Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588524.[MT7]-AYPDANLLNDRVLR.3b4_1.heavy 591.996 / 591.289 4294.0 35.14310073852539 37 14 10 5 8 2.3982498348819132 41.697073651596384 0.04959869384765625 4 0.9400276279612997 5.014088757871438 4294.0 2.749567585911349 6.0 - - - - - - - 889.75 10 4 CCND1 cyclin D1 3 1 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588524.[MT7]-AYPDANLLNDRVLR.3y4_1.heavy 591.996 / 543.372 3681.0 35.14310073852539 37 14 10 5 8 2.3982498348819132 41.697073651596384 0.04959869384765625 4 0.9400276279612997 5.014088757871438 3681.0 5.100815217391304 0.0 - - - - - - - 806.2857142857143 7 7 CCND1 cyclin D1 5 1 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588524.[MT7]-AYPDANLLNDRVLR.3y12_2.heavy 591.996 / 698.389 12882.0 35.14310073852539 37 14 10 5 8 2.3982498348819132 41.697073651596384 0.04959869384765625 4 0.9400276279612997 5.014088757871438 12882.0 44.940603422784676 0.0 - - - - - - - 355.9 25 10 CCND1 cyclin D1 7 1 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588524.[MT7]-AYPDANLLNDRVLR.3y13_2.heavy 591.996 / 779.92 5521.0 35.14310073852539 37 14 10 5 8 2.3982498348819132 41.697073651596384 0.04959869384765625 4 0.9400276279612997 5.014088757871438 5521.0 20.273354398802596 0.0 - - - - - - - 258.8888888888889 11 9 CCND1 cyclin D1 9 2 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544828.[MT7]-SLNINVLHQSLSQFGITEVSPEK[MT7].4y4_1.heavy 707.89 / 604.342 31567.0 43.612300872802734 43 13 10 10 10 1.944757080281543 51.42030385899044 0.0 3 0.9089420034009706 4.058367648710076 31567.0 80.24689127105665 0.0 - - - - - - - 769.2857142857143 63 7 PTPRR protein tyrosine phosphatase, receptor type, R 11 2 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544828.[MT7]-SLNINVLHQSLSQFGITEVSPEK[MT7].4b5_1.heavy 707.89 / 686.395 2773.0 43.612300872802734 43 13 10 10 10 1.944757080281543 51.42030385899044 0.0 3 0.9089420034009706 4.058367648710076 2773.0 1.160395461218984 1.0 - - - - - - - 697.8888888888889 6 9 PTPRR protein tyrosine phosphatase, receptor type, R 13 2 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544828.[MT7]-SLNINVLHQSLSQFGITEVSPEK[MT7].4y3_1.heavy 707.89 / 517.31 44781.0 43.612300872802734 43 13 10 10 10 1.944757080281543 51.42030385899044 0.0 3 0.9089420034009706 4.058367648710076 44781.0 97.29524656829983 0.0 - - - - - - - 754.5 89 12 PTPRR protein tyrosine phosphatase, receptor type, R 15 2 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544828.[MT7]-SLNINVLHQSLSQFGITEVSPEK[MT7].4b6_1.heavy 707.89 / 785.464 5465.0 43.612300872802734 43 13 10 10 10 1.944757080281543 51.42030385899044 0.0 3 0.9089420034009706 4.058367648710076 5465.0 19.022688952989252 0.0 - - - - - - - 214.375 10 16 PTPRR protein tyrosine phosphatase, receptor type, R 17 3 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543045.[MT7]-VQVEDIVFLIRK[MT7].4y5_1.heavy 437.523 / 820.552 9637.0 44.14179992675781 36 10 10 6 10 1.854829885351581 53.91329996877052 0.03800201416015625 3 0.832562680480908 2.9729073864908937 9637.0 141.81856790123456 0.0 - - - - - - - 202.5 19 4 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 19 3 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543045.[MT7]-VQVEDIVFLIRK[MT7].4y6_2.heavy 437.523 / 460.314 42839.0 44.14179992675781 36 10 10 6 10 1.854829885351581 53.91329996877052 0.03800201416015625 3 0.832562680480908 2.9729073864908937 42839.0 499.0550171179583 0.0 - - - - - - - 198.0 85 9 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 21 3 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543045.[MT7]-VQVEDIVFLIRK[MT7].4b5_1.heavy 437.523 / 715.374 4859.0 44.14179992675781 36 10 10 6 10 1.854829885351581 53.91329996877052 0.03800201416015625 3 0.832562680480908 2.9729073864908937 4859.0 59.44776543209876 0.0 - - - - - - - 141.75 9 4 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 23 3 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543045.[MT7]-VQVEDIVFLIRK[MT7].4b3_1.heavy 437.523 / 471.305 31502.0 44.14179992675781 36 10 10 6 10 1.854829885351581 53.91329996877052 0.03800201416015625 3 0.832562680480908 2.9729073864908937 31502.0 299.4634567901234 0.0 - - - - - - - 167.4 63 15 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 25 4 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543182.[MT7]-ITAEEALLHPFFK[MT7].3y3_1.heavy 602.013 / 585.352 3412.0 43.37260055541992 45 15 10 10 10 12.37679501271284 8.079636117208445 0.0 3 0.9534902770614805 5.700234352360435 3412.0 10.645051966513979 0.0 - - - - - - - 296.1764705882353 6 17 CDC7 cell division cycle 7 homolog (S. cerevisiae) 27 4 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543182.[MT7]-ITAEEALLHPFFK[MT7].3b5_1.heavy 602.013 / 688.363 2599.0 43.37260055541992 45 15 10 10 10 12.37679501271284 8.079636117208445 0.0 3 0.9534902770614805 5.700234352360435 2599.0 4.726980161656463 1.0 - - - - - - - 231.78571428571428 5 14 CDC7 cell division cycle 7 homolog (S. cerevisiae) 29 4 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543182.[MT7]-ITAEEALLHPFFK[MT7].3y4_1.heavy 602.013 / 682.404 10398.0 43.37260055541992 45 15 10 10 10 12.37679501271284 8.079636117208445 0.0 3 0.9534902770614805 5.700234352360435 10398.0 75.85426229508197 0.0 - - - - - - - 205.66666666666666 20 15 CDC7 cell division cycle 7 homolog (S. cerevisiae) 31 4 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543182.[MT7]-ITAEEALLHPFFK[MT7].3b7_1.heavy 602.013 / 872.485 3493.0 43.37260055541992 45 15 10 10 10 12.37679501271284 8.079636117208445 0.0 3 0.9534902770614805 5.700234352360435 3493.0 51.74814814814815 0.0 - - - - - - - 171.33333333333334 6 9 CDC7 cell division cycle 7 homolog (S. cerevisiae) 33 5 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544825.[MT7]-WNTDNTLGTEIAIEDQIC[CAM]QGLK[MT7].3b6_1.heavy 936.476 / 876.397 1564.0 45.18362617492676 37 11 10 6 10 1.0423972927515994 57.30118823251313 0.03929901123046875 3 0.8798270503362605 3.5237953711957815 1564.0 11.021476510067114 0.0 - - - - - - - 186.08333333333334 3 12 VDAC2 voltage-dependent anion channel 2 35 5 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544825.[MT7]-WNTDNTLGTEIAIEDQIC[CAM]QGLK[MT7].3b5_1.heavy 936.476 / 775.349 894.0 45.18362617492676 37 11 10 6 10 1.0423972927515994 57.30118823251313 0.03929901123046875 3 0.8798270503362605 3.5237953711957815 894.0 1.1035874439461884 1.0 - - - - - - - 0.0 1 0 VDAC2 voltage-dependent anion channel 2 37 5 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544825.[MT7]-WNTDNTLGTEIAIEDQIC[CAM]QGLK[MT7].3b7_1.heavy 936.476 / 989.481 2458.0 45.18362617492676 37 11 10 6 10 1.0423972927515994 57.30118823251313 0.03929901123046875 3 0.8798270503362605 3.5237953711957815 2458.0 30.02389261744966 0.0 - - - - - - - 143.86666666666667 4 15 VDAC2 voltage-dependent anion channel 2 39 5 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544825.[MT7]-WNTDNTLGTEIAIEDQIC[CAM]QGLK[MT7].3y5_1.heavy 936.476 / 749.41 3649.0 45.18362617492676 37 11 10 6 10 1.0423972927515994 57.30118823251313 0.03929901123046875 3 0.8798270503362605 3.5237953711957815 3649.0 31.86985884973064 0.0 - - - - - - - 171.05 7 20 VDAC2 voltage-dependent anion channel 2 41 6 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544822.[MT7]-AAEEEEEEEEEVDLAC[CAM]TPTDVR.3b6_1.heavy 898.728 / 803.354 2465.0 33.30754852294922 42 16 10 6 10 3.8321615127552193 21.870960038346773 0.0334014892578125 3 0.9617310778893614 6.288461920314514 2465.0 7.968598288840913 0.0 - - - - - - - 168.21052631578948 4 19 CCND1 cyclin D1 43 6 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544822.[MT7]-AAEEEEEEEEEVDLAC[CAM]TPTDVR.3b5_1.heavy 898.728 / 674.311 2739.0 33.30754852294922 42 16 10 6 10 3.8321615127552193 21.870960038346773 0.0334014892578125 3 0.9617310778893614 6.288461920314514 2739.0 13.919508196721312 0.0 - - - - - - - 234.125 5 16 CCND1 cyclin D1 45 6 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544822.[MT7]-AAEEEEEEEEEVDLAC[CAM]TPTDVR.3b8_1.heavy 898.728 / 1061.44 4200.0 33.30754852294922 42 16 10 6 10 3.8321615127552193 21.870960038346773 0.0334014892578125 3 0.9617310778893614 6.288461920314514 4200.0 18.625682557702607 0.0 - - - - - - - 273.9230769230769 8 13 CCND1 cyclin D1 47 6 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544822.[MT7]-AAEEEEEEEEEVDLAC[CAM]TPTDVR.3b7_1.heavy 898.728 / 932.396 4017.0 33.30754852294922 42 16 10 6 10 3.8321615127552193 21.870960038346773 0.0334014892578125 3 0.9617310778893614 6.288461920314514 4017.0 22.62317628565012 0.0 - - - - - - - 266.4166666666667 8 12 CCND1 cyclin D1 49 7 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587594.[MT7]-AEVAAAAAR.2y8_1.heavy 487.281 / 758.416 18322.0 19.769500732421875 47 17 10 10 10 2.347381848590727 29.685127244242132 0.0 3 0.9737448584841403 7.599768716558709 18322.0 87.4901627608333 0.0 - - - - - - - 168.47826086956522 36 23 UBA7 ubiquitin-like modifier activating enzyme 7 51 7 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587594.[MT7]-AEVAAAAAR.2b4_1.heavy 487.281 / 515.295 12149.0 19.769500732421875 47 17 10 10 10 2.347381848590727 29.685127244242132 0.0 3 0.9737448584841403 7.599768716558709 12149.0 46.05986930810172 0.0 - - - - - - - 231.08 24 25 UBA7 ubiquitin-like modifier activating enzyme 7 53 7 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587594.[MT7]-AEVAAAAAR.2y6_1.heavy 487.281 / 530.305 24891.0 19.769500732421875 47 17 10 10 10 2.347381848590727 29.685127244242132 0.0 3 0.9737448584841403 7.599768716558709 24891.0 97.21737373737375 0.0 - - - - - - - 580.3333333333334 49 9 UBA7 ubiquitin-like modifier activating enzyme 7 55 7 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587594.[MT7]-AEVAAAAAR.2y7_1.heavy 487.281 / 629.373 18362.0 19.769500732421875 47 17 10 10 10 2.347381848590727 29.685127244242132 0.0 3 0.9737448584841403 7.599768716558709 18362.0 53.47159119132378 0.0 - - - - - - - 655.2222222222222 36 9 UBA7 ubiquitin-like modifier activating enzyme 7 57 8 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18409.[MT7]-QTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIK[MT7].4y8_1.heavy 993.756 / 1002.6 8676.0 52.085899353027344 41 11 10 10 10 1.2463918205086462 63.85650246022949 0.0 3 0.8513424749153707 3.160355084353593 8676.0 133.25442633328058 0.0 - - - - - - - 119.04761904761905 17 21 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 59 8 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18409.[MT7]-QTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIK[MT7].4b4_1.heavy 993.756 / 570.337 3424.0 52.085899353027344 41 11 10 10 10 1.2463918205086462 63.85650246022949 0.0 3 0.8513424749153707 3.160355084353593 3424.0 126.2173153638814 0.0 - - - - - - - 82.29411764705883 6 17 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 61 8 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18409.[MT7]-QTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIK[MT7].4b5_1.heavy 993.756 / 685.364 4028.0 52.085899353027344 41 11 10 10 10 1.2463918205086462 63.85650246022949 0.0 3 0.8513424749153707 3.160355084353593 4028.0 106.01999999999998 0.0 - - - - - - - 85.0952380952381 8 21 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 63 8 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18409.[MT7]-QTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIK[MT7].4b6_1.heavy 993.756 / 772.396 3176.0 52.085899353027344 41 11 10 10 10 1.2463918205086462 63.85650246022949 0.0 3 0.8513424749153707 3.160355084353593 3176.0 76.5728121538218 0.0 - - - - - - - 77.77777777777777 6 18 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 65 9 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18353.[MT7]-YTGPGDASNFDDYEEEELR.3y7_1.heavy 784.34 / 967.437 9497.0 34.88209915161133 48 18 10 10 10 3.577638670304669 27.951397336468325 0.0 3 0.9833905523393873 9.562728368673973 9497.0 15.84391549842394 0.0 - - - - - - - 207.75 18 8 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 67 9 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18353.[MT7]-YTGPGDASNFDDYEEEELR.3b6_1.heavy 784.34 / 735.343 11397.0 34.88209915161133 48 18 10 10 10 3.577638670304669 27.951397336468325 0.0 3 0.9833905523393873 9.562728368673973 11397.0 34.31096842105263 0.0 - - - - - - - 761.9166666666666 22 12 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 69 9 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18353.[MT7]-YTGPGDASNFDDYEEEELR.3y5_1.heavy 784.34 / 675.331 9972.0 34.88209915161133 48 18 10 10 10 3.577638670304669 27.951397336468325 0.0 3 0.9833905523393873 9.562728368673973 9972.0 27.42681776416539 0.0 - - - - - - - 281.75 19 8 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 71 9 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18353.[MT7]-YTGPGDASNFDDYEEEELR.3y9_1.heavy 784.34 / 1197.49 10566.0 34.88209915161133 48 18 10 10 10 3.577638670304669 27.951397336468325 0.0 3 0.9833905523393873 9.562728368673973 10566.0 44.204877425944844 0.0 - - - - - - - 310.3076923076923 21 13 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 73 10 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18212.[MT7]-TIFSALENDPLFAR.3y7_1.heavy 579.981 / 832.431 20081.0 49.9960241317749 41 15 10 6 10 3.520550653824602 28.40464740689458 0.035701751708984375 3 0.959364584826299 6.101383088727762 20081.0 213.32594913050542 0.0 - - - - - - - 157.33333333333334 40 12 ACOX3 acyl-CoA oxidase 3, pristanoyl 75 10 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18212.[MT7]-TIFSALENDPLFAR.3b4_1.heavy 579.981 / 593.341 28466.0 49.9960241317749 41 15 10 6 10 3.520550653824602 28.40464740689458 0.035701751708984375 3 0.959364584826299 6.101383088727762 28466.0 408.3470531767084 0.0 - - - - - - - 158.78571428571428 56 14 ACOX3 acyl-CoA oxidase 3, pristanoyl 77 10 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18212.[MT7]-TIFSALENDPLFAR.3b5_1.heavy 579.981 / 664.379 52866.0 49.9960241317749 41 15 10 6 10 3.520550653824602 28.40464740689458 0.035701751708984375 3 0.959364584826299 6.101383088727762 52866.0 780.8631332622601 0.0 - - - - - - - 182.9090909090909 105 11 ACOX3 acyl-CoA oxidase 3, pristanoyl 79 10 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18212.[MT7]-TIFSALENDPLFAR.3y5_1.heavy 579.981 / 603.361 72905.0 49.9960241317749 41 15 10 6 10 3.520550653824602 28.40464740689458 0.035701751708984375 3 0.959364584826299 6.101383088727762 72905.0 481.8378025587828 0.0 - - - - - - - 150.33333333333334 145 12 ACOX3 acyl-CoA oxidase 3, pristanoyl 81 11 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18407.[MT7]-HLEGISDEDIINITLPTGVPILLELDENLR.4y4_1.heavy 872.227 / 531.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - BPGM 2,3-bisphosphoglycerate mutase 83 11 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18407.[MT7]-HLEGISDEDIINITLPTGVPILLELDENLR.4b5_1.heavy 872.227 / 694.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - BPGM 2,3-bisphosphoglycerate mutase 85 11 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18407.[MT7]-HLEGISDEDIINITLPTGVPILLELDENLR.4y6_1.heavy 872.227 / 759.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - BPGM 2,3-bisphosphoglycerate mutase 87 11 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18407.[MT7]-HLEGISDEDIINITLPTGVPILLELDENLR.4b9_1.heavy 872.227 / 1140.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - BPGM 2,3-bisphosphoglycerate mutase 89 12 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18211.[MT7]-TIFSALENDPLFAR.2y5_1.heavy 869.468 / 603.361 53764.0 49.9960241317749 46 20 10 6 10 8.262588135393466 12.102745333709892 0.035701751708984375 3 0.9907608039402036 12.829517772541053 53764.0 514.8936923076923 0.0 - - - - - - - 126.66666666666667 107 12 ACOX3 acyl-CoA oxidase 3, pristanoyl 91 12 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18211.[MT7]-TIFSALENDPLFAR.2b4_1.heavy 869.468 / 593.341 8235.0 49.9960241317749 46 20 10 6 10 8.262588135393466 12.102745333709892 0.035701751708984375 3 0.9907608039402036 12.829517772541053 8235.0 71.50725 0.0 - - - - - - - 142.22222222222223 16 18 ACOX3 acyl-CoA oxidase 3, pristanoyl 93 12 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18211.[MT7]-TIFSALENDPLFAR.2y10_1.heavy 869.468 / 1145.59 6995.0 49.9960241317749 46 20 10 6 10 8.262588135393466 12.102745333709892 0.035701751708984375 3 0.9907608039402036 12.829517772541053 6995.0 80.0053125 0.0 - - - - - - - 142.85714285714286 13 21 ACOX3 acyl-CoA oxidase 3, pristanoyl 95 12 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18211.[MT7]-TIFSALENDPLFAR.2b5_1.heavy 869.468 / 664.379 11033.0 49.9960241317749 46 20 10 6 10 8.262588135393466 12.102745333709892 0.035701751708984375 3 0.9907608039402036 12.829517772541053 11033.0 113.7778125 0.0 - - - - - - - 122.3529411764706 22 17 ACOX3 acyl-CoA oxidase 3, pristanoyl 97 13 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542187.[MT7]-NLWGAVLQESK[MT7].3y3_1.heavy 511.627 / 507.289 44950.0 40.63850021362305 33 9 6 10 8 0.5537283835123563 95.88141391400278 0.0 4 0.8103598453026419 2.7879308167241397 44950.0 129.9944784757995 0.0 - - - - - - - 734.0 89 7 ACOX3 acyl-CoA oxidase 3, pristanoyl 99 13 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542187.[MT7]-NLWGAVLQESK[MT7].3b6_1.heavy 511.627 / 785.443 21405.0 40.63850021362305 33 9 6 10 8 0.5537283835123563 95.88141391400278 0.0 4 0.8103598453026419 2.7879308167241397 21405.0 160.14906648918014 0.0 - - - - - - - 171.45454545454547 42 11 ACOX3 acyl-CoA oxidase 3, pristanoyl 101 13 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542187.[MT7]-NLWGAVLQESK[MT7].3b4_1.heavy 511.627 / 615.337 35104.0 40.63850021362305 33 9 6 10 8 0.5537283835123563 95.88141391400278 0.0 4 0.8103598453026419 2.7879308167241397 35104.0 183.7314619883041 1.0 - - - - - - - 325.4 148 5 ACOX3 acyl-CoA oxidase 3, pristanoyl 103 13 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542187.[MT7]-NLWGAVLQESK[MT7].3b5_1.heavy 511.627 / 686.374 22689.0 40.63850021362305 33 9 6 10 8 0.5537283835123563 95.88141391400278 0.0 4 0.8103598453026419 2.7879308167241397 22689.0 135.64250051198036 0.0 - - - - - - - 239.73333333333332 45 15 ACOX3 acyl-CoA oxidase 3, pristanoyl 105 14 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18401.[MT7]-REVAPPYQGADPILATALASDPIPNPLQK[MT7].4y4_1.heavy 833.463 / 629.41 18926.0 45.51350021362305 46 20 10 6 10 17.38730577524661 5.751322332086937 0.039398193359375 3 0.9989856946782718 38.74728721327154 18926.0 41.657347808584184 1.0 - - - - - - - 268.3333333333333 37 6 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 107 14 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18401.[MT7]-REVAPPYQGADPILATALASDPIPNPLQK[MT7].4b7_1.heavy 833.463 / 957.527 3669.0 45.51350021362305 46 20 10 6 10 17.38730577524661 5.751322332086937 0.039398193359375 3 0.9989856946782718 38.74728721327154 3669.0 12.259838271542833 0.0 - - - - - - - 193.30769230769232 7 13 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 109 14 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18401.[MT7]-REVAPPYQGADPILATALASDPIPNPLQK[MT7].4b11_2.heavy 833.463 / 664.839 10300.0 45.51350021362305 46 20 10 6 10 17.38730577524661 5.751322332086937 0.039398193359375 3 0.9989856946782718 38.74728721327154 10300.0 32.14786332702375 0.0 - - - - - - - 241.5 20 8 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 111 14 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18401.[MT7]-REVAPPYQGADPILATALASDPIPNPLQK[MT7].4b4_1.heavy 833.463 / 600.359 9463.0 45.51350021362305 46 20 10 6 10 17.38730577524661 5.751322332086937 0.039398193359375 3 0.9989856946782718 38.74728721327154 9463.0 24.86744449233985 0.0 - - - - - - - 249.625 18 8 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 113 15 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17972.[MT7]-EAQTLQQYR.2y8_1.heavy 640.839 / 1007.53 5072.0 24.868600845336914 46 20 10 6 10 7.5275667739092205 13.284505206463674 0.033599853515625 3 0.9957534895644123 18.931824322729977 5072.0 39.29104812834224 0.0 - - - - - - - 114.7 10 20 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 115 15 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17972.[MT7]-EAQTLQQYR.2y5_1.heavy 640.839 / 707.383 1335.0 24.868600845336914 46 20 10 6 10 7.5275667739092205 13.284505206463674 0.033599853515625 3 0.9957534895644123 18.931824322729977 1335.0 -1.1102230246251565E-16 1.0 - - - - - - - 167.26666666666668 2 15 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 117 15 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17972.[MT7]-EAQTLQQYR.2y6_1.heavy 640.839 / 808.431 1975.0 24.868600845336914 46 20 10 6 10 7.5275667739092205 13.284505206463674 0.033599853515625 3 0.9957534895644123 18.931824322729977 1975.0 18.161493445692884 0.0 - - - - - - - 160.23529411764707 3 17 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 119 15 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17972.[MT7]-EAQTLQQYR.2y7_1.heavy 640.839 / 936.49 2242.0 24.868600845336914 46 20 10 6 10 7.5275667739092205 13.284505206463674 0.033599853515625 3 0.9957534895644123 18.931824322729977 2242.0 27.25337813714166 0.0 - - - - - - - 143.21052631578948 4 19 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 121 16 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540818.[MT7]-FLSLEPVK[MT7].3y3_1.heavy 407.588 / 487.336 25087.0 38.185699462890625 39 9 10 10 10 1.2184769004699576 64.51163505862488 0.0 3 0.8199251332670578 2.8634670292688593 25087.0 227.64129629629628 0.0 - - - - - - - 216.0 50 5 CCND1 cyclin D1 123 16 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540818.[MT7]-FLSLEPVK[MT7].3b4_1.heavy 407.588 / 605.378 18923.0 38.185699462890625 39 9 10 10 10 1.2184769004699576 64.51163505862488 0.0 3 0.8199251332670578 2.8634670292688593 18923.0 259.3151851851852 0.0 - - - - - - - 216.0 37 10 CCND1 cyclin D1 125 16 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540818.[MT7]-FLSLEPVK[MT7].3b5_1.heavy 407.588 / 734.42 11030.0 38.185699462890625 39 9 10 10 10 1.2184769004699576 64.51163505862488 0.0 3 0.8199251332670578 2.8634670292688593 11030.0 142.47083333333333 0.0 - - - - - - - 144.0 22 6 CCND1 cyclin D1 127 16 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540818.[MT7]-FLSLEPVK[MT7].3b3_1.heavy 407.588 / 492.294 51579.0 38.185699462890625 39 9 10 10 10 1.2184769004699576 64.51163505862488 0.0 3 0.8199251332670578 2.8634670292688593 51579.0 160.74234212893623 0.0 - - - - - - - 256.75 103 8 CCND1 cyclin D1 129 17 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544189.[MT7]-RTEEEPLEEPLDEALVR.3y6_1.heavy 723.71 / 702.378 16039.0 37.0716495513916 45 20 10 5 10 4.33021540977465 17.963425225871127 0.04219818115234375 3 0.9934584226067666 15.250500462849194 16039.0 24.844964046185634 0.0 - - - - - - - 644.5714285714286 32 7 UBA7 ubiquitin-like modifier activating enzyme 7 131 17 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544189.[MT7]-RTEEEPLEEPLDEALVR.3b5_1.heavy 723.71 / 789.386 15412.0 37.0716495513916 45 20 10 5 10 4.33021540977465 17.963425225871127 0.04219818115234375 3 0.9934584226067666 15.250500462849194 15412.0 29.249168307044236 0.0 - - - - - - - 275.9 30 10 UBA7 ubiquitin-like modifier activating enzyme 7 133 17 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544189.[MT7]-RTEEEPLEEPLDEALVR.3y8_1.heavy 723.71 / 912.515 40598.0 37.0716495513916 45 20 10 5 10 4.33021540977465 17.963425225871127 0.04219818115234375 3 0.9934584226067666 15.250500462849194 40598.0 98.15699666719232 0.0 - - - - - - - 251.0 81 5 UBA7 ubiquitin-like modifier activating enzyme 7 135 17 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544189.[MT7]-RTEEEPLEEPLDEALVR.3y5_1.heavy 723.71 / 587.351 14034.0 37.0716495513916 45 20 10 5 10 4.33021540977465 17.963425225871127 0.04219818115234375 3 0.9934584226067666 15.250500462849194 14034.0 12.254935972115444 0.0 - - - - - - - 376.0 28 5 UBA7 ubiquitin-like modifier activating enzyme 7 137 18 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540953.[MT7]-VVLAYEPVWAIGTGK[MT7].3b6_1.heavy 631.036 / 819.473 13440.0 44.4547004699707 44 14 10 10 10 1.512673262818963 48.587202166267765 0.0 3 0.9363408830161128 4.865201075991841 13440.0 64.97391304347826 0.0 - - - - - - - 182.2 26 15 TPI1 triosephosphate isomerase 1 139 18 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540953.[MT7]-VVLAYEPVWAIGTGK[MT7].3b4_1.heavy 631.036 / 527.367 11830.0 44.4547004699707 44 14 10 10 10 1.512673262818963 48.587202166267765 0.0 3 0.9363408830161128 4.865201075991841 11830.0 49.60797501801585 0.0 - - - - - - - 221.125 23 16 TPI1 triosephosphate isomerase 1 141 18 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540953.[MT7]-VVLAYEPVWAIGTGK[MT7].3y4_1.heavy 631.036 / 506.306 23017.0 44.4547004699707 44 14 10 10 10 1.512673262818963 48.587202166267765 0.0 3 0.9363408830161128 4.865201075991841 23017.0 114.6084575569358 0.0 - - - - - - - 235.93333333333334 46 15 TPI1 triosephosphate isomerase 1 143 18 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540953.[MT7]-VVLAYEPVWAIGTGK[MT7].3y5_1.heavy 631.036 / 619.39 7726.0 44.4547004699707 44 14 10 10 10 1.512673262818963 48.587202166267765 0.0 3 0.9363408830161128 4.865201075991841 7726.0 46.6096770701786 0.0 - - - - - - - 254.72222222222223 15 18 TPI1 triosephosphate isomerase 1 145 19 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18203.[MT7]-VLVSGLQGLGAEVAK[MT7].2y8_1.heavy 865.027 / 888.527 5900.0 40.14699935913086 47 17 10 10 10 2.5141813064895113 32.882027992215825 0.0 3 0.9747663361187743 7.752731113337123 5900.0 38.24505928853755 0.0 - - - - - - - 168.625 11 16 UBA7 ubiquitin-like modifier activating enzyme 7 147 19 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18203.[MT7]-VLVSGLQGLGAEVAK[MT7].2y6_1.heavy 865.027 / 718.422 4804.0 40.14699935913086 47 17 10 10 10 2.5141813064895113 32.882027992215825 0.0 3 0.9747663361187743 7.752731113337123 4804.0 40.68803188594104 0.0 - - - - - - - 222.94117647058823 9 17 UBA7 ubiquitin-like modifier activating enzyme 7 149 19 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18203.[MT7]-VLVSGLQGLGAEVAK[MT7].2b5_1.heavy 865.027 / 600.384 3203.0 40.14699935913086 47 17 10 10 10 2.5141813064895113 32.882027992215825 0.0 3 0.9747663361187743 7.752731113337123 3203.0 20.391367682762343 0.0 - - - - - - - 168.55 6 20 UBA7 ubiquitin-like modifier activating enzyme 7 151 19 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18203.[MT7]-VLVSGLQGLGAEVAK[MT7].2y11_1.heavy 865.027 / 1186.69 2866.0 40.14699935913086 47 17 10 10 10 2.5141813064895113 32.882027992215825 0.0 3 0.9747663361187743 7.752731113337123 2866.0 9.52660121090804 0.0 - - - - - - - 226.21052631578948 5 19 UBA7 ubiquitin-like modifier activating enzyme 7 153 20 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587456.[MT7]-TLQLLR.2y4_1.heavy 444.293 / 529.346 N/A 33.921399434407554 42 16 10 6 10 1.8705376871372268 36.74485107250737 0.037200927734375 3 0.9604837121260672 6.187763154703221 3673.0 0.42709302325581394 2.0 - - - - - - - 612.0 12 8 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 155 20 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587456.[MT7]-TLQLLR.2b3_1.heavy 444.293 / 487.3 6020.0 33.921399434407554 42 16 10 6 10 1.8705376871372268 36.74485107250737 0.037200927734375 3 0.9604837121260672 6.187763154703221 6020.0 5.894248503274837 1.0 - - - - - - - 1235.3333333333333 12 9 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 157 20 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587456.[MT7]-TLQLLR.2y5_1.heavy 444.293 / 642.43 7652.0 33.921399434407554 42 16 10 6 10 1.8705376871372268 36.74485107250737 0.037200927734375 3 0.9604837121260672 6.187763154703221 7652.0 9.30323096266184 0.0 - - - - - - - 624.75 15 8 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 159 20 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587456.[MT7]-TLQLLR.2b4_1.heavy 444.293 / 600.384 8163.0 33.921399434407554 42 16 10 6 10 1.8705376871372268 36.74485107250737 0.037200927734375 3 0.9604837121260672 6.187763154703221 8163.0 14.088987394957984 0.0 - - - - - - - 626.5714285714286 16 7 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 161 21 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17979.[MT7]-ETIPLTAEK[MT7].2y4_1.heavy 645.381 / 592.342 4229.0 29.279600143432617 48 18 10 10 10 2.3091675346394798 43.30564954682362 0.0 3 0.9893956190000255 11.973887533069558 4229.0 15.108927304964539 0.0 - - - - - - - 283.6666666666667 8 18 CCND1 cyclin D1 163 21 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17979.[MT7]-ETIPLTAEK[MT7].2y8_1.heavy 645.381 / 1016.61 3759.0 29.279600143432617 48 18 10 10 10 2.3091675346394798 43.30564954682362 0.0 3 0.9893956190000255 11.973887533069558 3759.0 30.106622093991014 0.0 - - - - - - - 186.27777777777777 7 18 CCND1 cyclin D1 165 21 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17979.[MT7]-ETIPLTAEK[MT7].2y5_1.heavy 645.381 / 705.426 1477.0 29.279600143432617 48 18 10 10 10 2.3091675346394798 43.30564954682362 0.0 3 0.9893956190000255 11.973887533069558 1477.0 7.7192991492042395 0.0 - - - - - - - 205.86666666666667 2 15 CCND1 cyclin D1 167 21 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17979.[MT7]-ETIPLTAEK[MT7].2y6_1.heavy 645.381 / 802.479 30544.0 29.279600143432617 48 18 10 10 10 2.3091675346394798 43.30564954682362 0.0 3 0.9893956190000255 11.973887533069558 30544.0 129.6036370733092 0.0 - - - - - - - 197.73684210526315 61 19 CCND1 cyclin D1 169 22 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB538407.[MT7]-GLASGDR.2b3_1.heavy 410.226 / 386.252 4773.0 17.621349334716797 42 16 10 6 10 2.552477873966541 31.464998646288787 0.0326995849609375 3 0.9604268814611343 6.1832887426639545 4773.0 3.537131614816847 0.0 - - - - - - - 1260.642857142857 9 14 ACOX3 acyl-CoA oxidase 3, pristanoyl 171 22 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB538407.[MT7]-GLASGDR.2y5_1.heavy 410.226 / 505.237 7316.0 17.621349334716797 42 16 10 6 10 2.552477873966541 31.464998646288787 0.0326995849609375 3 0.9604268814611343 6.1832887426639545 7316.0 13.387032030902812 1.0 - - - - - - - 711.7777777777778 14 9 ACOX3 acyl-CoA oxidase 3, pristanoyl 173 22 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB538407.[MT7]-GLASGDR.2b6_1.heavy 410.226 / 645.332 10142.0 17.621349334716797 42 16 10 6 10 2.552477873966541 31.464998646288787 0.0326995849609375 3 0.9604268814611343 6.1832887426639545 10142.0 17.894496138588295 1.0 - - - - - - - 737.9 20 10 ACOX3 acyl-CoA oxidase 3, pristanoyl 175 22 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB538407.[MT7]-GLASGDR.2y6_1.heavy 410.226 / 618.321 5526.0 17.621349334716797 42 16 10 6 10 2.552477873966541 31.464998646288787 0.0326995849609375 3 0.9604268814611343 6.1832887426639545 5526.0 19.853403489338135 0.0 - - - - - - - 267.60869565217394 11 23 ACOX3 acyl-CoA oxidase 3, pristanoyl 177 23 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17833.[MT7]-TLGMGSFGR.2y8_1.heavy 535.283 / 824.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKACG protein kinase, cAMP-dependent, catalytic, gamma 179 23 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17833.[MT7]-TLGMGSFGR.2y5_1.heavy 535.283 / 523.262 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKACG protein kinase, cAMP-dependent, catalytic, gamma 181 23 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17833.[MT7]-TLGMGSFGR.2y6_1.heavy 535.283 / 654.303 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKACG protein kinase, cAMP-dependent, catalytic, gamma 183 23 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17833.[MT7]-TLGMGSFGR.2y7_1.heavy 535.283 / 711.324 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKACG protein kinase, cAMP-dependent, catalytic, gamma 185 24 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18347.[MT7]-K[MT7]WENPTQNNAGLEDFER.3y7_1.heavy 779.388 / 865.405 4285.0 32.56100082397461 44 14 10 10 10 2.0096357790536596 40.97076699347362 0.0 3 0.9493938954076744 5.462760823257316 4285.0 23.091388888888886 0.0 - - - - - - - 228.66666666666666 8 18 PRKACB protein kinase, cAMP-dependent, catalytic, beta 187 24 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18347.[MT7]-K[MT7]WENPTQNNAGLEDFER.3b4_1.heavy 779.388 / 846.471 4706.0 32.56100082397461 44 14 10 10 10 2.0096357790536596 40.97076699347362 0.0 3 0.9493938954076744 5.462760823257316 4706.0 24.890578231292515 0.0 - - - - - - - 168.0 9 16 PRKACB protein kinase, cAMP-dependent, catalytic, beta 189 24 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18347.[MT7]-K[MT7]WENPTQNNAGLEDFER.3b3_1.heavy 779.388 / 732.428 1260.0 32.56100082397461 44 14 10 10 10 2.0096357790536596 40.97076699347362 0.0 3 0.9493938954076744 5.462760823257316 1260.0 7.0 0.0 - - - - - - - 238.0 2 18 PRKACB protein kinase, cAMP-dependent, catalytic, beta 191 24 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18347.[MT7]-K[MT7]WENPTQNNAGLEDFER.3y8_1.heavy 779.388 / 936.442 2773.0 32.56100082397461 44 14 10 10 10 2.0096357790536596 40.97076699347362 0.0 3 0.9493938954076744 5.462760823257316 2773.0 13.864999999999998 0.0 - - - - - - - 179.2 5 15 PRKACB protein kinase, cAMP-dependent, catalytic, beta 193 25 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17835.[MT7]-EVPAQDLR.2y5_1.heavy 536.299 / 602.326 660.0 24.304675579071045 40 14 10 6 10 1.312389171215564 51.3572394754194 0.03930091857910156 3 0.9465532449061429 5.314325583872134 660.0 4.858371322005802 5.0 - - - - - - - 0.0 1 0 CDC7 cell division cycle 7 homolog (S. cerevisiae) 195 25 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17835.[MT7]-EVPAQDLR.2b6_1.heavy 536.299 / 784.396 2845.0 24.304675579071045 40 14 10 6 10 1.312389171215564 51.3572394754194 0.03930091857910156 3 0.9465532449061429 5.314325583872134 2845.0 20.294389414547602 0.0 - - - - - - - 165.25 5 20 CDC7 cell division cycle 7 homolog (S. cerevisiae) 197 25 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17835.[MT7]-EVPAQDLR.2y6_1.heavy 536.299 / 699.378 5994.0 24.304675579071045 40 14 10 6 10 1.312389171215564 51.3572394754194 0.03930091857910156 3 0.9465532449061429 5.314325583872134 5994.0 26.536235704143536 0.0 - - - - - - - 156.0 11 14 CDC7 cell division cycle 7 homolog (S. cerevisiae) 199 25 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17835.[MT7]-EVPAQDLR.2y7_1.heavy 536.299 / 798.447 2387.0 24.304675579071045 40 14 10 6 10 1.312389171215564 51.3572394754194 0.03930091857910156 3 0.9465532449061429 5.314325583872134 2387.0 13.992758620689655 0.0 - - - - - - - 172.7 4 20 CDC7 cell division cycle 7 homolog (S. cerevisiae) 201 26 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541817.[MT7]-TILISAHGNSSR.3y6_1.heavy 467.264 / 657.306 11938.0 25.190000534057617 47 17 10 10 10 4.544114557072648 22.006487456253907 0.0 3 0.9784076053805362 8.38353918459546 11938.0 22.005529953917048 0.0 - - - - - - - 694.6 23 10 BPGM 2,3-bisphosphoglycerate mutase 203 26 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541817.[MT7]-TILISAHGNSSR.3b3_1.heavy 467.264 / 472.325 35217.0 25.190000534057617 47 17 10 10 10 4.544114557072648 22.006487456253907 0.0 3 0.9784076053805362 8.38353918459546 35217.0 19.127556259636762 0.0 - - - - - - - 380.0 70 2 BPGM 2,3-bisphosphoglycerate mutase 205 26 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541817.[MT7]-TILISAHGNSSR.3y8_1.heavy 467.264 / 815.375 8519.0 25.190000534057617 47 17 10 10 10 4.544114557072648 22.006487456253907 0.0 3 0.9784076053805362 8.38353918459546 8519.0 78.57120390283657 0.0 - - - - - - - 678.25 17 8 BPGM 2,3-bisphosphoglycerate mutase 207 26 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541817.[MT7]-TILISAHGNSSR.3y5_1.heavy 467.264 / 520.247 61534.0 25.190000534057617 47 17 10 10 10 4.544114557072648 22.006487456253907 0.0 3 0.9784076053805362 8.38353918459546 61534.0 39.58117693618109 0.0 - - - - - - - 819.3 123 10 BPGM 2,3-bisphosphoglycerate mutase 209 27 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587868.[MT7]-SLDIAPQK[MT7].2y4_1.heavy 580.35 / 587.363 6612.0 27.72624969482422 41 15 10 6 10 3.473970631066638 28.785505296369266 0.034099578857421875 3 0.9585266802452425 6.039005921268684 6612.0 20.74053603732267 0.0 - - - - - - - 212.92857142857142 13 14 PTPRR protein tyrosine phosphatase, receptor type, R 211 27 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587868.[MT7]-SLDIAPQK[MT7].2y5_1.heavy 580.35 / 700.447 3500.0 27.72624969482422 41 15 10 6 10 3.473970631066638 28.785505296369266 0.034099578857421875 3 0.9585266802452425 6.039005921268684 3500.0 14.804933014733361 0.0 - - - - - - - 210.8125 7 16 PTPRR protein tyrosine phosphatase, receptor type, R 213 27 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587868.[MT7]-SLDIAPQK[MT7].2b4_1.heavy 580.35 / 573.336 4473.0 27.72624969482422 41 15 10 6 10 3.473970631066638 28.785505296369266 0.034099578857421875 3 0.9585266802452425 6.039005921268684 4473.0 9.19897172236504 1.0 - - - - - - - 255.0625 8 16 PTPRR protein tyrosine phosphatase, receptor type, R 215 27 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587868.[MT7]-SLDIAPQK[MT7].2y3_1.heavy 580.35 / 516.326 11992.0 27.72624969482422 41 15 10 6 10 3.473970631066638 28.785505296369266 0.034099578857421875 3 0.9585266802452425 6.039005921268684 11992.0 32.28353131982837 0.0 - - - - - - - 680.75 23 8 PTPRR protein tyrosine phosphatase, receptor type, R 217 28 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17831.[MT7]-K[MT7]ASTSAGR.2y5_1.heavy 533.316 / 491.257 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 219 28 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17831.