17.117084011812413 5.842116562084436 0.037799835205078125 3 0.9988325201330202 36.11564772502967 11835.0 53.69081462820912 0.0 - - - - - - - 224.30769230769232 23 13 LIMK1 LIM domain kinase 1 1415 183 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535873.[MT7]-SSEQILATLK[MT7].3y3_1.heavy 459.945 / 505.347 161680.0 35.05229949951172 42 12 10 10 10 2.412543548920017 27.63335264829114 0.0 2 0.8859337368854077 3.618815301956841 161680.0 73.75782933843905 0.0 - - - - - - - 734.0 323 2 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1417 183 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535873.[MT7]-SSEQILATLK[MT7].3b3_1.heavy 459.945 / 448.216 81528.0 35.05229949951172 42 12 10 10 10 2.412543548920017 27.63335264829114 0.0 2 0.8859337368854077 3.618815301956841 81528.0 103.00530788967288 0.0 - - - - - - - 397.6666666666667 163 3 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1419 184 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49301.[MT7]-ANHSGAVVLLK[MT7].3b6_1.heavy 466.289 / 682.339 16154.0 27.823099613189697 40 14 10 6 10 2.183584109721174 36.209848325970434 0.03719902038574219 3 0.9482962335154642 5.403959217664761 16154.0 37.27277884615384 0.0 - - - - - - - 371.5 32 8 ITGA6 integrin, alpha 6 1421 184 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49301.[MT7]-ANHSGAVVLLK[MT7].3y3_1.heavy 466.289 / 517.383 43814.0 27.823099613189697 40 14 10 6 10 2.183584109721174 36.209848325970434 0.03719902038574219 3 0.9482962335154642 5.403959217664761 43814.0 25.785567846118745 0.0 - - - - - - - 813.0 87 3 ITGA6 integrin, alpha 6 1423 184 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49301.[MT7]-ANHSGAVVLLK[MT7].3b5_1.heavy 466.289 / 611.302 6934.0 27.823099613189697 40 14 10 6 10 2.183584109721174 36.209848325970434 0.03719902038574219 3 0.9482962335154642 5.403959217664761 6934.0 15.636780485971475 0.0 - - - - - - - 674.8571428571429 13 14 ITGA6 integrin, alpha 6 1425 184 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49301.[MT7]-ANHSGAVVLLK[MT7].3b5_2.heavy 466.289 / 306.155 21259.0 27.823099613189697 40 14 10 6 10 2.183584109721174 36.209848325970434 0.03719902038574219 3 0.9482962335154642 5.403959217664761 21259.0 37.22655420190431 0.0 - - - - - - - 731.6 42 10 ITGA6 integrin, alpha 6 1427 185 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536104.[MT7]-TEFDFSDYVK[MT7].3y3_1.heavy 513.592 / 553.347 25867.0 38.33785057067871 44 18 10 6 10 4.003705214253971 24.976863842018265 0.03820037841796875 3 0.980666284143482 8.861403247403675 25867.0 24.93546718224194 0.0 - - - - - - - 755.5 51 8 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1429 185 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536104.[MT7]-TEFDFSDYVK[MT7].3b4_1.heavy 513.592 / 637.295 51976.0 38.33785057067871 44 18 10 6 10 4.003705214253971 24.976863842018265 0.03820037841796875 3 0.980666284143482 8.861403247403675 51976.0 123.91479740328481 0.0 - - - - - - - 695.9090909090909 103 11 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1431 185 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536104.[MT7]-TEFDFSDYVK[MT7].3b3_1.heavy 513.592 / 522.268 11120.0 38.33785057067871 44 18 10 6 10 4.003705214253971 24.976863842018265 0.03820037841796875 3 0.980666284143482 8.861403247403675 11120.0 17.247370004240025 0.0 - - - - - - - 716.2222222222222 22 9 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1433 185 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536104.[MT7]-TEFDFSDYVK[MT7].3b7_1.heavy 513.592 / 986.422 9106.0 38.33785057067871 44 18 10 6 10 4.003705214253971 24.976863842018265 0.03820037841796875 3 0.980666284143482 8.861403247403675 9106.0 88.34656999127355 0.0 - - - - - - - 212.92857142857142 18 14 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1435 186 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536246.[MT7]-EDSQRPGAHLTVK[MT7].3y11_2.heavy 575.988 / 669.392 4340.0 20.86359977722168 41 11 10 10 10 2.083738839890949 47.990658947084476 0.0 3 0.8686103677154456 3.366726166911385 4340.0 11.661040988231385 0.0 - - - - - - - 706.0 8 7 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 1437 186 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536246.[MT7]-EDSQRPGAHLTVK[MT7].3b5_1.heavy 575.988 / 760.371 603.0 20.86359977722168 41 11 10 10 10 2.083738839890949 47.990658947084476 0.0 3 0.8686103677154456 3.366726166911385 603.0 3.255786053853637 10.0 - - - - - - - 0.0 1 0 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 1439 186 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536246.[MT7]-EDSQRPGAHLTVK[MT7].3y8_1.heavy 575.988 / 966.585 1627.0 20.86359977722168 41 11 10 10 10 2.083738839890949 47.990658947084476 0.0 3 0.8686103677154456 3.366726166911385 1627.0 14.651988950276241 0.0 - - - - - - - 120.6 3 15 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 1441 186 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536246.[MT7]-EDSQRPGAHLTVK[MT7].3y12_2.heavy 575.988 / 726.906 3797.0 20.86359977722168 41 11 10 10 10 2.083738839890949 47.990658947084476 0.0 3 0.8686103677154456 3.366726166911385 3797.0 13.644339882166847 0.0 - - - - - - - 219.8235294117647 7 17 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 1443 187 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48633.[MT7]-LIATFPDTLTYSAYR.3y6_1.heavy 626.004 / 760.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 1445 187 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48633.[MT7]-LIATFPDTLTYSAYR.3b4_1.heavy 626.004 / 543.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 1447 187 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48633.[MT7]-LIATFPDTLTYSAYR.3y5_1.heavy 626.004 / 659.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 1449 187 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48633.[MT7]-LIATFPDTLTYSAYR.3y9_1.heavy 626.004 / 1089.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 1451 188 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536045.[MT7]-EELGARPDATK[MT7].3y10_2.heavy 492.275 / 601.336 5923.0 20.61090087890625 44 14 10 10 10 1.5287435967902896 45.996032570436796 0.0 3 0.9337126481763139 4.766705456016504 5923.0 9.334559099437149 1.0 - - - - - - - 1095.75 11 8 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1453 188 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536045.[MT7]-EELGARPDATK[MT7].3b4_1.heavy 492.275 / 573.3 4916.0 20.61090087890625 44 14 10 10 10 1.5287435967902896 45.996032570436796 0.0 3 0.9337126481763139 4.766705456016504 4916.0 6.242880617003695 0.0 - - - - - - - 725.5833333333334 9 12 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1455 188 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536045.[MT7]-EELGARPDATK[MT7].3y4_1.heavy 492.275 / 578.327 11610.0 20.61090087890625 44 14 10 10 10 1.5287435967902896 45.996032570436796 0.0 3 0.9337126481763139 4.766705456016504 11610.0 20.178429231775322 0.0 - - - - - - - 722.5 23 10 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1457 188 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536045.[MT7]-EELGARPDATK[MT7].3y5_1.heavy 492.275 / 675.379 8648.0 20.61090087890625 44 14 10 10 10 1.5287435967902896 45.996032570436796 0.0 3 0.9337126481763139 4.766705456016504 8648.0 36.634530018809414 0.0 - - - - - - - 643.0 17 7 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1459 189 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49207.[MT7]-SDVEAIFSK[MT7].2y4_1.heavy 642.358 / 638.399 4188.0 34.974998474121094 50 20 10 10 10 5.791610609315313 17.26635417083436 0.0 3 0.9945276535364427 16.67544096393389 4188.0 2.1204471389101562 0.0 - - - - - - - 1204.2222222222222 8 9 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1461 189 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49207.[MT7]-SDVEAIFSK[MT7].2b4_1.heavy 642.358 / 575.279 8103.0 34.974998474121094 50 20 10 10 10 5.791610609315313 17.26635417083436 0.0 3 0.9945276535364427 16.67544096393389 8103.0 6.647982548561357 0.0 - - - - - - - 1143.5555555555557 16 9 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1463 189 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49207.[MT7]-SDVEAIFSK[MT7].2y3_1.heavy 642.358 / 525.315 12929.0 34.974998474121094 50 20 10 10 10 5.791610609315313 17.26635417083436 0.0 3 0.9945276535364427 16.67544096393389 12929.0 22.258894379584838 0.0 - - - - - - - 1194.111111111111 25 9 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1465 189 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49207.[MT7]-SDVEAIFSK[MT7].2b5_1.heavy 642.358 / 646.316 9105.0 34.974998474121094 50 20 10 10 10 5.791610609315313 17.26635417083436 0.0 3 0.9945276535364427 16.67544096393389 9105.0 11.132877340650204 0.0 - - - - - - - 650.0 18 7 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1467 190 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49611.[MT7]-ALQDEWDAVMLHSFTLR.3y6_1.heavy 726.037 / 760.41 22371.0 48.505401611328125 44 14 10 10 10 4.050596900521893 19.737875226487674 0.0 3 0.9488178149068679 5.43166507135837 22371.0 118.90501293411404 0.0 - - - - - - - 233.71428571428572 44 21 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1469 190 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49611.[MT7]-ALQDEWDAVMLHSFTLR.3b4_1.heavy 726.037 / 572.316 13854.0 48.505401611328125 44 14 10 10 10 4.050596900521893 19.737875226487674 0.0 3 0.9488178149068679 5.43166507135837 13854.0 30.05367065704751 0.0 - - - - - - - 681.5 27 14 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1471 190 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49611.[MT7]-ALQDEWDAVMLHSFTLR.3b5_1.heavy 726.037 / 701.359 22641.0 48.505401611328125 44 14 10 10 10 4.050596900521893 19.737875226487674 0.0 3 0.9488178149068679 5.43166507135837 22641.0 28.191064550198806 0.0 - - - - - - - 736.7777777777778 45 9 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1473 190 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49611.[MT7]-ALQDEWDAVMLHSFTLR.3b7_1.heavy 726.037 / 1002.46 16280.0 48.505401611328125 44 14 10 10 10 4.050596900521893 19.737875226487674 0.0 3 0.9488178149068679 5.43166507135837 16280.0 73.44052284722032 0.0 - - - - - - - 254.8181818181818 32 22 PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1475 191 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535485.[MT7]-K[MT7]DETNVK[MT7].3y3_1.heavy 422.586 / 504.326 11367.0 15.952450037002563 40 14 10 6 10 2.839504622573255 27.968757342643915 0.03020000457763672 3 0.9443020716533498 5.204825431152551 11367.0 22.767436582742913 0.0 - - - - - - - 663.7 22 10 HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1477 191 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535485.[MT7]-K[MT7]DETNVK[MT7].3b3_2.heavy 422.586 / 331.192 14402.0 15.952450037002563 40 14 10 6 10 2.839504622573255 27.968757342643915 0.03020000457763672 3 0.9443020716533498 5.204825431152551 14402.0 9.13040294366972 0.0 - - - - - - - 1312.5454545454545 28 11 HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1479 191 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535485.[MT7]-K[MT7]DETNVK[MT7].3y4_1.heavy 422.586 / 605.374 6354.0 15.952450037002563 40 14 10 6 10 2.839504622573255 27.968757342643915 0.03020000457763672 3 0.9443020716533498 5.204825431152551 6354.0 27.89298305084746 0.0 - - - - - - - 227.75 12 20 HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1481 191 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535485.[MT7]-K[MT7]DETNVK[MT7].3y5_1.heavy 422.586 / 734.417 4766.0 15.952450037002563 40 14 10 6 10 2.839504622573255 27.968757342643915 0.03020000457763672 3 0.9443020716533498 5.204825431152551 4766.0 57.12915792628109 0.0 - - - - - - - 119.28571428571429 9 21 HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1483 192 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49392.[MT7]-VFYYLVQDLK[MT7].2b3_1.heavy 788.455 / 554.31 8805.0 47.976850509643555 43 17 10 6 10 2.437735770990405 35.03158759336753 0.033298492431640625 3 0.9729448742894571 7.486064087364102 8805.0 34.777760144228324 0.0 - - - - - - - 291.5263157894737 17 19 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 1485 192 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49392.[MT7]-VFYYLVQDLK[MT7].2y5_1.heavy 788.455 / 746.453 5759.0 47.976850509643555 43 17 10 6 10 2.437735770990405 35.03158759336753 0.033298492431640625 3 0.9729448742894571 7.486064087364102 5759.0 20.857888544682005 0.0 - - - - - - - 279.54545454545456 11 22 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 1487 192 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49392.