[MT7]-K[MT7]ASTSAGR.2y6_1.heavy 533.316 / 578.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 221 28 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17831.[MT7]-K[MT7]ASTSAGR.2b7_1.heavy 533.316 / 891.514 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 223 28 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17831.[MT7]-K[MT7]ASTSAGR.2y7_1.heavy 533.316 / 649.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 225 29 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543031.[MT7]-LAPITYPQGLALAK[MT7].3y6_1.heavy 582.025 / 716.479 16835.0 39.7671012878418 50 20 10 10 10 13.113348779664419 7.625817148635246 0.0 3 0.9973808617014419 24.109506390490356 16835.0 99.6583064516129 0.0 - - - - - - - 231.46666666666667 33 15 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 227 29 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543031.[MT7]-LAPITYPQGLALAK[MT7].3b4_1.heavy 582.025 / 539.367 11455.0 39.7671012878418 50 20 10 10 10 13.113348779664419 7.625817148635246 0.0 3 0.9973808617014419 24.109506390490356 11455.0 36.966825588653236 0.0 - - - - - - - 235.57142857142858 22 14 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 229 29 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543031.[MT7]-LAPITYPQGLALAK[MT7].3b5_1.heavy 582.025 / 640.415 9806.0 39.7671012878418 50 20 10 10 10 13.113348779664419 7.625817148635246 0.0 3 0.9973808617014419 24.109506390490356 9806.0 23.528676741252788 0.0 - - - - - - - 222.5 19 16 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 231 29 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543031.[MT7]-LAPITYPQGLALAK[MT7].3y4_1.heavy 582.025 / 546.373 25514.0 39.7671012878418 50 20 10 10 10 13.113348779664419 7.625817148635246 0.0 3 0.9973808617014419 24.109506390490356 25514.0 97.79633834146934 0.0 - - - - - - - 283.6 51 15 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 233 30 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540173.[MT7]-TVFDEAIR.2b6_1.heavy 547.802 / 807.401 12322.0 33.76145076751709 42 20 8 6 8 7.896065370443627 12.664535475392306 0.034999847412109375 4 0.9928218077527414 14.55776475042524 12322.0 80.63661764705883 0.0 - - - - - - - 169.33333333333334 24 15 RAC1;RAC2;RAC3 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) 235 30 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540173.[MT7]-TVFDEAIR.2y6_1.heavy 547.802 / 750.378 23104.0 33.76145076751709 42 20 8 6 8 7.896065370443627 12.664535475392306 0.034999847412109375 4 0.9928218077527414 14.55776475042524 23104.0 69.60080391121224 1.0 - - - - - - - 281.8888888888889 82 18 RAC1;RAC2;RAC3 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) 237 30 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540173.[MT7]-TVFDEAIR.2b5_1.heavy 547.802 / 736.363 11054.0 33.76145076751709 42 20 8 6 8 7.896065370443627 12.664535475392306 0.034999847412109375 4 0.9928218077527414 14.55776475042524 11054.0 27.140530035973494 0.0 - - - - - - - 258.92857142857144 22 14 RAC1;RAC2;RAC3 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) 239 30 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540173.[MT7]-TVFDEAIR.2y7_1.heavy 547.802 / 849.446 30805.0 33.76145076751709 42 20 8 6 8 7.896065370443627 12.664535475392306 0.034999847412109375 4 0.9928218077527414 14.55776475042524 30805.0 106.5834599402675 0.0 - - - - - - - 231.55555555555554 61 9 RAC1;RAC2;RAC3 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) 241 31 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543038.[MT7]-VQVEDIVFLIRK[MT7].3y6_1.heavy 583.029 / 919.621 13225.0 44.13229942321777 44 18 10 6 10 16.582010749696693 6.030631719487284 0.03800201416015625 3 0.9814191944370626 9.039727439669695 13225.0 198.2619658119658 0.0 - - - - - - - 162.16666666666666 26 12 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 243 31 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543038.[MT7]-VQVEDIVFLIRK[MT7].3b5_1.heavy 583.029 / 715.374 24827.0 44.13229942321777 44 18 10 6 10 16.582010749696693 6.030631719487284 0.03800201416015625 3 0.9814191944370626 9.039727439669695 24827.0 389.26283950617284 0.0 - - - - - - - 206.36363636363637 49 11 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 245 31 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543038.[MT7]-VQVEDIVFLIRK[MT7].3y8_1.heavy 583.029 / 1147.73 2191.0 44.13229942321777 44 18 10 6 10 16.582010749696693 6.030631719487284 0.03800201416015625 3 0.9814191944370626 9.039727439669695 2191.0 52.71924691358025 0.0 - - - - - - - 162.33333333333334 4 6 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 247 31 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543038.[MT7]-VQVEDIVFLIRK[MT7].3y5_1.heavy 583.029 / 820.552 18417.0 44.13229942321777 44 18 10 6 10 16.582010749696693 6.030631719487284 0.03800201416015625 3 0.9814191944370626 9.039727439669695 18417.0 422.9088888888889 0.0 - - - - - - - 171.22222222222223 36 9 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 249 32 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18221.[MT7]-ASDDLTALAQIMTIR.3y7_1.heavy 588.321 / 832.471 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC7 cell division cycle 7 homolog (S. cerevisiae) 251 32 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18221.[MT7]-ASDDLTALAQIMTIR.3b4_1.heavy 588.321 / 533.232 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC7 cell division cycle 7 homolog (S. cerevisiae) 253 32 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18221.[MT7]-ASDDLTALAQIMTIR.3b5_1.heavy 588.321 / 646.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC7 cell division cycle 7 homolog (S. cerevisiae) 255 32 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18221.[MT7]-ASDDLTALAQIMTIR.3y5_1.heavy 588.321 / 633.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC7 cell division cycle 7 homolog (S. cerevisiae) 257 33 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18223.[MT7]-AEETC[CAM]APSVSYFK[MT7].3y3_1.heavy 592.962 / 601.347 14591.0 32.304348945617676 44 18 10 6 10 4.354195101385489 22.966357196116537 0.032199859619140625 3 0.9871755442806621 10.886234142308142 14591.0 31.106257854493148 0.0 - - - - - - - 735.3636363636364 29 11 CCND1 cyclin D1 259 33 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18223.[MT7]-AEETC[CAM]APSVSYFK[MT7].3b6_1.heavy 592.962 / 806.347 14828.0 32.304348945617676 44 18 10 6 10 4.354195101385489 22.966357196116537 0.032199859619140625 3 0.9871755442806621 10.886234142308142 14828.0 92.89054154995331 0.0 - - - - - - - 223.0 29 16 CCND1 cyclin D1 261 33 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18223.[MT7]-AEETC[CAM]APSVSYFK[MT7].3b5_1.heavy 592.962 / 735.31 12212.0 32.304348945617676 44 18 10 6 10 4.354195101385489 22.966357196116537 0.032199859619140625 3 0.9871755442806621 10.886234142308142 12212.0 61.582354455295636 1.0 - - - - - - - 229.47368421052633 31 19 CCND1 cyclin D1 263 33 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18223.[MT7]-AEETC[CAM]APSVSYFK[MT7].3y4_1.heavy 592.962 / 688.379 22837.0 32.304348945617676 44 18 10 6 10 4.354195101385489 22.966357196116537 0.032199859619140625 3 0.9871755442806621 10.886234142308142 22837.0 49.171573819944115 0.0 - - - - - - - 237.86666666666667 45 15 CCND1 cyclin D1 265 34 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18094.[MT7]-SLFLDLVELQR.2y9_1.heavy 738.931 / 1132.64 12977.0 50.09410095214844 48 18 10 10 10 4.480416211140414 22.319355007990808 0.0 3 0.9851704240628092 10.12184863000374 12977.0 169.6904486803519 0.0 - - - - - - - 162.8095238095238 25 21 ACOX3 acyl-CoA oxidase 3, pristanoyl 267 34 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18094.[MT7]-SLFLDLVELQR.2y6_1.heavy 738.931 / 757.457 15490.0 50.09410095214844 48 18 10 10 10 4.480416211140414 22.319355007990808 0.0 3 0.9851704240628092 10.12184863000374 15490.0 96.80969424721056 0.0 - - - - - - - 158.26315789473685 30 19 ACOX3 acyl-CoA oxidase 3, pristanoyl 269 34 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18094.[MT7]-SLFLDLVELQR.2b5_1.heavy 738.931 / 720.405 15490.0 50.09410095214844 48 18 10 10 10 4.480416211140414 22.319355007990808 0.0 3 0.9851704240628092 10.12184863000374 15490.0 93.78875044219961 0.0 - - - - - - - 206.1 30 20 ACOX3 acyl-CoA oxidase 3, pristanoyl 271 34 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18094.[MT7]-SLFLDLVELQR.2y7_1.heavy 738.931 / 872.484 14501.0 50.09410095214844 48 18 10 10 10 4.480416211140414 22.319355007990808 0.0 3 0.9851704240628092 10.12184863000374 14501.0 228.1598259531139 0.0 - - - - - - - 102.875 29 16 ACOX3 acyl-CoA oxidase 3, pristanoyl 273 35 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17993.[MT7]-SPGADLSLEK[MT7].3b6_1.heavy 435.582 / 685.364 25939.0 29.18429946899414 46 20 10 6 10 14.894928643006095 6.713694465864725 0.037799835205078125 3 0.996701213015473 21.481557892899453 25939.0 54.78269979812374 0.0 - - - - - - - 792.7142857142857 51 7 ACOX3 acyl-CoA oxidase 3, pristanoyl 275 35 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17993.[MT7]-SPGADLSLEK[MT7].3y3_1.heavy 435.582 / 533.341 73069.0 29.18429946899414 46 20 10 6 10 14.894928643006095 6.713694465864725 0.037799835205078125 3 0.996701213015473 21.481557892899453 73069.0 42.2186485391908 0.0 - - - - - - - 869.0 146 5 ACOX3 acyl-CoA oxidase 3, pristanoyl 277 35 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17993.[MT7]-SPGADLSLEK[MT7].3b5_1.heavy 435.582 / 572.28 164055.0 29.18429946899414 46 20 10 6 10 14.894928643006095 6.713694465864725 0.037799835205078125 3 0.996701213015473 21.481557892899453 164055.0 296.99115188187494 0.0 - - - - - - - 1298.7142857142858 328 7 ACOX3 acyl-CoA oxidase 3, pristanoyl 279 35 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17993.[MT7]-SPGADLSLEK[MT7].3y4_1.heavy 435.582 / 620.374 56624.0 29.18429946899414 46 20 10 6 10 14.894928643006095 6.713694465864725 0.037799835205078125 3 0.996701213015473 21.481557892899453 56624.0 160.0876543884366 0.0 - - - - - - - 713.1111111111111 113 9 ACOX3 acyl-CoA oxidase 3, pristanoyl 281 36 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541329.[MT7]-SPGADLSLEK[MT7].2y4_1.heavy 652.869 / 620.374 3704.0 29.19374942779541 40 14 10 6 10 3.1273668313032523 31.975781989836953 0.037799835205078125 3 0.9495323917838662 5.470315642693509 3704.0 10.111758034026465 0.0 - - - - - - - 719.25 7 8 ACOX3 acyl-CoA oxidase 3, pristanoyl 283 36 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541329.[MT7]-SPGADLSLEK[MT7].2y5_1.heavy 652.869 / 733.458 4498.0 29.19374942779541 40 14 10 6 10 3.1273668313032523 31.975781989836953 0.037799835205078125 3 0.9495323917838662 5.470315642693509 4498.0 73.97424883273827 0.0 - - - - - - - 141.0 8 15 ACOX3 acyl-CoA oxidase 3, pristanoyl 285 36 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541329.[MT7]-SPGADLSLEK[MT7].2y9_1.heavy 652.869 / 1073.6 17529.0 29.19374942779541 40 14 10 6 10 3.1273668313032523 31.975781989836953 0.037799835205078125 3 0.9495323917838662 5.470315642693509 17529.0 167.65677009388594 0.0 - - - - - - - 206.1764705882353 35 17 ACOX3 acyl-CoA oxidase 3, pristanoyl 287 36 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541329.[MT7]-SPGADLSLEK[MT7].2y3_1.heavy 652.869 / 533.341 1588.0 29.19374942779541 40 14 10 6 10 3.1273668313032523 31.975781989836953 0.037799835205078125 3 0.9495323917838662 5.470315642693509 1588.0 4.867563025210083 1.0 - - - - - - - 254.55 3 20 ACOX3 acyl-CoA oxidase 3, pristanoyl 289 37 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18093.[MT7]-IRPEC[CAM]FELLR.3y4_1.heavy 492.942 / 530.33 26767.0 36.8921012878418 43 13 10 10 10 1.7792808511510558 44.71437777970934 0.0 3 0.9053563014132797 3.9795156338939917 26767.0 108.0839331210191 0.0 - - - - - - - 307.22222222222223 53 9 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 291 37 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18093.[MT7]-IRPEC[CAM]FELLR.3y5_1.heavy 492.942 / 677.398 17217.0 36.8921012878418 43 13 10 10 10 1.7792808511510558 44.71437777970934 0.0 3 0.9053563014132797 3.9795156338939917 17217.0 8.253727938019793 1.0 - - - - - - - 628.4285714285714 39 7 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 293 37 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18093.[MT7]-IRPEC[CAM]FELLR.3b8_2.heavy 492.942 / 595.311 18725.0 36.8921012878418 43 13 10 10 10 1.7792808511510558 44.71437777970934 0.0 3 0.9053563014132797 3.9795156338939917 18725.0 28.02804403208615 0.0 - - - - - - - 237.44444444444446 37 9 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 295 37 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18093.[MT7]-IRPEC[CAM]FELLR.3b7_2.heavy 492.942 / 538.769 51901.0 36.8921012878418 43 13 10 10 10 1.7792808511510558 44.71437777970934 0.0 3 0.9053563014132797 3.9795156338939917 51901.0 183.1154565897304 0.0 - - - - - - - 272.3333333333333 103 6 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 297 38 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587997.[MT7]-ETIPLTAEK[MT7].3y3_1.heavy 430.59 / 491.295 134543.0 29.279600143432617 50 20 10 10 10 8.359410469863999 11.962566063779724 0.0 3 0.9940299798013869 15.964604735723693 134543.0 110.46616366342793 0.0 - - - - - - - 1227.6666666666667 269 9 CCND1 cyclin D1 299 38 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587997.[MT7]-ETIPLTAEK[MT7].3b5_1.heavy 430.59 / 698.42 27151.0 29.279600143432617 50 20 10 10 10 8.359410469863999 11.962566063779724 0.0 3 0.9940299798013869 15.964604735723693 27151.0 43.0310607606679 1.0 - - - - - - - 665.25 176 8 CCND1 cyclin D1 301 38 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587997.[MT7]-ETIPLTAEK[MT7].3y4_1.heavy 430.59 / 592.342 106314.0 29.279600143432617 50 20 10 10 10 8.359410469863999 11.962566063779724 0.0 3 0.9940299798013869 15.964604735723693 106314.0 290.5392110207623 0.0 - - - - - - - 361.3636363636364 212 11 CCND1 cyclin D1 303 38 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587997.[MT7]-ETIPLTAEK[MT7].3b3_1.heavy 430.59 / 488.284 205689.0 29.279600143432617 50 20 10 10 10 8.359410469863999 11.962566063779724 0.0 3 0.9940299798013869 15.964604735723693 205689.0 167.6076386913528 0.0 - - - - - - - 309.6 411 5 CCND1 cyclin D1 305 39 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17989.[MT7]-REATLELLGR.3b6_1.heavy 434.593 / 844.464 22785.0 32.27282428741455 42 16 10 6 10 5.729347196383957 17.453995467950413 0.031299591064453125 3 0.9645967843412872 6.539602195578948 22785.0 422.3823113207547 0.0 - - - - - - - 135.6 45 10 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 307 39 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17989.[MT7]-REATLELLGR.3b4_1.heavy 434.593 / 602.338 48996.0 32.27282428741455 42 16 10 6 10 5.729347196383957 17.453995467950413 0.031299591064453125 3 0.9645967843412872 6.539602195578948 48996.0 130.5670913753543 0.0 - - - - - - - 265.6666666666667 97 15 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 309 39 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17989.[MT7]-REATLELLGR.3y4_1.heavy 434.593 / 458.309 139180.0 32.27282428741455 42 16 10 6 10 5.729347196383957 17.453995467950413 0.031299591064453125 3 0.9645967843412872 6.539602195578948 139180.0 80.92300168450797 0.0 - - - - - - - 2162.1428571428573 278 7 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 311 39 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17989.[MT7]-REATLELLGR.3y5_1.heavy 434.593 / 587.351 131532.0 32.27282428741455 42 16 10 6 10 5.729347196383957 17.453995467950413 0.031299591064453125 3 0.9645967843412872 6.539602195578948 131532.0 150.79940600547266 0.0 - - - - - - - 773.8571428571429 263 7 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 313 40 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541822.[MT7]-SPNNFLSYYR.2y4_1.heavy 702.855 / 588.278 2896.0 36.63209915161133 48 18 10 10 10 11.35635034971983 8.805645909160162 0.0 3 0.989784672421475 12.200168291226955 2896.0 3.9937617328519854 0.0 - - - - - - - 780.4 5 10 CCND1 cyclin D1 315 40 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541822.[MT7]-SPNNFLSYYR.2y8_1.heavy 702.855 / 1076.52 2770.0 36.63209915161133 48 18 10 10 10 11.35635034971983 8.805645909160162 0.0 3 0.989784672421475 12.200168291226955 2770.0 6.0430793650793655 0.0 - - - - - - - 252.0 5 8 CCND1 cyclin D1 317 40 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541822.[MT7]-SPNNFLSYYR.2y5_1.heavy 702.855 / 701.362 1511.0 36.63209915161133 48 18 10 10 10 11.35635034971983 8.805645909160162 0.0 3 0.989784672421475 12.200168291226955 1511.0 0.6801606368831089 4.0 - - - - - - - 234.0 5 14 CCND1 cyclin D1 319 40 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541822.[MT7]-SPNNFLSYYR.2y9_1.heavy 702.855 / 1173.57 20901.0 36.63209915161133 48 18 10 10 10 11.35635034971983 8.805645909160162 0.0 3 0.989784672421475 12.200168291226955 20901.0 48.102050531411926 0.0 - - - - - - - 226.8 41 10 CCND1 cyclin D1 321 41 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17846.[MT7]-NNFAVGYR.2b3_1.heavy 542.786 / 520.264 32379.0 28.26324987411499 22 5 10 6 1 1.3286700939316831 75.2632278371592 0.03859901428222656 16 0.6119105913560958 1.913062033692216 32379.0 30.748067760264924 0.0 - - - - - - - 811.2 64 10 VDAC2 voltage-dependent anion channel 2 323 41 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17846.[MT7]-NNFAVGYR.2y5_1.heavy 542.786 / 565.309 973.0 28.26324987411499 22 5 10 6 1 1.3286700939316831 75.2632278371592 0.03859901428222656 16 0.6119105913560958 1.913062033692216 973.0 4.493334651637993 7.0 - - - - - - - 266.6111111111111 14 18 VDAC2 voltage-dependent anion channel 2 325 41 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17846.[MT7]-NNFAVGYR.2y6_1.heavy 542.786 / 712.378 649.0 28.26324987411499 22 5 10 6 1 1.3286700939316831 75.2632278371592 0.03859901428222656 16 0.6119105913560958 1.913062033692216 649.0 2.246538461538462 17.0 - - - - - - - 231.3125 7 16 VDAC2 voltage-dependent anion channel 2 327 41 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17846.[MT7]-NNFAVGYR.2y7_1.heavy 542.786 / 826.421 584.0 28.26324987411499 22 5 10 6 1 1.3286700939316831 75.2632278371592 0.03859901428222656 16 0.6119105913560958 1.913062033692216 584.0 4.046541427723947 8.0 - - - - - - - 222.0 13 19 VDAC2 voltage-dependent anion channel 2 329 42 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541590.[MT7]-SNVSDAVAQSTR.3y6_1.heavy 460.24 / 661.363 5182.0 22.631200790405273 42 16 10 6 10 2.444813772627145 32.362275275648656 0.03079986572265625 3 0.9618194009978858 6.2957782606155686 5182.0 5.797656801139946 2.0 - - - - - - - 672.3333333333334 11 15 TPI1 triosephosphate isomerase 1 331 42 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541590.[MT7]-SNVSDAVAQSTR.3b6_1.heavy 460.24 / 718.349 14481.0 22.631200790405273 42 16 10 6 10 2.444813772627145 32.362275275648656 0.03079986572265625 3 0.9618194009978858 6.2957782606155686 14481.0 47.4963494436236 0.0 - - - - - - - 210.5 28 20 TPI1 triosephosphate isomerase 1 333 42 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541590.[MT7]-SNVSDAVAQSTR.3b5_1.heavy 460.24 / 647.312 19847.0 22.631200790405273 42 16 10 6 10 2.444813772627145 32.362275275648656 0.03079986572265625 3 0.9618194009978858 6.2957782606155686 19847.0 46.30918528220427 0.0 - - - - - - - 740.1818181818181 39 11 TPI1 triosephosphate isomerase 1 335 42 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541590.[MT7]-SNVSDAVAQSTR.3y5_1.heavy 460.24 / 562.294 31783.0 22.631200790405273 42 16 10 6 10 2.444813772627145 32.362275275648656 0.03079986572265625 3 0.9618194009978858 6.2957782606155686 31783.0 47.916646090534975 0.0 - - - - - - - 774.9166666666666 63 12 TPI1 triosephosphate isomerase 1 337 43 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 915593.0 31.049700419108074 23 -3 10 6 10 null 0.0 0.0326995849609375 3 0.0 0.0 915593.0 4103.049684885991 0.0 - - - - - - - 835.0 1831 3 339 43 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 294678.0 31.049700419108074 23 -3 10 6 10 null 0.0 0.0326995849609375 3 0.0 0.0 294678.0 170.1876454876895 0.0 - - - - - - - 417.5 589 2 341 43 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 306087.0 31.049700419108074 23 -3 10 6 10 null 0.0 0.0326995849609375 3 0.0 0.0 306087.0 352.49235974161775 0.0 - - - - - - - 417.0 612 1 343 44 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18359.[MT7]-FEVSSVADC[CAM]LDSAVALAAYK[MT7].3y3_1.heavy 802.082 / 525.315 6195.0 47.442599296569824 41 14 10 7 10 3.3182184467959153 24.600840607152556 0.027599334716796875 3 0.9365678160204431 4.873990479217332 6195.0 43.00079063005374 0.0 - - - - - - - 208.04 12 25 ACOX3 acyl-CoA oxidase 3, pristanoyl 345 44 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18359.[MT7]-FEVSSVADC[CAM]LDSAVALAAYK[MT7].3b3_1.heavy 802.082 / 520.289 2544.0 47.442599296569824 41 14 10 7 10 3.3182184467959153 24.600840607152556 0.027599334716796875 3 0.9365678160204431 4.873990479217332 2544.0 17.266968325791854 0.0 - - - - - - - 179.28 5 25 ACOX3 acyl-CoA oxidase 3, pristanoyl 347 44 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18359.[MT7]-FEVSSVADC[CAM]LDSAVALAAYK[MT7].3y4_1.heavy 802.082 / 596.352 8739.0 47.442599296569824 41 14 10 7 10 3.3182184467959153 24.600840607152556 0.027599334716796875 3 0.9365678160204431 4.873990479217332 8739.0 76.40495802705406 0.0 - - - - - - - 204.52173913043478 17 23 ACOX3 acyl-CoA oxidase 3, pristanoyl 349 44 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18359.[MT7]-FEVSSVADC[CAM]LDSAVALAAYK[MT7].3b8_1.heavy 802.082 / 979.485 3263.0 47.442599296569824 41 14 10 7 10 3.3182184467959153 24.600840607152556 0.027599334716796875 3 0.9365678160204431 4.873990479217332 3263.0 11.779783393501805 0.0 - - - - - - - 168.2608695652174 6 23 ACOX3 acyl-CoA oxidase 3, pristanoyl 351 45 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17845.[MT7]-ADGELYK[MT7].2y5_1.heavy 542.3 / 753.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACOX3 acyl-CoA oxidase 3, pristanoyl 353 45 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17845.[MT7]-ADGELYK[MT7].2b4_1.heavy 542.3 / 517.237 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACOX3 acyl-CoA oxidase 3, pristanoyl 355 45 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17845.[MT7]-ADGELYK[MT7].2y3_1.heavy 542.3 / 567.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACOX3 acyl-CoA oxidase 3, pristanoyl 357 45 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17845.[MT7]-ADGELYK[MT7].2y6_1.heavy 542.3 / 868.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACOX3 acyl-CoA oxidase 3, pristanoyl 359 46 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540947.[MT7]-DALLNWLK[MT7].3y3_1.heavy 420.923 / 590.378 8711.0 44.78049945831299 35 9 10 6 10 0.8547416865687455 72.34853954414018 0.037197113037109375 3 0.8180682804234397 2.8483444119985846 8711.0 147.10708764665287 0.0 - - - - - - - 177.5 17 10 PIK3CB;PIK3CD phosphoinositide-3-kinase, catalytic, beta polypeptide;phosphoinositide-3-kinase, catalytic, delta polypeptide 361 46 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540947.[MT7]-DALLNWLK[MT7].3b4_1.heavy 420.923 / 557.341 14438.0 44.78049945831299 35 9 10 6 10 0.8547416865687455 72.34853954414018 0.037197113037109375 3 0.8180682804234397 2.8483444119985846 14438.0 67.89091827173348 0.0 - - - - - - - 170.33333333333334 28 9 PIK3CB;PIK3CD phosphoinositide-3-kinase, catalytic, beta polypeptide;phosphoinositide-3-kinase, catalytic, delta polypeptide 363 46 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540947.[MT7]-DALLNWLK[MT7].3b5_1.heavy 420.923 / 671.385 8953.0 44.78049945831299 35 9 10 6 10 0.8547416865687455 72.34853954414018 0.037197113037109375 3 0.8180682804234397 2.8483444119985846 8953.0 53.49625386996904 0.0 - - - - - - - 177.7 17 10 PIK3CB;PIK3CD phosphoinositide-3-kinase, catalytic, beta polypeptide;phosphoinositide-3-kinase, catalytic, delta polypeptide 365 46 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540947.[MT7]-DALLNWLK[MT7].3b3_1.heavy 420.923 / 444.258 10002.0 44.78049945831299 35 9 10 6 10 0.8547416865687455 72.34853954414018 0.037197113037109375 3 0.8180682804234397 2.8483444119985846 10002.0 148.33085399449035 0.0 - - - - - - - 222.0 20 8 PIK3CB;PIK3CD phosphoinositide-3-kinase, catalytic, beta polypeptide;phosphoinositide-3-kinase, catalytic, delta polypeptide 367 47 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587719.[MT7]-LQFSFK[MT7].2y4_1.heavy 529.318 / 672.384 4170.0 37.35350036621094 40 18 4 10 8 4.195097064540515 23.837350712397143 0.0 4 0.9863210569039073 10.539980190512587 4170.0 13.19744375861637 1.0 - - - - - - - 240.2 14 10 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 369 47 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587719.[MT7]-LQFSFK[MT7].2y5_1.heavy 529.318 / 800.442 3159.0 37.35350036621094 40 18 4 10 8 4.195097064540515 23.837350712397143 0.0 4 0.9863210569039073 10.539980190512587 3159.0 21.725928853754944 1.0 - - - - - - - 234.57142857142858 6 14 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 371 47 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587719.[MT7]-LQFSFK[MT7].2b4_1.heavy 529.318 / 620.352 505.0 37.35350036621094 40 18 4 10 8 4.195097064540515 23.837350712397143 0.0 4 0.9863210569039073 10.539980190512587 505.0 0.2999010880316518 24.0 - - - - - - - 231.66666666666666 2 12 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 373 47 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587719.[MT7]-LQFSFK[MT7].2y3_1.heavy 529.318 / 525.315 3790.0 37.35350036621094 40 18 4 10 8 4.195097064540515 23.837350712397143 0.0 4 0.9863210569039073 10.539980190512587 3790.0 3.7492581602373884 1.0 - - - - - - - 631.6363636363636 7 11 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 375 48 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541435.[MT7]-ENLVFLAQK[MT7].3y3_1.heavy 450.606 / 490.311 86732.0 36.545501708984375 41 11 10 10 10 0.7415975570043221 77.43523094287909 0.0 3 0.8537145822011059 3.186541697642776 86732.0 146.22586923005213 0.0 - - - - - - - 284.0 173 8 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 377 48 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541435.[MT7]-ENLVFLAQK[MT7].3b4_1.heavy 450.606 / 600.347 49363.0 36.545501708984375 41 11 10 10 10 0.7415975570043221 77.43523094287909 0.0 3 0.8537145822011059 3.186541697642776 49363.0 104.98013574660632 0.0 - - - - - - - 694.25 98 8 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 379 48 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541435.[MT7]-ENLVFLAQK[MT7].3b5_1.heavy 450.606 / 747.416 33203.0 36.545501708984375 41 11 10 10 10 0.7415975570043221 77.43523094287909 0.0 3 0.8537145822011059 3.186541697642776 33203.0 285.85471365707997 0.0 - - - - - - - 176.4 66 5 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 381 48 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541435.[MT7]-ENLVFLAQK[MT7].3b3_1.heavy 450.606 / 501.279 33329.0 36.545501708984375 41 11 10 10 10 0.7415975570043221 77.43523094287909 0.0 3 0.8537145822011059 3.186541697642776 33329.0 103.78999207606972 0.0 - - - - - - - 240.8181818181818 66 11 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 383 49 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542975.[MT7]-RILQAVNFPFLVR.3y7_1.heavy 573.018 / 892.504 20512.0 44.38959884643555 41 15 10 6 10 3.3725998129432853 29.650716226758455 0.037200927734375 3 0.9516714615327235 5.591080740804332 20512.0 167.9743193277311 0.0 - - - - - - - 164.46153846153845 41 13 PRKACB protein kinase, cAMP-dependent, catalytic, beta 385 49 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542975.[MT7]-RILQAVNFPFLVR.3b4_1.heavy 573.018 / 655.437 10692.0 44.38959884643555 41 15 10 6 10 3.3725998129432853 29.650716226758455 0.037200927734375 3 0.9516714615327235 5.591080740804332 10692.0 167.19258164025103 0.0 - - - - - - - 181.0 21 14 PRKACB protein kinase, cAMP-dependent, catalytic, beta 387 49 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542975.[MT7]-RILQAVNFPFLVR.3b5_1.heavy 573.018 / 726.474 19086.0 44.38959884643555 41 15 10 6 10 3.3725998129432853 29.650716226758455 0.037200927734375 3 0.9516714615327235 5.591080740804332 19086.0 292.15458371600846 0.0 - - - - - - - 118.625 38 8 PRKACB protein kinase, cAMP-dependent, catalytic, beta 389 49 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542975.[MT7]-RILQAVNFPFLVR.3y5_1.heavy 573.018 / 631.393 75079.0 44.38959884643555 41 15 10 6 10 3.3725998129432853 29.650716226758455 0.037200927734375 3 0.9516714615327235 5.591080740804332 75079.0 399.96489780770355 0.0 - - - - - - - 252.0 150 11 PRKACB protein kinase, cAMP-dependent, catalytic, beta 391 50 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587841.[MT7]-VTGTLETK[MT7].2b4_1.heavy 568.842 / 503.295 3878.0 24.24685001373291 41 15 10 6 10 2.1070325430365364 39.28516550812031 0.037799835205078125 3 0.9563524801345261 5.8855917318947 3878.0 8.561946173477605 0.0 - - - - - - - 255.375 7 16 VDAC2 voltage-dependent anion channel 2 393 50 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587841.[MT7]-VTGTLETK[MT7].2y3_1.heavy 568.842 / 521.305 3464.0 24.24685001373291 41 15 10 6 10 2.1070325430365364 39.28516550812031 0.037799835205078125 3 0.9563524801345261 5.8855917318947 3464.0 15.196903225806452 0.0 - - - - - - - 248.71428571428572 6 21 VDAC2 voltage-dependent anion channel 2 395 50 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587841.[MT7]-VTGTLETK[MT7].2y6_1.heavy 568.842 / 792.458 4446.0 24.24685001373291 41 15 10 6 10 2.1070325430365364 39.28516550812031 0.037799835205078125 3 0.9563524801345261 5.8855917318947 4446.0 29.64 0.0 - - - - - - - 161.625 8 16 VDAC2 voltage-dependent anion channel 2 397 50 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587841.[MT7]-VTGTLETK[MT7].2y7_1.heavy 568.842 / 893.506 12718.0 24.24685001373291 41 15 10 6 10 2.1070325430365364 39.28516550812031 0.037799835205078125 3 0.9563524801345261 5.8855917318947 12718.0 51.939052785019484 0.0 - - - - - - - 204.11111111111111 25 18 VDAC2 voltage-dependent anion channel 2 399 51 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 709647.0 16.95009994506836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 709647.0 2080.8379764893216 0.0 - - - - - - - 181.44444444444446 1419 9 401 51 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 1203930.0 16.95009994506836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1203930.0 5499.495025339914 0.0 - - - - - - - 172.6 2407 10 403 51 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 570564.0 16.95009994506836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 570564.0 3655.142738607579 0.0 - - - - - - - 103.8 1141 10 405 52 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588022.[MT7]-NLLQVDLTK[MT7].3y3_1.heavy 444.609 / 505.347 33496.0 36.80670166015625 38 8 10 10 10 1.5134975469968392 44.95613812595916 0.0 3 0.7862791901102932 2.6204862202667574 33496.0 288.2751410491692 0.0 - - - - - - - 257.57142857142856 66 7 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 407 52 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588022.[MT7]-NLLQVDLTK[MT7].3b4_1.heavy 444.609 / 613.379 20613.0 36.80670166015625 38 8 10 10 10 1.5134975469968392 44.95613812595916 0.0 3 0.7862791901102932 2.6204862202667574 20613.0 47.38392088283181 0.0 - - - - - - - 300.6666666666667 41 3 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 409 52 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588022.[MT7]-NLLQVDLTK[MT7].3y4_1.heavy 444.609 / 620.374 36202.0 36.80670166015625 38 8 10 10 10 1.5134975469968392 44.95613812595916 0.0 3 0.7862791901102932 2.6204862202667574 36202.0 157.82910715599525 0.0 - - - - - - - 200.66666666666666 72 9 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 411 52 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588022.[MT7]-NLLQVDLTK[MT7].3b3_1.heavy 444.609 / 485.32 10049.0 36.80670166015625 38 8 10 10 10 1.5134975469968392 44.95613812595916 0.0 3 0.7862791901102932 2.6204862202667574 10049.0 17.780185516060325 1.0 - - - - - - - 607.1428571428571 23 7 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 413 53 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588025.[MT7]-VLNVVVDPQGR.2y9_1.heavy 670.394 / 983.527 17453.0 34.35439872741699 46 20 10 6 10 6.684380182564199 14.96025020552301 0.03839874267578125 3 0.9928773289065007 14.614461224159625 17453.0 95.19579472191393 0.0 - - - - - - - 266.09090909090907 34 11 PTPRR protein tyrosine phosphatase, receptor type, R 415 53 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588025.[MT7]-VLNVVVDPQGR.2b4_1.heavy 670.394 / 570.373 33779.0 34.35439872741699 46 20 10 6 10 6.684380182564199 14.96025020552301 0.03839874267578125 3 0.9928773289065007 14.614461224159625 33779.0 97.9391124260355 0.0 - - - - - - - 225.3 67 10 PTPRR protein tyrosine phosphatase, receptor type, R 417 53 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588025.[MT7]-VLNVVVDPQGR.2y10_1.heavy 670.394 / 1096.61 17903.0 34.35439872741699 46 20 10 6 10 6.684380182564199 14.96025020552301 0.03839874267578125 3 0.9928773289065007 14.614461224159625 17903.0 82.75341734368924 0.0 - - - - - - - 289.57142857142856 35 14 PTPRR protein tyrosine phosphatase, receptor type, R 419 53 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588025.[MT7]-VLNVVVDPQGR.2y7_1.heavy 670.394 / 770.416 15764.0 34.35439872741699 46 20 10 6 10 6.684380182564199 14.96025020552301 0.03839874267578125 3 0.9928773289065007 14.614461224159625 15764.0 161.08424778761062 0.0 - - - - - - - 202.7 31 10 PTPRR protein tyrosine phosphatase, receptor type, R 421 54 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18232.[MT7]-NSIELFVSPINRK[MT7].3y6_1.heavy 602.356 / 858.528 4082.0 37.08219909667969 42 17 10 5 10 2.4533375966352193 32.53361814537521 0.04219818115234375 3 0.9772872792787308 8.173392297201735 4082.0 11.768438563532904 0.0 - - - - - - - 258.72727272727275 8 11 PTPRR protein tyrosine phosphatase, receptor type, R 423 54 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18232.[MT7]-NSIELFVSPINRK[MT7].3b4_1.heavy 602.356 / 588.311 6433.0 37.08219909667969 42 17 10 5 10 2.4533375966352193 32.53361814537521 0.04219818115234375 3 0.9772872792787308 8.173392297201735 6433.0 7.657895729102133 0.0 - - - - - - - 757.625 12 8 PTPRR protein tyrosine phosphatase, receptor type, R 425 54 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18232.[MT7]-NSIELFVSPINRK[MT7].3b5_1.heavy 602.356 / 701.395 4330.0 37.08219909667969 42 17 10 5 10 2.4533375966352193 32.53361814537521 0.04219818115234375 3 0.9772872792787308 8.173392297201735 4330.0 8.111313131313132 0.0 - - - - - - - 881.5 8 8 PTPRR protein tyrosine phosphatase, receptor type, R 427 54 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18232.[MT7]-NSIELFVSPINRK[MT7].3y5_1.heavy 602.356 / 771.496 2845.0 37.08219909667969 42 17 10 5 10 2.4533375966352193 32.53361814537521 0.04219818115234375 3 0.9772872792787308 8.173392297201735 2845.0 20.983014229307905 0.0 - - - - - - - 293.75 5 8 PTPRR protein tyrosine phosphatase, receptor type, R 429 55 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544169.[MT7]-RAQLQELLLQQIAFK[MT7].3b6_1.heavy 696.424 / 870.491 16061.0 43.5724983215332 41 11 10 10 10 3.4193754916296797 29.245106378281918 0.0 3 0.8747146380778825 3.449610636838504 16061.0 75.83717099723324 0.0 - - - - - - - 209.78571428571428 32 14 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 431 55 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544169.[MT7]-RAQLQELLLQQIAFK[MT7].3y3_1.heavy 696.424 / 509.32 71093.0 43.5724983215332 41 11 10 10 10 3.4193754916296797 29.245106378281918 0.0 3 0.8747146380778825 3.449610636838504 71093.0 193.54157427993513 0.0 - - - - - - - 281.6363636363636 142 11 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 433 55 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544169.[MT7]-RAQLQELLLQQIAFK[MT7].3b8_1.heavy 696.424 / 1096.66 23399.0 43.5724983215332 41 11 10 10 10 3.4193754916296797 29.245106378281918 0.0 3 0.8747146380778825 3.449610636838504 23399.0 113.88470347648261 0.0 - - - - - - - 233.07142857142858 46 14 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 435 55 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544169.[MT7]-RAQLQELLLQQIAFK[MT7].3b7_1.heavy 696.424 / 983.575 20382.0 43.5724983215332 41 11 10 10 10 3.4193754916296797 29.245106378281918 0.0 3 0.8747146380778825 3.449610636838504 20382.0 124.82853541416567 0.0 - - - - - - - 193.0 40 11 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 437 56 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540836.[MT7]-LLPYWNER.2y4_1.heavy 617.839 / 604.284 3345.0 39.70870113372803 46 20 10 6 10 6.148823452903823 16.263273903688734 0.033199310302734375 3 0.9945417830353862 16.69703028423425 3345.0 13.601832460732984 0.0 - - - - - - - 704.625 6 8 BPGM 2,3-bisphosphoglycerate mutase 439 56 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540836.[MT7]-LLPYWNER.2y5_1.heavy 617.839 / 767.347 2962.0 39.70870113372803 46 20 10 6 10 6.148823452903823 16.263273903688734 0.033199310302734375 3 0.9945417830353862 16.69703028423425 2962.0 7.857312390924957 0.0 - - - - - - - 278.8333333333333 5 12 BPGM 2,3-bisphosphoglycerate mutase 441 56 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540836.[MT7]-LLPYWNER.2y6_1.heavy 617.839 / 864.4 59822.0 39.70870113372803 46 20 10 6 10 6.148823452903823 16.263273903688734 0.033199310302734375 3 0.9945417830353862 16.69703028423425 59822.0 142.51831710352678 0.0 - - - - - - - 656.875 119 8 BPGM 2,3-bisphosphoglycerate mutase 443 56 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540836.