[MT7]-VFYYLVQDLK[MT7].2b4_1.heavy 788.455 / 717.373 6147.0 47.976850509643555 43 17 10 6 10 2.437735770990405 35.03158759336753 0.033298492431640625 3 0.9729448742894571 7.486064087364102 6147.0 19.808843755090642 0.0 - - - - - - - 728.0 12 7 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 1489 192 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49392.[MT7]-VFYYLVQDLK[MT7].2y7_1.heavy 788.455 / 1022.6 6701.0 47.976850509643555 43 17 10 6 10 2.437735770990405 35.03158759336753 0.033298492431640625 3 0.9729448742894571 7.486064087364102 6701.0 22.985093059963678 0.0 - - - - - - - 226.8095238095238 13 21 MAGOH;MAGOHB mago-nashi homolog, proliferation-associated (Drosophila);mago-nashi homolog B (Drosophila) 1491 193 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48911.[MT7]-VYFFK[MT7].2b3_1.heavy 496.296 / 554.31 2578.0 37.18659973144531 47 17 10 10 10 2.661448470431035 37.57352475954738 0.0 3 0.9700559373831797 7.114056302334556 2578.0 6.551231134671649 0.0 - - - - - - - 622.0 5 7 MMP19;VTN matrix metallopeptidase 19;vitronectin 1493 193 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48911.[MT7]-VYFFK[MT7].2y4_1.heavy 496.296 / 748.415 7111.0 37.18659973144531 47 17 10 10 10 2.661448470431035 37.57352475954738 0.0 3 0.9700559373831797 7.114056302334556 7111.0 85.95937317099606 0.0 - - - - - - - 228.78571428571428 14 14 MMP19;VTN matrix metallopeptidase 19;vitronectin 1495 193 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48911.[MT7]-VYFFK[MT7].2y3_1.heavy 496.296 / 585.352 5955.0 37.18659973144531 47 17 10 10 10 2.661448470431035 37.57352475954738 0.0 3 0.9700559373831797 7.114056302334556 5955.0 14.156745539444227 0.0 - - - - - - - 733.25 11 12 MMP19;VTN matrix metallopeptidase 19;vitronectin 1497 194 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48913.[MT7]-DETNVK[MT7].2y4_1.heavy 497.276 / 605.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1499 194 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48913.[MT7]-DETNVK[MT7].2y5_1.heavy 497.276 / 734.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1501 194 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48913.[MT7]-DETNVK[MT7].2b4_1.heavy 497.276 / 604.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1503 194 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48913.[MT7]-DETNVK[MT7].2b5_1.heavy 497.276 / 703.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1505 195 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535589.[MT7]-DLFTELQK[MT7].3y3_1.heavy 427.915 / 532.357 56897.0 37.60559844970703 47 17 10 10 10 2.2156069484484133 35.97081406795467 0.0 3 0.9733037461194776 7.5364404935083895 56897.0 82.64842424599897 0.0 - - - - - - - 605.3333333333334 113 9 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1507 195 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535589.[MT7]-DLFTELQK[MT7].3b4_1.heavy 427.915 / 621.336 13489.0 37.60559844970703 47 17 10 10 10 2.2156069484484133 35.97081406795467 0.0 3 0.9733037461194776 7.5364404935083895 13489.0 47.042562620423894 0.0 - - - - - - - 194.25 26 8 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1509 195 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535589.[MT7]-DLFTELQK[MT7].3b5_1.heavy 427.915 / 750.379 32858.0 37.60559844970703 47 17 10 10 10 2.2156069484484133 35.97081406795467 0.0 3 0.9733037461194776 7.5364404935083895 32858.0 290.19054522730823 0.0 - - - - - - - 194.375 65 16 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1511 195 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535589.[MT7]-DLFTELQK[MT7].3b3_1.heavy 427.915 / 520.289 62690.0 37.60559844970703 47 17 10 10 10 2.2156069484484133 35.97081406795467 0.0 3 0.9733037461194776 7.5364404935083895 62690.0 82.07081877659913 0.0 - - - - - - - 749.3333333333334 125 9 ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1513 196 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534805.[MT7]-FSLFAER.2y4_1.heavy 507.28 / 522.267 4859.0 38.385650634765625 46 20 10 6 10 4.264289106366942 23.450567610599293 0.038299560546875 3 0.9905989840409452 12.718448997557639 4859.0 6.641573759746724 0.0 - - - - - - - 703.0 9 13 ITGA6 integrin, alpha 6 1515 196 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534805.[MT7]-FSLFAER.2b6_1.heavy 507.28 / 839.442 988.0 38.385650634765625 46 20 10 6 10 4.264289106366942 23.450567610599293 0.038299560546875 3 0.9905989840409452 12.718448997557639 988.0 2.352887537993921 2.0 - - - - - - - 240.53846153846155 2 13 ITGA6 integrin, alpha 6 1517 196 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534805.[MT7]-FSLFAER.2y6_1.heavy 507.28 / 722.383 12106.0 38.385650634765625 46 20 10 6 10 4.264289106366942 23.450567610599293 0.038299560546875 3 0.9905989840409452 12.718448997557639 12106.0 50.84173419424597 0.0 - - - - - - - 288.1666666666667 24 18 ITGA6 integrin, alpha 6 1519 196 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534805.[MT7]-FSLFAER.2b5_1.heavy 507.28 / 710.399 2306.0 38.385650634765625 46 20 10 6 10 4.264289106366942 23.450567610599293 0.038299560546875 3 0.9905989840409452 12.718448997557639 2306.0 12.320390314846115 0.0 - - - - - - - 242.44444444444446 4 18 ITGA6 integrin, alpha 6 1521 197 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536630.[MT7]-TLPGWPVTLPDPGMSLTDR.3b4_1.heavy 733.053 / 513.315 12564.0 46.39940071105957 39 13 10 6 10 1.4076122232929407 46.42949852261096 0.03639984130859375 3 0.9000545528121126 3.870753809674422 12564.0 24.867468802384057 0.0 - - - - - - - 276.84615384615387 25 13 IRF3 interferon regulatory factor 3 1523 197 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536630.[MT7]-TLPGWPVTLPDPGMSLTDR.3b5_1.heavy 733.053 / 699.395 35863.0 46.39940071105957 39 13 10 6 10 1.4076122232929407 46.42949852261096 0.03639984130859375 3 0.9000545528121126 3.870753809674422 35863.0 140.10883898305084 0.0 - - - - - - - 678.5 71 8 IRF3 interferon regulatory factor 3 1525 197 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536630.[MT7]-TLPGWPVTLPDPGMSLTDR.3y8_1.heavy 733.053 / 876.424 35391.0 46.39940071105957 39 13 10 6 10 1.4076122232929407 46.42949852261096 0.03639984130859375 3 0.9000545528121126 3.870753809674422 35391.0 115.68486682808717 0.0 - - - - - - - 767.0 70 7 IRF3 interferon regulatory factor 3 1527 197 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536630.[MT7]-TLPGWPVTLPDPGMSLTDR.3y10_1.heavy 733.053 / 1088.5 25186.0 46.39940071105957 39 13 10 6 10 1.4076122232929407 46.42949852261096 0.03639984130859375 3 0.9000545528121126 3.870753809674422 25186.0 45.946269578615926 0.0 - - - - - - - 715.375 50 8 IRF3 interferon regulatory factor 3 1529 198 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49104.[MT7]-FK[MT7]DPLK[MT7].2y4_1.heavy 590.377 / 616.379 N/A 28.1018009185791 45 15 10 10 10 5.938679471762622 16.838760279197157 0.0 2 0.9571237564861095 5.9386799191541995 1064.0 0.7538461538461537 25.0 - - - - - - - 722.0 7 12 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1531 198 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49104.[MT7]-FK[MT7]DPLK[MT7].2b3_1.heavy 590.377 / 679.402 8286.0 28.1018009185791 45 15 10 10 10 5.938679471762622 16.838760279197157 0.0 2 0.9571237564861095 5.9386799191541995 8286.0 14.029786555363264 0.0 - - - - - - - 751.5555555555555 16 9 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1533 198 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49104.[MT7]-FK[MT7]DPLK[MT7].2y5_1.heavy 590.377 / 888.576 N/A 28.1018009185791 45 15 10 10 10 5.938679471762622 16.838760279197157 0.0 2 0.9571237564861095 5.9386799191541995 836.0 1.1244444444444446 8.0 - - - - - - - 0.0 1 0 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1535 198 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49104.[MT7]-FK[MT7]DPLK[MT7].2y3_1.heavy 590.377 / 501.352 8210.0 28.1018009185791 45 15 10 10 10 5.938679471762622 16.838760279197157 0.0 2 0.9571237564861095 5.9386799191541995 8210.0 8.972413345579426 0.0 - - - - - - - 1226.857142857143 16 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1537 199 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536632.[MT7]-DLK[MT7]PENILLDDYGHIR.4y8_1.heavy 550.556 / 988.485 17629.0 37.41790008544922 50 20 10 10 10 7.3826797113919485 13.54521717171254 0.0 3 0.9951412087847527 17.6979208541754 17629.0 198.19585798816567 0.0 - - - - - - - 189.75 35 12 GRK5 G protein-coupled receptor kinase 5 1539 199 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536632.[MT7]-DLK[MT7]PENILLDDYGHIR.4b7_2.heavy 550.556 / 549.823 N/A 37.41790008544922 50 20 10 10 10 7.3826797113919485 13.54521717171254 0.0 3 0.9951412087847527 17.6979208541754 102908.0 22.759057598167768 0.0 - - - - - - - 2868.0 205 1 GRK5 G protein-coupled receptor kinase 5 1541 199 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536632.[MT7]-DLK[MT7]PENILLDDYGHIR.4y7_1.heavy 550.556 / 875.401 22943.0 37.41790008544922 50 20 10 10 10 7.3826797113919485 13.54521717171254 0.0 3 0.9951412087847527 17.6979208541754 22943.0 58.81549389547651 0.0 - - - - - - - 664.125 45 8 GRK5 G protein-coupled receptor kinase 5 1543 199 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536632.[MT7]-DLK[MT7]PENILLDDYGHIR.4b6_1.heavy 550.556 / 985.556 13918.0 37.41790008544922 50 20 10 10 10 7.3826797113919485 13.54521717171254 0.0 3 0.9951412087847527 17.6979208541754 13918.0 35.76703155356066 0.0 - - - - - - - 237.8181818181818 27 11 GRK5 G protein-coupled receptor kinase 5 1545 200 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535481.[MT7]-IAQEATVLK[MT7].3y3_1.heavy 420.93 / 503.367 76010.0 29.656299591064453 48 18 10 10 10 3.77877375942656 26.46361131055787 0.0 3 0.9856610506190725 10.293981666738706 76010.0 78.0753324779715 0.0 - - - - - - - 1259.5714285714287 152 7 CTNNA3 catenin (cadherin-associated protein), alpha 3 1547 200 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535481.[MT7]-IAQEATVLK[MT7].3b4_1.heavy 420.93 / 586.332 120757.0 29.656299591064453 48 18 10 10 10 3.77877375942656 26.46361131055787 0.0 3 0.9856610506190725 10.293981666738706 120757.0 164.1648207293452 0.0 - - - - - - - 1301.7142857142858 241 7 CTNNA3 catenin (cadherin-associated protein), alpha 3 1549 200 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535481.[MT7]-IAQEATVLK[MT7].3b5_1.heavy 420.93 / 657.369 45339.0 29.656299591064453 48 18 10 10 10 3.77877375942656 26.46361131055787 0.0 3 0.9856610506190725 10.293981666738706 45339.0 111.27730147285419 0.0 - - - - - - - 748.4 90 10 CTNNA3 catenin (cadherin-associated protein), alpha 3 1551 200 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535481.[MT7]-IAQEATVLK[MT7].3b3_1.heavy 420.93 / 457.289 99717.0 29.656299591064453 48 18 10 10 10 3.77877375942656 26.46361131055787 0.0 3 0.9856610506190725 10.293981666738706 99717.0 83.99821142771415 0.0 - - - - - - - 445.0 199 1 CTNNA3 catenin (cadherin-associated protein), alpha 3 1553 201 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49218.[MT7]-LNYLDILMR.2y4_1.heavy 647.869 / 532.328 2442.0 47.34397506713867 42 20 10 6 6 13.651719420315418 7.325084622760987 0.0343017578125 5 0.9975356381284501 24.855408249348297 2442.0 6.775841657876775 3.0 - - - - - - - 596.25 5 8 ITGA6 integrin, alpha 6 1555 201 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49218.[MT7]-LNYLDILMR.2y8_1.heavy 647.869 / 1037.54 2499.0 47.34397506713867 42 20 10 6 6 13.651719420315418 7.325084622760987 0.0343017578125 5 0.9975356381284501 24.855408249348297 2499.0 23.934705104469717 0.0 - - - - - - - 182.64285714285714 4 14 ITGA6 integrin, alpha 6 1557 201 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49218.[MT7]-LNYLDILMR.2b5_1.heavy 647.869 / 763.411 1249.0 47.34397506713867 42 20 10 6 6 13.651719420315418 7.325084622760987 0.0343017578125 5 0.9975356381284501 24.855408249348297 1249.0 9.967682270091135 0.0 - - - - - - - 190.2173913043478 2 23 ITGA6 integrin, alpha 6 1559 201 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49218.[MT7]-LNYLDILMR.2y7_1.heavy 647.869 / 923.502 852.0 47.34397506713867 42 20 10 6 6 13.651719420315418 7.325084622760987 0.0343017578125 5 0.9975356381284501 24.855408249348297 852.0 3.506027468256025 0.0 - - - - - - - 0.0 1 0 ITGA6 integrin, alpha 6 1561 202 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534973.