[MT7]-LLPYWNER.2y7_1.heavy 617.839 / 977.484 24942.0 39.70870113372803 46 20 10 6 10 6.148823452903823 16.263273903688734 0.033199310302734375 3 0.9945417830353862 16.69703028423425 24942.0 114.99901001546851 0.0 - - - - - - - 223.25 49 12 BPGM 2,3-bisphosphoglycerate mutase 445 57 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539905.[MT7]-VGLALELEA.2b3_1.heavy 529.814 / 414.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC2 voltage-dependent anion channel 2 447 57 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539905.[MT7]-VGLALELEA.2b6_1.heavy 529.814 / 727.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC2 voltage-dependent anion channel 2 449 57 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539905.[MT7]-VGLALELEA.2b7_1.heavy 529.814 / 840.531 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC2 voltage-dependent anion channel 2 451 57 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539905.[MT7]-VGLALELEA.2b5_1.heavy 529.814 / 598.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - VDAC2 voltage-dependent anion channel 2 453 58 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18229.[MT7]-LYEAVPQLSNVFK[MT7].2b3_1.heavy 898.513 / 550.299 1793.0 43.07469940185547 34 8 10 6 10 1.2677524855280833 63.243661042855344 0.03839874267578125 3 0.79552821221626 2.681337164563908 1793.0 0.0 1.0 - - - - - - - 229.45454545454547 3 11 CDC7 cell division cycle 7 homolog (S. cerevisiae) 455 58 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18229.[MT7]-LYEAVPQLSNVFK[MT7].2y8_1.heavy 898.513 / 1076.62 9290.0 43.07469940185547 34 8 10 6 10 1.2677524855280833 63.243661042855344 0.03839874267578125 3 0.79552821221626 2.681337164563908 9290.0 109.15644455805497 0.0 - - - - - - - 251.0 18 12 CDC7 cell division cycle 7 homolog (S. cerevisiae) 457 58 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18229.[MT7]-LYEAVPQLSNVFK[MT7].2b4_1.heavy 898.513 / 621.336 4971.0 43.07469940185547 34 8 10 6 10 1.2677524855280833 63.243661042855344 0.03839874267578125 3 0.79552821221626 2.681337164563908 4971.0 30.239767635864368 0.0 - - - - - - - 197.64285714285714 9 14 CDC7 cell division cycle 7 homolog (S. cerevisiae) 459 58 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18229.[MT7]-LYEAVPQLSNVFK[MT7].2b5_1.heavy 898.513 / 720.405 4401.0 43.07469940185547 34 8 10 6 10 1.2677524855280833 63.243661042855344 0.03839874267578125 3 0.79552821221626 2.681337164563908 4401.0 27.75 0.0 - - - - - - - 223.75 8 12 CDC7 cell division cycle 7 homolog (S. cerevisiae) 461 59 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541583.[MT7]-ATIISEQQAK[MT7].3b6_1.heavy 459.604 / 759.437 4915.0 25.16010093688965 47 17 10 10 10 3.7085230387575816 26.964912703765137 0.0 3 0.9722956408424376 7.397424295681158 4915.0 15.440641534391535 0.0 - - - - - - - 257.72727272727275 9 22 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 463 59 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541583.[MT7]-ATIISEQQAK[MT7].3y3_1.heavy 459.604 / 490.311 37757.0 25.16010093688965 47 17 10 10 10 3.7085230387575816 26.964912703765137 0.0 3 0.9722956408424376 7.397424295681158 37757.0 33.4461948769398 0.0 - - - - - - - 783.0 75 10 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 465 59 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541583.[MT7]-ATIISEQQAK[MT7].3b4_1.heavy 459.604 / 543.362 47372.0 25.16010093688965 47 17 10 10 10 3.7085230387575816 26.964912703765137 0.0 3 0.9722956408424376 7.397424295681158 47372.0 69.50422280384703 0.0 - - - - - - - 767.5714285714286 94 14 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 467 59 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541583.[MT7]-ATIISEQQAK[MT7].3b5_1.heavy 459.604 / 630.394 20256.0 25.16010093688965 47 17 10 10 10 3.7085230387575816 26.964912703765137 0.0 3 0.9722956408424376 7.397424295681158 20256.0 34.739456790123455 0.0 - - - - - - - 772.6153846153846 40 13 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 469 60 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17853.[MT7]-NILESVK[MT7].2y4_1.heavy 545.839 / 606.358 4889.0 32.48472499847412 44 18 10 6 10 4.458031271883741 22.43142631831405 0.033100128173828125 3 0.9895858553693853 12.082949078037977 4889.0 13.581028182444614 1.0 - - - - - - - 803.2857142857143 9 7 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 471 60 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17853.[MT7]-NILESVK[MT7].2y5_1.heavy 545.839 / 719.442 6764.0 32.48472499847412 44 18 10 6 10 4.458031271883741 22.43142631831405 0.033100128173828125 3 0.9895858553693853 12.082949078037977 6764.0 23.514928425357873 0.0 - - - - - - - 264.7 13 20 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 473 60 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17853.[MT7]-NILESVK[MT7].2b4_1.heavy 545.839 / 614.363 2282.0 32.48472499847412 44 18 10 6 10 4.458031271883741 22.43142631831405 0.033100128173828125 3 0.9895858553693853 12.082949078037977 2282.0 5.04 5.0 - - - - - - - 678.8888888888889 4 9 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 475 60 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17853.[MT7]-NILESVK[MT7].2y6_1.heavy 545.839 / 832.526 2771.0 32.48472499847412 44 18 10 6 10 4.458031271883741 22.43142631831405 0.033100128173828125 3 0.9895858553693853 12.082949078037977 2771.0 6.813934426229507 1.0 - - - - - - - 173.8181818181818 5 22 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 477 61 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17958.[MT7]-FFVGGNWK[MT7].2y6_1.heavy 621.847 / 804.448 1265.0 38.56009864807129 43 18 10 5 10 4.719848090196114 21.187122570261558 0.046199798583984375 3 0.9832307020962032 9.516914204418766 1265.0 4.895376712328767 1.0 - - - - - - - 263.47058823529414 2 17 TPI1 triosephosphate isomerase 1 479 61 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17958.[MT7]-FFVGGNWK[MT7].2b3_1.heavy 621.847 / 538.315 973.0 38.56009864807129 43 18 10 5 10 4.719848090196114 21.187122570261558 0.046199798583984375 3 0.9832307020962032 9.516914204418766 973.0 1.7007712082262212 6.0 - - - - - - - 0.0 1 0 TPI1 triosephosphate isomerase 1 481 61 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17958.[MT7]-FFVGGNWK[MT7].2y5_1.heavy 621.847 / 705.38 2725.0 38.56009864807129 43 18 10 5 10 4.719848090196114 21.187122570261558 0.046199798583984375 3 0.9832307020962032 9.516914204418766 2725.0 16.912417732848944 0.0 - - - - - - - 279.875 5 16 TPI1 triosephosphate isomerase 1 483 61 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17958.[MT7]-FFVGGNWK[MT7].2y7_1.heavy 621.847 / 951.517 2238.0 38.56009864807129 43 18 10 5 10 4.719848090196114 21.187122570261558 0.046199798583984375 3 0.9832307020962032 9.516914204418766 2238.0 16.462702845100104 0.0 - - - - - - - 201.64285714285714 4 14 TPI1 triosephosphate isomerase 1 485 62 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542424.[MT7]-ELALFTEGEGMLR.3y7_1.heavy 537.284 / 791.372 5342.0 44.78049945831299 40 14 10 6 10 2.0986382406468023 36.88052256548315 0.037197113037109375 3 0.9324584293297757 4.721734207667259 5342.0 124.20150000000001 0.0 - - - - - - - 135.7 10 10 ACOX3 acyl-CoA oxidase 3, pristanoyl 487 62 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542424.[MT7]-ELALFTEGEGMLR.3y6_1.heavy 537.284 / 662.329 20410.0 44.78049945831299 40 14 10 6 10 2.0986382406468023 36.88052256548315 0.037197113037109375 3 0.9324584293297757 4.721734207667259 20410.0 200.92579142654142 0.0 - - - - - - - 172.66666666666666 40 12 ACOX3 acyl-CoA oxidase 3, pristanoyl 489 62 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542424.[MT7]-ELALFTEGEGMLR.3b4_1.heavy 537.284 / 571.357 10046.0 44.78049945831299 40 14 10 6 10 2.0986382406468023 36.88052256548315 0.037197113037109375 3 0.9324584293297757 4.721734207667259 10046.0 176.1604009433962 0.0 - - - - - - - 139.58333333333334 20 12 ACOX3 acyl-CoA oxidase 3, pristanoyl 491 62 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542424.[MT7]-ELALFTEGEGMLR.3y8_1.heavy 537.284 / 892.419 2711.0 44.78049945831299 40 14 10 6 10 2.0986382406468023 36.88052256548315 0.037197113037109375 3 0.9324584293297757 4.721734207667259 2711.0 26.677036156943238 0.0 - - - - - - - 239.0 5 8 ACOX3 acyl-CoA oxidase 3, pristanoyl 493 63 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542972.[MT7]-LTFDTTFSPNTGK[MT7].3b4_1.heavy 572.973 / 621.336 8211.0 36.65419960021973 43 18 10 5 10 3.747103523226448 22.79676244792094 0.044200897216796875 3 0.983539030522392 9.60587910537589 8211.0 12.805678724420996 0.0 - - - - - - - 696.4285714285714 16 7 VDAC2 voltage-dependent anion channel 2 495 63 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542972.[MT7]-LTFDTTFSPNTGK[MT7].3b3_1.heavy 572.973 / 506.31 1924.0 36.65419960021973 43 18 10 5 10 3.747103523226448 22.79676244792094 0.044200897216796875 3 0.983539030522392 9.60587910537589 1924.0 3.3983376353446504 2.0 - - - - - - - 256.7 7 10 VDAC2 voltage-dependent anion channel 2 497 63 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542972.[MT7]-LTFDTTFSPNTGK[MT7].3y4_1.heavy 572.973 / 563.327 4619.0 36.65419960021973 43 18 10 5 10 3.747103523226448 22.79676244792094 0.044200897216796875 3 0.983539030522392 9.60587910537589 4619.0 3.504096086408276 0.0 - - - - - - - 256.6666666666667 9 9 VDAC2 voltage-dependent anion channel 2 499 63 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542972.[MT7]-LTFDTTFSPNTGK[MT7].3y5_1.heavy 572.973 / 660.38 6287.0 36.65419960021973 43 18 10 5 10 3.747103523226448 22.79676244792094 0.044200897216796875 3 0.983539030522392 9.60587910537589 6287.0 26.625009695957065 0.0 - - - - - - - 224.5 12 8 VDAC2 voltage-dependent anion channel 2 501 64 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18343.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.4y5_1.heavy 577.321 / 569.341 12471.0 37.35350036621094 37 7 10 10 10 0.36799836243385553 121.3099612426841 0.0 3 0.711081344463575 2.2382863900358023 12471.0 13.489289327546993 1.0 - - - - - - - 749.125 26 8 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 503 64 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18343.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.4y8_1.heavy 577.321 / 1052.63 8154.0 37.35350036621094 37 7 10 10 10 0.36799836243385553 121.3099612426841 0.0 3 0.711081344463575 2.2382863900358023 8154.0 27.13818098052851 0.0 - - - - - - - 225.0 16 8 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 505 64 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18343.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.4y8_2.heavy 577.321 / 526.82 44249.0 37.35350036621094 37 7 10 10 10 0.36799836243385553 121.3099612426841 0.0 3 0.711081344463575 2.2382863900358023 44249.0 100.91416719722822 0.0 - - - - - - - 192.0 88 5 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 507 64 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18343.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.4b4_1.heavy 577.321 / 599.388 33576.0 37.35350036621094 37 7 10 10 10 0.36799836243385553 121.3099612426841 0.0 3 0.711081344463575 2.2382863900358023 33576.0 83.65971971554684 0.0 - - - - - - - 222.85714285714286 67 7 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 509 65 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18342.[MT7]-ADQSFTSPPPRDFLLDIAR.3y7_1.heavy 764.07 / 847.504 3982.0 41.6338996887207 39 13 10 6 10 1.5171382553650115 54.176690846869384 0.0337982177734375 3 0.9144831995528645 4.189787455246522 3982.0 4.220239316239316 1.0 - - - - - - - 318.7692307692308 7 13 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 511 65 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18342.[MT7]-ADQSFTSPPPRDFLLDIAR.3b4_1.heavy 764.07 / 546.264 7069.0 41.6338996887207 39 13 10 6 10 1.5171382553650115 54.176690846869384 0.0337982177734375 3 0.9144831995528645 4.189787455246522 7069.0 1.6406992161551748 0.0 - - - - - - - 743.9230769230769 14 13 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 513 65 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18342.[MT7]-ADQSFTSPPPRDFLLDIAR.3b5_1.heavy 764.07 / 693.332 3657.0 41.6338996887207 39 13 10 6 10 1.5171382553650115 54.176690846869384 0.0337982177734375 3 0.9144831995528645 4.189787455246522 3657.0 8.317314289576856 0.0 - - - - - - - 376.72727272727275 7 11 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 515 65 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18342.[MT7]-ADQSFTSPPPRDFLLDIAR.3y8_1.heavy 764.07 / 962.531 2031.0 41.6338996887207 39 13 10 6 10 1.5171382553650115 54.176690846869384 0.0337982177734375 3 0.9144831995528645 4.189787455246522 2031.0 0.7499076923076923 1.0 - - - - - - - 719.7142857142857 4 7 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 517 66 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18344.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.3b4_1.heavy 769.426 / 599.388 14330.0 37.35350036621094 44 14 10 10 10 1.861262141738151 53.72698329672917 0.0 3 0.9373843647456489 4.906009291006239 14330.0 17.65217993079585 0.0 - - - - - - - 361.2857142857143 28 7 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 519 66 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18344.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.3y8_1.heavy 769.426 / 1052.63 35283.0 37.35350036621094 44 14 10 10 10 1.861262141738151 53.72698329672917 0.0 3 0.9373843647456489 4.906009291006239 35283.0 69.21838826289991 0.0 - - - - - - - 361.1666666666667 70 6 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 521 66 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18344.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.3y8_2.heavy 769.426 / 526.82 26854.0 37.35350036621094 44 14 10 10 10 1.861262141738151 53.72698329672917 0.0 3 0.9373843647456489 4.906009291006239 26854.0 124.79487774499938 0.0 - - - - - - - 200.5 53 6 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 523 66 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18344.[MT7]-LVIEFSEEYPNK[MT7]PPTVR.3y5_1.heavy 769.426 / 569.341 29262.0 37.35350036621094 44 14 10 10 10 1.861262141738151 53.72698329672917 0.0 3 0.9373843647456489 4.906009291006239 29262.0 37.52230627306273 0.0 - - - - - - - 361.0 58 2 UBE2B ubiquitin-conjugating enzyme E2B (RAD6 homolog) 525 67 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542572.[MT7]-AVDGYVK[MT7]PQIK[MT7].4y4_1.heavy 413.254 / 629.41 16510.0 26.98082447052002 43 17 10 6 10 4.097666406358411 24.40413398338832 0.034099578857421875 3 0.9759853275441919 7.947875656787621 16510.0 77.38466866774417 0.0 - - - - - - - 214.94736842105263 33 19 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 527 67 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542572.[MT7]-AVDGYVK[MT7]PQIK[MT7].4b4_1.heavy 413.254 / 487.263 27232.0 26.98082447052002 43 17 10 6 10 4.097666406358411 24.40413398338832 0.034099578857421875 3 0.9759853275441919 7.947875656787621 27232.0 39.718505013673656 0.0 - - - - - - - 764.8888888888889 54 9 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 529 67 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542572.[MT7]-AVDGYVK[MT7]PQIK[MT7].4b5_1.heavy 413.254 / 650.327 8834.0 26.98082447052002 43 17 10 6 10 4.097666406358411 24.40413398338832 0.034099578857421875 3 0.9759853275441919 7.947875656787621 8834.0 54.56301111739212 0.0 - - - - - - - 221.72727272727272 17 22 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 531 67 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542572.[MT7]-AVDGYVK[MT7]PQIK[MT7].4b3_1.heavy 413.254 / 430.242 11514.0 26.98082447052002 43 17 10 6 10 4.097666406358411 24.40413398338832 0.034099578857421875 3 0.9759853275441919 7.947875656787621 11514.0 17.295330094387502 0.0 - - - - - - - 1211.5555555555557 23 9 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 533 68 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18242.[MT7]-EEGVVDALSIVC[CAM]QLR.3y7_1.heavy 611.328 / 875.477 6331.0 47.02832508087158 44 17 10 7 10 1.8846346651050259 37.41403684802334 0.028301239013671875 3 0.9711424442871371 7.247406794984341 6331.0 63.48217089138828 0.0 - - - - - - - 123.5 12 14 PTPRR protein tyrosine phosphatase, receptor type, R 535 68 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18242.[MT7]-EEGVVDALSIVC[CAM]QLR.3b6_1.heavy 611.328 / 773.38 6906.0 47.02832508087158 44 17 10 7 10 1.8846346651050259 37.41403684802334 0.028301239013671875 3 0.9711424442871371 7.247406794984341 6906.0 82.1070163759819 0.0 - - - - - - - 185.66666666666666 13 18 PTPRR protein tyrosine phosphatase, receptor type, R 537 68 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18242.[MT7]-EEGVVDALSIVC[CAM]QLR.3b4_1.heavy 611.328 / 559.284 8978.0 47.02832508087158 44 17 10 7 10 1.8846346651050259 37.41403684802334 0.028301239013671875 3 0.9711424442871371 7.247406794984341 8978.0 61.414724637681154 0.0 - - - - - - - 200.30434782608697 17 23 PTPRR protein tyrosine phosphatase, receptor type, R 539 68 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18242.[MT7]-EEGVVDALSIVC[CAM]QLR.3y5_1.heavy 611.328 / 675.361 9324.0 47.02832508087158 44 17 10 7 10 1.8846346651050259 37.41403684802334 0.028301239013671875 3 0.9711424442871371 7.247406794984341 9324.0 81.30990606936416 0.0 - - - - - - - 157.68421052631578 18 19 PTPRR protein tyrosine phosphatase, receptor type, R 541 69 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18245.[MT7]-RILQAIDFPFLVK[MT7].3y3_1.heavy 616.716 / 503.367 24643.0 46.29837608337402 38 12 10 6 10 1.2111712920289572 54.737050813466524 0.03369903564453125 3 0.8997019543684984 3.8638261074060494 24643.0 52.34111326322654 0.0 - - - - - - - 647.4285714285714 49 7 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 543 69 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18245.[MT7]-RILQAIDFPFLVK[MT7].3y4_1.heavy 616.716 / 650.436 13288.0 46.29837608337402 38 12 10 6 10 1.2111712920289572 54.737050813466524 0.03369903564453125 3 0.8997019543684984 3.8638261074060494 13288.0 113.44013551665725 0.0 - - - - - - - 191.16666666666666 26 18 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 545 69 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18245.[MT7]-RILQAIDFPFLVK[MT7].3y5_1.heavy 616.716 / 747.489 15643.0 46.29837608337402 38 12 10 6 10 1.2111712920289572 54.737050813466524 0.03369903564453125 3 0.8997019543684984 3.8638261074060494 15643.0 304.02579889807157 0.0 - - - - - - - 181.125 31 16 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 547 69 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18245.[MT7]-RILQAIDFPFLVK[MT7].3b7_1.heavy 616.716 / 954.585 21200.0 46.29837608337402 38 12 10 6 10 1.2111712920289572 54.737050813466524 0.03369903564453125 3 0.8997019543684984 3.8638261074060494 21200.0 123.34158257613807 0.0 - - - - - - - 139.5 42 16 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 549 70 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 594470.0 19.687700271606445 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 594470.0 15143.60497796121 0.0 - - - - - - - 374.0 1188 2 551 70 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 316915.0 19.687700271606445 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 316915.0 2722.142119797943 0.0 - - - - - - - 764.4285714285714 633 7 553 70 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 360154.0 19.687700271606445 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 360154.0 9145.671502413392 0.0 - - - - - - - 1231.0 720 7 555 71 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18236.[MT7]-WFATTDWIAIYQR.3y6_1.heavy 605.65 / 763.446 2785.0 48.37240028381348 40 15 10 5 10 2.5378510618331798 39.40341555259214 0.040798187255859375 3 0.9551032130590985 5.802515746004755 2785.0 64.09023954409349 0.0 - - - - - - - 144.23076923076923 5 13 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 557 71 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18236.[MT7]-WFATTDWIAIYQR.3b6_1.heavy 605.65 / 866.417 7695.0 48.37240028381348 40 15 10 5 10 2.5378510618331798 39.40341555259214 0.040798187255859375 3 0.9551032130590985 5.802515746004755 7695.0 64.055 0.0 - - - - - - - 175.3846153846154 15 13 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 559 71 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18236.[MT7]-WFATTDWIAIYQR.3b3_1.heavy 605.65 / 549.294 2683.0 48.37240028381348 40 15 10 5 10 2.5378510618331798 39.40341555259214 0.040798187255859375 3 0.9551032130590985 5.802515746004755 2683.0 24.97965517241379 0.0 - - - - - - - 161.5 5 16 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 561 71 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18236.[MT7]-WFATTDWIAIYQR.3y4_1.heavy 605.65 / 579.325 4708.0 48.37240028381348 40 15 10 5 10 2.5378510618331798 39.40341555259214 0.040798187255859375 3 0.9551032130590985 5.802515746004755 4708.0 31.121439280359823 0.0 - - - - - - - 137.0 9 17 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 563 72 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17968.[MT7]-WLVC[CAM]YLLR.2b3_1.heavy 633.861 / 543.341 2776.0 49.9960241317749 44 18 10 6 10 6.349734110023873 15.748690932134798 0.035701751708984375 3 0.9888208571888794 11.661453885177929 2776.0 28.83443522194154 0.0 - - - - - - - 180.76190476190476 5 21 ACOX3 acyl-CoA oxidase 3, pristanoyl 565 72 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17968.[MT7]-WLVC[CAM]YLLR.2y5_1.heavy 633.861 / 724.381 4205.0 49.9960241317749 44 18 10 6 10 6.349734110023873 15.748690932134798 0.035701751708984375 3 0.9888208571888794 11.661453885177929 4205.0 127.05791683326669 0.0 - - - - - - - 134.28571428571428 8 14 ACOX3 acyl-CoA oxidase 3, pristanoyl 567 72 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17968.[MT7]-WLVC[CAM]YLLR.2y6_1.heavy 633.861 / 823.45 5103.0 49.9960241317749 44 18 10 6 10 6.349734110023873 15.748690932134798 0.035701751708984375 3 0.9888208571888794 11.661453885177929 5103.0 77.38155737704918 0.0 - - - - - - - 112.41666666666667 10 12 ACOX3 acyl-CoA oxidase 3, pristanoyl 569 72 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17968.[MT7]-WLVC[CAM]YLLR.2y7_1.heavy 633.861 / 936.534 8123.0 49.9960241317749 44 18 10 6 10 6.349734110023873 15.748690932134798 0.035701751708984375 3 0.9888208571888794 11.661453885177929 8123.0 111.89691883737302 0.0 - - - - - - - 100.73333333333333 16 15 ACOX3 acyl-CoA oxidase 3, pristanoyl 571 73 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18238.[MT7]-TRVEGGQLGGEEWTR.3y7_1.heavy 606.979 / 834.374 17105.0 28.024149894714355 44 18 10 6 10 3.3156608710997433 30.159899907625917 0.03890037536621094 3 0.9883428239029746 11.41938984129572 17105.0 108.15623076923077 0.0 - - - - - - - 173.33333333333334 34 15 SHC1 SHC (Src homology 2 domain containing) transforming protein 1 573 73 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18238.[MT7]-TRVEGGQLGGEEWTR.3y4_1.heavy 606.979 / 591.289 4357.0 28.024149894714355 44 18 10 6 10 3.3156608710997433 30.159899907625917 0.03890037536621094 3 0.9883428239029746 11.41938984129572 4357.0 15.991626373626373 0.0 - - - - - - - 252.35294117647058 8 17 SHC1 SHC (Src homology 2 domain containing) transforming protein 1 575 73 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18238.[MT7]-TRVEGGQLGGEEWTR.3y8_1.heavy 606.979 / 947.458 6374.0 28.024149894714355 44 18 10 6 10 3.3156608710997433 30.159899907625917 0.03890037536621094 3 0.9883428239029746 11.41938984129572 6374.0 93.15846153846154 0.0 - - - - - - - 167.14285714285714 12 7 SHC1 SHC (Src homology 2 domain containing) transforming protein 1 577 73 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18238.[MT7]-TRVEGGQLGGEEWTR.3b7_1.heavy 606.979 / 872.471 6894.0 28.024149894714355 44 18 10 6 10 3.3156608710997433 30.159899907625917 0.03890037536621094 3 0.9883428239029746 11.41938984129572 6894.0 147.95584615384615 0.0 - - - - - - - 110.0 13 13 SHC1 SHC (Src homology 2 domain containing) transforming protein 1 579 74 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587441.[MT7]-SVFGER.2y4_1.heavy 419.731 / 508.251 5214.0 25.921899795532227 43 20 10 3 10 5.149078776462836 19.420949715726643 0.06399917602539062 3 0.9934087719249379 15.192889061219065 5214.0 8.063763323226954 0.0 - - - - - - - 711.7692307692307 10 13 CDC7 cell division cycle 7 homolog (S. cerevisiae) 581 74 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587441.[MT7]-SVFGER.2y5_1.heavy 419.731 / 607.32 6952.0 25.921899795532227 43 20 10 3 10 5.149078776462836 19.420949715726643 0.06399917602539062 3 0.9934087719249379 15.192889061219065 6952.0 25.874949979991996 0.0 - - - - - - - 253.47368421052633 13 19 CDC7 cell division cycle 7 homolog (S. cerevisiae) 583 74 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587441.[MT7]-SVFGER.2b4_1.heavy 419.731 / 535.3 2747.0 25.921899795532227 43 20 10 3 10 5.149078776462836 19.420949715726643 0.06399917602539062 3 0.9934087719249379 15.192889061219065 2747.0 5.844427399814617 1.0 - - - - - - - 676.5 6 16 CDC7 cell division cycle 7 homolog (S. cerevisiae) 585 74 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587441.[MT7]-SVFGER.2b5_1.heavy 419.731 / 664.342 3700.0 25.921899795532227 43 20 10 3 10 5.149078776462836 19.420949715726643 0.06399917602539062 3 0.9934087719249379 15.192889061219065 3700.0 18.464126533919888 0.0 - - - - - - - 242.66666666666666 7 21 CDC7 cell division cycle 7 homolog (S. cerevisiae) 587 75 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544175.[MT7]-EAQTLQQYRVELAEK[MT7].4y9_2.heavy 524.291 / 640.36 28775.0 32.80699920654297 46 16 10 10 10 1.9296186428667141 34.754901654417715 0.0 3 0.9640953035781293 6.49349733628848 28775.0 62.49703537579609 0.0 - - - - - - - 277.11764705882354 57 17 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 589 75 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544175.[MT7]-EAQTLQQYRVELAEK[MT7].4y10_2.heavy 524.291 / 704.389 45645.0 32.80699920654297 46 16 10 10 10 1.9296186428667141 34.754901654417715 0.0 3 0.9640953035781293 6.49349733628848 45645.0 248.64980544747084 0.0 - - - - - - - 599.5 91 8 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 591 75 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544175.[MT7]-EAQTLQQYRVELAEK[MT7].4b4_1.heavy 524.291 / 574.295 40678.0 32.80699920654297 46 16 10 10 10 1.9296186428667141 34.754901654417715 0.0 3 0.9640953035781293 6.49349733628848 40678.0 43.61261536064201 0.0 - - - - - - - 698.1538461538462 81 13 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 593 75 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544175.[MT7]-EAQTLQQYRVELAEK[MT7].4b3_1.heavy 524.291 / 473.248 31772.0 32.80699920654297 46 16 10 10 10 1.9296186428667141 34.754901654417715 0.0 3 0.9640953035781293 6.49349733628848 31772.0 35.834661699314985 0.0 - - - - - - - 709.5 63 14 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 595 76 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17962.[MT7]-RSGSSDFEAR.2b8_1.heavy 628.311 / 1010.47 1183.0 18.175174713134766 37 11 10 6 10 1.0336823954012253 65.6499855917439 0.0363006591796875 3 0.869327804231812 3.376167870951349 1183.0 8.238549458895006 0.0 - - - - - - - 95.42857142857143 2 14 ACOX3 acyl-CoA oxidase 3, pristanoyl 597 76 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17962.[MT7]-RSGSSDFEAR.2y4_1.heavy 628.311 / 522.267 1107.0 18.175174713134766 37 11 10 6 10 1.0336823954012253 65.6499855917439 0.0363006591796875 3 0.869327804231812 3.376167870951349 1107.0 10.896125654450262 1.0 - - - - - - - 139.3 2 20 ACOX3 acyl-CoA oxidase 3, pristanoyl 599 76 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17962.[MT7]-RSGSSDFEAR.2y9_1.heavy 628.311 / 955.412 496.0 18.175174713134766 37 11 10 6 10 1.0336823954012253 65.6499855917439 0.0363006591796875 3 0.869327804231812 3.376167870951349 496.0 16.968421052631577 0.0 - - - - - - - 0.0 0 0 ACOX3 acyl-CoA oxidase 3, pristanoyl 601 76 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17962.[MT7]-RSGSSDFEAR.2b6_1.heavy 628.311 / 734.355 687.0 18.175174713134766 37 11 10 6 10 1.0336823954012253 65.6499855917439 0.0363006591796875 3 0.869327804231812 3.376167870951349 687.0 22.42889931350114 0.0 - - - - - - - 0.0 1 0 ACOX3 acyl-CoA oxidase 3, pristanoyl 603 77 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17961.[MT7]-YRELNFLR.3y3_1.heavy 418.907 / 435.271 46535.0 34.325599670410156 41 11 10 10 10 2.619827384458839 38.17045374562201 0.0 3 0.8690314344893909 3.372258218131247 46535.0 56.840696347031965 0.0 - - - - - - - 206.66666666666666 93 9 ACOX3 acyl-CoA oxidase 3, pristanoyl 605 77 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17961.[MT7]-YRELNFLR.3b5_1.heavy 418.907 / 820.443 12154.0 34.325599670410156 41 11 10 10 10 2.619827384458839 38.17045374562201 0.0 3 0.8690314344893909 3.372258218131247 12154.0 119.77832935360898 0.0 - - - - - - - 237.0 24 6 ACOX3 acyl-CoA oxidase 3, pristanoyl 607 77 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17961.[MT7]-YRELNFLR.3y4_1.heavy 418.907 / 549.314 59455.0 34.325599670410156 41 11 10 10 10 2.619827384458839 38.17045374562201 0.0 3 0.8690314344893909 3.372258218131247 59455.0 76.92541000278145 0.0 - - - - - - - 182.16666666666666 118 6 ACOX3 acyl-CoA oxidase 3, pristanoyl 609 77 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17961.[MT7]-YRELNFLR.3y5_1.heavy 418.907 / 662.398 12263.0 34.325599670410156 41 11 10 10 10 2.619827384458839 38.17045374562201 0.0 3 0.8690314344893909 3.372258218131247 12263.0 43.828455210237664 0.0 - - - - - - - 237.0 24 12 ACOX3 acyl-CoA oxidase 3, pristanoyl 611 78 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17865.[MT7]-ETALQQK[MT7].2y4_1.heavy 553.326 / 660.416 2385.0 20.33329963684082 38 20 0 10 8 15.452072204530023 6.471623914019984 0.0 4 0.9976132406542092 25.256411004553527 2385.0 25.11377887788779 0.0 - - - - - - - 106.4090909090909 4 22 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 613 78 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17865.[MT7]-ETALQQK[MT7].2y5_1.heavy 553.326 / 731.453 1738.0 20.33329963684082 38 20 0 10 8 15.452072204530023 6.471623914019984 0.0 4 0.9976132406542092 25.256411004553527 1738.0 6.306419323251006 0.0 - - - - - - - 102.77272727272727 3 22 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 615 78 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17865.[MT7]-ETALQQK[MT7].2b4_1.heavy 553.326 / 559.321 2304.0 20.33329963684082 38 20 0 10 8 15.452072204530023 6.471623914019984 0.0 4 0.9976132406542092 25.256411004553527 2304.0 20.147756351392715 0.0 - - - - - - - 146.1153846153846 4 26 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 617 78 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17865.[MT7]-ETALQQK[MT7].2y6_1.heavy 553.326 / 832.501 4042.0 20.33329963684082 38 20 0 10 8 15.452072204530023 6.471623914019984 0.0 4 0.9976132406542092 25.256411004553527 4042.0 31.834833292516528 1.0 - - - - - - - 148.68 28 25 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 619 79 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17863.[MT7]-ATVDADDVR.2y8_1.heavy 553.284 / 890.421 5501.0 21.74209976196289 47 17 10 10 10 3.1417053674904074 25.305430858104735 0.0 3 0.9787033970219805 8.441768253936445 5501.0 53.719043179457124 0.0 - - - - - - - 133.69565217391303 11 23 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 621 79 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17863.[MT7]-ATVDADDVR.2y5_1.heavy 553.284 / 575.278 9573.0 21.74209976196289 47 17 10 10 10 3.1417053674904074 25.305430858104735 0.0 3 0.9787033970219805 8.441768253936445 9573.0 54.03787923900656 0.0 - - - - - - - 214.11764705882354 19 17 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 623 79 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17863.[MT7]-ATVDADDVR.2b4_1.heavy 553.284 / 531.289 12865.0 21.74209976196289 47 17 10 10 10 3.1417053674904074 25.305430858104735 0.0 3 0.9787033970219805 8.441768253936445 12865.0 17.4525974025974 0.0 - - - - - - - 1272.375 25 8 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 625 79 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17863.[MT7]-ATVDADDVR.2b7_1.heavy 553.284 / 832.38 16850.0 21.74209976196289 47 17 10 10 10 3.1417053674904074 25.305430858104735 0.0 3 0.9787033970219805 8.441768253936445 16850.0 100.23589743589744 0.0 - - - - - - - 247.23529411764707 33 17 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 627 80 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17862.[MT7]-VQGTNLGK[MT7].2y4_1.heavy 552.834 / 575.363 1911.0 22.05620002746582 46 18 10 10 8 7.6604393033176095 13.054081631675047 0.0 4 0.9870567275057158 10.83604436203123 1911.0 3.375 1.0 - - - - - - - 219.0952380952381 5 21 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 629 80 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17862.[MT7]-VQGTNLGK[MT7].2y6_1.heavy 552.834 / 733.432 5370.0 22.05620002746582 46 18 10 10 8 7.6604393033176095 13.054081631675047 0.0 4 0.9870567275057158 10.83604436203123 5370.0 66.0923076923077 0.0 - - - - - - - 162.76190476190476 10 21 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 631 80 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17862.[MT7]-VQGTNLGK[MT7].2b5_1.heavy 552.834 / 644.348 1729.0 22.05620002746582 46 18 10 10 8 7.6604393033176095 13.054081631675047 0.0 4 0.9870567275057158 10.83604436203123 1729.0 5.486829268292683 0.0 - - - - - - - 174.70833333333334 3 24 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 633 80 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17862.[MT7]-VQGTNLGK[MT7].2y7_1.heavy 552.834 / 861.491 6189.0 22.05620002746582 46 18 10 10 8 7.6604393033176095 13.054081631675047 0.0 4 0.9870567275057158 10.83604436203123 6189.0 33.79188703465982 0.0 - - - - - - - 166.45 12 20 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 635 81 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542960.[MT7]-VRFPSHFSSDLK[MT7].4y4_1.heavy 427.741 / 606.358 6016.0 31.052425384521484 36 12 10 6 8 3.301202051675193 30.29199619855291 0.0326995849609375 4 0.8943099512893183 3.7622176600370194 6016.0 5.208197879858656 1.0 - - - - - - - 0.0 12 0 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 637 81 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542960.[MT7]-VRFPSHFSSDLK[MT7].4b5_1.heavy 427.741 / 731.432 2406.0 31.052425384521484 36 12 10 6 8 3.301202051675193 30.29199619855291 0.0326995849609375 4 0.8943099512893183 3.7622176600370194 2406.0 30.49859154929577 1.0 - - - - - - - 0.0 5 0 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 639 81 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542960.[MT7]-VRFPSHFSSDLK[MT7].4y3_1.heavy 427.741 / 519.326 9130.0 31.052425384521484 36 12 10 6 8 3.301202051675193 30.29199619855291 0.0326995849609375 4 0.8943099512893183 3.7622176600370194 9130.0 -0.6581603229527105 2.0 - - - - - - - 0.0 28 0 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 641 81 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542960.[MT7]-VRFPSHFSSDLK[MT7].4b6_2.heavy 427.741 / 434.749 22578.0 31.052425384521484 36 12 10 6 8 3.301202051675193 30.29199619855291 0.0326995849609375 4 0.8943099512893183 3.7622176600370194 22578.0 75.79187279151942 1.0 - - - - - - - 0.0 45 0 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 643 82 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544074.[MT7]-IGGGPGDAADVQRHPFFR.4y4_1.heavy 511.018 / 566.308 7946.0 30.574049949645996 42 16 10 6 10 28.437328603389123 3.516504710927106 0.033000946044921875 3 0.9691698751322929 7.01055801729133 7946.0 23.511341531391725 0.0 - - - - - - - 709.8181818181819 15 11 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 645 82 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544074.[MT7]-IGGGPGDAADVQRHPFFR.4b7_1.heavy 511.018 / 698.359 12989.0 30.574049949645996 42 16 10 6 10 28.437328603389123 3.516504710927106 0.033000946044921875 3 0.9691698751322929 7.01055801729133 12989.0 53.26097869162601 0.0 - - - - - - - 276.3636363636364 25 22 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 647 82 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544074.[MT7]-IGGGPGDAADVQRHPFFR.4y10_2.heavy 511.018 / 636.833 10502.0 30.574049949645996 42 16 10 6 10 28.437328603389123 3.516504710927106 0.033000946044921875 3 0.9691698751322929 7.01055801729133 10502.0 39.824304394426576 0.0 - - - - - - - 292.47058823529414 21 17 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 649 82 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544074.[MT7]-IGGGPGDAADVQRHPFFR.4y11_2.heavy 511.018 / 672.352 10087.0 30.574049949645996 42 16 10 6 10 28.437328603389123 3.516504710927106 0.033000946044921875 3 0.9691698751322929 7.01055801729133 10087.0 21.369805037028414 0.0 - - - - - - - 308.8235294117647 20 17 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 651 83 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18335.[MT7]-RIFEYDFLSVEDMFK[MT7].4y4_1.heavy 557.539 / 684.351 1680.0 49.28300094604492 45 15 10 10 10 1.811253220856819 42.48265170245319 0.0 3 0.957653150172526 5.9759532673478715 1680.0 54.75774358974358 0.0 - - - - - - - 146.11111111111111 3 9 ACOX3 acyl-CoA oxidase 3, pristanoyl 653 83 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18335.[MT7]-RIFEYDFLSVEDMFK[MT7].4b7_1.heavy 557.539 / 1115.56 363.0 49.28300094604492 45 15 10 10 10 1.811253220856819 42.48265170245319 0.0 3 0.957653150172526 5.9759532673478715 363.0 7.921466666666666 1.0 - - - - - - - 0.0 1 0 ACOX3 acyl-CoA oxidase 3, pristanoyl 655 83 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18335.