[MT7]-FDEETQR.2y4_1.heavy 534.758 / 533.268 6139.0 21.316699981689453 46 20 10 6 10 18.7141299775932 5.343555918428054 0.032398223876953125 3 0.9974804666166437 24.58165301958314 6139.0 23.987311735517245 0.0 - - - - - - - 272.2173913043478 12 23 LIMK1 LIM domain kinase 1 1563 202 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534973.[MT7]-FDEETQR.2y5_1.heavy 534.758 / 662.31 15676.0 21.316699981689453 46 20 10 6 10 18.7141299775932 5.343555918428054 0.032398223876953125 3 0.9974804666166437 24.58165301958314 15676.0 48.51458288592319 0.0 - - - - - - - 274.2 31 20 LIMK1 LIM domain kinase 1 1565 202 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534973.[MT7]-FDEETQR.2b4_1.heavy 534.758 / 665.29 7808.0 21.316699981689453 46 20 10 6 10 18.7141299775932 5.343555918428054 0.032398223876953125 3 0.9974804666166437 24.58165301958314 7808.0 21.714489196795846 0.0 - - - - - - - 723.8571428571429 15 7 LIMK1 LIM domain kinase 1 1567 202 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534973.[MT7]-FDEETQR.2y6_1.heavy 534.758 / 777.337 15080.0 21.316699981689453 46 20 10 6 10 18.7141299775932 5.343555918428054 0.032398223876953125 3 0.9974804666166437 24.58165301958314 15080.0 95.51525890102559 0.0 - - - - - - - 207.10526315789474 30 19 LIMK1 LIM domain kinase 1 1569 203 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48646.[MT7]-LAEMPADSGYPAYLGAR.2y10_1.heavy 963.481 / 1054.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1571 203 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48646.[MT7]-LAEMPADSGYPAYLGAR.2b5_1.heavy 963.481 / 686.366 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1573 203 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48646.[MT7]-LAEMPADSGYPAYLGAR.2b10_2.heavy 963.481 / 590.277 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1575 203 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48646.[MT7]-LAEMPADSGYPAYLGAR.2y7_1.heavy 963.481 / 747.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1577 204 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535210.[MT7]-SQQALVQK[MT7].2y5_1.heavy 595.361 / 702.463 7714.0 21.609325408935547 40 17 10 3 10 3.8145963176447335 26.215093727596194 0.061901092529296875 3 0.9770592892339254 8.132520541768168 7714.0 34.61869431643625 0.0 - - - - - - - 195.31578947368422 15 19 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1579 204 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535210.[MT7]-SQQALVQK[MT7].2b4_1.heavy 595.361 / 559.296 10128.0 21.609325408935547 40 17 10 3 10 3.8145963176447335 26.215093727596194 0.061901092529296875 3 0.9770592892339254 8.132520541768168 10128.0 18.787978951965364 0.0 - - - - - - - 679.5384615384615 20 13 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1581 204 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535210.[MT7]-SQQALVQK[MT7].2y3_1.heavy 595.361 / 518.342 9362.0 21.609325408935547 40 17 10 3 10 3.8145963176447335 26.215093727596194 0.061901092529296875 3 0.9770592892339254 8.132520541768168 9362.0 13.805263157894737 1.0 - - - - - - - 272.25 18 16 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1583 204 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535210.[MT7]-SQQALVQK[MT7].2b5_1.heavy 595.361 / 672.38 7360.0 21.609325408935547 40 17 10 3 10 3.8145963176447335 26.215093727596194 0.061901092529296875 3 0.9770592892339254 8.132520541768168 7360.0 17.523809523809522 1.0 - - - - - - - 166.41176470588235 14 17 ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 1585 205 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48355.[MT7]-ILLLGAGESGK[MT7].2y8_1.heavy 673.418 / 862.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA13;GNA12 guanine nucleotide binding protein (G protein), alpha 13;guanine nucleotide binding protein (G protein) alpha 12 1587 205 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48355.[MT7]-ILLLGAGESGK[MT7].2y5_1.heavy 673.418 / 621.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA13;GNA12 guanine nucleotide binding protein (G protein), alpha 13;guanine nucleotide binding protein (G protein) alpha 12 1589 205 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48355.[MT7]-ILLLGAGESGK[MT7].2y6_1.heavy 673.418 / 692.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA13;GNA12 guanine nucleotide binding protein (G protein), alpha 13;guanine nucleotide binding protein (G protein) alpha 12 1591 205 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48355.[MT7]-ILLLGAGESGK[MT7].2y7_1.heavy 673.418 / 749.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNA13;GNA12 guanine nucleotide binding protein (G protein), alpha 13;guanine nucleotide binding protein (G protein) alpha 12 1593 206 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47871.[MT7]-EIMTK[MT7].2b3_1.heavy 455.27 / 518.276 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 1595 206 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47871.[MT7]-EIMTK[MT7].2y4_1.heavy 455.27 / 636.387 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 1597 206 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47871.[MT7]-EIMTK[MT7].2y3_1.heavy 455.27 / 523.303 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 1599 207 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47877.[MT7]-VTQLC[CAM]R.2y4_1.heavy 460.759 / 576.292 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 1601 207 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47877.[MT7]-VTQLC[CAM]R.2b3_1.heavy 460.759 / 473.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 1603 207 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47877.[MT7]-VTQLC[CAM]R.2y5_1.heavy 460.759 / 677.34 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 1605 207 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47877.[MT7]-VTQLC[CAM]R.2b4_1.heavy 460.759 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 1607 208 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48543.[MT7]-ELENLDYLAFK[MT7].2b3_1.heavy 821.95 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 1609 208 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48543.[MT7]-ELENLDYLAFK[MT7].2b4_1.heavy 821.95 / 630.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 1611 208 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48543.[MT7]-ELENLDYLAFK[MT7].2b6_1.heavy 821.95 / 858.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 1613 208 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48543.[MT7]-ELENLDYLAFK[MT7].2b5_1.heavy 821.95 / 743.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 1615 209 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48544.[MT7]-ELENLDYLAFK[MT7].3b6_1.heavy 548.303 / 858.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 1617 209 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48544.[MT7]-ELENLDYLAFK[MT7].3b4_1.heavy 548.303 / 630.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 1619 209 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48544.[MT7]-ELENLDYLAFK[MT7].3y4_1.heavy 548.303 / 622.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 1621 209 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48544.[MT7]-ELENLDYLAFK[MT7].3b3_1.heavy 548.303 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 1623 210 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48265.[MT7]-K[MT7]DETNVK[MT7].2y4_1.heavy 633.375 / 605.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1625 210 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48265.[MT7]-K[MT7]DETNVK[MT7].2y5_1.heavy 633.375 / 734.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1627 210 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48265.[MT7]-K[MT7]DETNVK[MT7].2y3_1.heavy 633.375 / 504.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1629 210 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48265.[MT7]-K[MT7]DETNVK[MT7].2b5_1.heavy 633.375 / 876.466 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1631 211 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48262.[MT7]-IAQEATVLK[MT7].2y4_1.heavy 630.892 / 604.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 1633 211 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48262.[MT7]-IAQEATVLK[MT7].2y8_1.heavy 630.892 / 1003.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 1635 211 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48262.[MT7]-IAQEATVLK[MT7].2y5_1.heavy 630.892 / 675.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 1637 211 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48262.[MT7]-IAQEATVLK[MT7].2b4_1.heavy 630.892 / 586.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - CTNNA3 catenin (cadherin-associated protein), alpha 3 1639 212 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534876.[MT7]-ILDEDK[MT7].2y4_1.heavy 510.794 / 650.311 30086.0 25.900299072265625 46 18 10 10 8 31.31856228239236 3.192994592099175 0.0 4 0.9887213434125013 11.609797590896864 30086.0 44.82479387861363 0.0 - - - - - - - 1251.7777777777778 60 9 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1641 212 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534876.[MT7]-ILDEDK[MT7].2y5_1.heavy 510.794 / 763.395 49764.0 25.900299072265625 46 18 10 10 8 31.31856228239236 3.192994592099175 0.0 4 0.9887213434125013 11.609797590896864 49764.0 106.62527054108216 1.0 - - - - - - - 448.0 102 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1643 212 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534876.[MT7]-ILDEDK[MT7].2y3_1.heavy 510.794 / 535.284 32296.0 25.900299072265625 46 18 10 10 8 31.31856228239236 3.192994592099175 0.0 4 0.9887213434125013 11.609797590896864 32296.0 37.290506470881034 0.0 - - - - - - - 1324.0 64 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1645 212 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534876.[MT7]-ILDEDK[MT7].2b5_1.heavy 510.794 / 730.374 24098.0 25.900299072265625 46 18 10 10 8 31.31856228239236 3.192994592099175 0.0 4 0.9887213434125013 11.609797590896864 24098.0 32.571707687219096 1.0 - - - - - - - 815.0 58 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1647 213 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535621.[MT7]-IESVLSSSGK[MT7].3y3_1.heavy 432.253 / 435.268 43632.0 30.877399444580078 48 20 8 10 10 7.6665836549032065 13.043619492242081 0.0 3 0.9924639403601848 14.207481188126373 43632.0 31.928628693400363 0.0 - - - - - - - 329.5 87 2 GM2A GM2 ganglioside activator 1649 213 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535621.[MT7]-IESVLSSSGK[MT7].3b4_1.heavy 432.253 / 573.336 35726.0 30.877399444580078 48 20 8 10 10 7.6665836549032065 13.043619492242081 0.0 3 0.9924639403601848 14.207481188126373 35726.0 24.509243101596578 0.0 - - - - - - - 1281.0 71 8 GM2A GM2 ganglioside activator 1651 213 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535621.[MT7]-IESVLSSSGK[MT7].3y4_1.heavy 432.253 / 522.3 23207.0 30.877399444580078 48 20 8 10 10 7.6665836549032065 13.043619492242081 0.0 3 0.9924639403601848 14.207481188126373 23207.0 22.116442861613827 2.0 - - - - - - - 1202.7142857142858 119 7 GM2A GM2 ganglioside activator 1653 213 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535621.[MT7]-IESVLSSSGK[MT7].3y5_1.heavy 432.253 / 609.332 24013.0 30.877399444580078 48 20 8 10 10 7.6665836549032065 13.043619492242081 0.0 3 0.9924639403601848 14.207481188126373 24013.0 33.90252238426997 0.0 - - - - - - - 640.625 48 8 GM2A GM2 ganglioside activator 1655 214 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48255.[MT7]-GHAVVGAVGAK[MT7].2y4_1.heavy 627.382 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1657 214 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48255.[MT7]-GHAVVGAVGAK[MT7].2b4_1.heavy 627.382 / 509.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1659 214 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48255.[MT7]-GHAVVGAVGAK[MT7].2y6_1.heavy 627.382 / 646.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1661 214 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48255.[MT7]-GHAVVGAVGAK[MT7].2y7_1.heavy 627.382 / 745.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1663 215 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535600.[MT7]-FSYLPIQK[MT7].3y3_1.heavy 428.592 / 532.357 17435.0 36.38019943237305 44 14 10 10 10 2.028951675246141 38.515101425000516 0.0 3 0.9302229643785256 4.644595063829802 17435.0 17.310457507967087 0.0 - - - - - - - 205.375 34 8 ITGA6 integrin, alpha 6 1665 215 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535600.[MT7]-FSYLPIQK[MT7].3b4_1.heavy 428.592 / 655.357 36604.0 36.38019943237305 44 14 10 10 10 2.028951675246141 38.515101425000516 0.0 3 0.9302229643785256 4.644595063829802 36604.0 80.01607563187343 0.0 - - - - - - - 250.91666666666666 73 12 ITGA6 integrin, alpha 6 1667 215 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535600.[MT7]-FSYLPIQK[MT7].3y4_1.heavy 428.592 / 629.41 12688.0 36.38019943237305 44 14 10 10 10 2.028951675246141 38.515101425000516 0.0 3 0.9302229643785256 4.644595063829802 12688.0 34.43170741955538 0.0 - - - - - - - 691.1428571428571 25 7 ITGA6 integrin, alpha 6 1669 215 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535600.[MT7]-FSYLPIQK[MT7].3b3_1.heavy 428.592 / 542.273 29941.0 36.38019943237305 44 14 10 10 10 2.028951675246141 38.515101425000516 0.0 3 0.9302229643785256 4.644595063829802 29941.0 59.04732314063227 0.0 - - - - - - - 718.875 59 8 ITGA6 integrin, alpha 6 1671 216 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534879.[MT7]-DIDTAAK[MT7].2y4_1.heavy 511.292 / 534.337 31270.0 19.9197998046875 50 20 10 10 10 7.698935510104894 12.988808630589185 0.0 3 0.9958699016124454 19.196965501015956 31270.0 86.15763008758373 0.0 - - - - - - - 679.2222222222222 62 9 ATP5G1;ATP5G2;ATP5G3 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9);ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9);ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) 1673 216 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534879.[MT7]-DIDTAAK[MT7].2y5_1.heavy 511.292 / 649.364 16164.0 19.9197998046875 50 20 10 10 10 7.698935510104894 12.988808630589185 0.0 3 0.9958699016124454 19.196965501015956 16164.0 61.47280202591986 0.0 - - - - - - - 321.0 32 13 ATP5G1;ATP5G2;ATP5G3 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9);ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9);ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) 1675 216 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534879.[MT7]-DIDTAAK[MT7].2y6_1.heavy 511.292 / 762.448 9346.0 19.9197998046875 50 20 10 10 10 7.698935510104894 12.988808630589185 0.0 3 0.9958699016124454 19.196965501015956 9346.0 36.39350128689983 1.0 - - - - - - - 220.6 19 20 ATP5G1;ATP5G2;ATP5G3 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9);ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9);ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) 1677 216 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534879.[MT7]-DIDTAAK[MT7].2b5_1.heavy 511.292 / 660.332 4232.0 19.9197998046875 50 20 10 10 10 7.698935510104894 12.988808630589185 0.0 3 0.9958699016124454 19.196965501015956 4232.0 10.715853556005655 2.0 - - - - - - - 282.8125 36 16 ATP5G1;ATP5G2;ATP5G3 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9);ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9);ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) 1679 217 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49700.[MT7]-VGQTAFDVADEDILGYLEELQK[MT7].3b6_1.heavy 914.476 / 748.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12A protein phosphatase 1, regulatory (inhibitor) subunit 12A 1681 217 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49700.[MT7]-VGQTAFDVADEDILGYLEELQK[MT7].3b5_1.heavy 914.476 / 601.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12A protein phosphatase 1, regulatory (inhibitor) subunit 12A 1683 217 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49700.[MT7]-VGQTAFDVADEDILGYLEELQK[MT7].3b8_1.heavy 914.476 / 962.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12A protein phosphatase 1, regulatory (inhibitor) subunit 12A 1685 217 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49700.[MT7]-VGQTAFDVADEDILGYLEELQK[MT7].3b7_1.heavy 914.476 / 863.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12A protein phosphatase 1, regulatory (inhibitor) subunit 12A 1687 218 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48740.[MT7]-SPVFIAQVGQDLVSQTEEK[MT7].4y4_1.heavy 591.573 / 650.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 1689 218 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48740.[MT7]-SPVFIAQVGQDLVSQTEEK[MT7].4b4_1.heavy 591.573 / 575.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 1691 218 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48740.[MT7]-SPVFIAQVGQDLVSQTEEK[MT7].4b5_1.heavy 591.573 / 688.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 1693 218 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48740.[MT7]-SPVFIAQVGQDLVSQTEEK[MT7].4b6_1.heavy 591.573 / 759.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 1695 219 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49703.[MT7]-ILPWLVSQLDLGQLEGVAWVNK[MT7].3b6_1.heavy 922.865 / 866.562 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 1697 219 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49703.[MT7]-ILPWLVSQLDLGQLEGVAWVNK[MT7].3y3_1.heavy 922.865 / 504.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 1699 219 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49703.[MT7]-ILPWLVSQLDLGQLEGVAWVNK[MT7].3b4_1.heavy 922.865 / 654.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 1701 219 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49703.[MT7]-ILPWLVSQLDLGQLEGVAWVNK[MT7].3y5_1.heavy 922.865 / 761.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 1703 220 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49601.[MT7]-ISDLGLAVK[MT7]IPEGDLIR.3b9_2.heavy 699.756 / 593.376 11751.0 42.04119873046875 43 13 10 10 10 0.8758747261963244 73.2646327180187 0.0 3 0.9210154931476136 4.362049117397684 11751.0 19.25655794063391 0.0 - - - - - - - 727.2857142857143 23 14 GRK5 G protein-coupled receptor kinase 5 1705 220 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49601.[MT7]-ISDLGLAVK[MT7]IPEGDLIR.3y7_1.heavy 699.756 / 799.431 18223.0 42.04119873046875 43 13 10 10 10 0.8758747261963244 73.2646327180187 0.0 3 0.9210154931476136 4.362049117397684 18223.0 57.99875120569086 0.0 - - - - - - - 653.5 36 10 GRK5 G protein-coupled receptor kinase 5 1707 220 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49601.[MT7]-ISDLGLAVK[MT7]IPEGDLIR.3b6_1.heavy 699.756 / 743.442 3268.0 42.04119873046875 43 13 10 10 10 0.8758747261963244 73.2646327180187 0.0 3 0.9210154931476136 4.362049117397684 3268.0 14.688837377761681 0.0 - - - - - - - 754.0 6 11 GRK5 G protein-coupled receptor kinase 5 1709 220 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49601.[MT7]-ISDLGLAVK[MT7]IPEGDLIR.3b5_1.heavy 699.756 / 630.358 4210.0 42.04119873046875 43 13 10 10 10 0.8758747261963244 73.2646327180187 0.0 3 0.9210154931476136 4.362049117397684 4210.0 8.144692014438405 1.0 - - - - - - - 672.8235294117648 8 17 GRK5 G protein-coupled receptor kinase 5 1711 221 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535760.[MT7]-DYFEQYGK[MT7].3y3_1.heavy 446.559 / 511.3 116228.0 31.204299926757812 50 20 10 10 10 13.118758441920107 7.622672560267347 0.0 3 0.997052552621253 22.726502772883652 116228.0 107.93404451094848 0.0 - - - - - - - 1219.875 232 8 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 1713 221 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535760.[MT7]-DYFEQYGK[MT7].3b4_1.heavy 446.559 / 699.311 54078.0 31.204299926757812 50 20 10 10 10 13.118758441920107 7.622672560267347 0.0 3 0.997052552621253 22.726502772883652 54078.0 277.0208174386921 0.0 - - - - - - - 214.3846153846154 108 13 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 1715 221 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535760.[MT7]-DYFEQYGK[MT7].3b5_1.heavy 446.559 / 827.369 13721.0 31.204299926757812 50 20 10 10 10 13.118758441920107 7.622672560267347 0.0 3 0.997052552621253 22.726502772883652 13721.0 102.49595485466912 0.0 - - - - - - - 151.1875 27 16 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 1717 221 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535760.[MT7]-DYFEQYGK[MT7].3b3_1.heavy 446.559 / 570.268 93261.0 31.204299926757812 50 20 10 10 10 13.118758441920107 7.622672560267347 0.0 3 0.997052552621253 22.726502772883652 93261.0 114.50212831088857 0.0 - - - - - - - 773.9090909090909 186 11 HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 1719 222 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49706.[MT7]-SIFVFTHVLVPVWIIHYYMK[MT7].4y5_1.heavy 695.896 / 885.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 1721 222 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49706.[MT7]-SIFVFTHVLVPVWIIHYYMK[MT7].4y4_1.heavy 695.896 / 748.382 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 1723 222 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49706.[MT7]-SIFVFTHVLVPVWIIHYYMK[MT7].4b4_1.heavy 695.896 / 591.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 1725 222 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49706.[MT7]-SIFVFTHVLVPVWIIHYYMK[MT7].4y3_1.heavy 695.896 / 585.319 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa 1727 223 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536370.[MT7]-VFIGNLNTLVVK[MT7]K[MT7].4y4_1.heavy 470.054 / 761.549 5168.0 38.22297668457031 41 15 10 6 10 2.431199498299669 32.327823807019854 0.038299560546875 3 0.9589071053990695 6.067090434114713 5168.0 46.58 0.0 - - - - - - - 181.23076923076923 10 13 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1729 223 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536370.[MT7]-VFIGNLNTLVVK[MT7]K[MT7].4b4_1.heavy 470.054 / 561.352 14896.0 38.22297668457031 41 15 10 6 10 2.431199498299669 32.327823807019854 0.038299560546875 3 0.9589071053990695 6.067090434114713 14896.0 49.45230769230769 0.0 - - - - - - - 775.2 29 10 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1731 223 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536370.[MT7]-VFIGNLNTLVVK[MT7]K[MT7].4b5_1.heavy 470.054 / 675.395 13756.0 38.22297668457031 41 15 10 6 10 2.431199498299669 32.327823807019854 0.038299560546875 3 0.9589071053990695 6.067090434114713 13756.0 96.3825 0.0 - - - - - - - 223.25 27 16 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1733 223 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536370.[MT7]-VFIGNLNTLVVK[MT7]K[MT7].4y3_1.heavy 470.054 / 662.48 7752.0 38.22297668457031 41 15 10 6 10 2.431199498299669 32.327823807019854 0.038299560546875 3 0.9589071053990695 6.067090434114713 7752.0 46.92 0.0 - - - - - - - 245.88235294117646 15 17 HNRNPC;HNRNPCL1;LOC440563;LOC649330 heterogeneous nuclear ribonucleoprotein C (C1/C2);heterogeneous nuclear ribonucleoprotein C-like 1;heterogeneous nuclear ribonucleoprotein C-like;heterogeneous nuclear ribonucleoprotein C-like 1735 224 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49708.[MT7]-QDAQQEDFGIFQAWAEATGAYVPGR.3b9_1.heavy 967.13 / 1163.51 19180.0 51.5004997253418 47 17 10 10 10 2.7566193051876473 28.956567256394816 0.0 3 0.9737338231925252 7.598165036102016 19180.0 60.289762381122046 0.0 - - - - - - - 737.1428571428571 38 7 IRF3 interferon regulatory factor 3 1737 224 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49708.[MT7]-QDAQQEDFGIFQAWAEATGAYVPGR.3b4_1.heavy 967.13 / 587.291 14166.0 51.5004997253418 47 17 10 10 10 2.7566193051876473 28.956567256394816 0.0 3 0.9737338231925252 7.598165036102016 14166.0 86.0416869372927 0.0 - - - - - - - 223.8 28 15 IRF3 interferon regulatory factor 3 1739 224 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49708.[MT7]-QDAQQEDFGIFQAWAEATGAYVPGR.3b7_1.heavy 967.13 / 959.419 16600.0 51.5004997253418 47 17 10 10 10 2.7566193051876473 28.956567256394816 0.0 3 0.9737338231925252 7.598165036102016 16600.0 48.01743779331304 0.0 - - - - - - - 243.25 33 12 IRF3 interferon regulatory factor 3 1741 224 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49708.[MT7]-QDAQQEDFGIFQAWAEATGAYVPGR.3y10_1.heavy 967.13 / 1020.51 15334.0 51.5004997253418 47 17 10 10 10 2.7566193051876473 28.956567256394816 0.0 3 0.9737338231925252 7.598165036102016 15334.0 59.34026405454907 0.0 - - - - - - - 256.6363636363636 30 11 IRF3 interferon regulatory factor 3 1743 225 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536080.[MT7]-DK[MT7]PDLPTWK[MT7].3y3_1.heavy 511.3 / 578.342 59079.0 30.256999969482422 48 18 10 10 10 3.8095458370018678 26.249848217786642 0.0 3 0.9804065590262233 8.80228329642498 59079.0 48.70669841641836 0.0 - - - - - - - 656.125 118 8 IRF3 interferon regulatory factor 3 1745 225 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536080.