[MT7]-RIFEYDFLSVEDMFK[MT7].4b4_1.heavy 557.539 / 690.406 908.0 49.28300094604492 45 15 10 10 10 1.811253220856819 42.48265170245319 0.0 3 0.957653150172526 5.9759532673478715 908.0 12.106666666666666 0.0 - - - - - - - 0.0 1 0 ACOX3 acyl-CoA oxidase 3, pristanoyl 657 83 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18335.[MT7]-RIFEYDFLSVEDMFK[MT7].4b6_1.heavy 557.539 / 968.496 3179.0 49.28300094604492 45 15 10 10 10 1.811253220856819 42.48265170245319 0.0 3 0.957653150172526 5.9759532673478715 3179.0 93.64658608058608 0.0 - - - - - - - 147.5 6 8 ACOX3 acyl-CoA oxidase 3, pristanoyl 659 84 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17868.[MT7]-GFGFGLVK[MT7].2y4_1.heavy 556.839 / 560.389 13123.0 38.883399963378906 44 14 10 10 10 1.8662442705686773 42.68616146047172 0.0 3 0.9485538272443654 5.417589821454822 13123.0 9.526308911461806 0.0 - - - - - - - 313.5 26 10 VDAC2 voltage-dependent anion channel 2 661 84 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17868.[MT7]-GFGFGLVK[MT7].2b4_1.heavy 556.839 / 553.289 6276.0 38.883399963378906 44 14 10 10 10 1.8662442705686773 42.68616146047172 0.0 3 0.9485538272443654 5.417589821454822 6276.0 6.065438157235853 0.0 - - - - - - - 295.55555555555554 12 9 VDAC2 voltage-dependent anion channel 2 663 84 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17868.[MT7]-GFGFGLVK[MT7].2b6_1.heavy 556.839 / 723.395 7132.0 38.883399963378906 44 14 10 10 10 1.8662442705686773 42.68616146047172 0.0 3 0.9485538272443654 5.417589821454822 7132.0 65.31410526315788 0.0 - - - - - - - 215.9090909090909 14 11 VDAC2 voltage-dependent anion channel 2 665 84 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17868.[MT7]-GFGFGLVK[MT7].2b5_1.heavy 556.839 / 610.311 7893.0 38.883399963378906 44 14 10 10 10 1.8662442705686773 42.68616146047172 0.0 3 0.9485538272443654 5.417589821454822 7893.0 17.600424761160635 0.0 - - - - - - - 207.27272727272728 15 11 VDAC2 voltage-dependent anion channel 2 667 85 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18336.[MT7]-RIFEYDFLSVEDMFK[MT7].3y3_1.heavy 743.05 / 569.324 3259.0 49.28300094604492 44 14 10 10 10 3.07235465093366 32.54832575061311 0.0 3 0.9432763393283768 5.15710124934311 3259.0 11.063212425862389 0.0 - - - - - - - 221.68421052631578 6 19 ACOX3 acyl-CoA oxidase 3, pristanoyl 669 85 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18336.[MT7]-RIFEYDFLSVEDMFK[MT7].3b6_1.heavy 743.05 / 968.496 4346.0 49.28300094604492 44 14 10 10 10 3.07235465093366 32.54832575061311 0.0 3 0.9432763393283768 5.15710124934311 4346.0 44.18033149171271 0.0 - - - - - - - 126.7 8 20 ACOX3 acyl-CoA oxidase 3, pristanoyl 671 85 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18336.[MT7]-RIFEYDFLSVEDMFK[MT7].3b4_1.heavy 743.05 / 690.406 679.0 49.28300094604492 44 14 10 10 10 3.07235465093366 32.54832575061311 0.0 3 0.9432763393283768 5.15710124934311 679.0 1.372748077131405 4.0 - - - - - - - 221.1764705882353 2 17 ACOX3 acyl-CoA oxidase 3, pristanoyl 673 85 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18336.[MT7]-RIFEYDFLSVEDMFK[MT7].3y4_1.heavy 743.05 / 684.351 2445.0 49.28300094604492 44 14 10 10 10 3.07235465093366 32.54832575061311 0.0 3 0.9432763393283768 5.15710124934311 2445.0 9.852044198895026 0.0 - - - - - - - 253.55 4 20 ACOX3 acyl-CoA oxidase 3, pristanoyl 675 86 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544547.[MT7]-FEVSSVADC[CAM]LDSAVALAAYK[MT7].4y4_1.heavy 601.813 / 596.352 5136.0 47.442599296569824 32 11 6 7 8 0.7864160312529164 63.82489078153583 0.027599334716796875 4 0.8739649470490592 3.4391104129693626 5136.0 45.653333333333336 0.0 - - - - - - - 153.46153846153845 10 13 ACOX3 acyl-CoA oxidase 3, pristanoyl 677 86 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544547.[MT7]-FEVSSVADC[CAM]LDSAVALAAYK[MT7].4b5_1.heavy 601.813 / 694.353 1255.0 47.442599296569824 32 11 6 7 8 0.7864160312529164 63.82489078153583 0.027599334716796875 4 0.8739649470490592 3.4391104129693626 1255.0 24.989912280701752 0.0 - - - - - - - 119.7 2 10 ACOX3 acyl-CoA oxidase 3, pristanoyl 679 86 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544547.[MT7]-FEVSSVADC[CAM]LDSAVALAAYK[MT7].4y3_1.heavy 601.813 / 525.315 6163.0 47.442599296569824 32 11 6 7 8 0.7864160312529164 63.82489078153583 0.027599334716796875 4 0.8739649470490592 3.4391104129693626 6163.0 27.391111111111112 1.0 - - - - - - - 167.83333333333334 17 18 ACOX3 acyl-CoA oxidase 3, pristanoyl 681 86 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544547.[MT7]-FEVSSVADC[CAM]LDSAVALAAYK[MT7].4b3_1.heavy 601.813 / 520.289 1826.0 47.442599296569824 32 11 6 7 8 0.7864160312529164 63.82489078153583 0.027599334716796875 4 0.8739649470490592 3.4391104129693626 1826.0 32.03508771929825 0.0 - - - - - - - 176.42857142857142 3 21 ACOX3 acyl-CoA oxidase 3, pristanoyl 683 87 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17866.[MT7]-DFLLDIAR.2b3_1.heavy 553.82 / 520.289 9260.0 42.80905055999756 41 15 10 6 10 1.9226821224523285 34.802765850098176 0.037799835205078125 3 0.9557998775132087 5.848410588731644 9260.0 41.91774286873056 0.0 - - - - - - - 211.06666666666666 18 15 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 685 87 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17866.[MT7]-DFLLDIAR.2y6_1.heavy 553.82 / 700.435 3818.0 42.80905055999756 41 15 10 6 10 1.9226821224523285 34.802765850098176 0.037799835205078125 3 0.9557998775132087 5.848410588731644 3818.0 21.11977845288989 0.0 - - - - - - - 196.08333333333334 7 12 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 687 87 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17866.[MT7]-DFLLDIAR.2b5_1.heavy 553.82 / 748.4 14134.0 42.80905055999756 41 15 10 6 10 1.9226821224523285 34.802765850098176 0.037799835205078125 3 0.9557998775132087 5.848410588731644 14134.0 182.59507034755492 0.0 - - - - - - - 243.45454545454547 28 11 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 689 87 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17866.[MT7]-DFLLDIAR.2y7_1.heavy 553.82 / 847.504 8936.0 42.80905055999756 41 15 10 6 10 1.9226821224523285 34.802765850098176 0.037799835205078125 3 0.9557998775132087 5.848410588731644 8936.0 206.30024691358022 0.0 - - - - - - - 127.42857142857143 17 7 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 691 88 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18338.[MT7]-AVGPHQFLGDQEAIQAAIK[MT7].3b6_1.heavy 761.09 / 734.407 2841.0 36.21862506866455 33 10 10 5 8 1.2123812115439472 57.95861140280581 0.047100067138671875 4 0.849479624805754 3.1402217878752046 2841.0 6.406976744186046 1.0 - - - - - - - 180.6 5 5 BPGM 2,3-bisphosphoglycerate mutase 693 88 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18338.[MT7]-AVGPHQFLGDQEAIQAAIK[MT7].3b5_1.heavy 761.09 / 606.348 4261.0 36.21862506866455 33 10 10 5 8 1.2123812115439472 57.95861140280581 0.047100067138671875 4 0.849479624805754 3.1402217878752046 4261.0 5.877829769550434 1.0 - - - - - - - 361.2 10 5 BPGM 2,3-bisphosphoglycerate mutase 695 88 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18338.[MT7]-AVGPHQFLGDQEAIQAAIK[MT7].3y4_1.heavy 761.09 / 546.373 11364.0 36.21862506866455 33 10 10 5 8 1.2123812115439472 57.95861140280581 0.047100067138671875 4 0.849479624805754 3.1402217878752046 11364.0 40.88402321083172 0.0 - - - - - - - 258.0 22 7 BPGM 2,3-bisphosphoglycerate mutase 697 88 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18338.[MT7]-AVGPHQFLGDQEAIQAAIK[MT7].3b7_1.heavy 761.09 / 881.475 904.0 36.21862506866455 33 10 10 5 8 1.2123812115439472 57.95861140280581 0.047100067138671875 4 0.849479624805754 3.1402217878752046 904.0 -0.2573932218564148 5.0 - - - - - - - 258.0 4 8 BPGM 2,3-bisphosphoglycerate mutase 699 89 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543528.[MT7]-DTEQEESVNEFLAK[MT7].3b6_1.heavy 642.989 / 876.37 17494.0 35.21799850463867 44 14 10 10 10 1.2796384131179295 54.24565088357227 0.0 3 0.9360246304297569 4.853030009875047 17494.0 143.3575881590395 1.0 - - - - - - - 306.5 38 8 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 701 89 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543528.[MT7]-DTEQEESVNEFLAK[MT7].3b4_1.heavy 642.989 / 618.285 25308.0 35.21799850463867 44 14 10 10 10 1.2796384131179295 54.24565088357227 0.0 3 0.9360246304297569 4.853030009875047 25308.0 54.00776397941681 0.0 - - - - - - - 350.22222222222223 50 9 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 703 89 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543528.[MT7]-DTEQEESVNEFLAK[MT7].3b5_1.heavy 642.989 / 747.328 17611.0 35.21799850463867 44 14 10 10 10 1.2796384131179295 54.24565088357227 0.0 3 0.9360246304297569 4.853030009875047 17611.0 63.8433598642479 0.0 - - - - - - - 256.6 35 10 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 705 89 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543528.[MT7]-DTEQEESVNEFLAK[MT7].3y4_1.heavy 642.989 / 622.404 29740.0 35.21799850463867 44 14 10 10 10 1.2796384131179295 54.24565088357227 0.0 3 0.9360246304297569 4.853030009875047 29740.0 98.10106087488529 0.0 - - - - - - - 318.27272727272725 59 11 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 707 90 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540535.[MT7]-LYEAVPQLSNVFK[MT7].3b4_1.heavy 599.345 / 621.336 14108.0 43.084299087524414 40 14 10 6 10 2.627081218193574 29.436576399038298 0.03839874267578125 3 0.9328122091871286 4.734292240557838 14108.0 55.99227490871153 0.0 - - - - - - - 243.0 28 13 CDC7 cell division cycle 7 homolog (S. cerevisiae) 709 90 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540535.[MT7]-LYEAVPQLSNVFK[MT7].3b5_1.heavy 599.345 / 720.405 14270.0 43.084299087524414 40 14 10 6 10 2.627081218193574 29.436576399038298 0.03839874267578125 3 0.9328122091871286 4.734292240557838 14270.0 45.63487407495822 0.0 - - - - - - - 279.8181818181818 28 11 CDC7 cell division cycle 7 homolog (S. cerevisiae) 711 90 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540535.[MT7]-LYEAVPQLSNVFK[MT7].3b3_1.heavy 599.345 / 550.299 5838.0 43.084299087524414 40 14 10 6 10 2.627081218193574 29.436576399038298 0.03839874267578125 3 0.9328122091871286 4.734292240557838 5838.0 27.244 0.0 - - - - - - - 266.14285714285717 11 14 CDC7 cell division cycle 7 homolog (S. cerevisiae) 713 90 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540535.[MT7]-LYEAVPQLSNVFK[MT7].3y5_1.heavy 599.345 / 738.427 7297.0 43.084299087524414 40 14 10 6 10 2.627081218193574 29.436576399038298 0.03839874267578125 3 0.9328122091871286 4.734292240557838 7297.0 35.65920781893004 0.0 - - - - - - - 255.46153846153845 14 13 CDC7 cell division cycle 7 homolog (S. cerevisiae) 715 91 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587967.[MT7]-LLPYWNER.3y3_1.heavy 412.228 / 418.204 52498.0 39.700401306152344 40 10 10 10 10 0.5639292964161182 83.39051367501158 0.0 3 0.8474661062714517 3.118872336394147 52498.0 85.20984241551854 0.0 - - - - - - - 180.0 104 8 BPGM 2,3-bisphosphoglycerate mutase 717 91 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587967.[MT7]-LLPYWNER.3b4_1.heavy 412.228 / 631.394 18460.0 39.700401306152344 40 10 10 10 10 0.5639292964161182 83.39051367501158 0.0 3 0.8474661062714517 3.118872336394147 18460.0 150.24388888888888 0.0 - - - - - - - 244.28571428571428 36 14 BPGM 2,3-bisphosphoglycerate mutase 719 91 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587967.[MT7]-LLPYWNER.3y4_1.heavy 412.228 / 604.284 15128.0 39.700401306152344 40 10 10 10 10 0.5639292964161182 83.39051367501158 0.0 3 0.8474661062714517 3.118872336394147 15128.0 70.59546671602197 0.0 - - - - - - - 225.0 30 8 BPGM 2,3-bisphosphoglycerate mutase 721 91 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587967.[MT7]-LLPYWNER.3y5_1.heavy 412.228 / 767.347 4863.0 39.700401306152344 40 10 10 10 10 0.5639292964161182 83.39051367501158 0.0 3 0.8474661062714517 3.118872336394147 4863.0 62.13833333333333 0.0 - - - - - - - 216.0 9 10 BPGM 2,3-bisphosphoglycerate mutase 723 92 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 401086.0 38.58319854736328 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 401086.0 410.2466898583105 0.0 - - - - - - - 222.5 802 6 725 92 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 181434.0 38.58319854736328 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 181434.0 1001.0631126173097 0.0 - - - - - - - 267.0 362 5 727 92 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 444338.0 38.58319854736328 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 444338.0 1311.3435965402068 0.0 - - - - - - - 161.57142857142858 888 7 729 93 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17880.[MT7]-NILEEVK[MT7].2y4_1.heavy 566.844 / 648.369 3757.0 33.77020072937012 36 14 10 6 6 2.489191580154474 34.54654959435965 0.034999847412109375 5 0.9460470700026624 5.2891103039906495 3757.0 8.138879407315464 0.0 - - - - - - - 214.61111111111111 7 18 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 731 93 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17880.[MT7]-NILEEVK[MT7].2y5_1.heavy 566.844 / 761.453 5178.0 33.77020072937012 36 14 10 6 6 2.489191580154474 34.54654959435965 0.034999847412109375 5 0.9460470700026624 5.2891103039906495 5178.0 52.31265430310055 0.0 - - - - - - - 169.5 10 12 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 733 93 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17880.[MT7]-NILEEVK[MT7].2y3_1.heavy 566.844 / 519.326 1929.0 33.77020072937012 36 14 10 6 6 2.489191580154474 34.54654959435965 0.034999847412109375 5 0.9460470700026624 5.2891103039906495 1929.0 1.7484532019704435 4.0 - - - - - - - 623.7142857142857 6 7 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 735 93 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17880.[MT7]-NILEEVK[MT7].2b5_1.heavy 566.844 / 743.406 914.0 33.77020072937012 36 14 10 6 6 2.489191580154474 34.54654959435965 0.034999847412109375 5 0.9460470700026624 5.2891103039906495 914.0 6.272549019607843 6.0 - - - - - - - 638.2857142857143 4 7 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 737 94 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18311.[MT7]-IFEYDFLSVEDMFK[MT7].3y3_1.heavy 691.016 / 569.324 582.0 53.7144250869751 35 10 10 5 10 0.9843190492903928 67.03475954032841 0.045299530029296875 3 0.8285416082306875 2.936789949791093 582.0 6.466666666666666 1.0 - - - - - - - 0.0 1 0 ACOX3 acyl-CoA oxidase 3, pristanoyl 739 94 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18311.[MT7]-IFEYDFLSVEDMFK[MT7].3y5_1.heavy 691.016 / 813.393 865.0 53.7144250869751 35 10 10 5 10 0.9843190492903928 67.03475954032841 0.045299530029296875 3 0.8285416082306875 2.936789949791093 865.0 48.68397435897435 0.0 - - - - - - - 0.0 1 0 ACOX3 acyl-CoA oxidase 3, pristanoyl 741 94 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18311.[MT7]-IFEYDFLSVEDMFK[MT7].3b5_1.heavy 691.016 / 812.395 763.0 53.7144250869751 35 10 10 5 10 0.9843190492903928 67.03475954032841 0.045299530029296875 3 0.8285416082306875 2.936789949791093 763.0 46.856025641025646 0.0 - - - - - - - 0.0 1 0 ACOX3 acyl-CoA oxidase 3, pristanoyl 743 94 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18311.[MT7]-IFEYDFLSVEDMFK[MT7].3b3_1.heavy 691.016 / 534.304 448.0 53.7144250869751 35 10 10 5 10 0.9843190492903928 67.03475954032841 0.045299530029296875 3 0.8285416082306875 2.936789949791093 448.0 1.9055897175089005 2.0 - - - - - - - 0.0 1 0 ACOX3 acyl-CoA oxidase 3, pristanoyl 745 95 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18312.[MT7]-WFATTDWIAIYQRK[MT7].3b6_1.heavy 696.382 / 866.417 3657.0 44.8922004699707 35 17 2 6 10 3.7128270140839152 26.933654495797594 0.037200927734375 3 0.9784862737595017 8.398908573091443 3657.0 26.676666666666666 0.0 - - - - - - - 215.11764705882354 7 17 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 747 95 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18312.[MT7]-WFATTDWIAIYQRK[MT7].3y6_1.heavy 696.382 / 922.559 7797.0 44.8922004699707 35 17 2 6 10 3.7128270140839152 26.933654495797594 0.037200927734375 3 0.9784862737595017 8.398908573091443 7797.0 103.395 0.0 - - - - - - - 138.0 15 13 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 749 95 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18312.[MT7]-WFATTDWIAIYQRK[MT7].3b3_1.heavy 696.382 / 549.294 2415.0 44.8922004699707 35 17 2 6 10 3.7128270140839152 26.933654495797594 0.037200927734375 3 0.9784862737595017 8.398908573091443 2415.0 4.132692307692308 2.0 - - - - - - - 745.2 33 10 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 751 95 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18312.[MT7]-WFATTDWIAIYQRK[MT7].3y4_1.heavy 696.382 / 738.438 3174.0 44.8922004699707 35 17 2 6 10 3.7128270140839152 26.933654495797594 0.037200927734375 3 0.9784862737595017 8.398908573091443 3174.0 12.317777777777776 0.0 - - - - - - - 221.52631578947367 6 19 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 753 96 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542998.[MT7]-EAISLVC[CAM]EAVPGAK[MT7].3b6_1.heavy 577.99 / 757.458 5682.0 36.545501708984375 48 18 10 10 10 4.6052863307538 21.71417645244044 0.0 3 0.9847338062183154 9.975689649812967 5682.0 5.120242694316223 1.0 - - - - - - - 258.0 14 9 SHC1 SHC (Src homology 2 domain containing) transforming protein 1 755 96 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542998.[MT7]-EAISLVC[CAM]EAVPGAK[MT7].3b4_1.heavy 577.99 / 545.305 5424.0 36.545501708984375 48 18 10 10 10 4.6052863307538 21.71417645244044 0.0 3 0.9847338062183154 9.975689649812967 5424.0 11.654456890506246 0.0 - - - - - - - 309.6 10 15 SHC1 SHC (Src homology 2 domain containing) transforming protein 1 757 96 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542998.[MT7]-EAISLVC[CAM]EAVPGAK[MT7].3b5_1.heavy 577.99 / 658.389 8135.0 36.545501708984375 48 18 10 10 10 4.6052863307538 21.71417645244044 0.0 3 0.9847338062183154 9.975689649812967 8135.0 32.42392124579818 0.0 - - - - - - - 215.0 16 9 SHC1 SHC (Src homology 2 domain containing) transforming protein 1 759 96 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542998.[MT7]-EAISLVC[CAM]EAVPGAK[MT7].3y4_1.heavy 577.99 / 516.326 36932.0 36.545501708984375 48 18 10 10 10 4.6052863307538 21.71417645244044 0.0 3 0.9847338062183154 9.975689649812967 36932.0 91.40793953258994 0.0 - - - - - - - 681.1818181818181 73 11 SHC1 SHC (Src homology 2 domain containing) transforming protein 1 761 97 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18302.[MT7]-K[MT7]LAPITYPQGLALAK[MT7].4y4_1.heavy 504.82 / 546.373 54543.0 36.0890007019043 39 9 10 10 10 1.0241591238184558 62.7069424683591 0.0 3 0.80729333361125 2.7648994523435033 54543.0 76.71790717100166 0.0 - - - - - - - 735.1428571428571 109 7 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 763 97 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18302.[MT7]-K[MT7]LAPITYPQGLALAK[MT7].4b7_1.heavy 504.82 / 1075.68 N/A 36.0890007019043 39 9 10 10 10 1.0241591238184558 62.7069424683591 0.0 3 0.80729333361125 2.7648994523435033 0.0 0.0 2.0 - - - - - - - 0.0 0 0 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 765 97 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18302.[MT7]-K[MT7]LAPITYPQGLALAK[MT7].4b6_1.heavy 504.82 / 912.612 5917.0 36.0890007019043 39 9 10 10 10 1.0241591238184558 62.7069424683591 0.0 3 0.80729333361125 2.7648994523435033 5917.0 42.13272373540856 0.0 - - - - - - - 238.71428571428572 11 7 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 767 97 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18302.[MT7]-K[MT7]LAPITYPQGLALAK[MT7].4b3_1.heavy 504.82 / 601.427 19553.0 36.0890007019043 39 9 10 10 10 1.0241591238184558 62.7069424683591 0.0 3 0.80729333361125 2.7648994523435033 19553.0 28.139723630970906 0.0 - - - - - - - 278.8333333333333 39 6 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 769 98 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540852.[MT7]-GAESVTEEK[MT7].3y3_1.heavy 413.222 / 549.3 18628.0 19.878599166870117 50 20 10 10 10 5.493426390660333 18.203575125720324 0.0 3 0.9934777413577571 15.273094191865313 18628.0 76.27927950688107 0.0 - - - - - - - 319.8666666666667 37 15 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 771 98 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540852.[MT7]-GAESVTEEK[MT7].3b4_1.heavy 413.222 / 489.242 30227.0 19.878599166870117 50 20 10 10 10 5.493426390660333 18.203575125720324 0.0 3 0.9934777413577571 15.273094191865313 30227.0 69.04756740014793 0.0 - - - - - - - 691.3157894736842 60 19 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 773 98 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540852.[MT7]-GAESVTEEK[MT7].3b5_1.heavy 413.222 / 588.311 8219.0 19.878599166870117 50 20 10 10 10 5.493426390660333 18.203575125720324 0.0 3 0.9934777413577571 15.273094191865313 8219.0 30.15159923876493 0.0 - - - - - - - 242.15384615384616 16 26 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 775 98 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540852.[MT7]-GAESVTEEK[MT7].3y4_1.heavy 413.222 / 650.348 12521.0 19.878599166870117 50 20 10 10 10 5.493426390660333 18.203575125720324 0.0 3 0.9934777413577571 15.273094191865313 12521.0 45.31815881866997 0.0 - - - - - - - 204.36 25 25 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 777 99 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542990.[MT7]-VLVSGLQGLGAEVAK[MT7].3b6_1.heavy 577.02 / 713.468 21062.0 40.14699935913086 47 17 10 10 10 2.9552647881324225 26.707985914386974 0.0 3 0.9730698910572643 7.503499077562207 21062.0 345.9776512987896 0.0 - - - - - - - 226.28571428571428 42 14 UBA7 ubiquitin-like modifier activating enzyme 7 779 99 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542990.[MT7]-VLVSGLQGLGAEVAK[MT7].3y6_1.heavy 577.02 / 718.422 49488.0 40.14699935913086 47 17 10 10 10 2.9552647881324225 26.707985914386974 0.0 3 0.9730698910572643 7.503499077562207 49488.0 332.7168631066718 0.0 - - - - - - - 209.11111111111111 98 9 UBA7 ubiquitin-like modifier activating enzyme 7 781 99 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542990.[MT7]-VLVSGLQGLGAEVAK[MT7].3b5_1.heavy 577.02 / 600.384 36817.0 40.14699935913086 47 17 10 10 10 2.9552647881324225 26.707985914386974 0.0 3 0.9730698910572643 7.503499077562207 36817.0 216.95708234844903 0.0 - - - - - - - 251.4375 73 16 UBA7 ubiquitin-like modifier activating enzyme 7 783 99 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542990.[MT7]-VLVSGLQGLGAEVAK[MT7].3b8_1.heavy 577.02 / 898.548 22604.0 40.14699935913086 47 17 10 10 10 2.9552647881324225 26.707985914386974 0.0 3 0.9730698910572643 7.503499077562207 22604.0 303.5401304064334 0.0 - - - - - - - 228.33333333333334 45 9 UBA7 ubiquitin-like modifier activating enzyme 7 785 100 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588813.[MT7]-NQEIHLSPITLQPALSEAK[MT7].4y4_1.heavy 595.089 / 578.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTPRR protein tyrosine phosphatase, receptor type, R 787 100 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588813.[MT7]-NQEIHLSPITLQPALSEAK[MT7].4b4_1.heavy 595.089 / 629.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTPRR protein tyrosine phosphatase, receptor type, R 789 100 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588813.[MT7]-NQEIHLSPITLQPALSEAK[MT7].4b5_1.heavy 595.089 / 766.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTPRR protein tyrosine phosphatase, receptor type, R 791 100 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588813.[MT7]-NQEIHLSPITLQPALSEAK[MT7].4b3_1.heavy 595.089 / 516.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTPRR protein tyrosine phosphatase, receptor type, R 793 101 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18108.[MT7]-VINQMLEFAFR.2y4_1.heavy 756.412 / 540.293 4391.0 50.250473976135254 46 20 10 6 10 10.492262001200018 9.530833293008012 0.032497406005859375 3 0.9913305330665969 13.244998521853866 4391.0 71.17965580341581 0.0 - - - - - - - 149.91304347826087 8 23 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 795 101 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18108.[MT7]-VINQMLEFAFR.2b4_1.heavy 756.412 / 599.363 5148.0 50.250473976135254 46 20 10 6 10 10.492262001200018 9.530833293008012 0.032497406005859375 3 0.9913305330665969 13.244998521853866 5148.0 56.014872280037835 0.0 - - - - - - - 144.54545454545453 10 22 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 797 101 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18108.[MT7]-VINQMLEFAFR.2y9_1.heavy 756.412 / 1155.56 8783.0 50.250473976135254 46 20 10 6 10 10.492262001200018 9.530833293008012 0.032497406005859375 3 0.9913305330665969 13.244998521853866 8783.0 92.45844620986428 0.0 - - - - - - - 143.52631578947367 17 19 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 799 101 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18108.[MT7]-VINQMLEFAFR.2y6_1.heavy 756.412 / 782.42 2801.0 50.250473976135254 46 20 10 6 10 10.492262001200018 9.530833293008012 0.032497406005859375 3 0.9913305330665969 13.244998521853866 2801.0 16.824488448844885 0.0 - - - - - - - 162.08 5 25 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 801 102 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543514.[MT7]-AC[CAM]QEQIEALLESSLR.3y6_1.heavy 630.995 / 704.394 28024.0 45.33340072631836 44 14 10 10 10 1.8671291871316713 45.97691942187599 0.0 3 0.9424729681650567 5.120614728766341 28024.0 88.96507936507936 0.0 - - - - - - - 637.7142857142857 56 7 CCND1 cyclin D1 803 102 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543514.[MT7]-AC[CAM]QEQIEALLESSLR.3b5_1.heavy 630.995 / 761.337 40559.0 45.33340072631836 44 14 10 10 10 1.8671291871316713 45.97691942187599 0.0 3 0.9424729681650567 5.120614728766341 40559.0 271.3321990740741 0.0 - - - - - - - 170.1818181818182 81 11 CCND1 cyclin D1 805 102 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543514.[MT7]-AC[CAM]QEQIEALLESSLR.3y8_1.heavy 630.995 / 888.515 17074.0 45.33340072631836 44 14 10 10 10 1.8671291871316713 45.97691942187599 0.0 3 0.9424729681650567 5.120614728766341 17074.0 173.7042361111111 0.0 - - - - - - - 148.8 34 15 CCND1 cyclin D1 807 102 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543514.[MT7]-AC[CAM]QEQIEALLESSLR.3y5_1.heavy 630.995 / 591.31 38037.0 45.33340072631836 44 14 10 10 10 1.8671291871316713 45.97691942187599 0.0 3 0.9424729681650567 5.120614728766341 38037.0 89.74361962908557 0.0 - - - - - - - 252.0 76 8 CCND1 cyclin D1 809 103 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17690.[MT7]-LLVGGK[MT7].2b3_1.heavy 437.802 / 470.346 14767.0 28.531200408935547 48 18 10 10 10 7.755024454051526 12.894865850198075 0.0 3 0.987063134378958 10.838733074014735 14767.0 30.75184649846062 1.0 - - - - - - - 1271.2857142857142 41 7 STAT5A;STAT5B;KIF3B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B;kinesin family member 3B 811 103 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17690.[MT7]-LLVGGK[MT7].2y4_1.heavy 437.802 / 504.326 33159.0 28.531200408935547 48 18 10 10 10 7.755024454051526 12.894865850198075 0.0 3 0.987063134378958 10.838733074014735 33159.0 43.6863462770723 0.0 - - - - - - - 767.7058823529412 66 17 STAT5A;STAT5B;KIF3B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B;kinesin family member 3B 813 103 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17690.[MT7]-LLVGGK[MT7].2y5_1.heavy 437.802 / 617.41 35203.0 28.531200408935547 48 18 10 10 10 7.755024454051526 12.894865850198075 0.0 3 0.987063134378958 10.838733074014735 35203.0 38.6828367816092 0.0 - - - - - - - 791.0 70 11 STAT5A;STAT5B;KIF3B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B;kinesin family member 3B 815 103 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17690.[MT7]-LLVGGK[MT7].2y3_1.heavy 437.802 / 405.258 46080.0 28.531200408935547 48 18 10 10 10 7.755024454051526 12.894865850198075 0.0 3 0.987063134378958 10.838733074014735 46080.0 36.932567243559006 1.0 - - - - - - - 817.4 92 5 STAT5A;STAT5B;KIF3B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B;kinesin family member 3B 817 104 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588053.[MT7]-K[MT7]ATVDADDVR.3y6_1.heavy 459.924 / 690.305 33673.0 19.8990740776062 41 14 10 7 10 1.6797829420548873 47.44930451310497 0.027299880981445312 3 0.9362382339869935 4.861240713173697 33673.0 96.34690034756893 0.0 - - - - - - - 681.2857142857143 67 14 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 819 104 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588053.[MT7]-K[MT7]ATVDADDVR.3b5_2.heavy 459.924 / 402.247 85943.0 19.8990740776062 41 14 10 7 10 1.6797829420548873 47.44930451310497 0.027299880981445312 3 0.9362382339869935 4.861240713173697 85943.0 64.05553447004363 0.0 - - - - - - - 2345.8571428571427 171 7 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 821 104 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588053.[MT7]-K[MT7]ATVDADDVR.3y5_1.heavy 459.924 / 575.278 22000.0 19.8990740776062 41 14 10 7 10 1.6797829420548873 47.44930451310497 0.027299880981445312 3 0.9362382339869935 4.861240713173697 22000.0 48.20675141581261 0.0 - - - - - - - 675.1875 44 16 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 823 104 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588053.[MT7]-K[MT7]ATVDADDVR.3b8_2.heavy 459.924 / 552.792 79731.0 19.8990740776062 41 14 10 7 10 1.6797829420548873 47.44930451310497 0.027299880981445312 3 0.9362382339869935 4.861240713173697 79731.0 104.38173567957114 0.0 - - - - - - - 1158.1818181818182 159 11 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 825 105 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17891.[MT7]-EATLELLGR.2y8_1.heavy 573.336 / 872.52 10332.0 36.36869812011719 47 17 10 10 10 44.86935387757793 2.2286926678917904 0.0 3 0.9714662061750537 7.2886063135464205 10332.0 150.5748837209302 0.0 - - - - - - - 177.375 20 8 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 827 105 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17891.[MT7]-EATLELLGR.2y5_1.heavy 573.336 / 587.351 1679.0 36.36869812011719 47 17 10 10 10 44.86935387757793 2.2286926678917904 0.0 3 0.9714662061750537 7.2886063135464205 1679.0 -0.23214263964221138 5.0 - - - - - - - 572.2857142857143 8 7 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 829 105 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17891.[MT7]-EATLELLGR.2y6_1.heavy 573.336 / 700.435 3487.0 36.36869812011719 47 17 10 10 10 44.86935387757793 2.2286926678917904 0.0 3 0.9714662061750537 7.2886063135464205 3487.0 19.009404995396867 0.0 - - - - - - - 215.0 6 9 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 831 105 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17891.[MT7]-EATLELLGR.2b5_1.heavy 573.336 / 688.363 6070.0 36.36869812011719 47 17 10 10 10 44.86935387757793 2.2286926678917904 0.0 3 0.9714662061750537 7.2886063135464205 6070.0 14.959612903225805 0.0 - - - - - - - 613.75 12 8 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 833 106 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588749.[MT7]-YLLHSLVFGSAVYSSGSER.3y7_1.heavy 739.387 / 785.342 9042.0 41.84617328643799 39 13 10 6 10 1.329373105563762 51.62253421089912 0.034099578857421875 3 0.9274021656224274 4.552368894384089 9042.0 37.4207830664803 0.0 - - - - - - - 305.375 18 16 ACOX3 acyl-CoA oxidase 3, pristanoyl 835 106 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588749.[MT7]-YLLHSLVFGSAVYSSGSER.3y11_1.heavy 739.387 / 1099.5 7983.0 41.84617328643799 39 13 10 6 10 1.329373105563762 51.62253421089912 0.034099578857421875 3 0.9274021656224274 4.552368894384089 7983.0 19.090717600236363 0.0 - - - - - - - 743.375 15 8 ACOX3 acyl-CoA oxidase 3, pristanoyl 837 106 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588749.[MT7]-YLLHSLVFGSAVYSSGSER.3b3_1.heavy 739.387 / 534.341 5784.0 41.84617328643799 39 13 10 6 10 1.329373105563762 51.62253421089912 0.034099578857421875 3 0.9274021656224274 4.552368894384089 5784.0 9.801315916857003 0.0 - - - - - - - 183.0 11 12 ACOX3 acyl-CoA oxidase 3, pristanoyl 839 106 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588749.[MT7]-YLLHSLVFGSAVYSSGSER.3y12_1.heavy 739.387 / 1246.57 4643.0 41.84617328643799 39 13 10 6 10 1.329373105563762 51.62253421089912 0.034099578857421875 3 0.9274021656224274 4.552368894384089 4643.0 9.367143568822287 0.0 - - - - - - - 263.52941176470586 9 17 ACOX3 acyl-CoA oxidase 3, pristanoyl 841 107 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17688.[MT7]-QSLLNR.2y4_1.heavy 437.765 / 515.33 6424.0 24.380650520324707 46 20 10 6 10 9.518321348060478 10.506054202548722 0.035800933837890625 3 0.9941351521994438 16.10725418216223 6424.0 8.955039591315453 0.0 - - - - - - - 718.9230769230769 12 13 ACOX3 acyl-CoA oxidase 3, pristanoyl 843 107 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17688.[MT7]-QSLLNR.2b3_1.heavy 437.765 / 473.284 17914.0 24.380650520324707 46 20 10 6 10 9.518321348060478 10.506054202548722 0.035800933837890625 3 0.9941351521994438 16.10725418216223 17914.0 27.331368588437833 0.0 - - - - - - - 1220.75 35 8 ACOX3 acyl-CoA oxidase 3, pristanoyl 845 107 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17688.[MT7]-QSLLNR.2y5_1.heavy 437.765 / 602.362 46325.0 24.380650520324707 46 20 10 6 10 9.518321348060478 10.506054202548722 0.035800933837890625 3 0.9941351521994438 16.10725418216223 46325.0 43.600070863470506 0.0 - - - - - - - 435.3333333333333 92 3 ACOX3 acyl-CoA oxidase 3, pristanoyl 847 107 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17688.[MT7]-QSLLNR.2b4_1.heavy 437.765 / 586.368 9662.0 24.380650520324707 46 20 10 6 10 9.518321348060478 10.506054202548722 0.035800933837890625 3 0.9941351521994438 16.10725418216223 9662.0 23.987486951173405 0.0 - - - - - - - 773.8181818181819 19 11 ACOX3 acyl-CoA oxidase 3, pristanoyl 849 108 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18313.[MT7]-RAQLQELLLQQIAFK[MT7].4b8_1.heavy 522.57 / 1096.66 N/A 43.5724983215332 39 9 10 10 10 1.086968926535418 57.01611111035939 0.0 3 0.8026694501357053 2.731179122156444 162.0 0.8 0.0 - - - - - - - 0.0 0 0 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 851 108 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18313.[MT7]-RAQLQELLLQQIAFK[MT7].4b7_1.heavy 522.57 / 983.575 15600.0 43.5724983215332 39 9 10 10 10 1.086968926535418 57.01611111035939 0.0 3 0.8026694501357053 2.731179122156444 15600.0 241.0556769884639 0.0 - - - - - - - 178.6 31 5 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 853 108 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18313.[MT7]-RAQLQELLLQQIAFK[MT7].4y3_1.heavy 522.57 / 509.32 169243.0 43.5724983215332 39 9 10 10 10 1.086968926535418 57.01611111035939 0.0 3 0.8026694501357053 2.731179122156444 169243.0 556.9066614870897 0.0 - - - - - - - 209.66666666666666 338 12 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 855 108 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18313.[MT7]-RAQLQELLLQQIAFK[MT7].4b6_1.heavy 522.57 / 870.491 30387.0 43.5724983215332 39 9 10 10 10 1.086968926535418 57.01611111035939 0.0 3 0.8026694501357053 2.731179122156444 30387.0 270.99841226472375 0.0 - - - - - - - 155.58333333333334 60 12 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 857 109 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17686.[MT7]-DPVNQR.2b3_1.heavy 436.739 / 456.258 1611.0 16.438724994659424 39 20 10 3 6 7.9333850306332705 12.60495987700948 0.06669998168945312 5 0.9973944585528458 24.172358908775124 1611.0 6.513003406131036 0.0 - - - - - - - 260.1304347826087 3 23 SHC4;SHC1 SHC (Src homology 2 domain containing) family, member 4;SHC (Src homology 2 domain containing) transforming protein 1 859 109 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17686.[MT7]-DPVNQR.2y4_1.heavy 436.739 / 516.289 650.0 16.438724994659424 39 20 10 3 6 7.9333850306332705 12.60495987700948 0.06669998168945312 5 0.9973944585528458 24.172358908775124 650.0 3.8999999999999995 16.0 - - - - - - - 0.0 1 0 SHC4;SHC1 SHC (Src homology 2 domain containing) family, member 4;SHC (Src homology 2 domain containing) transforming protein 1 861 109 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17686.[MT7]-DPVNQR.2y5_1.heavy 436.739 / 613.342 17035.0 16.438724994659424 39 20 10 3 6 7.9333850306332705 12.60495987700948 0.06669998168945312 5 0.9973944585528458 24.172358908775124 17035.0 149.8347311827957 0.0 - - - - - - - 197.42105263157896 34 19 SHC4;SHC1 SHC (Src homology 2 domain containing) family, member 4;SHC (Src homology 2 domain containing) transforming protein 1 863 109 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17686.[MT7]-DPVNQR.2y3_1.heavy 436.739 / 417.22 1363.0 16.438724994659424 39 20 10 3 6 7.9333850306332705 12.60495987700948 0.06669998168945312 5 0.9973944585528458 24.172358908775124 1363.0 1.3031995033112582 13.0 - - - - - - - 693.4666666666667 3 15 SHC4;SHC1 SHC (Src homology 2 domain containing) family, member 4;SHC (Src homology 2 domain containing) transforming protein 1 865 110 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18316.[MT7]-EAQTLQQYRVELAEK[MT7].3y6_1.heavy 698.719 / 832.49 2887.0 32.80699920654297 38 12 10 10 6 2.082466276218009 48.01998531357307 0.0 6 0.8957830548745165 3.7891976188907597 2887.0 7.713358778625954 0.0 - - - - - - - 213.55555555555554 5 18 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 867 110 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18316.