[MT7]-DK[MT7]PDLPTWK[MT7].3b4_1.heavy 511.3 / 744.413 35812.0 30.256999969482422 48 18 10 10 10 3.8095458370018678 26.249848217786642 0.0 3 0.9804065590262233 8.80228329642498 35812.0 99.75208460346275 0.0 - - - - - - - 365.0 71 7 IRF3 interferon regulatory factor 3 1747 225 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536080.[MT7]-DK[MT7]PDLPTWK[MT7].3y4_1.heavy 511.3 / 675.395 60757.0 30.256999969482422 48 18 10 10 10 3.8095458370018678 26.249848217786642 0.0 3 0.9804065590262233 8.80228329642498 60757.0 96.35386342977696 0.0 - - - - - - - 756.5 121 8 IRF3 interferon regulatory factor 3 1749 225 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536080.[MT7]-DK[MT7]PDLPTWK[MT7].3y5_1.heavy 511.3 / 788.479 20058.0 30.256999969482422 48 18 10 10 10 3.8095458370018678 26.249848217786642 0.0 3 0.9804065590262233 8.80228329642498 20058.0 54.098570669905214 0.0 - - - - - - - 275.15384615384613 40 13 IRF3 interferon regulatory factor 3 1751 226 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48748.[MT7]-VAHPIRPK[MT7]PPSATSIPAILK[MT7].4y4_1.heavy 632.147 / 588.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1753 226 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48748.[MT7]-VAHPIRPK[MT7]PPSATSIPAILK[MT7].4y5_1.heavy 632.147 / 685.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1755 226 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48748.[MT7]-VAHPIRPK[MT7]PPSATSIPAILK[MT7].4b12_2.heavy 632.147 / 770.472 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1757 226 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48748.[MT7]-VAHPIRPK[MT7]PPSATSIPAILK[MT7].4y3_1.heavy 632.147 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRPF19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) 1759 227 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534364.[MT7]-LQQLR.2b3_1.heavy 401.257 / 514.311 56593.0 24.277700424194336 50 20 10 10 10 9.942482218049648 10.057850525340577 0.0 3 0.9954018340779553 18.19296553931876 56593.0 39.85847265242089 0.0 - - - - - - - 808.25 113 4 FBXO33;CCDC42B;NDUFB6;CRTC3 F-box protein 33;coiled-coil domain containing 42B;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa;CREB regulated transcription coactivator 3 1761 227 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534364.[MT7]-LQQLR.2y4_1.heavy 401.257 / 544.32 143131.0 24.277700424194336 50 20 10 10 10 9.942482218049648 10.057850525340577 0.0 3 0.9954018340779553 18.19296553931876 143131.0 35.72846022937031 0.0 - - - - - - - 1358.0 286 1 FBXO33;CCDC42B;NDUFB6;CRTC3 F-box protein 33;coiled-coil domain containing 42B;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa;CREB regulated transcription coactivator 3 1763 227 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534364.[MT7]-LQQLR.2b4_1.heavy 401.257 / 627.395 22702.0 24.277700424194336 50 20 10 10 10 9.942482218049648 10.057850525340577 0.0 3 0.9954018340779553 18.19296553931876 22702.0 22.568262150220914 0.0 - - - - - - - 1247.2857142857142 45 7 FBXO33;CCDC42B;NDUFB6;CRTC3 F-box protein 33;coiled-coil domain containing 42B;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa;CREB regulated transcription coactivator 3 1765 227 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534364.[MT7]-LQQLR.2y3_1.heavy 401.257 / 416.262 26582.0 24.277700424194336 50 20 10 10 10 9.942482218049648 10.057850525340577 0.0 3 0.9954018340779553 18.19296553931876 26582.0 22.521991650448335 0.0 - - - - - - - 2263.714285714286 53 7 FBXO33;CCDC42B;NDUFB6;CRTC3 F-box protein 33;coiled-coil domain containing 42B;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa;CREB regulated transcription coactivator 3 1767 228 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48747.[MT7]-SPSLDNPTPFPNLGPSENPLK[MT7].3y3_1.heavy 837.111 / 501.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 1769 228 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48747.[MT7]-SPSLDNPTPFPNLGPSENPLK[MT7].3b6_1.heavy 837.111 / 758.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 1771 228 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48747.[MT7]-SPSLDNPTPFPNLGPSENPLK[MT7].3b5_1.heavy 837.111 / 644.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 1773 228 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48747.[MT7]-SPSLDNPTPFPNLGPSENPLK[MT7].3y8_1.heavy 837.111 / 985.544 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 1775 229 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535228.[MT7]-LPAAFAPLPR.2y8_1.heavy 598.867 / 842.488 42736.0 38.6697998046875 50 20 10 10 10 8.954856562631473 11.167124710550807 0.0 3 0.9975059002396541 24.70672342691495 42736.0 174.76041602314018 0.0 - - - - - - - 244.6 85 15 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 1777 229 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535228.[MT7]-LPAAFAPLPR.2y9_1.heavy 598.867 / 939.541 697671.0 38.6697998046875 50 20 10 10 10 8.954856562631473 11.167124710550807 0.0 3 0.9975059002396541 24.70672342691495 697671.0 2400.566950647018 0.0 - - - - - - - 215.25 1395 8 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 1779 229 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535228.[MT7]-LPAAFAPLPR.2y6_1.heavy 598.867 / 700.414 57331.0 38.6697998046875 50 20 10 10 10 8.954856562631473 11.167124710550807 0.0 3 0.9975059002396541 24.70672342691495 57331.0 128.45630265539427 0.0 - - - - - - - 626.875 114 8 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 1781 229 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535228.[MT7]-LPAAFAPLPR.2y7_1.heavy 598.867 / 771.451 60848.0 38.6697998046875 50 20 10 10 10 8.954856562631473 11.167124710550807 0.0 3 0.9975059002396541 24.70672342691495 60848.0 204.95102442369318 0.0 - - - - - - - 207.3846153846154 121 13 NDUFAB1 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa 1783 230 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49229.[MT7]-ALDEYYDK[MT7].2y4_1.heavy 652.834 / 732.369 6844.0 29.06232452392578 40 14 10 6 10 1.3616880959171154 48.95883783265783 0.03530120849609375 3 0.9482046791083052 5.3991390421973735 6844.0 22.549258512979186 0.0 - - - - - - - 709.0 13 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1785 230 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49229.[MT7]-ALDEYYDK[MT7].2y5_1.heavy 652.834 / 861.411 12410.0 29.06232452392578 40 14 10 6 10 1.3616880959171154 48.95883783265783 0.03530120849609375 3 0.9482046791083052 5.3991390421973735 12410.0 38.570105194579085 0.0 - - - - - - - 676.875 24 8 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1787 230 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49229.[MT7]-ALDEYYDK[MT7].2b4_1.heavy 652.834 / 573.3 10981.0 29.06232452392578 40 14 10 6 10 1.3616880959171154 48.95883783265783 0.03530120849609375 3 0.9482046791083052 5.3991390421973735 10981.0 18.20037432534523 0.0 - - - - - - - 630.0 21 8 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1789 230 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49229.[MT7]-ALDEYYDK[MT7].2y3_1.heavy 652.834 / 569.305 7897.0 29.06232452392578 40 14 10 6 10 1.3616880959171154 48.95883783265783 0.03530120849609375 3 0.9482046791083052 5.3991390421973735 7897.0 32.574876859004405 0.0 - - - - - - - 838.1428571428571 15 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1791 231 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 526384.0 44.16429901123047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 526384.0 829.8093702101494 0.0 - - - - - - - 782.8571428571429 1052 7 1793 231 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 810149.0 44.16429901123047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 810149.0 568.3733574462232 0.0 - - - - - - - 854.25 1620 4 1795 231 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 816510.0 44.16429901123047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 816510.0 1037.009145338702 0.0 - - - - - - - 128.5 1633 2 1797 232 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536064.[MT7]-SFRPGDIVLAK[MT7].3b6_1.heavy 497.636 / 804.412 64256.0 33.07429885864258 41 11 10 10 10 1.7059266652898362 58.619166951710696 0.0 3 0.8674485086254587 3.3515973023134427 64256.0 154.4113636577008 0.0 - - - - - - - 272.45454545454544 128 11 EXOSC1 exosome component 1 1799 232 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536064.[MT7]-SFRPGDIVLAK[MT7].3y4_1.heavy 497.636 / 574.404 56406.0 33.07429885864258 41 11 10 10 10 1.7059266652898362 58.619166951710696 0.0 3 0.8674485086254587 3.3515973023134427 56406.0 63.710188254152 0.0 - - - - - - - 202.5 112 2 EXOSC1 exosome component 1 1801 232 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536064.[MT7]-SFRPGDIVLAK[MT7].3y5_1.heavy 497.636 / 687.489 55921.0 33.07429885864258 41 11 10 10 10 1.7059266652898362 58.619166951710696 0.0 3 0.8674485086254587 3.3515973023134427 55921.0 47.382312444836714 0.0 - - - - - - - 728.0 111 7 EXOSC1 exosome component 1 1803 232 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536064.[MT7]-SFRPGDIVLAK[MT7].3b7_1.heavy 497.636 / 917.496 20879.0 33.07429885864258 41 11 10 10 10 1.7059266652898362 58.619166951710696 0.0 3 0.8674485086254587 3.3515973023134427 20879.0 137.62027812984087 0.0 - - - - - - - 227.8125 41 16 EXOSC1 exosome component 1 1805 233 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535362.[MT7]-AVQFTEEK[MT7].2y4_1.heavy 620.345 / 650.348 25163.0 26.210500717163086 47 17 10 10 10 2.1991116212054176 36.265247169735595 0.0 3 0.9740402805472697 7.643079116233375 25163.0 96.84434884717308 0.0 - - - - - - - 255.83333333333334 50 12 SH3GLB1;SH3GLB2 SH3-domain GRB2-like endophilin B1;SH3-domain GRB2-like endophilin B2 1807 233 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535362.[MT7]-AVQFTEEK[MT7].2y5_1.heavy 620.345 / 797.416 34899.0 26.210500717163086 47 17 10 10 10 2.1991116212054176 36.265247169735595 0.0 3 0.9740402805472697 7.643079116233375 34899.0 42.04009401446315 0.0 - - - - - - - 209.9 69 10 SH3GLB1;SH3GLB2 SH3-domain GRB2-like endophilin B1;SH3-domain GRB2-like endophilin B2 1809 233 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535362.[MT7]-AVQFTEEK[MT7].2y6_1.heavy 620.345 / 925.475 20670.0 26.210500717163086 47 17 10 10 10 2.1991116212054176 36.265247169735595 0.0 3 0.9740402805472697 7.643079116233375 20670.0 103.35 0.0 - - - - - - - 206.125 41 16 SH3GLB1;SH3GLB2 SH3-domain GRB2-like endophilin B1;SH3-domain GRB2-like endophilin B2 1811 233 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535362.[MT7]-AVQFTEEK[MT7].2y7_1.heavy 620.345 / 1024.54 26511.0 26.210500717163086 47 17 10 10 10 2.1991116212054176 36.265247169735595 0.0 3 0.9740402805472697 7.643079116233375 26511.0 74.9633564173489 0.0 - - - - - - - 655.25 53 8 SH3GLB1;SH3GLB2 SH3-domain GRB2-like endophilin B1;SH3-domain GRB2-like endophilin B2 1813 234 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536066.[MT7]-SK[MT7]DPHDPHK[MT7].3b6_1.heavy 498.279 / 968.504 557.0 14.162300109863281 48 18 10 10 10 8.198115041847178 12.197925924380327 0.0 3 0.9878998685202792 11.20800799307779 557.0 48.27333333333334 0.0 - - - - - - - 0.0 1 0 IRF3 interferon regulatory factor 3 1815 234 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536066.[MT7]-SK[MT7]DPHDPHK[MT7].3y3_1.heavy 498.279 / 525.326 24453.0 14.162300109863281 48 18 10 10 10 8.198115041847178 12.197925924380327 0.0 3 0.9878998685202792 11.20800799307779 24453.0 206.5279569892473 0.0 - - - - - - - 131.8695652173913 48 23 IRF3 interferon regulatory factor 3 1817 234 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536066.[MT7]-SK[MT7]DPHDPHK[MT7].3y4_1.heavy 498.279 / 640.354 2476.0 14.162300109863281 48 18 10 10 10 8.198115041847178 12.197925924380327 0.0 3 0.9878998685202792 11.20800799307779 2476.0 89.4111111111111 0.0 - - - - - - - 62.05263157894737 4 19 IRF3 interferon regulatory factor 3 1819 234 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536066.[MT7]-SK[MT7]DPHDPHK[MT7].3b3_1.heavy 498.279 / 619.365 34379.0 14.162300109863281 48 18 10 10 10 8.198115041847178 12.197925924380327 0.0 3 0.9878998685202792 11.20800799307779 34379.0 242.1284688581315 0.0 - - - - - - - 179.1818181818182 68 22 IRF3 interferon regulatory factor 3 1821 235 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48345.[MT7]-DYFEQYGK[MT7].2b3_1.heavy 669.334 / 570.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 1823 235 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48345.[MT7]-DYFEQYGK[MT7].2y4_1.heavy 669.334 / 639.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 1825 235 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48345.[MT7]-DYFEQYGK[MT7].2b4_1.heavy 669.334 / 699.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 1827 235 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48345.[MT7]-DYFEQYGK[MT7].2y3_1.heavy 669.334 / 511.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPA1L2;HNRNPA1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1 1829 236 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48150.[MT7]-K[MT7]AAELAK[MT7].2b3_1.heavy 581.88 / 559.381 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 1831 236 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48150.[MT7]-K[MT7]AAELAK[MT7].2y5_1.heavy 581.88 / 675.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 1833 236 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48150.[MT7]-K[MT7]AAELAK[MT7].2b4_1.heavy 581.88 / 688.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 1835 236 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48150.[MT7]-K[MT7]AAELAK[MT7].2y6_1.heavy 581.88 / 746.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa 1837 237 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49226.[MT7]-VNADPDYLPR.2y4_1.heavy 652.342 / 548.319 10178.0 30.03404998779297 39 13 10 6 10 1.409227308532932 48.2505401935225 0.0343017578125 3 0.9221028070155186 4.392796896471772 10178.0 19.43587744354191 0.0 - - - - - - - 677.3333333333334 20 12 LIMK1 LIM domain kinase 1 1839 237 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49226.[MT7]-VNADPDYLPR.2y9_1.heavy 652.342 / 1060.51 6517.0 30.03404998779297 39 13 10 6 10 1.409227308532932 48.2505401935225 0.0343017578125 3 0.9221028070155186 4.392796896471772 6517.0 9.478965259333883 3.0 - - - - - - - 669.5714285714286 33 14 LIMK1 LIM domain kinase 1 1841 237 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49226.[MT7]-VNADPDYLPR.2b4_1.heavy 652.342 / 544.285 18965.0 30.03404998779297 39 13 10 6 10 1.409227308532932 48.2505401935225 0.0343017578125 3 0.9221028070155186 4.392796896471772 18965.0 24.870345876145244 0.0 - - - - - - - 726.1666666666666 37 12 LIMK1 LIM domain kinase 1 1843 237 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49226.[MT7]-VNADPDYLPR.2y6_1.heavy 652.342 / 760.399 15084.0 30.03404998779297 39 13 10 6 10 1.409227308532932 48.2505401935225 0.0343017578125 3 0.9221028070155186 4.392796896471772 15084.0 33.380395105410585 0.0 - - - - - - - 675.4444444444445 30 9 LIMK1 LIM domain kinase 1 1845 238 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49368.[MT7]-DK[MT7]PDLPTWK[MT7].2y4_1.heavy 766.446 / 675.395 2411.0 30.256999969482422 29 8 10 3 8 0.5619811094044103 90.69169299696605 0.06859970092773438 4 0.7579428677020192 2.455987460711465 2411.0 -0.5 3.0 - - - - - - - 700.0833333333334 5 12 IRF3 interferon regulatory factor 3 1847 238 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49368.[MT7]-DK[MT7]PDLPTWK[MT7].2y5_1.heavy 766.446 / 788.479 2265.0 30.256999969482422 29 8 10 3 8 0.5619811094044103 90.69169299696605 0.06859970092773438 4 0.7579428677020192 2.455987460711465 2265.0 13.755479452054793 0.0 - - - - - - - 215.1578947368421 4 19 IRF3 interferon regulatory factor 3 1849 238 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49368.[MT7]-DK[MT7]PDLPTWK[MT7].2y8_2.heavy 766.446 / 636.881 4310.0 30.256999969482422 29 8 10 3 8 0.5619811094044103 90.69169299696605 0.06859970092773438 4 0.7579428677020192 2.455987460711465 4310.0 13.627585264933916 0.0 - - - - - - - 250.28571428571428 8 14 IRF3 interferon regulatory factor 3 1851 238 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49368.[MT7]-DK[MT7]PDLPTWK[MT7].2b4_1.heavy 766.446 / 744.413 2557.0 30.256999969482422 29 8 10 3 8 0.5619811094044103 90.69169299696605 0.06859970092773438 4 0.7579428677020192 2.455987460711465 2557.0 0.4515673289183223 1.0 - - - - - - - 737.4545454545455 5 11 IRF3 interferon regulatory factor 3 1853 239 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48444.[MT7]-GFAFVQYVNER.3y6_1.heavy 491.925 / 808.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1855 239 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48444.[MT7]-GFAFVQYVNER.3b5_1.heavy 491.925 / 666.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1857 239 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48444.[MT7]-GFAFVQYVNER.3y4_1.heavy 491.925 / 517.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1859 239 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48444.[MT7]-GFAFVQYVNER.3y5_1.heavy 491.925 / 680.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1861 240 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48251.[MT7]-TVISQSLSK[MT7].2y4_1.heavy 625.882 / 578.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1863 240 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48251.[MT7]-TVISQSLSK[MT7].2y5_1.heavy 625.882 / 706.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1865 240 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48251.[MT7]-TVISQSLSK[MT7].2y6_1.heavy 625.882 / 793.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1867 240 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48251.[MT7]-TVISQSLSK[MT7].2y7_1.heavy 625.882 / 906.538 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1869 241 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47885.[MT7]-ALVEMAR.2y4_1.heavy 467.269 / 506.239 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 1871 241 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47885.[MT7]-ALVEMAR.2y5_1.heavy 467.269 / 605.308 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 1873 241 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47885.[MT7]-ALVEMAR.2b4_1.heavy 467.269 / 557.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 1875 241 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47885.[MT7]-ALVEMAR.2y6_1.heavy 467.269 / 718.392 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 1877 242 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47888.[MT7]-EMLQDR.2y5_1.heavy 468.24 / 662.329 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO7 LIM domain 7 1879 242 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47888.[MT7]-EMLQDR.2b4_1.heavy 468.24 / 646.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO7 LIM domain 7 1881 242 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47888.[MT7]-EMLQDR.2b5_1.heavy 468.24 / 761.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO7 LIM domain 7 1883 243 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535615.[MT7]-HFTEFVPLR.3y6_1.heavy 430.576 / 760.435 10808.0 34.26250076293945 48 18 10 10 10 3.554044624199259 28.1369567841401 0.0 3 0.9888824647263221 11.69378035244049 10808.0 130.00053755091045 0.0 - - - - - - - 201.45454545454547 21 11 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1885 243 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535615.[MT7]-HFTEFVPLR.3b4_1.heavy 430.576 / 659.327 119157.0 34.26250076293945 48 18 10 10 10 3.554044624199259 28.1369567841401 0.0 3 0.9888824647263221 11.69378035244049 119157.0 204.88495523451417 0.0 - - - - - - - 670.7142857142857 238 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1887 243 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535615.[MT7]-HFTEFVPLR.3b5_1.heavy 430.576 / 806.395 28084.0 34.26250076293945 48 18 10 10 10 3.554044624199259 28.1369567841401 0.0 3 0.9888824647263221 11.69378035244049 28084.0 209.44715789473682 0.0 - - - - - - - 166.125 56 8 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1889 243 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535615.[MT7]-HFTEFVPLR.3y5_1.heavy 430.576 / 631.393 57585.0 34.26250076293945 48 18 10 10 10 3.554044624199259 28.1369567841401 0.0 3 0.9888824647263221 11.69378035244049 57585.0 73.13322072371136 0.0 - - - - - - - 221.5 115 6 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1891 244 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48244.[MT7]-LAYVAPTIPR.2y8_1.heavy 622.878 / 916.525 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12A protein phosphatase 1, regulatory (inhibitor) subunit 12A 1893 244 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48244.[MT7]-LAYVAPTIPR.2y9_1.heavy 622.878 / 987.562 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12A protein phosphatase 1, regulatory (inhibitor) subunit 12A 1895 244 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48244.[MT7]-LAYVAPTIPR.2y6_1.heavy 622.878 / 654.393 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12A protein phosphatase 1, regulatory (inhibitor) subunit 12A 1897 244 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48244.[MT7]-LAYVAPTIPR.2y7_1.heavy 622.878 / 753.462 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12A protein phosphatase 1, regulatory (inhibitor) subunit 12A 1899 245 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48857.[MT7]-SYDEK[MT7].2y4_1.heavy 465.245 / 698.348 3149.0 17.398700714111328 39 9 10 10 10 0.7362392764872392 68.26884945969839 0.0 3 0.8147029035722388 2.8215109031690178 3149.0 17.366212914485168 0.0 - - - - - - - 184.36363636363637 6 22 LIMK1 LIM domain kinase 1 1901 245 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48857.[MT7]-SYDEK[MT7].2b3_1.heavy 465.245 / 510.232 6107.0 17.398700714111328 39 9 10 10 10 0.7362392764872392 68.26884945969839 0.0 3 0.8147029035722388 2.8215109031690178 6107.0 17.43393499238717 0.0 - - - - - - - 257.0 12 18 LIMK1 LIM domain kinase 1 1903 245 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48857.[MT7]-SYDEK[MT7].2y3_1.heavy 465.245 / 535.284 2911.0 17.398700714111328 39 9 10 10 10 0.7362392764872392 68.26884945969839 0.0 3 0.8147029035722388 2.8215109031690178 2911.0 6.770051516775231 0.0 - - - - - - - 238.71428571428572 5 21 LIMK1 LIM domain kinase 1 1905 246 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535093.[MT7]-FIGVLYK[MT7].2y5_1.heavy 564.357 / 723.452 18144.0 38.36650085449219 47 17 10 10 10 2.8115947761231235 35.567003057918924 0.0 3 0.9751446712801022 7.811760906958564 18144.0 56.09448471843646 0.0 - - - - - - - 193.7058823529412 36 17 LIMK1;LIMK2 LIM domain kinase 1;LIM domain kinase 2 1907 246 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535093.[MT7]-FIGVLYK[MT7].2b4_1.heavy 564.357 / 561.352 14612.0 38.36650085449219 47 17 10 10 10 2.8115947761231235 35.567003057918924 0.0 3 0.9751446712801022 7.811760906958564 14612.0 25.873996180849687 0.0 - - - - - - - 740.4444444444445 29 9 LIMK1;LIMK2 LIM domain kinase 1;LIM domain kinase 2 1909 246 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535093.[MT7]-FIGVLYK[MT7].2y3_1.heavy 564.357 / 567.362 17100.0 38.36650085449219 47 17 10 10 10 2.8115947761231235 35.567003057918924 0.0 3 0.9751446712801022 7.811760906958564 17100.0 47.69051841223909 0.0 - - - - - - - 642.3333333333334 34 9 LIMK1;LIMK2 LIM domain kinase 1;LIM domain kinase 2 1911 246 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535093.[MT7]-FIGVLYK[MT7].2y6_1.heavy 564.357 / 836.536 13728.0 38.36650085449219 47 17 10 10 10 2.8115947761231235 35.567003057918924 0.0 3 0.9751446712801022 7.811760906958564 13728.0 57.868233979366934 0.0 - - - - - - - 260.8125 27 16 LIMK1;LIMK2 LIM domain kinase 1;LIM domain kinase 2 1913 247 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48668.[MT7]-IFRPSDLIHGEVLGK[MT7].3y6_1.heavy 657.054 / 746.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 1915 247 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48668.[MT7]-IFRPSDLIHGEVLGK[MT7].3b6_1.heavy 657.054 / 860.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 1917 247 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48668.[MT7]-IFRPSDLIHGEVLGK[MT7].3b8_1.heavy 657.054 / 1086.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 1919 247 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48668.[MT7]-IFRPSDLIHGEVLGK[MT7].3b7_1.heavy 657.054 / 973.559 N/A N/A - - - - - - - - - 0.0 - - - - - - - LIMK1 LIM domain kinase 1 1921 248 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48669.[MT7]-MIAGQVLDINLAAEPK[MT7].2b3_1.heavy 986.063 / 460.271 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1923 248 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48669.[MT7]-MIAGQVLDINLAAEPK[MT7].2y4_1.heavy 986.063 / 588.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1925 248 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48669.