[MT7]-EAQTLQQYRVELAEK[MT7].3b4_1.heavy 698.719 / 574.295 3062.0 32.80699920654297 38 12 10 10 6 2.082466276218009 48.01998531357307 0.0 6 0.8957830548745165 3.7891976188907597 3062.0 8.905816993464052 3.0 - - - - - - - 289.2307692307692 15 13 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 869 110 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18316.[MT7]-EAQTLQQYRVELAEK[MT7].3y14_2.heavy 698.719 / 911.003 12512.0 32.80699920654297 38 12 10 10 6 2.082466276218009 48.01998531357307 0.0 6 0.8957830548745165 3.7891976188907597 12512.0 78.31938931297711 0.0 - - - - - - - 167.33333333333334 25 12 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 871 110 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18316.[MT7]-EAQTLQQYRVELAEK[MT7].3y12_2.heavy 698.719 / 811.455 6737.0 32.80699920654297 38 12 10 10 6 2.082466276218009 48.01998531357307 0.0 6 0.8957830548745165 3.7891976188907597 6737.0 21.43007619047619 0.0 - - - - - - - 180.1875 13 16 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 873 111 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17889.[MT7]-HSQDIEK[MT7].2y6_1.heavy 572.814 / 863.459 799.0 16.747600078582764 39 16 10 3 10 4.520284891617054 22.122499443663763 0.06680107116699219 3 0.960850178205964 6.216848941910862 799.0 16.099253731343282 0.0 - - - - - - - 0.0 1 0 PTPRR protein tyrosine phosphatase, receptor type, R 875 111 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17889.[MT7]-HSQDIEK[MT7].2y4_1.heavy 572.814 / 648.369 133.0 16.747600078582764 39 16 10 3 10 4.520284891617054 22.122499443663763 0.06680107116699219 3 0.960850178205964 6.216848941910862 133.0 0.0 12.0 - - - - - - - 0.0 0 0 PTPRR protein tyrosine phosphatase, receptor type, R 877 111 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17889.[MT7]-HSQDIEK[MT7].2b4_1.heavy 572.814 / 612.286 466.0 16.747600078582764 39 16 10 3 10 4.520284891617054 22.122499443663763 0.06680107116699219 3 0.960850178205964 6.216848941910862 466.0 3.966255639097744 0.0 - - - - - - - 0.0 0 0 PTPRR protein tyrosine phosphatase, receptor type, R 879 111 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17889.[MT7]-HSQDIEK[MT7].2y3_1.heavy 572.814 / 533.341 766.0 16.747600078582764 39 16 10 3 10 4.520284891617054 22.122499443663763 0.06680107116699219 3 0.960850178205964 6.216848941910862 766.0 7.97378313253012 0.0 - - - - - - - 0.0 1 0 PTPRR protein tyrosine phosphatase, receptor type, R 881 112 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17884.[MT7]-VVFEQTK[MT7].2y4_1.heavy 569.839 / 649.364 2404.0 27.755499521891277 43 17 10 6 10 2.9703847201004954 33.66567277406974 0.03660011291503906 3 0.9735396400774331 7.570109892396982 2404.0 2.876581196581196 0.0 - - - - - - - 566.4285714285714 4 7 TPI1 triosephosphate isomerase 1 883 112 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17884.[MT7]-VVFEQTK[MT7].2y5_1.heavy 569.839 / 796.432 2599.0 27.755499521891277 43 17 10 6 10 2.9703847201004954 33.66567277406974 0.03660011291503906 3 0.9735396400774331 7.570109892396982 2599.0 18.392923076923076 0.0 - - - - - - - 130.0 5 17 TPI1 triosephosphate isomerase 1 885 112 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17884.[MT7]-VVFEQTK[MT7].2b4_1.heavy 569.839 / 619.357 N/A 27.755499521891277 43 17 10 6 10 2.9703847201004954 33.66567277406974 0.03660011291503906 3 0.9735396400774331 7.570109892396982 4289.0 27.99632967032967 0.0 - - - - - - - 222.3684210526316 8 19 TPI1 triosephosphate isomerase 1 887 112 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17884.[MT7]-VVFEQTK[MT7].2y6_1.heavy 569.839 / 895.5 2599.0 27.755499521891277 43 17 10 6 10 2.9703847201004954 33.66567277406974 0.03660011291503906 3 0.9735396400774331 7.570109892396982 2599.0 19.83236923076923 2.0 - - - - - - - 164.21052631578948 5 19 TPI1 triosephosphate isomerase 1 889 113 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17885.[MT7]-ARGDFLYR.2y4_1.heavy 571.315 / 598.335 4205.0 27.227049827575684 43 17 10 6 10 2.867264856668825 34.87644323035422 0.03230094909667969 3 0.9751850445624646 7.818139635097783 4205.0 12.489659720390398 0.0 - - - - - - - 176.94444444444446 8 18 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 891 113 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17885.[MT7]-ARGDFLYR.2b4_1.heavy 571.315 / 544.296 4332.0 27.227049827575684 43 17 10 6 10 2.867264856668825 34.87644323035422 0.03230094909667969 3 0.9751850445624646 7.818139635097783 4332.0 7.024332228504582 0.0 - - - - - - - 721.9166666666666 8 12 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 893 113 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17885.[MT7]-ARGDFLYR.2b6_1.heavy 571.315 / 804.448 2740.0 27.227049827575684 43 17 10 6 10 2.867264856668825 34.87644323035422 0.03230094909667969 3 0.9751850445624646 7.818139635097783 2740.0 48.7390931372549 0.0 - - - - - - - 154.78571428571428 5 14 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 895 113 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17885.[MT7]-ARGDFLYR.2b5_1.heavy 571.315 / 691.364 1274.0 27.227049827575684 43 17 10 6 10 2.867264856668825 34.87644323035422 0.03230094909667969 3 0.9751850445624646 7.818139635097783 1274.0 2.9976470588235293 0.0 - - - - - - - 183.1875 2 16 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 897 114 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18116.[MT7]-NLWGAVLQESK[MT7].2y8_1.heavy 766.937 / 975.559 N/A 39.04790115356445 27 3 10 10 4 0.3789147177169039 122.69598288892317 0.0 8 0.5117091697196888 1.6885543807131391 0.0 0.0 34.0 - - - - - - - 197.76470588235293 16 17 ACOX3 acyl-CoA oxidase 3, pristanoyl 899 114 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18116.[MT7]-NLWGAVLQESK[MT7].2y5_1.heavy 766.937 / 748.432 984.0 39.04790115356445 27 3 10 10 4 0.3789147177169039 122.69598288892317 0.0 8 0.5117091697196888 1.6885543807131391 984.0 1.08 11.0 - - - - - - - 676.5 11 8 ACOX3 acyl-CoA oxidase 3, pristanoyl 901 114 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18116.[MT7]-NLWGAVLQESK[MT7].2b4_1.heavy 766.937 / 615.337 17786.0 39.04790115356445 27 3 10 10 4 0.3789147177169039 122.69598288892317 0.0 8 0.5117091697196888 1.6885543807131391 17786.0 13.02473555736371 0.0 - - - - - - - 667.7142857142857 35 7 ACOX3 acyl-CoA oxidase 3, pristanoyl 903 114 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18116.[MT7]-NLWGAVLQESK[MT7].2b5_1.heavy 766.937 / 686.374 1639.0 39.04790115356445 27 3 10 10 4 0.3789147177169039 122.69598288892317 0.0 8 0.5117091697196888 1.6885543807131391 1639.0 9.49420731707317 3.0 - - - - - - - 230.625 6 16 ACOX3 acyl-CoA oxidase 3, pristanoyl 905 115 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 374010.0 35.70640182495117 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 374010.0 131.04384367873655 0.0 - - - - - - - 358.22222222222223 748 9 907 115 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 87120.0 35.70640182495117 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 87120.0 60.28074605129203 0.0 - - - - - - - 283.42857142857144 174 14 909 115 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 124794.0 35.70640182495117 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 124794.0 166.031396346565 0.0 - - - - - - - 761.2857142857143 249 7 911 116 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540037.[MT7]-TGISDALPSEEVLR.3y7_1.heavy 544.297 / 829.441 15612.0 35.70640182495117 46 16 10 10 10 2.0021851093000267 35.46386794093325 0.0 3 0.9652338523550527 6.599602196339456 15612.0 48.734452550066756 0.0 - - - - - - - 784.8571428571429 31 7 PTPRR protein tyrosine phosphatase, receptor type, R 913 116 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540037.[MT7]-TGISDALPSEEVLR.3y6_1.heavy 544.297 / 732.389 5620.0 35.70640182495117 46 16 10 10 10 2.0021851093000267 35.46386794093325 0.0 3 0.9652338523550527 6.599602196339456 5620.0 25.102666666666664 0.0 - - - - - - - 285.7142857142857 11 7 PTPRR protein tyrosine phosphatase, receptor type, R 915 116 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540037.[MT7]-TGISDALPSEEVLR.3b6_1.heavy 544.297 / 689.359 13614.0 35.70640182495117 46 16 10 10 10 2.0021851093000267 35.46386794093325 0.0 3 0.9652338523550527 6.599602196339456 13614.0 136.14000000000001 0.0 - - - - - - - 194.44444444444446 27 9 PTPRR protein tyrosine phosphatase, receptor type, R 917 116 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540037.[MT7]-TGISDALPSEEVLR.3b5_1.heavy 544.297 / 618.321 12115.0 35.70640182495117 46 16 10 10 10 2.0021851093000267 35.46386794093325 0.0 3 0.9652338523550527 6.599602196339456 12115.0 37.69939487179487 0.0 - - - - - - - 593.25 24 8 PTPRR protein tyrosine phosphatase, receptor type, R 919 117 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543315.[MT7]-FTVQMPTSQSPAVK[MT7].3b4_1.heavy 603.665 / 620.352 8732.0 33.61199951171875 41 18 10 3 10 3.622862021288342 21.844187446179447 0.07180023193359375 3 0.9834514413582411 9.580353748930344 8732.0 13.662666681992095 0.0 - - - - - - - 254.1 17 10 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 921 117 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543315.[MT7]-FTVQMPTSQSPAVK[MT7].3b5_1.heavy 603.665 / 751.393 5686.0 33.61199951171875 41 18 10 3 10 3.622862021288342 21.844187446179447 0.07180023193359375 3 0.9834514413582411 9.580353748930344 5686.0 55.601518124491164 0.0 - - - - - - - 739.8571428571429 11 7 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 923 117 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543315.[MT7]-FTVQMPTSQSPAVK[MT7].3y4_1.heavy 603.665 / 558.373 9544.0 33.61199951171875 41 18 10 3 10 3.622862021288342 21.844187446179447 0.07180023193359375 3 0.9834514413582411 9.580353748930344 9544.0 11.927699255615472 0.0 - - - - - - - 812.3333333333334 19 9 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 925 117 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543315.[MT7]-FTVQMPTSQSPAVK[MT7].3y5_1.heavy 603.665 / 645.405 2945.0 33.61199951171875 41 18 10 3 10 3.622862021288342 21.844187446179447 0.07180023193359375 3 0.9834514413582411 9.580353748930344 2945.0 3.8409480386861032 1.0 - - - - - - - 250.6 5 15 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 927 118 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544904.[MT7]-AAGLEPVGHYEEVELTETSVNVGPER.4b12_2.heavy 732.369 / 699.344 13938.0 36.412899017333984 44 14 10 10 10 1.4486693860968858 48.589447354768595 0.0 3 0.9442239181709545 5.201143067787989 13938.0 18.108862220573634 0.0 - - - - - - - 161.25 27 4 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 929 118 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544904.[MT7]-AAGLEPVGHYEEVELTETSVNVGPER.4b14_2.heavy 732.369 / 813.4 22972.0 36.412899017333984 44 14 10 10 10 1.4486693860968858 48.589447354768595 0.0 3 0.9442239181709545 5.201143067787989 22972.0 28.326821236069097 1.0 - - - - - - - 279.5 55 6 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 931 118 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544904.[MT7]-AAGLEPVGHYEEVELTETSVNVGPER.4b5_1.heavy 732.369 / 586.332 16390.0 36.412899017333984 44 14 10 10 10 1.4486693860968858 48.589447354768595 0.0 3 0.9442239181709545 5.201143067787989 16390.0 27.39954648117601 0.0 - - - - - - - 709.5 32 8 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 933 118 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544904.[MT7]-AAGLEPVGHYEEVELTETSVNVGPER.4y6_1.heavy 732.369 / 671.347 20907.0 36.412899017333984 44 14 10 10 10 1.4486693860968858 48.589447354768595 0.0 3 0.9442239181709545 5.201143067787989 20907.0 32.33063593187029 0.0 - - - - - - - 322.5 41 6 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 935 119 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587987.[MT7]-DALLNWLK[MT7].2y4_1.heavy 630.881 / 704.421 N/A 44.765000661214195 34 18 0 6 10 5.208917300901475 19.197847503298547 0.037197113037109375 3 0.9872640743335013 10.924085822126628 4506.0 36.008646288209604 1.0 - - - - - - - 218.07142857142858 68 14 PIK3CB;PIK3CD phosphoinositide-3-kinase, catalytic, beta polypeptide;phosphoinositide-3-kinase, catalytic, delta polypeptide 937 119 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587987.[MT7]-DALLNWLK[MT7].2b4_1.heavy 630.881 / 557.341 1909.0 44.765000661214195 34 18 0 6 10 5.208917300901475 19.197847503298547 0.037197113037109375 3 0.9872640743335013 10.924085822126628 1909.0 5.820885245901639 1.0 - - - - - - - 267.1111111111111 3 18 PIK3CB;PIK3CD phosphoinositide-3-kinase, catalytic, beta polypeptide;phosphoinositide-3-kinase, catalytic, delta polypeptide 939 119 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587987.[MT7]-DALLNWLK[MT7].2y3_1.heavy 630.881 / 590.378 1909.0 44.765000661214195 34 18 0 6 10 5.208917300901475 19.197847503298547 0.037197113037109375 3 0.9872640743335013 10.924085822126628 1909.0 6.415853128786666 0.0 - - - - - - - 250.27777777777777 3 18 PIK3CB;PIK3CD phosphoinositide-3-kinase, catalytic, beta polypeptide;phosphoinositide-3-kinase, catalytic, delta polypeptide 941 119 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587987.[MT7]-DALLNWLK[MT7].2b5_1.heavy 630.881 / 671.385 1909.0 44.765000661214195 34 18 0 6 10 5.208917300901475 19.197847503298547 0.037197113037109375 3 0.9872640743335013 10.924085822126628 1909.0 10.333015158096892 0.0 - - - - - - - 190.77777777777777 3 18 PIK3CB;PIK3CD phosphoinositide-3-kinase, catalytic, beta polypeptide;phosphoinositide-3-kinase, catalytic, delta polypeptide 943 120 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587989.[MT7]-IAPEVLRGK[MT7].3y7_1.heavy 424.274 / 942.585 N/A 28.385700225830078 50 20 10 10 10 8.183204683048533 12.220151379953807 0.0 3 0.9969729334729537 22.425481306678353 0.0 0.0 6.0 - - - - - - - 0.0 0 0 BPGM 2,3-bisphosphoglycerate mutase 945 120 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587989.[MT7]-IAPEVLRGK[MT7].3b4_1.heavy 424.274 / 555.326 12919.0 28.385700225830078 50 20 10 10 10 8.183204683048533 12.220151379953807 0.0 3 0.9969729334729537 22.425481306678353 12919.0 22.897650189992994 0.0 - - - - - - - 619.75 25 8 BPGM 2,3-bisphosphoglycerate mutase 947 120 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587989.[MT7]-IAPEVLRGK[MT7].3y7_2.heavy 424.274 / 471.796 31254.0 28.385700225830078 50 20 10 10 10 8.183204683048533 12.220151379953807 0.0 3 0.9969729334729537 22.425481306678353 31254.0 64.00861305292838 0.0 - - - - - - - 732.2222222222222 62 9 BPGM 2,3-bisphosphoglycerate mutase 949 120 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587989.[MT7]-IAPEVLRGK[MT7].3y8_2.heavy 424.274 / 507.315 32951.0 28.385700225830078 50 20 10 10 10 8.183204683048533 12.220151379953807 0.0 3 0.9969729334729537 22.425481306678353 32951.0 45.574982353479676 0.0 - - - - - - - 763.4 65 10 BPGM 2,3-bisphosphoglycerate mutase 951 121 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543648.[MT7]-WGNPAQNTASSDQFER.3y7_1.heavy 651.305 / 868.38 13546.0 30.095199584960938 48 18 10 10 10 5.228941001500395 19.12433128836335 0.0 3 0.9832158021121137 9.512677114645367 13546.0 211.27022887798145 0.0 - - - - - - - 231.92307692307693 27 13 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 953 121 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543648.[MT7]-WGNPAQNTASSDQFER.3b5_1.heavy 651.305 / 670.343 9254.0 30.095199584960938 48 18 10 10 10 5.228941001500395 19.12433128836335 0.0 3 0.9832158021121137 9.512677114645367 9254.0 19.31262947441185 0.0 - - - - - - - 281.4 18 15 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 955 121 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543648.[MT7]-WGNPAQNTASSDQFER.3b3_1.heavy 651.305 / 502.253 28970.0 30.095199584960938 48 18 10 10 10 5.228941001500395 19.12433128836335 0.0 3 0.9832158021121137 9.512677114645367 28970.0 11.567235467899526 0.0 - - - - - - - 376.875 57 8 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 957 121 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543648.[MT7]-WGNPAQNTASSDQFER.3y8_1.heavy 651.305 / 939.417 8450.0 30.095199584960938 48 18 10 10 10 5.228941001500395 19.12433128836335 0.0 3 0.9832158021121137 9.512677114645367 8450.0 34.274394084622756 0.0 - - - - - - - 258.42857142857144 16 14 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 959 122 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540870.[MT7]-LTDFGLC[CAM]K[MT7].2y5_1.heavy 621.344 / 768.419 9359.0 35.68095016479492 35 14 10 3 8 2.1408482315481696 35.78928392105608 0.0509033203125 4 0.9315503231546675 4.689944514549897 9359.0 54.74734873596201 0.0 - - - - - - - 227.15384615384616 18 13 RPS6KB1;RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 1;ribosomal protein S6 kinase, 70kDa, polypeptide 2 961 122 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540870.[MT7]-LTDFGLC[CAM]K[MT7].2y6_1.heavy 621.344 / 883.446 3448.0 35.68095016479492 35 14 10 3 8 2.1408482315481696 35.78928392105608 0.0509033203125 4 0.9315503231546675 4.689944514549897 3448.0 12.835444735786101 0.0 - - - - - - - 300.77777777777777 6 9 RPS6KB1;RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 1;ribosomal protein S6 kinase, 70kDa, polypeptide 2 963 122 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540870.[MT7]-LTDFGLC[CAM]K[MT7].2b5_1.heavy 621.344 / 678.358 3571.0 35.68095016479492 35 14 10 3 8 2.1408482315481696 35.78928392105608 0.0509033203125 4 0.9315503231546675 4.689944514549897 3571.0 14.026229981920928 1.0 - - - - - - - 302.09090909090907 14 11 RPS6KB1;RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 1;ribosomal protein S6 kinase, 70kDa, polypeptide 2 965 122 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540870.[MT7]-LTDFGLC[CAM]K[MT7].2y7_1.heavy 621.344 / 984.494 14777.0 35.68095016479492 35 14 10 3 8 2.1408482315481696 35.78928392105608 0.0509033203125 4 0.9315503231546675 4.689944514549897 14777.0 47.5708696308536 0.0 - - - - - - - 232.44444444444446 29 9 RPS6KB1;RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 1;ribosomal protein S6 kinase, 70kDa, polypeptide 2 967 123 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588734.[MT7]-WFATTDWIAIYQRK[MT7].4b4_1.heavy 522.538 / 650.342 3947.0 44.9015007019043 30 12 0 10 8 3.334132956465135 29.992805117772065 0.0 4 0.8999576970512468 3.8688472033477095 3947.0 41.096220543533875 0.0 - - - - - - - 154.46153846153845 7 13 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 969 123 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588734.[MT7]-WFATTDWIAIYQRK[MT7].4y6_1.heavy 522.538 / 922.559 2830.0 44.9015007019043 30 12 0 10 8 3.334132956465135 29.992805117772065 0.0 4 0.8999576970512468 3.8688472033477095 2830.0 75.33918918918918 0.0 - - - - - - - 111.5 5 2 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 971 123 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588734.[MT7]-WFATTDWIAIYQRK[MT7].4b3_1.heavy 522.538 / 549.294 5958.0 44.9015007019043 30 12 0 10 8 3.334132956465135 29.992805117772065 0.0 4 0.8999576970512468 3.8688472033477095 5958.0 30.750967741935483 1.0 - - - - - - - 172.0 71 16 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 973 123 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588734.[MT7]-WFATTDWIAIYQRK[MT7].4b6_1.heavy 522.538 / 866.417 1490.0 44.9015007019043 30 12 0 10 8 3.334132956465135 29.992805117772065 0.0 4 0.8999576970512468 3.8688472033477095 1490.0 28.225675675675674 0.0 - - - - - - - 99.0 2 6 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 975 124 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588588.[MT7]-ATQLLEGLVQELQK[MT7].4b7_1.heavy 465.278 / 857.485 3322.0 50.26674842834473 35 9 10 6 10 0.7175918214447123 78.20517651228818 0.03260040283203125 3 0.8179990690771732 2.8477851656177546 3322.0 42.289779396883226 0.0 - - - - - - - 126.75 6 8 STAT5B signal transducer and activator of transcription 5B 977 124 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588588.[MT7]-ATQLLEGLVQELQK[MT7].4b4_1.heavy 465.278 / 558.337 3281.0 50.26674842834473 35 9 10 6 10 0.7175918214447123 78.20517651228818 0.03260040283203125 3 0.8179990690771732 2.8477851656177546 3281.0 101.5391443422631 0.0 - - - - - - - 86.5 6 8 STAT5B signal transducer and activator of transcription 5B 979 124 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588588.[MT7]-ATQLLEGLVQELQK[MT7].4b5_1.heavy 465.278 / 671.421 2674.0 50.26674842834473 35 9 10 6 10 0.7175918214447123 78.20517651228818 0.03260040283203125 3 0.8179990690771732 2.8477851656177546 2674.0 50.21664845173042 0.0 - - - - - - - 116.75 5 8 STAT5B signal transducer and activator of transcription 5B 981 124 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588588.[MT7]-ATQLLEGLVQELQK[MT7].4y3_1.heavy 465.278 / 532.357 3322.0 50.26674842834473 35 9 10 6 10 0.7175918214447123 78.20517651228818 0.03260040283203125 3 0.8179990690771732 2.8477851656177546 3322.0 79.97407407407408 0.0 - - - - - - - 81.2 6 5 STAT5B signal transducer and activator of transcription 5B 983 125 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17899.[MT7]-TILPNPLSR.2y8_1.heavy 577.854 / 909.552 1808.0 37.35350036621094 22 -2 10 10 4 0.3578064261593633 131.36623656060317 0.0 10 0.18424517029827792 1.2597175774707394 1808.0 6.457364341085271 3.0 - - - - - - - 202.71428571428572 12 7 PTPRR protein tyrosine phosphatase, receptor type, R 985 125 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17899.[MT7]-TILPNPLSR.2y5_1.heavy 577.854 / 586.331 904.0 37.35350036621094 22 -2 10 10 4 0.3578064261593633 131.36623656060317 0.0 10 0.18424517029827792 1.2597175774707394 904.0 1.1893383475756178 15.0 - - - - - - - 760.6666666666666 4 9 PTPRR protein tyrosine phosphatase, receptor type, R 987 125 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17899.[MT7]-TILPNPLSR.2b4_1.heavy 577.854 / 569.378 15238.0 37.35350036621094 22 -2 10 10 4 0.3578064261593633 131.36623656060317 0.0 10 0.18424517029827792 1.2597175774707394 15238.0 17.035623472039525 0.0 - - - - - - - 1254.142857142857 30 7 PTPRR protein tyrosine phosphatase, receptor type, R 989 125 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17899.[MT7]-TILPNPLSR.2y7_1.heavy 577.854 / 796.468 129.0 37.35350036621094 22 -2 10 10 4 0.3578064261593633 131.36623656060317 0.0 10 0.18424517029827792 1.2597175774707394 129.0 0.29999999999999993 27.0 - - - - - - - 221.14285714285714 9 7 PTPRR protein tyrosine phosphatase, receptor type, R 991 126 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588580.[MT7]-SRAEASQELLAQLNR.3y6_1.heavy 610.67 / 714.426 16210.0 33.4010009765625 43 13 10 10 10 1.3865391397841336 48.90913869408153 0.0 3 0.9156615632193057 4.219383140612077 16210.0 100.5648366916139 0.0 - - - - - - - 689.1428571428571 32 7 UBA7 ubiquitin-like modifier activating enzyme 7 993 126 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588580.[MT7]-SRAEASQELLAQLNR.3y8_1.heavy 610.67 / 956.552 4728.0 33.4010009765625 43 13 10 10 10 1.3865391397841336 48.90913869408153 0.0 3 0.9156615632193057 4.219383140612077 4728.0 38.950880829015546 0.0 - - - - - - - 220.28571428571428 9 14 UBA7 ubiquitin-like modifier activating enzyme 7 995 126 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588580.[MT7]-SRAEASQELLAQLNR.3y5_1.heavy 610.67 / 601.342 21710.0 33.4010009765625 43 13 10 10 10 1.3865391397841336 48.90913869408153 0.0 3 0.9156615632193057 4.219383140612077 21710.0 46.83793974285166 0.0 - - - - - - - 771.7142857142857 43 7 UBA7 ubiquitin-like modifier activating enzyme 7 997 126 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588580.[MT7]-SRAEASQELLAQLNR.3b8_2.heavy 610.67 / 502.25 28561.0 33.4010009765625 43 13 10 10 10 1.3865391397841336 48.90913869408153 0.0 3 0.9156615632193057 4.219383140612077 28561.0 46.534456013378296 0.0 - - - - - - - 689.0 57 7 UBA7 ubiquitin-like modifier activating enzyme 7 999 127 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587478.[MT7]-GDFLYR.2y4_1.heavy 457.746 / 598.335 21115.0 30.794225692749023 41 15 10 6 10 2.179431412072631 38.4396008706512 0.03070068359375 3 0.9556683299839571 5.839661930097553 21115.0 35.140877389178605 0.0 - - - - - - - 775.4 42 10 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1001 127 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587478.[MT7]-GDFLYR.2b3_1.heavy 457.746 / 464.226 19107.0 30.794225692749023 41 15 10 6 10 2.179431412072631 38.4396008706512 0.03070068359375 3 0.9556683299839571 5.839661930097553 19107.0 25.427057307525377 0.0 - - - - - - - 722.0 38 7 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1003 127 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587478.[MT7]-GDFLYR.2y5_1.heavy 457.746 / 713.362 5054.0 30.794225692749023 41 15 10 6 10 2.179431412072631 38.4396008706512 0.03070068359375 3 0.9556683299839571 5.839661930097553 5054.0 12.77412364418303 1.0 - - - - - - - 253.83333333333334 10 18 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1005 127 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587478.[MT7]-GDFLYR.2b4_1.heavy 457.746 / 577.31 18346.0 30.794225692749023 41 15 10 6 10 2.179431412072631 38.4396008706512 0.03070068359375 3 0.9556683299839571 5.839661930097553 18346.0 25.763539535769027 0.0 - - - - - - - 735.5 36 8 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1007 128 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 413141.0 23.767099380493164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 413141.0 670.396361250818 0.0 - - - - - - - 724.8571428571429 826 7 1009 128 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 688655.0 23.767099380493164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 688655.0 657.3014411285699 0.0 - - - - - - - 231.78947368421052 1377 19 1011 128 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 2067980.0 23.767099380493164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2067980.0 14834.669962686568 0.0 - - - - - - - 208.41176470588235 4135 17 1013 129 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17995.[MT7]-SLLQVDLTK[MT7].2y4_1.heavy 652.905 / 620.374 11544.0 37.061100006103516 46 16 10 10 10 10.942731235498313 9.138486347503369 0.0 3 0.9697376308962822 7.076353963814009 11544.0 18.963207772221125 0.0 - - - - - - - 827.6666666666666 23 9 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1015 129 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17995.[MT7]-SLLQVDLTK[MT7].2y5_1.heavy 652.905 / 719.442 12040.0 37.061100006103516 46 16 10 10 10 10.942731235498313 9.138486347503369 0.0 3 0.9697376308962822 7.076353963814009 12040.0 21.09728096676737 0.0 - - - - - - - 260.5 24 10 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1017 129 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17995.[MT7]-SLLQVDLTK[MT7].2b4_1.heavy 652.905 / 586.368 14150.0 37.061100006103516 46 16 10 10 10 10.942731235498313 9.138486347503369 0.0 3 0.9697376308962822 7.076353963814009 14150.0 21.43593875906527 0.0 - - - - - - - 674.1428571428571 28 7 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1019 129 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17995.[MT7]-SLLQVDLTK[MT7].2y3_1.heavy 652.905 / 505.347 11047.0 37.061100006103516 46 16 10 10 10 10.942731235498313 9.138486347503369 0.0 3 0.9697376308962822 7.076353963814009 11047.0 5.779144065395921 1.0 - - - - - - - 275.6666666666667 29 9 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1021 130 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587983.[MT7]-RSGSSDFEAR.3b6_1.heavy 419.21 / 734.355 15489.0 18.166099548339844 44 14 10 10 10 2.339915304265372 33.26800422635304 0.0 3 0.9468950278584098 5.331554507016566 15489.0 121.4304525372768 0.0 - - - - - - - 203.1578947368421 30 19 ACOX3 acyl-CoA oxidase 3, pristanoyl 1023 130 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587983.[MT7]-RSGSSDFEAR.3b4_1.heavy 419.21 / 532.296 3898.0 18.166099548339844 44 14 10 10 10 2.339915304265372 33.26800422635304 0.0 3 0.9468950278584098 5.331554507016566 3898.0 8.762359209637227 2.0 - - - - - - - 700.1 8 10 ACOX3 acyl-CoA oxidase 3, pristanoyl 1025 130 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587983.[MT7]-RSGSSDFEAR.3y4_1.heavy 419.21 / 522.267 28356.0 18.166099548339844 44 14 10 10 10 2.339915304265372 33.26800422635304 0.0 3 0.9468950278584098 5.331554507016566 28356.0 108.61582348003358 0.0 - - - - - - - 712.7777777777778 56 9 ACOX3 acyl-CoA oxidase 3, pristanoyl 1027 130 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587983.[MT7]-RSGSSDFEAR.3y5_1.heavy 419.21 / 637.294 8659.0 18.166099548339844 44 14 10 10 10 2.339915304265372 33.26800422635304 0.0 3 0.9468950278584098 5.331554507016566 8659.0 79.54386333218615 0.0 - - - - - - - 187.17391304347825 17 23 ACOX3 acyl-CoA oxidase 3, pristanoyl 1029 131 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17996.[MT7]-LTLSALVDGK[MT7].3y3_1.heavy 435.606 / 463.263 60950.0 40.50892639160156 42 16 10 6 10 2.6835213912869884 30.338279999102383 0.0345001220703125 3 0.968260491701514 6.908867093408084 60950.0 281.8146292426545 0.0 - - - - - - - 256.0 121 9 VDAC2 voltage-dependent anion channel 2 1031 131 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17996.[MT7]-LTLSALVDGK[MT7].3b4_1.heavy 435.606 / 559.357 38001.0 40.50892639160156 42 16 10 6 10 2.6835213912869884 30.338279999102383 0.0345001220703125 3 0.968260491701514 6.908867093408084 38001.0 232.4560515972694 0.0 - - - - - - - 258.7142857142857 76 14 VDAC2 voltage-dependent anion channel 2 1033 131 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17996.[MT7]-LTLSALVDGK[MT7].3b5_1.heavy 435.606 / 630.394 65227.0 40.50892639160156 42 16 10 6 10 2.6835213912869884 30.338279999102383 0.0345001220703125 3 0.968260491701514 6.908867093408084 65227.0 108.79526625582821 0.0 - - - - - - - 234.3846153846154 130 13 VDAC2 voltage-dependent anion channel 2 1035 131 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17996.[MT7]-LTLSALVDGK[MT7].3b3_1.heavy 435.606 / 472.325 46803.0 40.50892639160156 42 16 10 6 10 2.6835213912869884 30.338279999102383 0.0345001220703125 3 0.968260491701514 6.908867093408084 46803.0 93.67748088801133 0.0 - - - - - - - 219.33333333333334 93 15 VDAC2 voltage-dependent anion channel 2 1037 132 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588837.[MT7]-ASIPATSAVQNVLINPSLIGSK[MT7].3y7_1.heavy 823.482 / 845.521 32739.0 42.78070068359375 48 18 10 10 10 2.78964591601411 28.86755451268407 0.0 3 0.9808352744021069 8.900512667013095 32739.0 28.94123794341476 0.0 - - - - - - - 170.9 65 10 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1039 132 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588837.[MT7]-ASIPATSAVQNVLINPSLIGSK[MT7].3b5_1.heavy 823.482 / 584.352 11402.0 42.78070068359375 48 18 10 10 10 2.78964591601411 28.86755451268407 0.0 3 0.9808352744021069 8.900512667013095 11402.0 37.303867373574285 0.0 - - - - - - - 232.57142857142858 22 7 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1041 132 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588837.[MT7]-ASIPATSAVQNVLINPSLIGSK[MT7].3y4_1.heavy 823.482 / 548.352 16939.0 42.78070068359375 48 18 10 10 10 2.78964591601411 28.86755451268407 0.0 3 0.9808352744021069 8.900512667013095 16939.0 94.01587938750879 0.0 - - - - - - - 302.42857142857144 33 7 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1043 132 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588837.[MT7]-ASIPATSAVQNVLINPSLIGSK[MT7].3b8_1.heavy 823.482 / 843.469 12216.0 42.78070068359375 48 18 10 10 10 2.78964591601411 28.86755451268407 0.0 3 0.9808352744021069 8.900512667013095 12216.0 24.1035707502573 0.0 - - - - - - - 232.57142857142858 24 7 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1045 133 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588836.[MT7]-ASIPATSAVQNVLINPSLIGSK[MT7].4b8_1.heavy 617.864 / 843.469 6281.0 42.78070068359375 47 17 10 10 10 4.258796265781813 23.480813300103335 0.0 3 0.9744200732639966 7.699855602468876 6281.0 27.19147860434496 0.0 - - - - - - - 226.77777777777777 12 9 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1047 133 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588836.[MT7]-ASIPATSAVQNVLINPSLIGSK[MT7].4y4_1.heavy 617.864 / 548.352 31812.0 42.78070068359375 47 17 10 10 10 4.258796265781813 23.480813300103335 0.0 3 0.9744200732639966 7.699855602468876 31812.0 89.8860874251006 0.0 - - - - - - - 326.125 63 8 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1049 133 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588836.[MT7]-ASIPATSAVQNVLINPSLIGSK[MT7].4b5_1.heavy 617.864 / 584.352 11909.0 42.78070068359375 47 17 10 10 10 4.258796265781813 23.480813300103335 0.0 3 0.9744200732639966 7.699855602468876 11909.0 12.848304432368394 0.0 - - - - - - - 407.6666666666667 23 6 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1051 133 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588836.[MT7]-ASIPATSAVQNVLINPSLIGSK[MT7].4y7_1.heavy 617.864 / 845.521 12317.0 42.78070068359375 47 17 10 10 10 4.258796265781813 23.480813300103335 0.0 3 0.9744200732639966 7.699855602468876 12317.0 65.40211430891375 0.0 - - - - - - - 193.0 24 11 TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1053 134 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543537.[MT7]-IQAQFGPLAQLSPQER.3y6_1.heavy 643.022 / 729.389 29922.0 39.86970043182373 36 15 10 3 8 1.5520212432632396 46.507441263955954 0.07139968872070312 4 0.9566633920308846 5.906822165728718 29922.0 170.98285714285714 1.0 - - - - - - - 229.25 59 8 STAT5B signal transducer and activator of transcription 5B 1055 134 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543537.[MT7]-IQAQFGPLAQLSPQER.3b6_1.heavy 643.022 / 789.438 51532.0 39.86970043182373 36 15 10 3 8 1.5520212432632396 46.507441263955954 0.07139968872070312 4 0.9566633920308846 5.906822165728718 51532.0 94.5982530139373 0.0 - - - - - - - 680.3333333333334 103 9 STAT5B signal transducer and activator of transcription 5B 1057 134 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543537.[MT7]-IQAQFGPLAQLSPQER.3b4_1.heavy 643.022 / 585.348 30097.0 39.86970043182373 36 15 10 3 8 1.5520212432632396 46.507441263955954 0.07139968872070312 4 0.9566633920308846 5.906822165728718 30097.0 36.330559085133416 1.0 - - - - - - - 349.5 80 2 STAT5B signal transducer and activator of transcription 5B 1059 134 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543537.[MT7]-IQAQFGPLAQLSPQER.3y5_1.heavy 643.022 / 616.305 55470.0 39.86970043182373 36 15 10 3 8 1.5520212432632396 46.507441263955954 0.07139968872070312 4 0.9566633920308846 5.906822165728718 55470.0 73.39858971157221 0.0 - - - - - - - 327.75 110 4 STAT5B signal transducer and activator of transcription 5B 1061 135 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18102.[MT7]-FLSLEPVK[MT7]K[MT7].3y3_1.heavy 498.32 / 662.48 2633.0 33.96237564086914 41 15 10 6 10 1.7240824870682725 47.03933354164441 0.0381011962890625 3 0.9511597882198926 5.561474762609771 2633.0 7.58871967154443 1.0 - - - - - - - 226.76923076923077 5 13 CCND1 cyclin D1 1063 135 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18102.[MT7]-FLSLEPVK[MT7]K[MT7].3y7_2.heavy 498.32 / 544.849 9058.0 33.96237564086914 41 15 10 6 10 1.7240824870682725 47.03933354164441 0.0381011962890625 3 0.9511597882198926 5.561474762609771 9058.0 12.317982891130997 0.0 - - - - - - - 692.1428571428571 18 7 CCND1 cyclin D1 1065 135 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18102.[MT7]-FLSLEPVK[MT7]K[MT7].3b5_1.heavy 498.32 / 734.42 7899.0 33.96237564086914 41 15 10 6 10 1.7240824870682725 47.03933354164441 0.0381011962890625 3 0.9511597882198926 5.561474762609771 7899.0 23.435522902994087 0.0 - - - - - - - 617.1428571428571 15 7 CCND1 cyclin D1 1067 135 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18102.[MT7]-FLSLEPVK[MT7]K[MT7].3y4_1.heavy 498.32 / 759.533 15377.0 33.96237564086914 41 15 10 6 10 1.7240824870682725 47.03933354164441 0.0381011962890625 3 0.9511597882198926 5.561474762609771 15377.0 56.23107076280104 0.0 - - - - - - - 217.73333333333332 30 15 CCND1 cyclin D1 1069 136 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18103.[MT7]-DLLTMNEELK[MT7].2y8_1.heavy 747.41 / 1121.6 2906.0 36.77437496185303 42 17 10 5 10 7.050067748087603 14.184260857227358 0.043102264404296875 3 0.9700150141028289 7.109175525906358 2906.0 7.362425115929314 0.0 - - - - - - - 229.63636363636363 5 11 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 1071 136 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18103.[MT7]-DLLTMNEELK[MT7].2y5_1.heavy 747.41 / 776.427 2022.0 36.77437496185303 42 17 10 5 10 7.050067748087603 14.184260857227358 0.043102264404296875 3 0.9700150141028289 7.109175525906358 2022.0 13.193768061314236 1.0 - - - - - - - 206.72727272727272 7 11 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 1073 136 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18103.[MT7]-DLLTMNEELK[MT7].2y3_1.heavy 747.41 / 533.341 2653.0 36.77437496185303 42 17 10 5 10 7.050067748087603 14.184260857227358 0.043102264404296875 3 0.9700150141028289 7.109175525906358 2653.0 6.179291196517555 0.0 - - - - - - - 656.8 5 10 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 1075 136 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18103.[MT7]-DLLTMNEELK[MT7].2y7_1.heavy 747.41 / 1008.52 5054.0 36.77437496185303 42 17 10 5 10 7.050067748087603 14.184260857227358 0.043102264404296875 3 0.9700150141028289 7.109175525906358 5054.0 11.20232223399077 0.0 - - - - - - - 243.57142857142858 10 14 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 1077 137 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18200.