[MT7]-MIAGQVLDINLAAEPK[MT7].2b6_1.heavy 986.063 / 744.419 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1927 248 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48669.[MT7]-MIAGQVLDINLAAEPK[MT7].2b5_1.heavy 986.063 / 645.351 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) 1929 249 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48335.[MT7]-DK[MT7]VEIYK[MT7].2y4_1.heavy 663.903 / 696.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOSC1 exosome component 1 1931 249 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48335.[MT7]-DK[MT7]VEIYK[MT7].2b4_1.heavy 663.903 / 760.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOSC1 exosome component 1 1933 249 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48335.[MT7]-DK[MT7]VEIYK[MT7].2b5_1.heavy 663.903 / 873.528 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOSC1 exosome component 1 1935 249 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48335.[MT7]-DK[MT7]VEIYK[MT7].2y6_2.heavy 663.903 / 534.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - EXOSC1 exosome component 1 1937 250 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49235.[MT7]-EDTEEHHLR.2y4_1.heavy 655.316 / 562.321 1524.0 15.907150030136108 37 11 10 6 10 1.223907508649576 56.60714545313766 0.03020000457763672 3 0.8773789078586777 3.487696594351381 1524.0 9.837735849056601 0.0 - - - - - - - 89.10526315789474 3 19 HNRNPA1L2;HNRNPA1;HNRNPA2B1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1;heterogeneous nuclear ribonucleoprotein A2/B1 1939 250 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49235.[MT7]-EDTEEHHLR.2y8_1.heavy 655.316 / 1036.48 2159.0 15.907150030136108 37 11 10 6 10 1.223907508649576 56.60714545313766 0.03020000457763672 3 0.8773789078586777 3.487696594351381 2159.0 16.49801886792453 0.0 - - - - - - - 141.85 4 20 HNRNPA1L2;HNRNPA1;HNRNPA2B1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1;heterogeneous nuclear ribonucleoprotein A2/B1 1941 250 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49235.[MT7]-EDTEEHHLR.2b5_1.heavy 655.316 / 748.312 889.0 15.907150030136108 37 11 10 6 10 1.223907508649576 56.60714545313766 0.03020000457763672 3 0.8773789078586777 3.487696594351381 889.0 9.2832741617357 0.0 - - - - - - - 0.0 1 0 HNRNPA1L2;HNRNPA1;HNRNPA2B1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1;heterogeneous nuclear ribonucleoprotein A2/B1 1943 250 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49235.[MT7]-EDTEEHHLR.2y7_1.heavy 655.316 / 921.454 1567.0 15.907150030136108 37 11 10 6 10 1.223907508649576 56.60714545313766 0.03020000457763672 3 0.8773789078586777 3.487696594351381 1567.0 43.05386587771203 0.0 - - - - - - - 119.18181818181819 3 11 HNRNPA1L2;HNRNPA1;HNRNPA2B1 heterogeneous nuclear ribonucleoprotein A1-like 2;heterogeneous nuclear ribonucleoprotein A1;heterogeneous nuclear ribonucleoprotein A2/B1 1945 251 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47998.[MT7]-ISAVEPK[MT7].2y5_1.heavy 516.321 / 687.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO7 LIM domain 7 1947 251 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47998.[MT7]-ISAVEPK[MT7].2b4_1.heavy 516.321 / 515.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO7 LIM domain 7 1949 251 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47998.[MT7]-ISAVEPK[MT7].2y6_1.heavy 516.321 / 774.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO7 LIM domain 7 1951 251 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47998.[MT7]-ISAVEPK[MT7].2b5_1.heavy 516.321 / 644.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO7 LIM domain 7 1953 252 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536216.[MT7]-VHILYVGSMPLK[MT7].3y6_1.heavy 548.997 / 776.446 5835.0 37.531700134277344 50 20 10 10 10 9.655172391743077 10.35714288079601 0.0 3 0.9927059511650779 14.441546477361992 5835.0 26.974452554744524 0.0 - - - - - - - 207.33333333333334 11 21 EXOSC1 exosome component 1 1955 252 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536216.[MT7]-VHILYVGSMPLK[MT7].3y3_1.heavy 548.997 / 501.352 41751.0 37.531700134277344 50 20 10 10 10 9.655172391743077 10.35714288079601 0.0 3 0.9927059511650779 14.441546477361992 41751.0 36.929704698693634 0.0 - - - - - - - 1197.7142857142858 83 7 EXOSC1 exosome component 1 1957 252 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536216.[MT7]-VHILYVGSMPLK[MT7].3b4_1.heavy 548.997 / 607.405 17424.0 37.531700134277344 50 20 10 10 10 9.655172391743077 10.35714288079601 0.0 3 0.9927059511650779 14.441546477361992 17424.0 40.899674262139 0.0 - - - - - - - 379.38461538461536 34 13 EXOSC1 exosome component 1 1959 252 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB536216.[MT7]-VHILYVGSMPLK[MT7].3b5_1.heavy 548.997 / 770.468 8137.0 37.531700134277344 50 20 10 10 10 9.655172391743077 10.35714288079601 0.0 3 0.9927059511650779 14.441546477361992 8137.0 39.3068460490883 0.0 - - - - - - - 246.5 16 18 EXOSC1 exosome component 1 1961 253 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534997.[MT7]-LVGSEVGDR.2y8_1.heavy 538.297 / 818.4 99083.0 25.232900619506836 50 20 10 10 10 26.60206231241911 3.7591070506332596 0.0 3 0.9993024101705376 46.723680962734655 99083.0 125.6433896114371 0.0 - - - - - - - 339.0 198 3 IRF3 interferon regulatory factor 3 1963 253 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534997.[MT7]-LVGSEVGDR.2y6_1.heavy 538.297 / 662.31 14435.0 25.232900619506836 50 20 10 10 10 26.60206231241911 3.7591070506332596 0.0 3 0.9993024101705376 46.723680962734655 14435.0 50.20672305985959 0.0 - - - - - - - 707.8888888888889 28 9 IRF3 interferon regulatory factor 3 1965 253 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534997.[MT7]-LVGSEVGDR.2b5_1.heavy 538.297 / 630.358 20264.0 25.232900619506836 50 20 10 10 10 26.60206231241911 3.7591070506332596 0.0 3 0.9993024101705376 46.723680962734655 20264.0 33.763993362831854 0.0 - - - - - - - 677.4545454545455 40 11 IRF3 interferon regulatory factor 3 1967 253 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534997.[MT7]-LVGSEVGDR.2y7_1.heavy 538.297 / 719.332 68314.0 25.232900619506836 50 20 10 10 10 26.60206231241911 3.7591070506332596 0.0 3 0.9993024101705376 46.723680962734655 68314.0 143.30207853936946 0.0 - - - - - - - 338.8 136 5 IRF3 interferon regulatory factor 3 1969 254 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48478.[MT7]-TEFDFSDYVK[MT7].2b3_1.heavy 769.884 / 522.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1971 254 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48478.[MT7]-TEFDFSDYVK[MT7].2b4_1.heavy 769.884 / 637.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1973 254 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48478.[MT7]-TEFDFSDYVK[MT7].2y3_1.heavy 769.884 / 553.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1975 254 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48478.[MT7]-TEFDFSDYVK[MT7].2y6_1.heavy 769.884 / 902.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1977 255 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48283.[MT7]-DLFTELQK[MT7].2b3_1.heavy 641.368 / 520.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1979 255 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48283.[MT7]-DLFTELQK[MT7].2y5_1.heavy 641.368 / 762.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1981 255 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48283.[MT7]-DLFTELQK[MT7].2b6_1.heavy 641.368 / 863.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1983 255 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48283.[MT7]-DLFTELQK[MT7].2y3_1.heavy 641.368 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGAL integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) 1985 256 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47892.[MT7]-NMNFK[MT7].2b3_1.heavy 471.259 / 504.236 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 1987 256 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47892.[MT7]-NMNFK[MT7].2y4_1.heavy 471.259 / 683.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 1989 256 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47892.[MT7]-NMNFK[MT7].2y3_1.heavy 471.259 / 552.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 1991 257 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535643.[MT7]-ALDEYYDK[MT7].3y3_1.heavy 435.559 / 569.305 116957.0 29.071149826049805 43 17 10 6 10 3.1331887565695196 25.177764742127387 0.03530120849609375 3 0.9728539731594629 7.473462486225006 116957.0 128.92514993456564 0.0 - - - - - - - 1154.142857142857 233 7 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1993 257 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535643.[MT7]-ALDEYYDK[MT7].3b4_1.heavy 435.559 / 573.3 197974.0 29.071149826049805 43 17 10 6 10 3.1331887565695196 25.177764742127387 0.03530120849609375 3 0.9728539731594629 7.473462486225006 197974.0 177.2713892530948 0.0 - - - - - - - 1703.111111111111 395 9 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1995 257 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535643.[MT7]-ALDEYYDK[MT7].3b5_1.heavy 435.559 / 736.363 36544.0 29.071149826049805 43 17 10 6 10 3.1331887565695196 25.177764742127387 0.03530120849609375 3 0.9728539731594629 7.473462486225006 36544.0 185.5236402116402 0.0 - - - - - - - 308.0 73 13 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1997 257 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535643.[MT7]-ALDEYYDK[MT7].3b3_1.heavy 435.559 / 444.258 165583.0 29.071149826049805 43 17 10 6 10 3.1331887565695196 25.177764742127387 0.03530120849609375 3 0.9728539731594629 7.473462486225006 165583.0 86.85963295145145 0.0 - - - - - - - 1284.0 331 1 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 1999 258 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535646.[MT7]-NVVVADFGLAR.2y8_1.heavy 652.876 / 848.463 32350.0 38.027198791503906 47 17 10 10 10 3.9721627256008825 25.175202253294557 0.0 3 0.9714218869878019 7.282925320708974 32350.0 54.66970325576342 0.0 - - - - - - - 678.4285714285714 64 7 LIMK1 LIM domain kinase 1 2001 258 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535646.[MT7]-NVVVADFGLAR.2y5_1.heavy 652.876 / 563.33 42506.0 38.027198791503906 47 17 10 10 10 3.9721627256008825 25.175202253294557 0.0 3 0.9714218869878019 7.282925320708974 42506.0 61.26679153094462 0.0 - - - - - - - 1228.4545454545455 85 11 LIMK1 LIM domain kinase 1 2003 258 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535646.[MT7]-NVVVADFGLAR.2y9_1.heavy 652.876 / 947.531 28337.0 38.027198791503906 47 17 10 10 10 3.9721627256008825 25.175202253294557 0.0 3 0.9714218869878019 7.282925320708974 28337.0 89.04612139266638 0.0 - - - - - - - 725.2857142857143 56 7 LIMK1 LIM domain kinase 1 2005 258 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535646.[MT7]-NVVVADFGLAR.2y10_1.heavy 652.876 / 1046.6 20147.0 38.027198791503906 47 17 10 10 10 3.9721627256008825 25.175202253294557 0.0 3 0.9714218869878019 7.282925320708974 20147.0 23.371978147593055 0.0 - - - - - - - 382.0833333333333 40 12 LIMK1 LIM domain kinase 1 2007 259 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48671.[MT7]-FHIYNMGNPGFEEER.3y7_1.heavy 661.976 / 863.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 2009 259 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48671.[MT7]-FHIYNMGNPGFEEER.3y6_1.heavy 661.976 / 766.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 2011 259 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48671.[MT7]-FHIYNMGNPGFEEER.3b3_1.heavy 661.976 / 542.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 2013 259 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48671.[MT7]-FHIYNMGNPGFEEER.3y5_1.heavy 661.976 / 709.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 2015 260 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535743.[MT7]-DK[MT7]VEIYK[MT7].3y6_2.heavy 442.938 / 534.339 51964.0 24.540374279022217 41 15 10 6 10 2.0100565661547427 39.3731684635709 0.03289985656738281 3 0.9596512099857907 6.123164356302248 51964.0 41.367134007191595 0.0 - - - - - - - 1255.875 103 8 EXOSC1 exosome component 1 2017 260 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535743.[MT7]-DK[MT7]VEIYK[MT7].3y3_1.heavy 442.938 / 567.362 66735.0 24.540374279022217 41 15 10 6 10 2.0100565661547427 39.3731684635709 0.03289985656738281 3 0.9596512099857907 6.123164356302248 66735.0 87.3324793259479 0.0 - - - - - - - 1214.375 133 8 EXOSC1 exosome component 1 2019 260 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535743.[MT7]-DK[MT7]VEIYK[MT7].3b4_1.heavy 442.938 / 760.444 20160.0 24.540374279022217 41 15 10 6 10 2.0100565661547427 39.3731684635709 0.03289985656738281 3 0.9596512099857907 6.123164356302248 20160.0 104.73513513513512 0.0 - - - - - - - 241.78947368421052 40 19 EXOSC1 exosome component 1 2021 260 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535743.[MT7]-DK[MT7]VEIYK[MT7].3y4_1.heavy 442.938 / 696.405 24418.0 24.540374279022217 41 15 10 6 10 2.0100565661547427 39.3731684635709 0.03289985656738281 3 0.9596512099857907 6.123164356302248 24418.0 89.68473071432088 0.0 - - - - - - - 704.0 48 12 EXOSC1 exosome component 1 2023 261 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47794.[MT7]-ASLILR.2y4_1.heavy 408.775 / 514.371 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 2025 261 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47794.[MT7]-ASLILR.2b3_1.heavy 408.775 / 416.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 2027 261 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47794.[MT7]-ASLILR.2y5_1.heavy 408.775 / 601.403 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 2029 261 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB47794.[MT7]-ASLILR.2b4_1.heavy 408.775 / 529.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 2031 262 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48138.[MT7]-FC[CAM]PFYK[MT7].2y4_1.heavy 575.304 / 698.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 2033 262 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48138.[MT7]-FC[CAM]PFYK[MT7].2y5_1.heavy 575.304 / 858.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 2035 262 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48138.[MT7]-FC[CAM]PFYK[MT7].2y3_1.heavy 575.304 / 601.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 2037 262 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48138.[MT7]-FC[CAM]PFYK[MT7].2b5_1.heavy 575.304 / 859.393 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 2039 263 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48131.[MT7]-GVPELVLK[MT7].2y4_1.heavy 571.873 / 616.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 2041 263 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48131.[MT7]-GVPELVLK[MT7].2y3_1.heavy 571.873 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 2043 263 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48131.[MT7]-GVPELVLK[MT7].2y6_1.heavy 571.873 / 842.547 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 2045 263 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48131.[MT7]-GVPELVLK[MT7].2b5_1.heavy 571.873 / 640.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGA6 integrin, alpha 6 2047 264 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535249.[MT7]-ISDLGLAVK[MT7].2y8_1.heavy 602.381 / 946.569 11828.0 35.27799987792969 38 16 2 10 10 12.01074969250361 8.325874950371666 0.0 3 0.9612553584866519 6.249485475466532 11828.0 46.18300630769873 0.0 - - - - - - - 308.06666666666666 23 15 GRK5 G protein-coupled receptor kinase 5 2049 264 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535249.[MT7]-ISDLGLAVK[MT7].2y5_1.heavy 602.381 / 631.426 12012.0 35.27799987792969 38 16 2 10 10 12.01074969250361 8.325874950371666 0.0 3 0.9612553584866519 6.249485475466532 12012.0 15.981476766390834 0.0 - - - - - - - 716.0 24 8 GRK5 G protein-coupled receptor kinase 5 2051 264 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535249.[MT7]-ISDLGLAVK[MT7].2y6_1.heavy 602.381 / 744.51 9240.0 35.27799987792969 38 16 2 10 10 12.01074969250361 8.325874950371666 0.0 3 0.9612553584866519 6.249485475466532 9240.0 13.924229808492923 0.0 - - - - - - - 727.625 18 8 GRK5 G protein-coupled receptor kinase 5 2053 264 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB535249.[MT7]-ISDLGLAVK[MT7].2b5_1.heavy 602.381 / 630.358 5082.0 35.27799987792969 38 16 2 10 10 12.01074969250361 8.325874950371666 0.0 3 0.9612553584866519 6.249485475466532 5082.0 16.0195050189991 2.0 - - - - - - - 705.4545454545455 68 11 GRK5 G protein-coupled receptor kinase 5 2055 265 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49519.[MT7]-HFPSVNWLISYSK[MT7].3y3_1.heavy 622.677 / 541.31 6061.0 41.514801025390625 39 13 10 6 10 0.9804179872909845 67.1497105187002 0.033599853515625 3 0.9149559181900027 4.201586688250725 6061.0 4.797625329815303 0.0 - - - - - - - 683.1818181818181 12 11 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 2057 265 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49519.[MT7]-HFPSVNWLISYSK[MT7].3b6_1.heavy 622.677 / 826.433 6945.0 41.514801025390625 39 13 10 6 10 0.9804179872909845 67.1497105187002 0.033599853515625 3 0.9149559181900027 4.201586688250725 6945.0 49.56836076559032 0.0 - - - - - - - 221.0 13 16 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 2059 265 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49519.[MT7]-HFPSVNWLISYSK[MT7].3y4_1.heavy 622.677 / 628.342 12059.0 41.514801025390625 39 13 10 6 10 0.9804179872909845 67.1497105187002 0.033599853515625 3 0.9149559181900027 4.201586688250725 12059.0 10.83370236144815 0.0 - - - - - - - 757.6666666666666 24 9 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 2061 265 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB49519.[MT7]-HFPSVNWLISYSK[MT7].3y5_1.heavy 622.677 / 741.426 11428.0 41.514801025390625 39 13 10 6 10 0.9804179872909845 67.1497105187002 0.033599853515625 3 0.9149559181900027 4.201586688250725 11428.0 16.867936110900068 0.0 - - - - - - - 320.61538461538464 22 13 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 2063 266 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48532.[MT7]-RAVETTAQSDNK[MT7].3b6_1.heavy 536.625 / 802.454 1129.0 16.351699829101562 42 16 10 10 6 3.8410537063797507 26.034522723258522 0.0 5 0.96909354355357 7.001850412654337 1129.0 9.487843010538874 1.0 - - - - - - - 169.30769230769232 2 13 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 2065 266 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48532.[MT7]-RAVETTAQSDNK[MT7].3y3_1.heavy 536.625 / 520.285 2418.0 16.351699829101562 42 16 10 10 6 3.8410537063797507 26.034522723258522 0.0 5 0.96909354355357 7.001850412654337 2418.0 5.919337281511497 4.0 - - - - - - - 685.25 5 8 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 2067 266 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48532.[MT7]-RAVETTAQSDNK[MT7].3b4_1.heavy 536.625 / 600.359 699.0 16.351699829101562 42 16 10 10 6 3.8410537063797507 26.034522723258522 0.0 5 0.96909354355357 7.001850412654337 699.0 2.36385786508739 3.0 - - - - - - - 230.7058823529412 2 17 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 2069 266 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48532.[MT7]-RAVETTAQSDNK[MT7].3y4_1.heavy 536.625 / 607.317 3224.0 16.351699829101562 42 16 10 10 6 3.8410537063797507 26.034522723258522 0.0 5 0.96909354355357 7.001850412654337 3224.0 5.248372093023256 0.0 - - - - - - - 236.5 6 10 ATP6V1A ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A 2071 267 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534721.[MT7]-FSEEAK[MT7].2b3_1.heavy 499.773 / 508.252 4453.0 21.521699905395508 46 16 10 10 10 1.5607736752464187 41.195820130304455 0.0 3 0.9689523432759303 6.985827418288936 4453.0 9.451661027690609 1.0 - - - - - - - 320.85714285714283 8 21 GRK5 G protein-coupled receptor kinase 5 2073 267 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534721.[MT7]-FSEEAK[MT7].2y4_1.heavy 499.773 / 620.337 2287.0 21.521699905395508 46 16 10 10 10 1.5607736752464187 41.195820130304455 0.0 3 0.9689523432759303 6.985827418288936 2287.0 3.187037100032987 1.0 - - - - - - - 696.5 4 14 GRK5 G protein-coupled receptor kinase 5 2075 267 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534721.[MT7]-FSEEAK[MT7].2y5_1.heavy 499.773 / 707.369 11494.0 21.521699905395508 46 16 10 10 10 1.5607736752464187 41.195820130304455 0.0 3 0.9689523432759303 6.985827418288936 11494.0 26.108254847645426 0.0 - - - - - - - 309.04545454545456 22 22 GRK5 G protein-coupled receptor kinase 5 2077 267 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534721.[MT7]-FSEEAK[MT7].2b4_1.heavy 499.773 / 637.295 4152.0 21.521699905395508 46 16 10 10 10 1.5607736752464187 41.195820130304455 0.0 3 0.9689523432759303 6.985827418288936 4152.0 12.44130185536986 0.0 - - - - - - - 246.1818181818182 8 22 GRK5 G protein-coupled receptor kinase 5 2079 268 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48739.[MT7]-SPVFIAQVGQDLVSQTEEK[MT7].3y6_1.heavy 788.428 / 865.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 2081 268 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48739.[MT7]-SPVFIAQVGQDLVSQTEEK[MT7].3b4_1.heavy 788.428 / 575.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 2083 268 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48739.[MT7]-SPVFIAQVGQDLVSQTEEK[MT7].3b5_1.heavy 788.428 / 688.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 2085 268 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48739.[MT7]-SPVFIAQVGQDLVSQTEEK[MT7].3y4_1.heavy 788.428 / 650.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRK5 G protein-coupled receptor kinase 5 2087 269 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534398.[MT7]-VLVDAR.2b3_1.heavy 408.757 / 456.33 58361.0 25.08804988861084 40 14 10 6 10 3.171214554732909 31.53365950933659 0.038600921630859375 3 0.9344108799143299 4.792296136797086 58361.0 43.06547175637591 0.0 - - - - - - - 1221.375 116 8 GNA13;GNA12 guanine nucleotide binding protein (G protein), alpha 13;guanine nucleotide binding protein (G protein) alpha 12 2089 269 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534398.[MT7]-VLVDAR.2y5_1.heavy 408.757 / 573.336 148781.0 25.08804988861084 40 14 10 6 10 3.171214554732909 31.53365950933659 0.038600921630859375 3 0.9344108799143299 4.792296136797086 148781.0 134.92063261573588 0.0 - - - - - - - 1296.75 297 8 GNA13;GNA12 guanine nucleotide binding protein (G protein), alpha 13;guanine nucleotide binding protein (G protein) alpha 12 2091 269 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534398.[MT7]-VLVDAR.2b4_1.heavy 408.757 / 571.357 488375.0 25.08804988861084 40 14 10 6 10 3.171214554732909 31.53365950933659 0.038600921630859375 3 0.9344108799143299 4.792296136797086 488375.0 368.5161959257481 0.0 - - - - - - - 853.25 976 4 GNA13;GNA12 guanine nucleotide binding protein (G protein), alpha 13;guanine nucleotide binding protein (G protein) alpha 12 2093 269 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB534398.[MT7]-VLVDAR.2y3_1.heavy 408.757 / 361.183 21819.0 25.08804988861084 40 14 10 6 10 3.171214554732909 31.53365950933659 0.038600921630859375 3 0.9344108799143299 4.792296136797086 21819.0 19.21583339197748 0.0 - - - - - - - 2158.5 43 8 GNA13;GNA12 guanine nucleotide binding protein (G protein), alpha 13;guanine nucleotide binding protein (G protein) alpha 12 2095 270 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48953.[MT7]-RLVMVK[MT7].2b3_1.heavy 517.343 / 513.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 2097 270 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48953.[MT7]-RLVMVK[MT7].2y4_1.heavy 517.343 / 620.392 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 2099 270 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48953.[MT7]-RLVMVK[MT7].2y5_1.heavy 517.343 / 733.476 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 2101 270 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48953.[MT7]-RLVMVK[MT7].2y3_1.heavy 517.343 / 521.324 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 2103 271 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48874.[MT7]-GVMSYVR.2y4_1.heavy 478.261 / 524.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 2105 271 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48874.[MT7]-GVMSYVR.2y5_1.heavy 478.261 / 655.323 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 2107 271 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48874.[MT7]-GVMSYVR.2b4_1.heavy 478.261 / 519.272 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3 2109 271 C20140303_KEGG1700_set14_02 C20140303_KEGG1700_set14_02 TB48874.[MT7]-GVMSYVR.2y6_1.heavy 478.261 / 754.392 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRF3 interferon regulatory factor 3