[MT7]-VLEDGTPFWSGPK[MT7].3b6_1.heavy 574.31 / 759.401 5137.0 39.119399070739746 41 15 10 6 10 1.8458910958945889 36.814426534537475 0.039997100830078125 3 0.9523471078703677 5.6309005132801815 5137.0 12.517465940054494 1.0 - - - - - - - 246.92307692307693 10 13 UBA7 ubiquitin-like modifier activating enzyme 7 1079 137 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18200.[MT7]-VLEDGTPFWSGPK[MT7].3b4_1.heavy 574.31 / 601.331 3486.0 39.119399070739746 41 15 10 6 10 1.8458910958945889 36.814426534537475 0.039997100830078125 3 0.9523471078703677 5.6309005132801815 3486.0 10.94584911930874 0.0 - - - - - - - 239.84615384615384 6 13 UBA7 ubiquitin-like modifier activating enzyme 7 1081 137 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18200.[MT7]-VLEDGTPFWSGPK[MT7].3b5_1.heavy 574.31 / 658.353 2569.0 39.119399070739746 41 15 10 6 10 1.8458910958945889 36.814426534537475 0.039997100830078125 3 0.9523471078703677 5.6309005132801815 2569.0 8.42516339869281 0.0 - - - - - - - 244.5 5 18 UBA7 ubiquitin-like modifier activating enzyme 7 1083 137 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18200.[MT7]-VLEDGTPFWSGPK[MT7].3y5_1.heavy 574.31 / 718.4 4403.0 39.119399070739746 41 15 10 6 10 1.8458910958945889 36.814426534537475 0.039997100830078125 3 0.9523471078703677 5.6309005132801815 4403.0 18.92908268516225 0.0 - - - - - - - 211.6153846153846 8 13 UBA7 ubiquitin-like modifier activating enzyme 7 1085 138 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542274.[MT7]-YQLDPTASISAK[MT7].3b4_1.heavy 527.962 / 664.342 60295.0 31.949100494384766 46 20 10 6 10 6.865001203727418 14.566639834775856 0.033599853515625 3 0.9909454489654816 12.959870706573485 60295.0 163.9123272017837 0.0 - - - - - - - 653.875 120 8 VDAC2 voltage-dependent anion channel 2 1087 138 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542274.[MT7]-YQLDPTASISAK[MT7].3y4_1.heavy 527.962 / 562.368 12627.0 31.949100494384766 46 20 10 6 10 6.865001203727418 14.566639834775856 0.033599853515625 3 0.9909454489654816 12.959870706573485 12627.0 22.300243110236224 0.0 - - - - - - - 635.0 25 8 VDAC2 voltage-dependent anion channel 2 1089 138 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542274.[MT7]-YQLDPTASISAK[MT7].3b3_1.heavy 527.962 / 549.315 14271.0 31.949100494384766 46 20 10 6 10 6.865001203727418 14.566639834775856 0.033599853515625 3 0.9909454489654816 12.959870706573485 14271.0 17.125022120148664 0.0 - - - - - - - 310.38461538461536 28 13 VDAC2 voltage-dependent anion channel 2 1091 138 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542274.[MT7]-YQLDPTASISAK[MT7].3y5_1.heavy 527.962 / 649.4 14271.0 31.949100494384766 46 20 10 6 10 6.865001203727418 14.566639834775856 0.033599853515625 3 0.9909454489654816 12.959870706573485 14271.0 27.604622588558122 0.0 - - - - - - - 640.2857142857143 28 7 VDAC2 voltage-dependent anion channel 2 1093 139 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588072.[MT7]-VAHALAEGLGVIAC[CAM]IGEK[MT7].3y6_1.heavy 699.397 / 821.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - TPI1 triosephosphate isomerase 1 1095 139 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588072.[MT7]-VAHALAEGLGVIAC[CAM]IGEK[MT7].3b4_1.heavy 699.397 / 523.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - TPI1 triosephosphate isomerase 1 1097 139 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588072.[MT7]-VAHALAEGLGVIAC[CAM]IGEK[MT7].3b5_1.heavy 699.397 / 636.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - TPI1 triosephosphate isomerase 1 1099 139 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588072.[MT7]-VAHALAEGLGVIAC[CAM]IGEK[MT7].3y5_1.heavy 699.397 / 750.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - TPI1 triosephosphate isomerase 1 1101 140 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544307.[MT7]-ADQSFTSPPPRDFLLDIAR.4y12_2.heavy 573.304 / 705.399 17513.0 41.692925453186035 35 13 10 6 6 1.0459768413121169 54.821856112015766 0.032901763916015625 5 0.9055324571651807 3.983284834667838 17513.0 35.09762781186094 0.0 - - - - - - - 197.71428571428572 35 7 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1103 140 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544307.[MT7]-ADQSFTSPPPRDFLLDIAR.4y11_2.heavy 573.304 / 656.872 11404.0 41.692925453186035 35 13 10 6 6 1.0459768413121169 54.821856112015766 0.032901763916015625 5 0.9055324571651807 3.983284834667838 11404.0 3.788977970386421 1.0 - - - - - - - 784.0 23 8 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1105 140 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544307.[MT7]-ADQSFTSPPPRDFLLDIAR.4b4_1.heavy 573.304 / 546.264 9042.0 41.692925453186035 35 13 10 6 6 1.0459768413121169 54.821856112015766 0.032901763916015625 5 0.9055324571651807 3.983284834667838 9042.0 7.325351882160392 1.0 - - - - - - - 267.57142857142856 22 7 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1107 140 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544307.[MT7]-ADQSFTSPPPRDFLLDIAR.4y13_2.heavy 573.304 / 748.915 7901.0 41.692925453186035 35 13 10 6 6 1.0459768413121169 54.821856112015766 0.032901763916015625 5 0.9055324571651807 3.983284834667838 7901.0 1.2651721377101681 1.0 - - - - - - - 195.4 15 10 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1109 141 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544300.[MT7]-AVGPHQFLGDQEAIQAAIK[MT7].4y4_1.heavy 571.069 / 546.373 18032.0 36.23040008544922 38 8 10 10 10 0.5200585926147623 90.9089092436433 0.0 3 0.7875388548210459 2.6285426234237432 18032.0 34.177637795275594 0.0 - - - - - - - 235.85714285714286 36 7 BPGM 2,3-bisphosphoglycerate mutase 1111 141 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544300.[MT7]-AVGPHQFLGDQEAIQAAIK[MT7].4b5_1.heavy 571.069 / 606.348 3175.0 36.23040008544922 38 8 10 10 10 0.5200585926147623 90.9089092436433 0.0 3 0.7875388548210459 2.6285426234237432 3175.0 3.0219780219780223 1.0 - - - - - - - 239.88888888888889 6 9 BPGM 2,3-bisphosphoglycerate mutase 1113 141 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544300.[MT7]-AVGPHQFLGDQEAIQAAIK[MT7].4b6_1.heavy 571.069 / 734.407 2540.0 36.23040008544922 38 8 10 10 10 0.5200585926147623 90.9089092436433 0.0 3 0.7875388548210459 2.6285426234237432 2540.0 27.6 0.0 - - - - - - - 203.2 5 10 BPGM 2,3-bisphosphoglycerate mutase 1115 141 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544300.[MT7]-AVGPHQFLGDQEAIQAAIK[MT7].4b10_2.heavy 571.069 / 583.807 9651.0 36.23040008544922 38 8 10 10 10 0.5200585926147623 90.9089092436433 0.0 3 0.7875388548210459 2.6285426234237432 9651.0 85.60512992125985 0.0 - - - - - - - 183.44444444444446 19 9 BPGM 2,3-bisphosphoglycerate mutase 1117 142 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541804.[MT7]-QVEHILNEK[MT7].3y3_1.heavy 466.605 / 534.3 41323.0 26.478900909423828 45 15 10 10 10 12.689072770347599 7.8807964781859035 0.0 3 0.9566410203049834 5.905286924208037 41323.0 103.93404451925903 0.0 - - - - - - - 1198.7777777777778 82 9 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1119 142 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541804.[MT7]-QVEHILNEK[MT7].3b4_1.heavy 466.605 / 638.338 44709.0 26.478900909423828 45 15 10 10 10 12.689072770347599 7.8807964781859035 0.0 3 0.9566410203049834 5.905286924208037 44709.0 139.26911366172487 0.0 - - - - - - - 253.1764705882353 89 17 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1121 142 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541804.[MT7]-QVEHILNEK[MT7].3y4_1.heavy 466.605 / 647.385 34550.0 26.478900909423828 45 15 10 10 10 12.689072770347599 7.8807964781859035 0.0 3 0.9566410203049834 5.905286924208037 34550.0 69.21667757572307 0.0 - - - - - - - 328.6363636363636 69 11 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1123 142 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541804.[MT7]-QVEHILNEK[MT7].3b3_1.heavy 466.605 / 501.279 32542.0 26.478900909423828 45 15 10 10 10 12.689072770347599 7.8807964781859035 0.0 3 0.9566410203049834 5.905286924208037 32542.0 35.45915782171021 0.0 - - - - - - - 807.5 65 14 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1125 143 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 279641.0 33.06230163574219 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 279641.0 1044.2396190673678 0.0 - - - - - - - 225.66666666666666 559 9 1127 143 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 284546.0 33.06230163574219 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 284546.0 1106.7219753987565 0.0 - - - - - - - 169.25 569 4 1129 143 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 597084.0 33.06230163574219 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 597084.0 560.6648169660449 0.0 - - - - - - - 708.0 1194 8 1131 144 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543336.[MT7]-TLLPMPGVMVGDIGK[MT7].3y6_1.heavy 606.015 / 732.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACOX3 acyl-CoA oxidase 3, pristanoyl 1133 144 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543336.[MT7]-TLLPMPGVMVGDIGK[MT7].3b5_1.heavy 606.015 / 700.418 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACOX3 acyl-CoA oxidase 3, pristanoyl 1135 144 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543336.[MT7]-TLLPMPGVMVGDIGK[MT7].3b7_1.heavy 606.015 / 854.493 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACOX3 acyl-CoA oxidase 3, pristanoyl 1137 144 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543336.[MT7]-TLLPMPGVMVGDIGK[MT7].3y5_1.heavy 606.015 / 633.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACOX3 acyl-CoA oxidase 3, pristanoyl 1139 145 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588590.[MT7]-ATQLLEGLVQELQK[MT7].3y3_1.heavy 620.034 / 532.357 78477.0 50.28304862976074 34 8 10 6 10 2.4356110700880556 32.61240026168 0.03260040283203125 3 0.7737644051285663 2.5440853871506293 78477.0 987.9103632781312 0.0 - - - - - - - 156.4 156 15 STAT5B signal transducer and activator of transcription 5B 1141 145 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588590.[MT7]-ATQLLEGLVQELQK[MT7].3b4_1.heavy 620.034 / 558.337 22410.0 50.28304862976074 34 8 10 6 10 2.4356110700880556 32.61240026168 0.03260040283203125 3 0.7737644051285663 2.5440853871506293 22410.0 159.2633009708738 0.0 - - - - - - - 190.9090909090909 44 11 STAT5B signal transducer and activator of transcription 5B 1143 145 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588590.[MT7]-ATQLLEGLVQELQK[MT7].3b5_1.heavy 620.034 / 671.421 52813.0 50.28304862976074 34 8 10 6 10 2.4356110700880556 32.61240026168 0.03260040283203125 3 0.7737644051285663 2.5440853871506293 52813.0 631.5198094109769 0.0 - - - - - - - 164.83333333333334 105 12 STAT5B signal transducer and activator of transcription 5B 1145 145 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588590.[MT7]-ATQLLEGLVQELQK[MT7].3b7_1.heavy 620.034 / 857.485 92978.0 50.28304862976074 34 8 10 6 10 2.4356110700880556 32.61240026168 0.03260040283203125 3 0.7737644051285663 2.5440853871506293 92978.0 1165.0872164338148 0.0 - - - - - - - 140.0 185 10 STAT5B signal transducer and activator of transcription 5B 1147 146 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587973.[MT7]-GAESVTEEK[MT7].2b8_1.heavy 619.329 / 947.444 513.0 19.88542413711548 47 20 10 7 10 7.19345965468256 13.901516766679205 0.027299880981445312 3 0.9911241726554229 13.089895999662584 513.0 3.745569620253164 1.0 - - - - - - - 0.0 1 0 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1149 146 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587973.[MT7]-GAESVTEEK[MT7].2y6_1.heavy 619.329 / 836.448 552.0 19.88542413711548 47 20 10 7 10 7.19345965468256 13.901516766679205 0.027299880981445312 3 0.9911241726554229 13.089895999662584 552.0 10.1221712078953 0.0 - - - - - - - 0.0 1 0 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1151 146 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587973.[MT7]-GAESVTEEK[MT7].2y4_1.heavy 619.329 / 650.348 710.0 19.88542413711548 47 20 10 7 10 7.19345965468256 13.901516766679205 0.027299880981445312 3 0.9911241726554229 13.089895999662584 710.0 12.267721518987342 0.0 - - - - - - - 0.0 1 0 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1153 146 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587973.[MT7]-GAESVTEEK[MT7].2b3_1.heavy 619.329 / 402.211 1144.0 19.88542413711548 47 20 10 7 10 7.19345965468256 13.901516766679205 0.027299880981445312 3 0.9911241726554229 13.089895999662584 1144.0 4.8955340821299105 0.0 - - - - - - - 172.92307692307693 2 26 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1155 147 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587482.[MT7]-LEGFASR.2y5_1.heavy 462.257 / 537.278 39127.0 29.146499633789062 46 20 10 6 10 9.706898954193747 10.301951269081277 0.037799835205078125 3 0.9922275272286433 13.989463782147608 39127.0 72.94162123014411 0.0 - - - - - - - 736.625 78 8 PRKACB protein kinase, cAMP-dependent, catalytic, beta 1157 147 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587482.[MT7]-LEGFASR.2b4_1.heavy 462.257 / 591.326 13969.0 29.146499633789062 46 20 10 6 10 9.706898954193747 10.301951269081277 0.037799835205078125 3 0.9922275272286433 13.989463782147608 13969.0 21.676286727089625 0.0 - - - - - - - 764.4545454545455 27 11 PRKACB protein kinase, cAMP-dependent, catalytic, beta 1159 147 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587482.[MT7]-LEGFASR.2y6_1.heavy 462.257 / 666.321 68920.0 29.146499633789062 46 20 10 6 10 9.706898954193747 10.301951269081277 0.037799835205078125 3 0.9922275272286433 13.989463782147608 68920.0 76.74057249417248 0.0 - - - - - - - 248.25 137 4 PRKACB protein kinase, cAMP-dependent, catalytic, beta 1161 147 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587482.[MT7]-LEGFASR.2b5_1.heavy 462.257 / 662.363 13837.0 29.146499633789062 46 20 10 6 10 9.706898954193747 10.301951269081277 0.037799835205078125 3 0.9922275272286433 13.989463782147608 13837.0 48.876112598122056 0.0 - - - - - - - 250.57142857142858 27 14 PRKACB protein kinase, cAMP-dependent, catalytic, beta 1163 148 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17665.[MT7]-FWVGNMGK[MT7].3y3_1.heavy 409.558 / 479.277 N/A 36.45709991455078 48 18 10 10 10 4.306777162033472 18.68429616437723 0.0 3 0.9892953860397709 11.917596832150979 2053.0 7.775088594381672 1.0 - - - - - - - 214.0 6 6 ACOX3 acyl-CoA oxidase 3, pristanoyl 1165 148 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17665.[MT7]-FWVGNMGK[MT7].3b4_1.heavy 409.558 / 634.347 4105.0 36.45709991455078 48 18 10 10 10 4.306777162033472 18.68429616437723 0.0 3 0.9892953860397709 11.917596832150979 4105.0 49.708984375 0.0 - - - - - - - 170.83333333333334 8 6 ACOX3 acyl-CoA oxidase 3, pristanoyl 1167 148 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17665.[MT7]-FWVGNMGK[MT7].3b5_1.heavy 409.558 / 748.39 2438.0 36.45709991455078 48 18 10 10 10 4.306777162033472 18.68429616437723 0.0 3 0.9892953860397709 11.917596832150979 2438.0 27.961850072957198 0.0 - - - - - - - 213.66666666666666 4 3 ACOX3 acyl-CoA oxidase 3, pristanoyl 1169 148 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17665.[MT7]-FWVGNMGK[MT7].3b3_1.heavy 409.558 / 577.326 2566.0 36.45709991455078 48 18 10 10 10 4.306777162033472 18.68429616437723 0.0 3 0.9892953860397709 11.917596832150979 2566.0 7.989386804732017 0.0 - - - - - - - 308.1 5 10 ACOX3 acyl-CoA oxidase 3, pristanoyl 1171 149 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588651.[MT7]-IQAQFGPLAQLSPQER.2y4_1.heavy 964.03 / 529.273 6140.0 39.8089485168457 39 15 10 6 8 2.9155636516028345 34.29868524565563 0.0334014892578125 4 0.9587593143522849 6.056133863731508 6140.0 11.869959028648262 0.0 - - - - - - - 212.0909090909091 12 11 STAT5B signal transducer and activator of transcription 5B 1173 149 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588651.[MT7]-IQAQFGPLAQLSPQER.2b4_1.heavy 964.03 / 585.348 8389.0 39.8089485168457 39 15 10 6 8 2.9155636516028345 34.29868524565563 0.0334014892578125 4 0.9587593143522849 6.056133863731508 8389.0 0.0 1.0 - - - - - - - 182.44444444444446 17 9 STAT5B signal transducer and activator of transcription 5B 1175 149 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588651.[MT7]-IQAQFGPLAQLSPQER.2y10_1.heavy 964.03 / 1138.62 3027.0 39.8089485168457 39 15 10 6 8 2.9155636516028345 34.29868524565563 0.0334014892578125 4 0.9587593143522849 6.056133863731508 3027.0 -0.3804675716440422 3.0 - - - - - - - 172.6153846153846 7 13 STAT5B signal transducer and activator of transcription 5B 1177 149 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588651.[MT7]-IQAQFGPLAQLSPQER.2y11_1.heavy 964.03 / 1195.64 6918.0 39.8089485168457 39 15 10 6 8 2.9155636516028345 34.29868524565563 0.0334014892578125 4 0.9587593143522849 6.056133863731508 6918.0 3.1990751445086705 1.0 - - - - - - - 271.57142857142856 13 7 STAT5B signal transducer and activator of transcription 5B 1179 150 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18009.[MT7]-NLLQVDLTK[MT7].2y5_1.heavy 666.41 / 719.442 13956.0 36.80670166015625 43 13 10 10 10 1.442550762272726 46.247358453734996 0.0 3 0.9126981716771805 4.146095671851708 13956.0 27.1086923179337 0.0 - - - - - - - 207.8181818181818 27 11 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 1181 150 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18009.[MT7]-NLLQVDLTK[MT7].2b4_1.heavy 666.41 / 613.379 9008.0 36.80670166015625 43 13 10 10 10 1.442550762272726 46.247358453734996 0.0 3 0.9126981716771805 4.146095671851708 9008.0 11.17465695518408 2.0 - - - - - - - 668.6363636363636 18 11 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 1183 150 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18009.[MT7]-NLLQVDLTK[MT7].2y3_1.heavy 666.41 / 505.347 12053.0 36.80670166015625 43 13 10 10 10 1.442550762272726 46.247358453734996 0.0 3 0.9126981716771805 4.146095671851708 12053.0 17.943334052263335 0.0 - - - - - - - 254.0 24 9 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 1185 150 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18009.[MT7]-NLLQVDLTK[MT7].2y6_1.heavy 666.41 / 847.5 11926.0 36.80670166015625 43 13 10 10 10 1.442550762272726 46.247358453734996 0.0 3 0.9126981716771805 4.146095671851708 11926.0 60.87861745199831 0.0 - - - - - - - 181.42857142857142 23 7 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 1187 151 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 282966.0 27.542299270629883 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 282966.0 666.5440223690083 0.0 - - - - - - - 1061.0 565 1 1189 151 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 371131.0 27.542299270629883 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 371131.0 482.92291529264475 0.0 - - - - - - - 374.0 742 1 1191 151 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 468282.0 27.542299270629883 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 468282.0 1494.9533160669118 0.0 - - - - - - - 1310.0 936 1 1193 152 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17769.[MT7]-ALDFNTR.2y4_1.heavy 490.768 / 537.278 24778.0 29.35700035095215 50 20 10 10 10 8.417149231294264 11.880506956940751 0.0 3 0.9911839256436499 13.134246604763339 24778.0 37.78138723239201 0.0 - - - - - - - 702.2857142857143 49 7 SHC1 SHC (Src homology 2 domain containing) transforming protein 1 1195 152 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17769.[MT7]-ALDFNTR.2y5_1.heavy 490.768 / 652.305 6127.0 29.35700035095215 50 20 10 10 10 8.417149231294264 11.880506956940751 0.0 3 0.9911839256436499 13.134246604763339 6127.0 6.75722497249725 0.0 - - - - - - - 703.3333333333334 12 9 SHC1 SHC (Src homology 2 domain containing) transforming protein 1 1197 152 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17769.[MT7]-ALDFNTR.2y6_1.heavy 490.768 / 765.389 11514.0 29.35700035095215 50 20 10 10 10 8.417149231294264 11.880506956940751 0.0 3 0.9911839256436499 13.134246604763339 11514.0 38.88495178041542 0.0 - - - - - - - 229.7058823529412 23 17 SHC1 SHC (Src homology 2 domain containing) transforming protein 1 1199 152 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17769.[MT7]-ALDFNTR.2b5_1.heavy 490.768 / 705.369 3636.0 29.35700035095215 50 20 10 10 10 8.417149231294264 11.880506956940751 0.0 3 0.9911839256436499 13.134246604763339 3636.0 9.713592091745628 0.0 - - - - - - - 309.75 7 20 SHC1 SHC (Src homology 2 domain containing) transforming protein 1 1201 153 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17765.[MT7]-WFPEVR.2y4_1.heavy 489.27 / 500.283 39069.0 37.39720153808594 43 13 10 10 10 1.0926990245318975 57.58186542556282 0.0 3 0.9224698319859774 4.403320930095036 39069.0 49.1573038507599 0.0 - - - - - - - 284.0 78 5 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1203 153 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17765.[MT7]-WFPEVR.2y5_1.heavy 489.27 / 647.351 35754.0 37.39720153808594 43 13 10 10 10 1.0926990245318975 57.58186542556282 0.0 3 0.9224698319859774 4.403320930095036 35754.0 96.80379105287832 0.0 - - - - - - - 379.0 71 5 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1205 153 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17765.[MT7]-WFPEVR.2y3_2.heavy 489.27 / 202.119 1184.0 37.39720153808594 43 13 10 10 10 1.0926990245318975 57.58186542556282 0.0 3 0.9224698319859774 4.403320930095036 1184.0 1.9957956236444006 17.0 - - - - - - - 309.7692307692308 4 13 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1207 153 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17765.[MT7]-WFPEVR.2b4_1.heavy 489.27 / 704.352 36583.0 37.39720153808594 43 13 10 10 10 1.0926990245318975 57.58186542556282 0.0 3 0.9224698319859774 4.403320930095036 36583.0 346.57349128670324 0.0 - - - - - - - 197.16666666666666 73 6 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1209 154 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543625.[MT7]-AQLQELLLQQIAFK[MT7].3y3_1.heavy 644.39 / 509.32 4141.0 47.2338752746582 43 16 10 7 10 2.406151886328937 33.27853726352177 0.028900146484375 3 0.9665407815693214 6.728000992788927 4141.0 14.265945048309177 0.0 - - - - - - - 204.35 8 20 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 1211 154 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543625.[MT7]-AQLQELLLQQIAFK[MT7].3b6_1.heavy 644.39 / 827.474 3394.0 47.2338752746582 43 16 10 7 10 2.406151886328937 33.27853726352177 0.028900146484375 3 0.9665407815693214 6.728000992788927 3394.0 42.84679768786127 0.0 - - - - - - - 142.2 6 15 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 1213 154 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543625.[MT7]-AQLQELLLQQIAFK[MT7].3b5_1.heavy 644.39 / 714.39 3739.0 47.2338752746582 43 16 10 7 10 2.406151886328937 33.27853726352177 0.028900146484375 3 0.9665407815693214 6.728000992788927 3739.0 22.217246376811595 0.0 - - - - - - - 192.8 7 20 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 1215 154 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543625.[MT7]-AQLQELLLQQIAFK[MT7].3b7_1.heavy 644.39 / 940.558 2646.0 47.2338752746582 43 16 10 7 10 2.406151886328937 33.27853726352177 0.028900146484375 3 0.9665407815693214 6.728000992788927 2646.0 16.066187484292534 1.0 - - - - - - - 222.53333333333333 5 15 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 1217 155 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18015.[MT7]-ELDQQSTTK[MT7].2y4_1.heavy 669.361 / 580.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC7 cell division cycle 7 homolog (S. cerevisiae) 1219 155 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18015.[MT7]-ELDQQSTTK[MT7].2b3_1.heavy 669.361 / 502.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC7 cell division cycle 7 homolog (S. cerevisiae) 1221 155 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18015.[MT7]-ELDQQSTTK[MT7].2b4_1.heavy 669.361 / 630.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC7 cell division cycle 7 homolog (S. cerevisiae) 1223 155 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18015.[MT7]-ELDQQSTTK[MT7].2y6_1.heavy 669.361 / 836.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC7 cell division cycle 7 homolog (S. cerevisiae) 1225 156 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18014.[MT7]-RDSVC[CAM]PQGK[MT7].3b4_1.heavy 445.574 / 602.338 19312.0 16.914600372314453 43 13 10 10 10 0.9177662225944714 70.85100565046271 0.0 3 0.9094534860944674 4.06999351501959 19312.0 40.062792178262846 0.0 - - - - - - - 635.3846153846154 38 13 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 1227 156 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18014.[MT7]-RDSVC[CAM]PQGK[MT7].3b5_2.heavy 445.574 / 381.688 40022.0 16.914600372314453 43 13 10 10 10 0.9177662225944714 70.85100565046271 0.0 3 0.9094534860944674 4.06999351501959 40022.0 39.57388979737425 0.0 - - - - - - - 1240.25 80 8 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 1229 156 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18014.[MT7]-RDSVC[CAM]PQGK[MT7].3b3_1.heavy 445.574 / 503.269 10122.0 16.914600372314453 43 13 10 10 10 0.9177662225944714 70.85100565046271 0.0 3 0.9094534860944674 4.06999351501959 10122.0 40.90877598152425 0.0 - - - - - - - 348.6842105263158 20 19 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 1231 156 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18014.[MT7]-RDSVC[CAM]PQGK[MT7].3y4_1.heavy 445.574 / 573.348 52508.0 16.914600372314453 43 13 10 10 10 0.9177662225944714 70.85100565046271 0.0 3 0.9094534860944674 4.06999351501959 52508.0 56.32987139193147 0.0 - - - - - - - 1193.857142857143 105 7 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 1233 157 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18010.[MT7]-TATHAVVFAK[MT7].3y3_1.heavy 444.934 / 509.32 81620.0 25.793899536132812 50 20 10 10 10 4.241444961379144 23.57687083306725 0.0 3 0.9907838381195687 12.84556507254458 81620.0 126.32024291497976 0.0 - - - - - - - 718.2 163 10 ACOX3 acyl-CoA oxidase 3, pristanoyl 1235 157 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18010.[MT7]-TATHAVVFAK[MT7].3b4_1.heavy 444.934 / 555.301 22343.0 25.793899536132812 50 20 10 10 10 4.241444961379144 23.57687083306725 0.0 3 0.9907838381195687 12.84556507254458 22343.0 40.771419351053225 0.0 - - - - - - - 745.0714285714286 44 14 ACOX3 acyl-CoA oxidase 3, pristanoyl 1237 157 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18010.[MT7]-TATHAVVFAK[MT7].3b5_1.heavy 444.934 / 626.338 17270.0 25.793899536132812 50 20 10 10 10 4.241444961379144 23.57687083306725 0.0 3 0.9907838381195687 12.84556507254458 17270.0 49.68912280701754 1.0 - - - - - - - 719.625 34 8 ACOX3 acyl-CoA oxidase 3, pristanoyl 1239 157 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18010.[MT7]-TATHAVVFAK[MT7].3y4_1.heavy 444.934 / 608.389 58081.0 25.793899536132812 50 20 10 10 10 4.241444961379144 23.57687083306725 0.0 3 0.9907838381195687 12.84556507254458 58081.0 213.9826315789474 0.0 - - - - - - - 235.125 116 16 ACOX3 acyl-CoA oxidase 3, pristanoyl 1241 158 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18299.[MT7]-K[MT7]TIFSALENDPLFAR.3y7_1.heavy 670.714 / 832.431 2518.0 45.38352584838867 45 20 10 5 10 7.865333575711965 12.714018933513326 0.04010009765625 3 0.9949753585703346 17.4031481275612 2518.0 26.64395348837209 0.0 - - - - - - - 215.2 5 15 ACOX3 acyl-CoA oxidase 3, pristanoyl 1243 158 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18299.[MT7]-K[MT7]TIFSALENDPLFAR.3b3_1.heavy 670.714 / 631.438 1291.0 45.38352584838867 45 20 10 5 10 7.865333575711965 12.714018933513326 0.04010009765625 3 0.9949753585703346 17.4031481275612 1291.0 2.8881486756126913 0.0 - - - - - - - 227.6315789473684 2 19 ACOX3 acyl-CoA oxidase 3, pristanoyl 1245 158 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18299.[MT7]-K[MT7]TIFSALENDPLFAR.3y8_1.heavy 670.714 / 961.474 2260.0 45.38352584838867 45 20 10 5 10 7.865333575711965 12.714018933513326 0.04010009765625 3 0.9949753585703346 17.4031481275612 2260.0 5.080755858987985 1.0 - - - - - - - 143.55555555555554 5 18 ACOX3 acyl-CoA oxidase 3, pristanoyl 1247 158 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18299.[MT7]-K[MT7]TIFSALENDPLFAR.3y5_1.heavy 670.714 / 603.361 9813.0 45.38352584838867 45 20 10 5 10 7.865333575711965 12.714018933513326 0.04010009765625 3 0.9949753585703346 17.4031481275612 9813.0 51.835776513787884 0.0 - - - - - - - 258.2 19 15 ACOX3 acyl-CoA oxidase 3, pristanoyl 1249 159 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539245.[MT7]-IAPEVLR.2y5_1.heavy 471.299 / 613.367 74420.0 30.832700729370117 50 20 10 10 10 8.13462577962425 12.293128498975541 0.0 3 0.9951325294808782 17.682122207722333 74420.0 152.01582614215806 0.0 - - - - - - - 722.5833333333334 148 12 BPGM 2,3-bisphosphoglycerate mutase 1251 159 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539245.[MT7]-IAPEVLR.2b4_1.heavy 471.299 / 555.326 23789.0 30.832700729370117 50 20 10 10 10 8.13462577962425 12.293128498975541 0.0 3 0.9951325294808782 17.682122207722333 23789.0 57.33965046777547 0.0 - - - - - - - 706.0909090909091 47 11 BPGM 2,3-bisphosphoglycerate mutase 1253 159 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539245.[MT7]-IAPEVLR.2y6_1.heavy 471.299 / 684.404 125675.0 30.832700729370117 50 20 10 10 10 8.13462577962425 12.293128498975541 0.0 3 0.9951325294808782 17.682122207722333 125675.0 228.39014423076924 0.0 - - - - - - - 362.61538461538464 251 13 BPGM 2,3-bisphosphoglycerate mutase 1255 159 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539245.[MT7]-IAPEVLR.2b5_1.heavy 471.299 / 654.394 22749.0 30.832700729370117 50 20 10 10 10 8.13462577962425 12.293128498975541 0.0 3 0.9951325294808782 17.682122207722333 22749.0 49.1841911735054 1.0 - - - - - - - 763.0 62 7 BPGM 2,3-bisphosphoglycerate mutase 1257 160 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17671.[MT7]-QQVAPR.2y4_1.heavy 421.752 / 442.277 514.0 18.175174713134766 16 -1 10 6 1 0.40174902293200515 140.26395734632592 0.0363006591796875 17 0.29065152559291724 1.367932279036111 514.0 -0.7205607476635514 17.0 - - - - - - - 0.0 1 0 CDC7 cell division cycle 7 homolog (S. cerevisiae) 1259 160 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17671.[MT7]-QQVAPR.2b3_1.heavy 421.752 / 500.295 87740.0 18.175174713134766 16 -1 10 6 1 0.40174902293200515 140.26395734632592 0.0363006591796875 17 0.29065152559291724 1.367932279036111 87740.0 -6.588735919899875 0.0 - - - - - - - 207.03571428571428 175 28 CDC7 cell division cycle 7 homolog (S. cerevisiae) 1261 160 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17671.[MT7]-QQVAPR.2y5_1.heavy 421.752 / 570.336 571.0 18.175174713134766 16 -1 10 6 1 0.40174902293200515 140.26395734632592 0.0363006591796875 17 0.29065152559291724 1.367932279036111 571.0 -0.13317784256559762 21.0 - - - - - - - 255.84 5 25 CDC7 cell division cycle 7 homolog (S. cerevisiae) 1263 160 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17671.[MT7]-QQVAPR.2b4_1.heavy 421.752 / 571.332 343.0 18.175174713134766 16 -1 10 6 1 0.40174902293200515 140.26395734632592 0.0363006591796875 17 0.29065152559291724 1.367932279036111 343.0 -0.36042031523642726 23.0 - - - - - - - 216.6551724137931 2 29 CDC7 cell division cycle 7 homolog (S. cerevisiae) 1265 161 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539713.[MT7]-ASFSWK[MT7].2y4_1.heavy 507.287 / 711.395 3497.0 32.32849884033203 38 20 0 10 8 72.95608337155657 1.370687616147265 0.0 4 0.9964106995288718 20.59337249378576 3497.0 14.095286059680001 0.0 - - - - - - - 280.5 6 20 ACOX3 acyl-CoA oxidase 3, pristanoyl 1267 161 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539713.[MT7]-ASFSWK[MT7].2y5_1.heavy 507.287 / 798.427 8962.0 32.32849884033203 38 20 0 10 8 72.95608337155657 1.370687616147265 0.0 4 0.9964106995288718 20.59337249378576 8962.0 38.2378591545754 1.0 - - - - - - - 218.66666666666666 171 21 ACOX3 acyl-CoA oxidase 3, pristanoyl 1269 161 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539713.[MT7]-ASFSWK[MT7].2b4_1.heavy 507.287 / 537.279 3352.0 32.32849884033203 38 20 0 10 8 72.95608337155657 1.370687616147265 0.0 4 0.9964106995288718 20.59337249378576 3352.0 5.174614065180103 0.0 - - - - - - - 611.0 6 13 ACOX3 acyl-CoA oxidase 3, pristanoyl 1271 161 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539713.[MT7]-ASFSWK[MT7].2y3_1.heavy 507.287 / 564.326 8525.0 32.32849884033203 38 20 0 10 8 72.95608337155657 1.370687616147265 0.0 4 0.9964106995288718 20.59337249378576 8525.0 11.512564177790818 0.0 - - - - - - - 1102.125 17 8 ACOX3 acyl-CoA oxidase 3, pristanoyl 1273 162 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588644.[MT7]-WFATTSWIAIYEK[MT7].3y3_1.heavy 635.345 / 583.321 12573.0 48.04217529296875 41 15 10 6 10 3.0523670299019994 32.761459883548355 0.038299560546875 3 0.9512506229421377 5.566696606388747 12573.0 100.3193766864544 0.0 - - - - - - - 159.66666666666666 25 15 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1275 162 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588644.[MT7]-WFATTSWIAIYEK[MT7].3y4_1.heavy 635.345 / 696.405 8382.0 48.04217529296875 41 15 10 6 10 3.0523670299019994 32.761459883548355 0.038299560546875 3 0.9512506229421377 5.566696606388747 8382.0 62.33914597949272 0.0 - - - - - - - 172.27777777777777 16 18 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1277 162 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588644.[MT7]-WFATTSWIAIYEK[MT7].3b3_1.heavy 635.345 / 549.294 5552.0 48.04217529296875 41 15 10 6 10 3.0523670299019994 32.761459883548355 0.038299560546875 3 0.9512506229421377 5.566696606388747 5552.0 44.0950296815974 0.0 - - - - - - - 200.6875 11 16 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1279 162 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588644.[MT7]-WFATTSWIAIYEK[MT7].3y5_1.heavy 635.345 / 767.442 12138.0 48.04217529296875 41 15 10 6 10 3.0523670299019994 32.761459883548355 0.038299560546875 3 0.9512506229421377 5.566696606388747 12138.0 110.90544478527607 0.0 - - - - - - - 169.9375 24 16 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1281 163 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539716.[MT7]-TPVSPVK[MT7].2y4_1.heavy 508.323 / 574.368 5097.0 22.77517557144165 41 15 10 6 10 2.7300178342061105 36.629797339430205 0.03190040588378906 3 0.9598729521022841 6.140174517465028 5097.0 9.71885593220339 1.0 - - - - - - - 689.0 10 10 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1283 163 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539716.[MT7]-TPVSPVK[MT7].2y5_1.heavy 508.323 / 673.437 1085.0 22.77517557144165 41 15 10 6 10 2.7300178342061105 36.629797339430205 0.03190040588378906 3 0.9598729521022841 6.140174517465028 1085.0 0.9194915254237288 4.0 - - - - - - - 278.6 2 20 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1285 163 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539716.[MT7]-TPVSPVK[MT7].2b4_1.heavy 508.323 / 529.31 1935.0 22.77517557144165 41 15 10 6 10 2.7300178342061105 36.629797339430205 0.03190040588378906 3 0.9598729521022841 6.140174517465028 1935.0 4.773702709782266 0.0 - - - - - - - 631.375 3 8 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1287 163 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539716.[MT7]-TPVSPVK[MT7].2y6_1.heavy 508.323 / 770.489 10146.0 22.77517557144165 41 15 10 6 10 2.7300178342061105 36.629797339430205 0.03190040588378906 3 0.9598729521022841 6.140174517465028 10146.0 67.16366197183098 1.0 - - - - - - - 180.88888888888889 21 18 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1289 164 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541939.[MT7]-K[MT7]VEAPFIPK[MT7].3y3_1.heavy 487.645 / 501.352 14400.0 30.48200035095215 44 14 10 10 10 1.4386014844860315 45.40004081403575 0.0 3 0.9471720557645106 5.345641328240054 14400.0 15.479639743584878 0.0 - - - - - - - 777.0 28 9 PRKACA;PRKACB;PRKACG protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta;protein kinase, cAMP-dependent, catalytic, gamma 1291 164 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541939.[MT7]-K[MT7]VEAPFIPK[MT7].3b6_1.heavy 487.645 / 960.576 6438.0 30.48200035095215 44 14 10 10 10 1.4386014844860315 45.40004081403575 0.0 3 0.9471720557645106 5.345641328240054 6438.0 119.2905058528428 0.0 - - - - - - - 146.875 12 8 PRKACA;PRKACB;PRKACG protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta;protein kinase, cAMP-dependent, catalytic, gamma 1293 164 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541939.[MT7]-K[MT7]VEAPFIPK[MT7].3b4_1.heavy 487.645 / 716.455 24300.0 30.48200035095215 44 14 10 10 10 1.4386014844860315 45.40004081403575 0.0 3 0.9471720557645106 5.345641328240054 24300.0 28.4641534303143 0.0 - - - - - - - 302.09090909090907 48 11 PRKACA;PRKACB;PRKACG protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta;protein kinase, cAMP-dependent, catalytic, gamma 1295 164 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541939.[MT7]-K[MT7]VEAPFIPK[MT7].3b3_1.heavy 487.645 / 645.417 14192.0 30.48200035095215 44 14 10 10 10 1.4386014844860315 45.40004081403575 0.0 3 0.9471720557645106 5.345641328240054 14192.0 35.99198863896651 0.0 - - - - - - - 675.0 28 8 PRKACA;PRKACB;PRKACG protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta;protein kinase, cAMP-dependent, catalytic, gamma 1297 165 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 201607.0 37.93320083618164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 201607.0 219.4778635101398 0.0 - - - - - - - 295.57142857142856 403 14 1299 165 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 544371.0 37.93320083618164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 544371.0 223.5941157668455 0.0 - - - - - - - 268.4 1088 10 1301 165 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 483387.0 37.93320083618164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 483387.0 135.01400571176532 0.0 - - - - - - - 615.0 966 8 1303 166 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17755.[MT7]-LAVAIALR.2y5_1.heavy 485.83 / 543.361 4554.0 37.6171989440918 43 13 10 10 10 1.4665599766696242 57.82907650151812 0.0 3 0.9101331328774563 4.085594177114908 4554.0 12.985152605631402 0.0 - - - - - - - 255.5 9 16 ACOX3 acyl-CoA oxidase 3, pristanoyl 1305 166 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17755.[MT7]-LAVAIALR.2b4_1.heavy 485.83 / 499.336 3620.0 37.6171989440918 43 13 10 10 10 1.4665599766696242 57.82907650151812 0.0 3 0.9101331328774563 4.085594177114908 3620.0 17.238549350193185 0.0 - - - - - - - 224.76923076923077 7 13 ACOX3 acyl-CoA oxidase 3, pristanoyl 1307 166 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17755.[MT7]-LAVAIALR.2y6_1.heavy 485.83 / 642.43 2803.0 37.6171989440918 43 13 10 10 10 1.4665599766696242 57.82907650151812 0.0 3 0.9101331328774563 4.085594177114908 2803.0 5.360089477731579 0.0 - - - - - - - 634.0 5 7 ACOX3 acyl-CoA oxidase 3, pristanoyl 1309 166 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17755.[MT7]-LAVAIALR.2y7_1.heavy 485.83 / 713.467 6189.0 37.6171989440918 43 13 10 10 10 1.4665599766696242 57.82907650151812 0.0 3 0.9101331328774563 4.085594177114908 6189.0 20.712364471678573 0.0 - - - - - - - 170.92307692307693 12 13 ACOX3 acyl-CoA oxidase 3, pristanoyl 1311 167 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18016.[MT7]-LRTLGMGSFGR.3y7_1.heavy 446.919 / 711.324 2975.0 33.15802574157715 40 14 10 6 10 1.4117367689128881 46.09775310739715 0.03350067138671875 3 0.9433516616310662 5.16056175439543 2975.0 17.594086021505376 0.0 - - - - - - - 158.64705882352942 5 17 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1313 167 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18016.[MT7]-LRTLGMGSFGR.3y6_1.heavy 446.919 / 654.303 1859.0 33.15802574157715 40 14 10 6 10 1.4117367689128881 46.09775310739715 0.03350067138671875 3 0.9433516616310662 5.16056175439543 1859.0 3.3315412186379927 2.0 - - - - - - - 651.0 5 7 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1315 167 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18016.[MT7]-LRTLGMGSFGR.3b5_1.heavy 446.919 / 685.448 2603.0 33.15802574157715 40 14 10 6 10 1.4117367689128881 46.09775310739715 0.03350067138671875 3 0.9433516616310662 5.16056175439543 2603.0 9.610478325859491 0.0 - - - - - - - 186.0 5 19 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1317 167 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18016.[MT7]-LRTLGMGSFGR.3y5_1.heavy 446.919 / 523.262 10504.0 33.15802574157715 40 14 10 6 10 1.4117367689128881 46.09775310739715 0.03350067138671875 3 0.9433516616310662 5.16056175439543 10504.0 37.43360983102919 0.0 - - - - - - - 709.125 21 8 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1319 168 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18026.[MT7]-FC[CAM]SWVDQK[MT7].2b3_1.heavy 679.344 / 539.24 N/A N/A - - - - - - - - - 0.0 - - - - - - - BPGM 2,3-bisphosphoglycerate mutase 1321 168 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18026.[MT7]-FC[CAM]SWVDQK[MT7].2b4_1.heavy 679.344 / 725.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - BPGM 2,3-bisphosphoglycerate mutase 1323 168 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18026.[MT7]-FC[CAM]SWVDQK[MT7].2b6_1.heavy 679.344 / 939.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - BPGM 2,3-bisphosphoglycerate mutase 1325 168 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18026.[MT7]-FC[CAM]SWVDQK[MT7].2y7_1.heavy 679.344 / 1066.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - BPGM 2,3-bisphosphoglycerate mutase 1327 169 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540699.[MT7]-FSPGDFWGR.2y4_1.heavy 606.8 / 565.288 8219.0 40.121399879455566 40 17 10 3 10 2.7381331539197666 24.65209723948874 0.06829833984375 3 0.9779332531814444 8.292611904152848 8219.0 34.71563176895307 0.0 - - - - - - - 240.0 16 15 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1329 169 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540699.[MT7]-FSPGDFWGR.2y8_1.heavy 606.8 / 921.421 12006.0 40.121399879455566 40 17 10 3 10 2.7381331539197666 24.65209723948874 0.06829833984375 3 0.9779332531814444 8.292611904152848 12006.0 41.51846541226876 0.0 - - - - - - - 193.9 24 10 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1331 169 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540699.[MT7]-FSPGDFWGR.2b5_1.heavy 606.8 / 648.311 5541.0 40.121399879455566 40 17 10 3 10 2.7381331539197666 24.65209723948874 0.06829833984375 3 0.9779332531814444 8.292611904152848 5541.0 35.91977618403248 0.0 - - - - - - - 190.73333333333332 11 15 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1333 169 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540699.[MT7]-FSPGDFWGR.2y7_1.heavy 606.8 / 834.389 10713.0 40.121399879455566 40 17 10 3 10 2.7381331539197666 24.65209723948874 0.06829833984375 3 0.9779332531814444 8.292611904152848 10713.0 84.80820128793053 0.0 - - - - - - - 191.69230769230768 21 13 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1335 170 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17762.[MT7]-EVLPSMR.2b3_1.heavy 488.274 / 486.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCND1 cyclin D1 1337 170 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17762.[MT7]-EVLPSMR.2y4_1.heavy 488.274 / 490.244 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCND1 cyclin D1 1339 170 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17762.[MT7]-EVLPSMR.2y5_1.heavy 488.274 / 603.328 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCND1 cyclin D1 1341 170 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17762.[MT7]-EVLPSMR.2y6_1.heavy 488.274 / 702.397 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCND1 cyclin D1 1343 171 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18025.[MT7]-DMGITEYEPR.2y8_1.heavy 677.825 / 964.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1345 171 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18025.[MT7]-DMGITEYEPR.2b4_1.heavy 677.825 / 561.282 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1347 171 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18025.[MT7]-DMGITEYEPR.2y9_1.heavy 677.825 / 1095.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1349 171 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18025.[MT7]-DMGITEYEPR.2y6_1.heavy 677.825 / 794.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1351 172 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB538390.[MT7]-FAATVR.2y4_1.heavy 404.743 / 446.272 17637.0 24.747699737548828 50 20 10 10 10 1.8306531701006974 31.850935640049432 0.0 3 0.990806772496286 12.861602694190564 17637.0 35.00738381537553 0.0 - - - - - - - 718.2857142857143 35 14 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1353 172 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB538390.[MT7]-FAATVR.2b3_1.heavy 404.743 / 434.252 18875.0 24.747699737548828 50 20 10 10 10 1.8306531701006974 31.850935640049432 0.0 3 0.990806772496286 12.861602694190564 18875.0 30.68922249159801 0.0 - - - - - - - 670.5 37 10 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1355 172 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB538390.[MT7]-FAATVR.2y5_1.heavy 404.743 / 517.309 131915.0 24.747699737548828 50 20 10 10 10 1.8306531701006974 31.850935640049432 0.0 3 0.990806772496286 12.861602694190564 131915.0 152.0755136358979 0.0 - - - - - - - 240.66666666666666 263 3 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1357 172 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB538390.[MT7]-FAATVR.2b4_1.heavy 404.743 / 535.3 21866.0 24.747699737548828 50 20 10 10 10 1.8306531701006974 31.850935640049432 0.0 3 0.990806772496286 12.861602694190564 21866.0 15.476590621039291 0.0 - - - - - - - 1293.909090909091 43 11 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1359 173 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18022.[MT7]-ENLVFLAQK[MT7].2y4_1.heavy 675.405 / 603.395 3848.0 36.545501708984375 50 20 10 10 10 8.435847250699378 11.854173864007489 0.0 3 0.9956543279887328 18.714425377145627 3848.0 10.501364522417154 1.0 - - - - - - - 612.7777777777778 12 9 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1361 173 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18022.[MT7]-ENLVFLAQK[MT7].2b3_1.heavy 675.405 / 501.279 11417.0 36.545501708984375 50 20 10 10 10 8.435847250699378 11.854173864007489 0.0 3 0.9956543279887328 18.714425377145627 11417.0 39.65477497784866 0.0 - - - - - - - 275.14285714285717 22 7 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1363 173 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18022.[MT7]-ENLVFLAQK[MT7].2y5_1.heavy 675.405 / 750.463 8338.0 36.545501708984375 50 20 10 10 10 8.435847250699378 11.854173864007489 0.0 3 0.9956543279887328 18.714425377145627 8338.0 24.478764545679624 0.0 - - - - - - - 221.63636363636363 16 11 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1365 173 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18022.[MT7]-ENLVFLAQK[MT7].2b4_1.heavy 675.405 / 600.347 9493.0 36.545501708984375 50 20 10 10 10 8.435847250699378 11.854173864007489 0.0 3 0.9956543279887328 18.714425377145627 9493.0 8.436101208120363 0.0 - - - - - - - 224.5 18 8 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1367 174 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18165.[MT7]-TGISDALPSEEVLR.2y9_1.heavy 815.942 / 1013.56 5064.0 35.70640182495117 46 16 10 10 10 8.259370347114784 12.107460471842463 0.0 3 0.9645352518572404 6.533892576325283 5064.0 49.87504848736013 0.0 - - - - - - - 225.33333333333334 10 9 PTPRR protein tyrosine phosphatase, receptor type, R 1369 174 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18165.[MT7]-TGISDALPSEEVLR.2b6_1.heavy 815.942 / 689.359 3418.0 35.70640182495117 46 16 10 10 10 8.259370347114784 12.107460471842463 0.0 3 0.9645352518572404 6.533892576325283 3418.0 18.725406698564594 0.0 - - - - - - - 243.46153846153845 6 13 PTPRR protein tyrosine phosphatase, receptor type, R 1371 174 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18165.[MT7]-TGISDALPSEEVLR.2b5_1.heavy 815.942 / 618.321 2532.0 35.70640182495117 46 16 10 10 10 8.259370347114784 12.107460471842463 0.0 3 0.9645352518572404 6.533892576325283 2532.0 12.705957353858956 0.0 - - - - - - - 284.875 5 8 PTPRR protein tyrosine phosphatase, receptor type, R 1373 174 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18165.[MT7]-TGISDALPSEEVLR.2y7_1.heavy 815.942 / 829.441 4810.0 35.70640182495117 46 16 10 10 10 8.259370347114784 12.107460471842463 0.0 3 0.9645352518572404 6.533892576325283 4810.0 18.454879785400838 1.0 - - - - - - - 239.22222222222223 10 9 PTPRR protein tyrosine phosphatase, receptor type, R 1375 175 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542223.[MT7]-LNLPPYLTQEAR.3y7_1.heavy 520.295 / 880.452 7907.0 39.25139904022217 42 16 10 6 10 2.8780143571778156 28.17508169687222 0.036800384521484375 3 0.96679236293499 6.753581946526528 7907.0 81.84968059461632 0.0 - - - - - - - 211.66666666666666 15 9 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1377 175 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542223.[MT7]-LNLPPYLTQEAR.3y6_1.heavy 520.295 / 717.389 23243.0 39.25139904022217 42 16 10 6 10 2.8780143571778156 28.17508169687222 0.036800384521484375 3 0.96679236293499 6.753581946526528 23243.0 60.727325590763186 0.0 - - - - - - - 238.125 46 8 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1379 175 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542223.[MT7]-LNLPPYLTQEAR.3y8_1.heavy 520.295 / 977.505 6763.0 39.25139904022217 42 16 10 6 10 2.8780143571778156 28.17508169687222 0.036800384521484375 3 0.96679236293499 6.753581946526528 6763.0 11.663006095377508 0.0 - - - - - - - 317.44444444444446 13 9 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1381 175 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542223.[MT7]-LNLPPYLTQEAR.3y5_1.heavy 520.295 / 604.305 23148.0 39.25139904022217 42 16 10 6 10 2.8780143571778156 28.17508169687222 0.036800384521484375 3 0.96679236293499 6.753581946526528 23148.0 70.59836220472441 0.0 - - - - - - - 286.0 46 7 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1383 176 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541892.[MT7]-YVTTILDDAK[MT7].2y4_1.heavy 713.905 / 592.306 10838.0 37.44179916381836 43 13 10 10 10 6.211997123807356 16.09788253390395 0.0 3 0.9131901393410153 4.158003530551173 10838.0 23.53837827771327 0.0 - - - - - - - 762.5555555555555 21 9 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1385 176 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541892.[MT7]-YVTTILDDAK[MT7].2y8_1.heavy 713.905 / 1020.57 15775.0 37.44179916381836 43 13 10 10 10 6.211997123807356 16.09788253390395 0.0 3 0.9131901393410153 4.158003530551173 15775.0 67.59956890422824 0.0 - - - - - - - 240.58333333333334 31 12 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1387 176 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541892.[MT7]-YVTTILDDAK[MT7].2y5_1.heavy 713.905 / 705.39 13728.0 37.44179916381836 43 13 10 10 10 6.211997123807356 16.09788253390395 0.0 3 0.9131901393410153 4.158003530551173 13728.0 11.47702256711949 1.0 - - - - - - - 1324.7142857142858 31 7 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1389 176 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541892.[MT7]-YVTTILDDAK[MT7].2y7_1.heavy 713.905 / 919.522 8068.0 37.44179916381836 43 13 10 10 10 6.211997123807356 16.09788253390395 0.0 3 0.9131901393410153 4.158003530551173 8068.0 11.10317219331787 0.0 - - - - - - - 240.66666666666666 16 6 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1391 177 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541612.[MT7]-YLEC[CAM]SALTQR.3y6_1.heavy 462.239 / 675.378 8796.0 31.59910011291504 48 18 10 10 10 4.394213652834748 22.757200241160117 0.0 3 0.9875011551628169 11.027423229953477 8796.0 41.29577464788733 0.0 - - - - - - - 239.1578947368421 17 19 RAC1;RAC2;RAC3 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) 1393 177 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541612.[MT7]-YLEC[CAM]SALTQR.3b3_1.heavy 462.239 / 550.299 27380.0 31.59910011291504 48 18 10 10 10 4.394213652834748 22.757200241160117 0.0 3 0.9875011551628169 11.027423229953477 27380.0 63.23513487879724 0.0 - - - - - - - 741.2727272727273 54 11 RAC1;RAC2;RAC3 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) 1395 177 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541612.[MT7]-YLEC[CAM]SALTQR.3y4_1.heavy 462.239 / 517.309 33481.0 31.59910011291504 48 18 10 10 10 4.394213652834748 22.757200241160117 0.0 3 0.9875011551628169 11.027423229953477 33481.0 33.67221500430324 0.0 - - - - - - - 1287.142857142857 66 7 RAC1;RAC2;RAC3 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) 1397 177 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541612.[MT7]-YLEC[CAM]SALTQR.3y5_1.heavy 462.239 / 588.346 22841.0 31.59910011291504 48 18 10 10 10 4.394213652834748 22.757200241160117 0.0 3 0.9875011551628169 11.027423229953477 22841.0 34.47197019289517 0.0 - - - - - - - 747.2307692307693 45 13 RAC1;RAC2;RAC3 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) 1399 178 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543500.[MT7]-FEISETSVNRGPEK[MT7].4y4_1.heavy 471.004 / 574.332 12308.0 28.740999221801758 40 10 10 10 10 0.6799597041816573 84.38704269485945 0.0 3 0.8457226050926777 3.1007213403981906 12308.0 15.118509767454045 0.0 - - - - - - - 769.375 24 8 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1401 178 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543500.[MT7]-FEISETSVNRGPEK[MT7].4y9_2.heavy 471.004 / 566.316 33322.0 28.740999221801758 40 10 10 10 10 0.6799597041816573 84.38704269485945 0.0 3 0.8457226050926777 3.1007213403981906 33322.0 44.08750665923162 0.0 - - - - - - - 767.0 66 7 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1403 178 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543500.[MT7]-FEISETSVNRGPEK[MT7].4b4_1.heavy 471.004 / 621.336 10802.0 28.740999221801758 40 10 10 10 10 0.6799597041816573 84.38704269485945 0.0 3 0.8457226050926777 3.1007213403981906 10802.0 21.84729930111177 0.0 - - - - - - - 685.4 21 15 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1405 178 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543500.[MT7]-FEISETSVNRGPEK[MT7].4b3_1.heavy 471.004 / 534.304 24157.0 28.740999221801758 40 10 10 10 10 0.6799597041816573 84.38704269485945 0.0 3 0.8457226050926777 3.1007213403981906 24157.0 54.53106870229008 0.0 - - - - - - - 764.0 48 9 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1407 179 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18127.[MT7]-VSIVSLAILNLK[MT7].3y3_1.heavy 520.011 / 518.342 11496.0 49.5276985168457 46 16 10 10 10 1.9504691961274034 40.906246175457625 0.0 3 0.9604894203898753 6.18821311199182 11496.0 86.05944134078213 0.0 - - - - - - - 136.52631578947367 22 19 ACOX3 acyl-CoA oxidase 3, pristanoyl 1409 179 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18127.[MT7]-VSIVSLAILNLK[MT7].3b4_1.heavy 520.011 / 543.362 7336.0 49.5276985168457 46 16 10 10 10 1.9504691961274034 40.906246175457625 0.0 3 0.9604894203898753 6.18821311199182 7336.0 147.54426966292135 0.0 - - - - - - - 96.91666666666667 14 12 ACOX3 acyl-CoA oxidase 3, pristanoyl 1411 179 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18127.[MT7]-VSIVSLAILNLK[MT7].3y4_1.heavy 520.011 / 631.426 11139.0 49.5276985168457 46 16 10 10 10 1.9504691961274034 40.906246175457625 0.0 3 0.9604894203898753 6.18821311199182 11139.0 194.1152414891833 0.0 - - - - - - - 142.36363636363637 22 11 ACOX3 acyl-CoA oxidase 3, pristanoyl 1413 179 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18127.[MT7]-VSIVSLAILNLK[MT7].3b7_1.heavy 520.011 / 814.516 6576.0 49.5276985168457 46 16 10 10 10 1.9504691961274034 40.906246175457625 0.0 3 0.9604894203898753 6.18821311199182 6576.0 89.31582089552239 0.0 - - - - - - - 89.42857142857143 13 7 ACOX3 acyl-CoA oxidase 3, pristanoyl 1415 180 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18128.[MT7]-LNLPPYLTQEAR.2y8_1.heavy 779.939 / 977.505 11702.0 39.26979923248291 44 18 10 6 10 3.8363222429407666 26.066631963467206 0.036800384521484375 3 0.9863735855516551 10.560322464391104 11702.0 44.346098621521946 0.0 - - - - - - - 213.16666666666666 23 6 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1417 180 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18128.[MT7]-LNLPPYLTQEAR.2y9_1.heavy 779.939 / 1074.56 92429.0 39.26979923248291 44 18 10 6 10 3.8363222429407666 26.066631963467206 0.036800384521484375 3 0.9863735855516551 10.560322464391104 92429.0 173.98557488775631 0.0 - - - - - - - 297.25 184 4 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1419 180 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18128.[MT7]-LNLPPYLTQEAR.2y6_1.heavy 779.939 / 717.389 2011.0 39.26979923248291 44 18 10 6 10 3.8363222429407666 26.066631963467206 0.036800384521484375 3 0.9863735855516551 10.560322464391104 2011.0 2.1995312499999997 1.0 - - - - - - - 653.1428571428571 4 7 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1421 180 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18128.[MT7]-LNLPPYLTQEAR.2y10_1.heavy 779.939 / 1187.64 5028.0 39.26979923248291 44 18 10 6 10 3.8363222429407666 26.066631963467206 0.036800384521484375 3 0.9863735855516551 10.560322464391104 5028.0 9.901969365426696 0.0 - - - - - - - 309.3076923076923 10 13 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1423 181 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17786.[MT7]-ELSVFK[MT7].2y4_1.heavy 505.81 / 624.384 15207.0 33.20814895629883 44 18 10 6 10 5.606498735560385 17.83644386927784 0.0334014892578125 3 0.98883951933097 11.671217963679291 15207.0 28.404861791555312 0.0 - - - - - - - 284.25 30 12 INPP5A;FCRL2 inositol polyphosphate-5-phosphatase, 40kDa;Fc receptor-like 2 1425 181 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17786.[MT7]-ELSVFK[MT7].2y5_1.heavy 505.81 / 737.468 16037.0 33.20814895629883 44 18 10 6 10 5.606498735560385 17.83644386927784 0.0334014892578125 3 0.98883951933097 11.671217963679291 16037.0 50.24455886054639 0.0 - - - - - - - 249.11764705882354 32 17 INPP5A;FCRL2 inositol polyphosphate-5-phosphatase, 40kDa;Fc receptor-like 2 1427 181 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17786.[MT7]-ELSVFK[MT7].2b4_1.heavy 505.81 / 573.336 4977.0 33.20814895629883 44 18 10 6 10 5.606498735560385 17.83644386927784 0.0334014892578125 3 0.98883951933097 11.671217963679291 4977.0 12.563503574683285 0.0 - - - - - - - 665.5555555555555 9 9 INPP5A;FCRL2 inositol polyphosphate-5-phosphatase, 40kDa;Fc receptor-like 2 1429 181 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17786.[MT7]-ELSVFK[MT7].2y3_1.heavy 505.81 / 537.352 7650.0 33.20814895629883 44 18 10 6 10 5.606498735560385 17.83644386927784 0.0334014892578125 3 0.98883951933097 11.671217963679291 7650.0 19.74121416901341 0.0 - - - - - - - 716.6666666666666 15 9 INPP5A;FCRL2 inositol polyphosphate-5-phosphatase, 40kDa;Fc receptor-like 2 1431 182 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17785.[MT7]-DLEPLK[MT7].2y4_1.heavy 501.807 / 630.394 2671.0 28.133633931477863 37 15 10 6 6 2.136651103576117 46.80221297367165 0.03730010986328125 6 0.9506299921545311 5.531305116028227 2671.0 5.21534170153417 3.0 - - - - - - - 675.0 5 11 UBA7 ubiquitin-like modifier activating enzyme 7 1433 182 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17785.[MT7]-DLEPLK[MT7].2y5_1.heavy 501.807 / 743.478 3192.0 28.133633931477863 37 15 10 6 6 2.136651103576117 46.80221297367165 0.03730010986328125 6 0.9506299921545311 5.531305116028227 3192.0 3.7776711452335254 0.0 - - - - - - - 729.5333333333333 6 15 UBA7 ubiquitin-like modifier activating enzyme 7 1435 182 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17785.[MT7]-DLEPLK[MT7].2b4_1.heavy 501.807 / 599.316 2280.0 28.133633931477863 37 15 10 6 6 2.136651103576117 46.80221297367165 0.03730010986328125 6 0.9506299921545311 5.531305116028227 2280.0 5.585474174247077 2.0 - - - - - - - 777.9411764705883 5 17 UBA7 ubiquitin-like modifier activating enzyme 7 1437 183 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18029.[MT7]-FVQSEAQQER.2y8_1.heavy 683.348 / 975.449 5694.0 23.31760025024414 50 20 10 10 10 7.402500072146114 13.50894954750176 0.0 3 0.9936220260103917 15.44507070990669 5694.0 168.39702127659575 0.0 - - - - - - - 125.28571428571429 11 14 CDC7 cell division cycle 7 homolog (S. cerevisiae) 1439 183 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18029.[MT7]-FVQSEAQQER.2y5_1.heavy 683.348 / 631.316 2041.0 23.31760025024414 50 20 10 10 10 7.402500072146114 13.50894954750176 0.0 3 0.9936220260103917 15.44507070990669 2041.0 11.145500777259606 0.0 - - - - - - - 246.33333333333334 4 21 CDC7 cell division cycle 7 homolog (S. cerevisiae) 1441 183 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18029.[MT7]-FVQSEAQQER.2y9_1.heavy 683.348 / 1074.52 5789.0 23.31760025024414 50 20 10 10 10 7.402500072146114 13.50894954750176 0.0 3 0.9936220260103917 15.44507070990669 5789.0 49.66352631578947 0.0 - - - - - - - 122.58823529411765 11 17 CDC7 cell division cycle 7 homolog (S. cerevisiae) 1443 183 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18029.[MT7]-FVQSEAQQER.2y7_1.heavy 683.348 / 847.39 4034.0 23.31760025024414 50 20 10 10 10 7.402500072146114 13.50894954750176 0.0 3 0.9936220260103917 15.44507070990669 4034.0 48.408 0.0 - - - - - - - 97.47058823529412 8 17 CDC7 cell division cycle 7 homolog (S. cerevisiae) 1445 184 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 482315.0 40.794532775878906 23 -3 10 6 10 null 0.0 0.032901763916015625 3 0.0 0.0 482315.0 229.8127056582224 0.0 - - - - - - - 329.5 964 2 1447 184 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 600828.0 40.794532775878906 23 -3 10 6 10 null 0.0 0.032901763916015625 3 0.0 0.0 600828.0 154.0168915272531 1.0 - - - - - - - 631.3333333333334 1201 3 1449 184 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 981312.0 40.794532775878906 23 -3 10 6 10 null 0.0 0.032901763916015625 3 0.0 0.0 981312.0 316.12871392293647 0.0 - - - - - - - 1317.5 1962 2 1451 185 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540257.[MT7]-LLDLNPASR.2y8_1.heavy 571.836 / 885.479 5807.0 35.68095016479492 41 20 8 3 10 24.20033003900254 4.132175050457356 0.0509033203125 3 0.9958033081177311 19.043940986325687 5807.0 14.94034391110593 0.0 - - - - - - - 302.1111111111111 11 9 CDC7 cell division cycle 7 homolog (S. cerevisiae) 1453 185 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540257.[MT7]-LLDLNPASR.2y6_1.heavy 571.836 / 657.368 5683.0 35.68095016479492 41 20 8 3 10 24.20033003900254 4.132175050457356 0.0509033203125 3 0.9958033081177311 19.043940986325687 5683.0 17.46281067961165 0.0 - - - - - - - 247.33333333333334 11 6 CDC7 cell division cycle 7 homolog (S. cerevisiae) 1455 185 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540257.[MT7]-LLDLNPASR.2b5_1.heavy 571.836 / 713.431 1730.0 35.68095016479492 41 20 8 3 10 24.20033003900254 4.132175050457356 0.0509033203125 3 0.9958033081177311 19.043940986325687 1730.0 4.616662212482406 1.0 - - - - - - - 321.4 14 5 CDC7 cell division cycle 7 homolog (S. cerevisiae) 1457 185 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540257.[MT7]-LLDLNPASR.2y7_1.heavy 571.836 / 772.395 3336.0 35.68095016479492 41 20 8 3 10 24.20033003900254 4.132175050457356 0.0509033203125 3 0.9958033081177311 19.043940986325687 3336.0 20.248187959012192 0.0 - - - - - - - 274.55555555555554 6 9 CDC7 cell division cycle 7 homolog (S. cerevisiae) 1459 186 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541968.[MT7]-LALPPYLTPDAR.3y7_1.heavy 490.953 / 835.431 12014.0 41.28929901123047 46 20 10 6 10 3.581837125555256 20.075308910104987 0.0352020263671875 3 0.9983960959680622 30.811661349723387 12014.0 10.083029247885488 0.0 - - - - - - - 256.0769230769231 24 13 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 1461 186 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541968.[MT7]-LALPPYLTPDAR.3y6_1.heavy 490.953 / 672.367 39531.0 41.28929901123047 46 20 10 6 10 3.581837125555256 20.075308910104987 0.0352020263671875 3 0.9983960959680622 30.811661349723387 39531.0 42.03028125296039 0.0 - - - - - - - 182.75 79 4 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 1463 186 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541968.[MT7]-LALPPYLTPDAR.3b3_1.heavy 490.953 / 442.315 231018.0 41.28929901123047 46 20 10 6 10 3.581837125555256 20.075308910104987 0.0352020263671875 3 0.9983960959680622 30.811661349723387 231018.0 94.31258999596764 0.0 - - - - - - - 690.0 462 2 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 1465 186 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541968.[MT7]-LALPPYLTPDAR.3y5_1.heavy 490.953 / 559.284 25894.0 41.28929901123047 46 20 10 6 10 3.581837125555256 20.075308910104987 0.0352020263671875 3 0.9983960959680622 30.811661349723387 25894.0 110.06751226462876 0.0 - - - - - - - 316.6 51 10 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 1467 187 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18031.[MT7]-ATIISEQQAK[MT7].2y9_1.heavy 688.903 / 1161.66 2292.0 25.15260076522827 40 14 10 6 10 1.9191872875725096 52.10538890474068 0.030000686645507812 3 0.9407206685962404 5.043611502885216 2292.0 18.37343924815395 0.0 - - - - - - - 116.125 4 16 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1469 187 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18031.[MT7]-ATIISEQQAK[MT7].2b4_1.heavy 688.903 / 543.362 4803.0 25.15260076522827 40 14 10 6 10 1.9191872875725096 52.10538890474068 0.030000686645507812 3 0.9407206685962404 5.043611502885216 4803.0 4.174042788976217 1.0 - - - - - - - 272.7894736842105 9 19 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1471 187 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18031.[MT7]-ATIISEQQAK[MT7].2y6_1.heavy 688.903 / 834.444 5458.0 25.15260076522827 40 14 10 6 10 1.9191872875725096 52.10538890474068 0.030000686645507812 3 0.9407206685962404 5.043611502885216 5458.0 33.519827267533685 0.0 - - - - - - - 169.83333333333334 10 18 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1473 187 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18031.[MT7]-ATIISEQQAK[MT7].2y7_1.heavy 688.903 / 947.528 5403.0 25.15260076522827 40 14 10 6 10 1.9191872875725096 52.10538890474068 0.030000686645507812 3 0.9407206685962404 5.043611502885216 5403.0 27.01160333945231 0.0 - - - - - - - 189.76190476190476 10 21 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1475 188 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18033.[MT7]-SNVSDAVAQSTR.2y9_1.heavy 689.856 / 934.459 3778.0 22.615800857543945 42 16 10 6 10 1.4521312495922618 45.55914964668568 0.03079986572265625 3 0.9619068101529598 6.3030438753723885 3778.0 86.75912008654886 0.0 - - - - - - - 172.3 7 20 TPI1 triosephosphate isomerase 1 1477 188 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18033.[MT7]-SNVSDAVAQSTR.2b5_1.heavy 689.856 / 647.312 2739.0 22.615800857543945 42 16 10 6 10 1.4521312495922618 45.55914964668568 0.03079986572265625 3 0.9619068101529598 6.3030438753723885 2739.0 13.084961790927794 0.0 - - - - - - - 207.3913043478261 5 23 TPI1 triosephosphate isomerase 1 1479 188 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18033.[MT7]-SNVSDAVAQSTR.2y11_1.heavy 689.856 / 1147.57 1606.0 22.615800857543945 42 16 10 6 10 1.4521312495922618 45.55914964668568 0.03079986572265625 3 0.9619068101529598 6.3030438753723885 1606.0 34.72562965190587 0.0 - - - - - - - 133.0 3 22 TPI1 triosephosphate isomerase 1 1481 188 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18033.[MT7]-SNVSDAVAQSTR.2y7_1.heavy 689.856 / 732.4 2503.0 22.615800857543945 42 16 10 6 10 1.4521312495922618 45.55914964668568 0.03079986572265625 3 0.9619068101529598 6.3030438753723885 2503.0 25.03 1.0 - - - - - - - 103.65 5 20 TPI1 triosephosphate isomerase 1 1483 189 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18032.[MT7]-K[MT7]ATVDADDVR.2b8_1.heavy 689.382 / 1104.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1485 189 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18032.[MT7]-K[MT7]ATVDADDVR.2y5_1.heavy 689.382 / 575.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1487 189 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18032.[MT7]-K[MT7]ATVDADDVR.2y9_1.heavy 689.382 / 961.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1489 189 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18032.[MT7]-K[MT7]ATVDADDVR.2b5_1.heavy 689.382 / 803.487 N/A N/A - - - - - - - - - 0.0 - - - - - - - TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1491 190 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17793.[MT7]-SLEC[CAM]TK[MT7].2b3_1.heavy 513.281 / 474.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 1493 190 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17793.[MT7]-SLEC[CAM]TK[MT7].2y4_1.heavy 513.281 / 681.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 1495 190 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17793.[MT7]-SLEC[CAM]TK[MT7].2y5_1.heavy 513.281 / 794.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 1497 190 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17793.[MT7]-SLEC[CAM]TK[MT7].2y3_1.heavy 513.281 / 552.293 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 1499 191 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18037.[MT7]-YLEC[CAM]SALTQR.2b3_1.heavy 692.854 / 550.299 6734.0 31.607200145721436 43 17 10 6 10 6.972291079550639 14.342487836357652 0.03240013122558594 3 0.9725927827345909 7.437602710926884 6734.0 17.416755546075088 0.0 - - - - - - - 685.4545454545455 13 11 RAC1;RAC2;RAC3 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) 1501 191 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18037.[MT7]-YLEC[CAM]SALTQR.2y8_1.heavy 692.854 / 964.452 9443.0 31.607200145721436 43 17 10 6 10 6.972291079550639 14.342487836357652 0.03240013122558594 3 0.9725927827345909 7.437602710926884 9443.0 45.45298998489341 0.0 - - - - - - - 202.9090909090909 18 22 RAC1;RAC2;RAC3 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) 1503 191 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18037.[MT7]-YLEC[CAM]SALTQR.2y9_1.heavy 692.854 / 1077.54 16324.0 31.607200145721436 43 17 10 6 10 6.972291079550639 14.342487836357652 0.03240013122558594 3 0.9725927827345909 7.437602710926884 16324.0 137.44515617686523 0.0 - - - - - - - 192.57894736842104 32 19 RAC1;RAC2;RAC3 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) 1505 191 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18037.[MT7]-YLEC[CAM]SALTQR.2y7_1.heavy 692.854 / 835.409 6588.0 31.607200145721436 43 17 10 6 10 6.972291079550639 14.342487836357652 0.03240013122558594 3 0.9725927827345909 7.437602710926884 6588.0 13.17740487804878 0.0 - - - - - - - 748.2222222222222 13 9 RAC1;RAC2;RAC3 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) 1507 192 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 165222.0 35.89830017089844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 165222.0 579.1892891102558 0.0 - - - - - - - 263.45454545454544 330 11 1509 192 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 46666.0 35.89830017089844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 46666.0 88.69185187404798 2.0 - - - - - - - 658.7777777777778 95 9 1511 192 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 43387.0 35.89830017089844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 43387.0 73.92537058399424 0.0 - - - - - - - 769.6 86 10 1513 193 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18135.[MT7]-LVTQDTENELK[MT7].3y3_1.heavy 526.626 / 533.341 24655.0 29.279600143432617 46 16 10 10 10 2.4100983667080413 35.30716088361976 0.0 3 0.9681343119968868 6.895101522572257 24655.0 50.69519868428645 0.0 - - - - - - - 794.0909090909091 49 11 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1515 193 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18135.[MT7]-LVTQDTENELK[MT7].3b4_1.heavy 526.626 / 586.368 20893.0 29.279600143432617 46 16 10 10 10 2.4100983667080413 35.30716088361976 0.0 3 0.9681343119968868 6.895101522572257 20893.0 53.42648668567563 0.0 - - - - - - - 694.1111111111111 41 9 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1517 193 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18135.[MT7]-LVTQDTENELK[MT7].3b5_1.heavy 526.626 / 701.395 38024.0 29.279600143432617 46 16 10 10 10 2.4100983667080413 35.30716088361976 0.0 3 0.9681343119968868 6.895101522572257 38024.0 144.93382653829389 0.0 - - - - - - - 291.0833333333333 76 12 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1519 193 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18135.[MT7]-LVTQDTENELK[MT7].3y4_1.heavy 526.626 / 647.385 42928.0 29.279600143432617 46 16 10 10 10 2.4100983667080413 35.30716088361976 0.0 3 0.9681343119968868 6.895101522572257 42928.0 112.90221245421245 0.0 - - - - - - - 732.2 85 10 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1521 194 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18130.[MT7]-RAYPDANLLNDR.3b5_1.heavy 521.278 / 747.391 14458.0 29.486949920654297 34 8 10 6 10 0.9498829501669386 68.39597232714112 0.035900115966796875 3 0.791396016498296 2.653657619187701 14458.0 39.21207065584854 0.0 - - - - - - - 253.3846153846154 28 13 CCND1 cyclin D1 1523 194 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18130.[MT7]-RAYPDANLLNDR.3b3_1.heavy 521.278 / 535.311 9750.0 29.486949920654297 34 8 10 6 10 0.9498829501669386 68.39597232714112 0.035900115966796875 3 0.791396016498296 2.653657619187701 9750.0 9.520446096654274 1.0 - - - - - - - 815.375 19 8 CCND1 cyclin D1 1525 194 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18130.[MT7]-RAYPDANLLNDR.3y4_1.heavy 521.278 / 517.273 41557.0 29.486949920654297 34 8 10 6 10 0.9498829501669386 68.39597232714112 0.035900115966796875 3 0.791396016498296 2.653657619187701 41557.0 48.24226562358801 0.0 - - - - - - - 1689.625 83 8 CCND1 cyclin D1 1527 194 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18130.[MT7]-RAYPDANLLNDR.3b7_1.heavy 521.278 / 932.471 8809.0 29.486949920654297 34 8 10 6 10 0.9498829501669386 68.39597232714112 0.035900115966796875 3 0.791396016498296 2.653657619187701 8809.0 43.2416096475719 0.0 - - - - - - - 186.23076923076923 17 13 CCND1 cyclin D1 1529 195 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588368.[MT7]-QSLGELIGTLNAAK[MT7].3b6_1.heavy 568.336 / 772.432 7162.0 41.97434997558594 34 10 10 6 8 0.6649869020490422 86.35538582971363 0.03510284423828125 4 0.8275427383932745 2.9280123923279637 7162.0 100.22894342194954 0.0 - - - - - - - 215.07142857142858 14 14 TPI1 triosephosphate isomerase 1 1531 195 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588368.[MT7]-QSLGELIGTLNAAK[MT7].3b4_1.heavy 568.336 / 530.305 2930.0 41.97434997558594 34 10 10 6 8 0.6649869020490422 86.35538582971363 0.03510284423828125 4 0.8275427383932745 2.9280123923279637 2930.0 11.014496314496313 0.0 - - - - - - - 275.04761904761904 5 21 TPI1 triosephosphate isomerase 1 1533 195 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588368.[MT7]-QSLGELIGTLNAAK[MT7].3b5_1.heavy 568.336 / 659.348 4395.0 41.97434997558594 34 10 10 6 8 0.6649869020490422 86.35538582971363 0.03510284423828125 4 0.8275427383932745 2.9280123923279637 4395.0 43.40740740740741 1.0 - - - - - - - 212.76923076923077 9 13 TPI1 triosephosphate isomerase 1 1535 195 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588368.[MT7]-QSLGELIGTLNAAK[MT7].3y4_1.heavy 568.336 / 547.332 9441.0 41.97434997558594 34 10 10 6 8 0.6649869020490422 86.35538582971363 0.03510284423828125 4 0.8275427383932745 2.9280123923279637 9441.0 45.891112466056526 0.0 - - - - - - - 248.88235294117646 18 17 TPI1 triosephosphate isomerase 1 1537 196 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541249.[MT7]-LLDEELYSR.2y8_1.heavy 641.344 / 1024.49 33169.0 36.36869812011719 46 16 10 10 10 3.3526384390002466 29.82725450997928 0.0 3 0.9649277129868815 6.5705659196977875 33169.0 77.80302420212928 0.0 - - - - - - - 663.5 66 10 UBA7 ubiquitin-like modifier activating enzyme 7 1539 196 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541249.[MT7]-LLDEELYSR.2y6_1.heavy 641.344 / 796.384 18524.0 36.36869812011719 46 16 10 10 10 3.3526384390002466 29.82725450997928 0.0 3 0.9649277129868815 6.5705659196977875 18524.0 68.7717365269461 0.0 - - - - - - - 237.5 37 10 UBA7 ubiquitin-like modifier activating enzyme 7 1541 196 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541249.[MT7]-LLDEELYSR.2b5_1.heavy 641.344 / 744.39 6509.0 36.36869812011719 46 16 10 10 10 3.3526384390002466 29.82725450997928 0.0 3 0.9649277129868815 6.5705659196977875 6509.0 20.099911574985846 0.0 - - - - - - - 187.5 13 8 UBA7 ubiquitin-like modifier activating enzyme 7 1543 196 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541249.[MT7]-LLDEELYSR.2y7_1.heavy 641.344 / 911.411 15395.0 36.36869812011719 46 16 10 10 10 3.3526384390002466 29.82725450997928 0.0 3 0.9649277129868815 6.5705659196977875 15395.0 144.05981916932907 0.0 - - - - - - - 203.125 30 8 UBA7 ubiquitin-like modifier activating enzyme 7 1545 197 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17776.[MT7]-ISINEK[MT7].2y4_1.heavy 496.305 / 647.385 3567.0 25.921899795532227 50 20 10 10 10 8.444438776492477 11.842113211641578 0.0 3 0.9932413795228819 15.003356664648486 3567.0 6.927087011349306 0.0 - - - - - - - 668.0 7 10 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1547 197 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17776.[MT7]-ISINEK[MT7].2y5_1.heavy 496.305 / 734.417 15854.0 25.921899795532227 50 20 10 10 10 8.444438776492477 11.842113211641578 0.0 3 0.9932413795228819 15.003356664648486 15854.0 39.97815168455944 0.0 - - - - - - - 720.7272727272727 31 11 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1549 197 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17776.[MT7]-ISINEK[MT7].2b4_1.heavy 496.305 / 572.352 1416.0 25.921899795532227 50 20 10 10 10 8.444438776492477 11.842113211641578 0.0 3 0.9932413795228819 15.003356664648486 1416.0 2.915294117647059 11.0 - - - - - - - 667.3571428571429 4 14 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1551 197 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17776.[MT7]-ISINEK[MT7].2y3_1.heavy 496.305 / 534.3 7247.0 25.921899795532227 50 20 10 10 10 8.444438776492477 11.842113211641578 0.0 3 0.9932413795228819 15.003356664648486 7247.0 14.44631931548953 0.0 - - - - - - - 639.0 14 14 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1553 198 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17775.[MT7]-DSLALGK[MT7].2y4_1.heavy 496.305 / 532.357 3707.0 26.871599197387695 45 17 10 10 8 2.1663291341470226 31.36765557865194 0.0 4 0.9707693737798883 7.200782662837526 3707.0 10.527021313862221 1.0 - - - - - - - 707.4285714285714 8 14 PIK3CB;PIK3CD phosphoinositide-3-kinase, catalytic, beta polypeptide;phosphoinositide-3-kinase, catalytic, delta polypeptide 1555 198 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17775.[MT7]-DSLALGK[MT7].2b4_1.heavy 496.305 / 531.289 4254.0 26.871599197387695 45 17 10 10 8 2.1663291341470226 31.36765557865194 0.0 4 0.9707693737798883 7.200782662837526 4254.0 8.264453060551066 1.0 - - - - - - - 745.9090909090909 8 11 PIK3CB;PIK3CD phosphoinositide-3-kinase, catalytic, beta polypeptide;phosphoinositide-3-kinase, catalytic, delta polypeptide 1557 198 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17775.[MT7]-DSLALGK[MT7].2y3_1.heavy 496.305 / 461.32 N/A 26.871599197387695 45 17 10 10 8 2.1663291341470226 31.36765557865194 0.0 4 0.9707693737798883 7.200782662837526 7353.0 3.775146130065684 1.0 - - - - - - - 1754.75 14 8 PIK3CB;PIK3CD phosphoinositide-3-kinase, catalytic, beta polypeptide;phosphoinositide-3-kinase, catalytic, delta polypeptide 1559 198 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17775.[MT7]-DSLALGK[MT7].2y6_1.heavy 496.305 / 732.474 2917.0 26.871599197387695 45 17 10 10 8 2.1663291341470226 31.36765557865194 0.0 4 0.9707693737798883 7.200782662837526 2917.0 7.352438356164384 1.0 - - - - - - - 245.56 5 25 PIK3CB;PIK3CD phosphoinositide-3-kinase, catalytic, beta polypeptide;phosphoinositide-3-kinase, catalytic, delta polypeptide 1561 199 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18038.[MT7]-IGPHC[CAM]FELLR.3y6_1.heavy 462.588 / 837.429 23686.0 36.13629913330078 42 12 10 10 10 1.1324910370466528 61.815212976476516 0.0 3 0.8882849967386822 3.6574471894136864 23686.0 180.6403112840467 0.0 - - - - - - - 235.83333333333334 47 6 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 1563 199 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18038.[MT7]-IGPHC[CAM]FELLR.3b4_1.heavy 462.588 / 549.326 24330.0 36.13629913330078 42 12 10 10 10 1.1324910370466528 61.815212976476516 0.0 3 0.8882849967386822 3.6574471894136864 24330.0 56.53839631267503 0.0 - - - - - - - 643.7142857142857 48 7 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 1565 199 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18038.[MT7]-IGPHC[CAM]FELLR.3y4_1.heavy 462.588 / 530.33 33341.0 36.13629913330078 42 12 10 10 10 1.1324910370466528 61.815212976476516 0.0 3 0.8882849967386822 3.6574471894136864 33341.0 67.53900544862007 0.0 - - - - - - - 257.2 66 5 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 1567 199 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18038.[MT7]-IGPHC[CAM]FELLR.3y5_1.heavy 462.588 / 677.398 27677.0 36.13629913330078 42 12 10 10 10 1.1324910370466528 61.815212976476516 0.0 3 0.8882849967386822 3.6574471894136864 27677.0 105.40204663212435 0.0 - - - - - - - 257.375 55 8 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 1569 200 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18048.[MT7]-TILISAHGNSSR.2y8_1.heavy 700.392 / 815.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - BPGM 2,3-bisphosphoglycerate mutase 1571 200 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18048.[MT7]-TILISAHGNSSR.2y10_1.heavy 700.392 / 1041.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - BPGM 2,3-bisphosphoglycerate mutase 1573 200 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18048.[MT7]-TILISAHGNSSR.2b9_2.heavy 700.392 / 526.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - BPGM 2,3-bisphosphoglycerate mutase 1575 200 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18048.[MT7]-TILISAHGNSSR.2y11_1.heavy 700.392 / 1154.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - BPGM 2,3-bisphosphoglycerate mutase 1577 201 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18045.[MT7]-VAMEYLQSASR.2y8_1.heavy 699.862 / 953.469 2048.0 34.11852550506592 36 11 10 5 10 1.4146827924337178 62.697996126791594 0.040302276611328125 3 0.8686619772160982 3.367402802571354 2048.0 2.2797773654916513 1.0 - - - - - - - 296.3333333333333 4 12 PTPRR protein tyrosine phosphatase, receptor type, R 1579 201 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18045.[MT7]-VAMEYLQSASR.2y9_1.heavy 699.862 / 1084.51 3126.0 34.11852550506592 36 11 10 5 10 1.4146827924337178 62.697996126791594 0.040302276611328125 3 0.8686619772160982 3.367402802571354 3126.0 9.22822256568779 0.0 - - - - - - - 215.66666666666666 6 15 PTPRR protein tyrosine phosphatase, receptor type, R 1581 201 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18045.[MT7]-VAMEYLQSASR.2b4_1.heavy 699.862 / 575.298 1509.0 34.11852550506592 36 11 10 5 10 1.4146827924337178 62.697996126791594 0.040302276611328125 3 0.8686619772160982 3.367402802571354 1509.0 5.721090702736094 2.0 - - - - - - - 727.375 3 8 PTPRR protein tyrosine phosphatase, receptor type, R 1583 201 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18045.[MT7]-VAMEYLQSASR.2y10_1.heavy 699.862 / 1155.55 3557.0 34.11852550506592 36 11 10 5 10 1.4146827924337178 62.697996126791594 0.040302276611328125 3 0.8686619772160982 3.367402802571354 3557.0 15.876024968932498 0.0 - - - - - - - 209.72222222222223 7 18 PTPRR protein tyrosine phosphatase, receptor type, R 1585 202 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17782.[MT7]-RQQVAPR.2b3_1.heavy 499.802 / 557.328 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC7 cell division cycle 7 homolog (S. cerevisiae) 1587 202 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17782.[MT7]-RQQVAPR.2b3_2.heavy 499.802 / 279.167 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC7 cell division cycle 7 homolog (S. cerevisiae) 1589 202 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17782.[MT7]-RQQVAPR.2y6_1.heavy 499.802 / 698.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC7 cell division cycle 7 homolog (S. cerevisiae) 1591 202 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17782.[MT7]-RQQVAPR.2b5_1.heavy 499.802 / 727.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC7 cell division cycle 7 homolog (S. cerevisiae) 1593 203 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB538761.[MT7]-SLLQVDLTK[MT7].3y3_1.heavy 435.606 / 505.347 40989.0 37.061100006103516 41 11 10 10 10 1.8174048817977242 37.26410650389298 0.0 3 0.864455656447195 3.313519189266226 40989.0 79.77724832214766 0.0 - - - - - - - 255.42857142857142 81 7 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1595 203 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB538761.[MT7]-SLLQVDLTK[MT7].3b4_1.heavy 435.606 / 586.368 31667.0 37.061100006103516 41 11 10 10 10 1.8174048817977242 37.26410650389298 0.0 3 0.864455656447195 3.313519189266226 31667.0 73.3069762320668 0.0 - - - - - - - 229.9 63 10 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1597 203 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB538761.[MT7]-SLLQVDLTK[MT7].3y4_1.heavy 435.606 / 620.374 37285.0 37.061100006103516 41 11 10 10 10 1.8174048817977242 37.26410650389298 0.0 3 0.864455656447195 3.313519189266226 37285.0 72.66279545743093 0.0 - - - - - - - 610.2222222222222 74 9 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1599 203 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB538761.[MT7]-SLLQVDLTK[MT7].3b3_1.heavy 435.606 / 458.31 17494.0 37.061100006103516 41 11 10 10 10 1.8174048817977242 37.26410650389298 0.0 3 0.864455656447195 3.313519189266226 17494.0 55.48992790463587 0.0 - - - - - - - 306.2 34 5 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1601 204 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542245.[MT7]-VDGVAAALDSFQAR.3y6_1.heavy 521.946 / 723.342 29398.0 40.80550003051758 43 13 10 10 10 3.8084976781734823 26.25707259140539 0.0 3 0.9274313611544349 4.55329592989667 29398.0 124.47801801801802 0.0 - - - - - - - 256.38461538461536 58 13 UBA7 ubiquitin-like modifier activating enzyme 7 1603 204 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542245.[MT7]-VDGVAAALDSFQAR.3b4_1.heavy 521.946 / 515.295 17322.0 40.80550003051758 43 13 10 10 10 3.8084976781734823 26.25707259140539 0.0 3 0.9274313611544349 4.55329592989667 17322.0 76.2168 0.0 - - - - - - - 782.8 34 10 UBA7 ubiquitin-like modifier activating enzyme 7 1605 204 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542245.[MT7]-VDGVAAALDSFQAR.3b5_1.heavy 521.946 / 586.332 13242.0 40.80550003051758 43 13 10 10 10 3.8084976781734823 26.25707259140539 0.0 3 0.9274313611544349 4.55329592989667 13242.0 16.56677617234061 0.0 - - - - - - - 243.3846153846154 26 13 UBA7 ubiquitin-like modifier activating enzyme 7 1607 204 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542245.[MT7]-VDGVAAALDSFQAR.3y5_1.heavy 521.946 / 608.315 13825.0 40.80550003051758 43 13 10 10 10 3.8084976781734823 26.25707259140539 0.0 3 0.9274313611544349 4.55329592989667 13825.0 36.74211711711712 0.0 - - - - - - - 541.5 27 8 UBA7 ubiquitin-like modifier activating enzyme 7 1609 205 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17939.[MT7]-HILYNEQR.3y6_1.heavy 406.223 / 822.41 567.0 21.845300674438477 48 18 10 10 10 3.042725987405607 26.13345905139375 0.0 3 0.9821841105346366 9.232338514828225 567.0 15.682978723404256 0.0 - - - - - - - 0.0 1 0 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1611 205 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17939.[MT7]-HILYNEQR.3b3_1.heavy 406.223 / 508.336 27343.0 21.845300674438477 48 18 10 10 10 3.042725987405607 26.13345905139375 0.0 3 0.9821841105346366 9.232338514828225 27343.0 88.78432941176472 0.0 - - - - - - - 736.7 54 10 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1613 205 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17939.[MT7]-HILYNEQR.3y4_1.heavy 406.223 / 546.263 46752.0 21.845300674438477 48 18 10 10 10 3.042725987405607 26.13345905139375 0.0 3 0.9821841105346366 9.232338514828225 46752.0 88.76164672962877 0.0 - - - - - - - 684.6 93 10 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1615 205 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17939.[MT7]-HILYNEQR.3y5_1.heavy 406.223 / 709.326 20826.0 21.845300674438477 48 18 10 10 10 3.042725987405607 26.13345905139375 0.0 3 0.9821841105346366 9.232338514828225 20826.0 98.95845224327019 0.0 - - - - - - - 241.33333333333334 41 18 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1617 206 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541901.[MT7]-YVTTILDDAK[MT7].3b4_1.heavy 476.273 / 609.336 44589.0 37.48640060424805 50 20 10 10 10 18.420390358440255 5.428766603427588 0.0 3 0.998777726859472 35.29669077231896 44589.0 108.94814295182547 0.0 - - - - - - - 285.72727272727275 89 11 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1619 206 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541901.[MT7]-YVTTILDDAK[MT7].3b3_1.heavy 476.273 / 508.289 22959.0 37.48640060424805 50 20 10 10 10 18.420390358440255 5.428766603427588 0.0 3 0.998777726859472 35.29669077231896 22959.0 146.1027272727273 0.0 - - - - - - - 293.7142857142857 45 14 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1621 206 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541901.[MT7]-YVTTILDDAK[MT7].3y4_1.heavy 476.273 / 592.306 119991.0 37.48640060424805 50 20 10 10 10 18.420390358440255 5.428766603427588 0.0 3 0.998777726859472 35.29669077231896 119991.0 140.23478327313146 1.0 - - - - - - - 322.3333333333333 266 9 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1623 206 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541901.[MT7]-YVTTILDDAK[MT7].3y5_1.heavy 476.273 / 705.39 34076.0 37.48640060424805 50 20 10 10 10 18.420390358440255 5.428766603427588 0.0 3 0.998777726859472 35.29669077231896 34076.0 86.95255172413793 0.0 - - - - - - - 282.3333333333333 68 6 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1625 207 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541257.[MT7]-LAEIIWQNR.2y8_1.heavy 643.87 / 1029.55 41269.0 40.714924812316895 46 20 10 6 10 9.980859473304545 10.019177232929339 0.032901763916015625 3 0.9971129620888871 22.963156497016413 41269.0 113.04417641162061 0.0 - - - - - - - 721.4285714285714 82 7 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1627 207 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541257.[MT7]-LAEIIWQNR.2y5_1.heavy 643.87 / 716.384 15412.0 40.714924812316895 46 20 10 6 10 9.980859473304545 10.019177232929339 0.032901763916015625 3 0.9971129620888871 22.963156497016413 15412.0 129.78526315789475 0.0 - - - - - - - 235.4375 30 16 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1629 207 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541257.[MT7]-LAEIIWQNR.2b4_1.heavy 643.87 / 571.357 20634.0 40.714924812316895 46 20 10 6 10 9.980859473304545 10.019177232929339 0.032901763916015625 3 0.9971129620888871 22.963156497016413 20634.0 63.004029492275585 0.0 - - - - - - - 623.7142857142857 41 7 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1631 207 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541257.[MT7]-LAEIIWQNR.2y6_1.heavy 643.87 / 829.468 15668.0 40.714924812316895 46 20 10 6 10 9.980859473304545 10.019177232929339 0.032901763916015625 3 0.9971129620888871 22.963156497016413 15668.0 46.33338521400778 0.0 - - - - - - - 242.5 31 12 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1633 208 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18049.[MT7]-QIEHTLNEK[MT7].3y3_1.heavy 467.264 / 534.3 26402.0 22.18199920654297 41 14 10 7 10 2.2258437299808254 34.82933297320852 0.0279998779296875 3 0.9323342140092421 4.717348253869179 26402.0 62.08102784023985 0.0 - - - - - - - 664.3636363636364 52 11 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 1635 208 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18049.[MT7]-QIEHTLNEK[MT7].3y4_1.heavy 467.264 / 647.385 11315.0 22.18199920654297 41 14 10 7 10 2.2258437299808254 34.82933297320852 0.0279998779296875 3 0.9323342140092421 4.717348253869179 11315.0 76.47649845916794 0.0 - - - - - - - 243.95652173913044 22 23 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 1637 208 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18049.[MT7]-QIEHTLNEK[MT7].3b3_1.heavy 467.264 / 515.295 19047.0 22.18199920654297 41 14 10 7 10 2.2258437299808254 34.82933297320852 0.0279998779296875 3 0.9323342140092421 4.717348253869179 19047.0 33.979485807737376 0.0 - - - - - - - 732.4666666666667 38 15 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 1639 208 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18049.[MT7]-QIEHTLNEK[MT7].3y5_1.heavy 467.264 / 748.432 3253.0 22.18199920654297 41 14 10 7 10 2.2258437299808254 34.82933297320852 0.0279998779296875 3 0.9323342140092421 4.717348253869179 3253.0 20.60470525548264 0.0 - - - - - - - 137.2608695652174 6 23 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 1641 209 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544006.[MT7]-QQTIILDDELIQWK[MT7].3b4_1.heavy 677.717 / 615.358 27529.0 44.05622482299805 44 18 10 6 10 4.135288076797661 24.18211213895389 0.0381011962890625 3 0.9820668822906646 9.202022791968774 27529.0 46.336584041548626 0.0 - - - - - - - 709.5714285714286 55 7 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1643 209 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544006.[MT7]-QQTIILDDELIQWK[MT7].3b5_1.heavy 677.717 / 728.442 23945.0 44.05622482299805 44 18 10 6 10 4.135288076797661 24.18211213895389 0.0381011962890625 3 0.9820668822906646 9.202022791968774 23945.0 124.492993397748 0.0 - - - - - - - 292.1764705882353 47 17 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1645 209 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544006.[MT7]-QQTIILDDELIQWK[MT7].3y4_1.heavy 677.717 / 718.437 15556.0 44.05622482299805 44 18 10 6 10 4.135288076797661 24.18211213895389 0.0381011962890625 3 0.9820668822906646 9.202022791968774 15556.0 62.682819909774935 0.0 - - - - - - - 249.73333333333332 31 15 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1647 209 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB544006.[MT7]-QQTIILDDELIQWK[MT7].3b3_1.heavy 677.717 / 502.274 8389.0 44.05622482299805 44 18 10 6 10 4.135288076797661 24.18211213895389 0.0381011962890625 3 0.9820668822906646 9.202022791968774 8389.0 27.663113496932514 0.0 - - - - - - - 296.88235294117646 16 17 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1649 210 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588698.[MT7]-SVDFLDAYPGILDQK[MT7].3y7_1.heavy 657.022 / 914.543 21623.0 44.19779968261719 43 13 10 10 10 1.8362420548874854 36.30603410330433 0.0 3 0.9290444616260911 4.605398117730386 21623.0 96.33062390250078 0.0 - - - - - - - 252.9375 43 16 ACOX3 acyl-CoA oxidase 3, pristanoyl 1651 210 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588698.[MT7]-SVDFLDAYPGILDQK[MT7].3b6_1.heavy 657.022 / 821.416 16412.0 44.19779968261719 43 13 10 10 10 1.8362420548874854 36.30603410330433 0.0 3 0.9290444616260911 4.605398117730386 16412.0 65.06893568305244 0.0 - - - - - - - 237.94117647058823 32 17 ACOX3 acyl-CoA oxidase 3, pristanoyl 1653 210 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588698.[MT7]-SVDFLDAYPGILDQK[MT7].3b4_1.heavy 657.022 / 593.305 16879.0 44.19779968261719 43 13 10 10 10 1.8362420548874854 36.30603410330433 0.0 3 0.9290444616260911 4.605398117730386 16879.0 42.56397166210897 0.0 - - - - - - - 748.625 33 8 ACOX3 acyl-CoA oxidase 3, pristanoyl 1655 210 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588698.[MT7]-SVDFLDAYPGILDQK[MT7].3b7_1.heavy 657.022 / 892.453 17112.0 44.19779968261719 43 13 10 10 10 1.8362420548874854 36.30603410330433 0.0 3 0.9290444616260911 4.605398117730386 17112.0 156.47554786049963 0.0 - - - - - - - 209.53846153846155 34 13 ACOX3 acyl-CoA oxidase 3, pristanoyl 1657 211 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17934.[MT7]-QAFPMISK[MT7].2y6_1.heavy 605.349 / 866.493 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1659 212 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17729.[MT7]-GPLDAYR.2y4_1.heavy 468.257 / 524.246 6710.0 27.965700149536133 48 18 10 10 10 2.9680678403300877 33.69195226645449 0.0 3 0.980858259927786 8.90587213999754 6710.0 3.303493912122816 1.0 - - - - - - - 723.2 13 10 ACOX3 acyl-CoA oxidase 3, pristanoyl 1661 212 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17729.[MT7]-GPLDAYR.2b4_1.heavy 468.257 / 527.295 43646.0 27.965700149536133 48 18 10 10 10 2.9680678403300877 33.69195226645449 0.0 3 0.980858259927786 8.90587213999754 43646.0 66.65812739831159 0.0 - - - - - - - 667.625 87 8 ACOX3 acyl-CoA oxidase 3, pristanoyl 1663 212 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17729.[MT7]-GPLDAYR.2y6_1.heavy 468.257 / 734.383 25471.0 27.965700149536133 48 18 10 10 10 2.9680678403300877 33.69195226645449 0.0 3 0.980858259927786 8.90587213999754 25471.0 52.54886615515772 0.0 - - - - - - - 707.1428571428571 50 7 ACOX3 acyl-CoA oxidase 3, pristanoyl 1665 212 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17729.[MT7]-GPLDAYR.2b5_1.heavy 468.257 / 598.332 13354.0 27.965700149536133 48 18 10 10 10 2.9680678403300877 33.69195226645449 0.0 3 0.980858259927786 8.90587213999754 13354.0 56.60962959126763 0.0 - - - - - - - 749.125 26 8 ACOX3 acyl-CoA oxidase 3, pristanoyl 1667 213 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539491.[MT7]-EIDSVK[MT7].2y4_1.heavy 489.789 / 592.342 7464.0 22.471500873565674 44 17 10 7 10 4.036819949381885 24.771974290136953 0.029600143432617188 3 0.9744127763486063 7.698752883337315 7464.0 13.530099630099631 0.0 - - - - - - - 657.0 14 7 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1669 213 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539491.[MT7]-EIDSVK[MT7].2b3_1.heavy 489.789 / 502.263 12743.0 22.471500873565674 44 17 10 7 10 4.036819949381885 24.771974290136953 0.029600143432617188 3 0.9744127763486063 7.698752883337315 12743.0 26.98615281475664 0.0 - - - - - - - 665.875 25 8 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1671 213 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539491.[MT7]-EIDSVK[MT7].2y5_1.heavy 489.789 / 705.426 7782.0 22.471500873565674 44 17 10 7 10 4.036819949381885 24.771974290136953 0.029600143432617188 3 0.9744127763486063 7.698752883337315 7782.0 27.53601899426833 0.0 - - - - - - - 273.23809523809524 15 21 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1673 213 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539491.[MT7]-EIDSVK[MT7].2b4_1.heavy 489.789 / 589.295 2503.0 22.471500873565674 44 17 10 7 10 4.036819949381885 24.771974290136953 0.029600143432617188 3 0.9744127763486063 7.698752883337315 2503.0 6.65632967032967 1.0 - - - - - - - 608.75 5 8 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1675 214 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539201.[MT7]-FDSQER.2b3_1.heavy 463.228 / 494.237 1052.0 19.755850791931152 37 16 8 7 6 2.946402618024391 33.939692894738045 0.027299880981445312 5 0.964883568125679 6.566410220665456 1052.0 1.9004362385736264 3.0 - - - - - - - 308.2857142857143 2 14 STAT5B signal transducer and activator of transcription 5B 1677 214 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539201.[MT7]-FDSQER.2y4_1.heavy 463.228 / 519.252 5948.0 19.755850791931152 37 16 8 7 6 2.946402618024391 33.939692894738045 0.027299880981445312 5 0.964883568125679 6.566410220665456 5948.0 18.176038272780985 0.0 - - - - - - - 311.8 11 10 STAT5B signal transducer and activator of transcription 5B 1679 214 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539201.[MT7]-FDSQER.2y5_1.heavy 463.228 / 634.279 4787.0 19.755850791931152 37 16 8 7 6 2.946402618024391 33.939692894738045 0.027299880981445312 5 0.964883568125679 6.566410220665456 4787.0 24.32016091954023 0.0 - - - - - - - 222.85714285714286 9 14 STAT5B signal transducer and activator of transcription 5B 1681 214 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539201.[MT7]-FDSQER.2b4_1.heavy 463.228 / 622.295 2829.0 19.755850791931152 37 16 8 7 6 2.946402618024391 33.939692894738045 0.027299880981445312 5 0.964883568125679 6.566410220665456 2829.0 3.3119729166104865 3.0 - - - - - - - 471.0 16 1 STAT5B signal transducer and activator of transcription 5B 1683 215 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18196.[MT7]-LTFDTTFSPNTGK[MT7].2b3_1.heavy 858.956 / 506.31 1015.0 36.69835090637207 38 13 10 5 10 2.435630809237707 41.05712557942949 0.044101715087890625 3 0.9160000441506921 4.227998744033 1015.0 4.955118110236221 2.0 - - - - - - - 269.875 2 8 VDAC2 voltage-dependent anion channel 2 1685 215 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18196.[MT7]-LTFDTTFSPNTGK[MT7].2y5_1.heavy 858.956 / 660.38 2157.0 36.69835090637207 38 13 10 5 10 2.435630809237707 41.05712557942949 0.044101715087890625 3 0.9160000441506921 4.227998744033 2157.0 11.853215650188696 0.0 - - - - - - - 254.0 4 6 VDAC2 voltage-dependent anion channel 2 1687 215 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18196.[MT7]-LTFDTTFSPNTGK[MT7].2b4_1.heavy 858.956 / 621.336 1776.0 36.69835090637207 38 13 10 5 10 2.435630809237707 41.05712557942949 0.044101715087890625 3 0.9160000441506921 4.227998744033 1776.0 6.921690056881691 0.0 - - - - - - - 215.9 3 10 VDAC2 voltage-dependent anion channel 2 1689 215 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18196.[MT7]-LTFDTTFSPNTGK[MT7].2y7_1.heavy 858.956 / 894.48 1142.0 36.69835090637207 38 13 10 5 10 2.435630809237707 41.05712557942949 0.044101715087890625 3 0.9160000441506921 4.227998744033 1142.0 16.095905511811026 0.0 - - - - - - - 169.33333333333334 2 6 VDAC2 voltage-dependent anion channel 2 1691 216 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588158.[MT7]-DLLTMNEELK[MT7].3y3_1.heavy 498.609 / 533.341 5034.0 36.785149574279785 36 14 10 2 10 2.105677607343266 37.8958688628787 0.08620071411132812 3 0.9338436958039648 4.771477661662456 5034.0 29.39751937984496 0.0 - - - - - - - 645.0 10 7 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 1693 216 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588158.[MT7]-DLLTMNEELK[MT7].3b4_1.heavy 498.609 / 587.352 9164.0 36.785149574279785 36 14 10 2 10 2.105677607343266 37.8958688628787 0.08620071411132812 3 0.9338436958039648 4.771477661662456 9164.0 37.970717327219134 0.0 - - - - - - - 693.5 18 8 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 1695 216 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588158.[MT7]-DLLTMNEELK[MT7].3b5_1.heavy 498.609 / 718.393 1162.0 36.785149574279785 36 14 10 2 10 2.105677607343266 37.8958688628787 0.08620071411132812 3 0.9338436958039648 4.771477661662456 1162.0 0.6503875968992247 3.0 - - - - - - - 258.0 3 9 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 1697 216 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588158.[MT7]-DLLTMNEELK[MT7].3y4_1.heavy 498.609 / 662.384 5034.0 36.785149574279785 36 14 10 2 10 2.105677607343266 37.8958688628787 0.08620071411132812 3 0.9338436958039648 4.771477661662456 5034.0 31.018604651162793 1.0 - - - - - - - 258.0 10 7 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 1699 217 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18396.[MT7]-LC[CAM]IYTDNSIRPEELLQMELLLVNK[MT7].4y4_1.heavy 798.937 / 617.41 1345.0 50.52705097198486 43 17 10 6 10 5.580865244134085 17.91836850121182 0.032596588134765625 3 0.9750011279480292 7.789207048721143 1345.0 7.603263392584448 0.0 - - - - - - - 238.95454545454547 2 22 CCND1 cyclin D1 1701 217 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18396.[MT7]-LC[CAM]IYTDNSIRPEELLQMELLLVNK[MT7].4b14_2.heavy 798.937 / 924.968 1253.0 50.52705097198486 43 17 10 6 10 5.580865244134085 17.91836850121182 0.032596588134765625 3 0.9750011279480292 7.789207048721143 1253.0 11.349900353584054 0.0 - - - - - - - 154.04166666666666 2 24 CCND1 cyclin D1 1703 217 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18396.[MT7]-LC[CAM]IYTDNSIRPEELLQMELLLVNK[MT7].4y3_1.heavy 798.937 / 504.326 2170.0 50.52705097198486 43 17 10 6 10 5.580865244134085 17.91836850121182 0.032596588134765625 3 0.9750011279480292 7.789207048721143 2170.0 22.643793911007027 0.0 - - - - - - - 201.75 4 20 CCND1 cyclin D1 1705 217 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18396.[MT7]-LC[CAM]IYTDNSIRPEELLQMELLLVNK[MT7].4b3_1.heavy 798.937 / 531.308 581.0 50.52705097198486 43 17 10 6 10 5.580865244134085 17.91836850121182 0.032596588134765625 3 0.9750011279480292 7.789207048721143 581.0 0.9498637602179836 4.0 - - - - - - - 190.2962962962963 3 27 CCND1 cyclin D1 1707 218 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18052.[MT7]-AYPDANLLNDR.2b4_1.heavy 703.363 / 591.289 8700.0 32.753400802612305 40 14 10 6 10 2.609232817649115 38.32544161011232 0.035800933837890625 3 0.9345809700079568 4.79859179479396 8700.0 22.602543635019448 0.0 - - - - - - - 645.7142857142857 17 7 CCND1 cyclin D1 1709 218 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18052.[MT7]-AYPDANLLNDR.2y9_1.heavy 703.363 / 1027.52 45289.0 32.753400802612305 40 14 10 6 10 2.609232817649115 38.32544161011232 0.035800933837890625 3 0.9345809700079568 4.79859179479396 45289.0 119.70025323962525 0.0 - - - - - - - 743.1428571428571 90 7 CCND1 cyclin D1 1711 218 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18052.[MT7]-AYPDANLLNDR.2y10_1.heavy 703.363 / 1190.58 8614.0 32.753400802612305 40 14 10 6 10 2.609232817649115 38.32544161011232 0.035800933837890625 3 0.9345809700079568 4.79859179479396 8614.0 38.49089974075744 0.0 - - - - - - - 211.0 17 19 CCND1 cyclin D1 1713 218 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18052.[MT7]-AYPDANLLNDR.2y7_1.heavy 703.363 / 815.437 14926.0 32.753400802612305 40 14 10 6 10 2.609232817649115 38.32544161011232 0.035800933837890625 3 0.9345809700079568 4.79859179479396 14926.0 188.56557453936347 0.0 - - - - - - - 250.375 29 16 CCND1 cyclin D1 1715 219 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18192.[MT7]-AVLC[CAM]PQPTRQQK[MT7].3y6_1.heavy 571.994 / 901.534 2276.0 21.97825002670288 31 13 9 3 6 1.4777756346746083 47.9767353924036 0.05980110168457031 5 0.9267333421906329 4.531283311847701 2276.0 5.294229642880805 0.0 - - - - - - - 162.5 4 14 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1717 219 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18192.[MT7]-AVLC[CAM]PQPTRQQK[MT7].3y8_1.heavy 571.994 / 1126.64 1812.0 21.97825002670288 31 13 9 3 6 1.4777756346746083 47.9767353924036 0.05980110168457031 5 0.9267333421906329 4.531283311847701 1812.0 42.75580177653109 0.0 - - - - - - - 194.1818181818182 3 11 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1719 219 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18192.[MT7]-AVLC[CAM]PQPTRQQK[MT7].3y8_2.heavy 571.994 / 563.826 3252.0 21.97825002670288 31 13 9 3 6 1.4777756346746083 47.9767353924036 0.05980110168457031 5 0.9267333421906329 4.531283311847701 3252.0 4.490721875285191 2.0 - - - - - - - 245.52380952380952 7 21 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1721 219 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18192.[MT7]-AVLC[CAM]PQPTRQQK[MT7].3y9_2.heavy 571.994 / 643.841 3020.0 21.97825002670288 31 13 9 3 6 1.4777756346746083 47.9767353924036 0.05980110168457031 5 0.9267333421906329 4.531283311847701 3020.0 3.531191219604504 1.0 - - - - - - - 185.6875 6 16 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1723 220 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539610.[MT7]-LNITLLR.2y4_1.heavy 493.828 / 502.335 8324.0 39.314924240112305 41 18 10 3 10 4.899378841732774 20.410750674800397 0.0718994140625 3 0.9856652508664777 10.295493306856162 8324.0 22.87355266716515 0.0 - - - - - - - 259.5 16 14 PTPRR protein tyrosine phosphatase, receptor type, R 1725 220 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539610.[MT7]-LNITLLR.2y5_1.heavy 493.828 / 615.419 6698.0 39.314924240112305 41 18 10 3 10 4.899378841732774 20.410750674800397 0.0718994140625 3 0.9856652508664777 10.295493306856162 6698.0 17.50348432055749 0.0 - - - - - - - 693.625 13 8 PTPRR protein tyrosine phosphatase, receptor type, R 1727 220 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539610.[MT7]-LNITLLR.2b4_1.heavy 493.828 / 586.368 4019.0 39.314924240112305 41 18 10 3 10 4.899378841732774 20.410750674800397 0.0718994140625 3 0.9856652508664777 10.295493306856162 4019.0 4.728235294117647 1.0 - - - - - - - 717.5 8 8 PTPRR protein tyrosine phosphatase, receptor type, R 1729 220 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539610.[MT7]-LNITLLR.2y6_1.heavy 493.828 / 729.462 17988.0 39.314924240112305 41 18 10 3 10 4.899378841732774 20.410750674800397 0.0718994140625 3 0.9856652508664777 10.295493306856162 17988.0 67.33983497238926 0.0 - - - - - - - 277.5 35 10 PTPRR protein tyrosine phosphatase, receptor type, R 1731 221 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17949.[MT7]-K[MT7]VEDQGK[MT7].3y3_1.heavy 412.582 / 476.295 25256.0 15.486924886703491 43 16 10 7 10 3.2291237111630764 30.96815388469018 0.02670001983642578 3 0.9654971106783613 6.624879165534867 25256.0 60.87372603325561 0.0 - - - - - - - 678.375 50 8 BPGM 2,3-bisphosphoglycerate mutase 1733 221 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17949.[MT7]-K[MT7]VEDQGK[MT7].3b4_1.heavy 412.582 / 760.444 3547.0 15.486924886703491 43 16 10 7 10 3.2291237111630764 30.96815388469018 0.02670001983642578 3 0.9654971106783613 6.624879165534867 3547.0 53.53962264150944 0.0 - - - - - - - 113.33333333333333 7 21 BPGM 2,3-bisphosphoglycerate mutase 1735 221 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17949.[MT7]-K[MT7]VEDQGK[MT7].3y4_1.heavy 412.582 / 591.322 11913.0 15.486924886703491 43 16 10 7 10 3.2291237111630764 30.96815388469018 0.02670001983642578 3 0.9654971106783613 6.624879165534867 11913.0 59.4027922583155 0.0 - - - - - - - 155.6 23 25 BPGM 2,3-bisphosphoglycerate mutase 1737 221 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17949.[MT7]-K[MT7]VEDQGK[MT7].3y5_1.heavy 412.582 / 720.364 3653.0 15.486924886703491 43 16 10 7 10 3.2291237111630764 30.96815388469018 0.02670001983642578 3 0.9654971106783613 6.624879165534867 3653.0 53.86034162378502 0.0 - - - - - - - 83.26315789473684 7 19 BPGM 2,3-bisphosphoglycerate mutase 1739 222 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 274159.0 44.38029861450195 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 274159.0 521.5227379435953 0.0 - - - - - - - 281.4 548 5 1741 222 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 402789.0 44.38029861450195 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 402789.0 666.2855382642799 0.0 - - - - - - - 1232.25 805 8 1743 222 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 364607.0 44.38029861450195 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 364607.0 482.18913931648757 0.0 - - - - - - - 313.0 729 4 1745 223 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17710.[MT7]-LAIQC[CAM]R.2y4_1.heavy 452.761 / 576.292 16312.0 25.501800537109375 50 20 10 10 10 8.37917709432101 11.9343461624382 0.0 3 0.9957149064001648 18.846339432163894 16312.0 32.7925740047748 0.0 - - - - - - - 708.8571428571429 32 14 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1747 223 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17710.[MT7]-LAIQC[CAM]R.2y5_1.heavy 452.761 / 647.329 71581.0 25.501800537109375 50 20 10 10 10 8.37917709432101 11.9343461624382 0.0 3 0.9957149064001648 18.846339432163894 71581.0 88.2216040562773 0.0 - - - - - - - 633.4 143 10 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1749 223 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17710.[MT7]-LAIQC[CAM]R.2b4_1.heavy 452.761 / 570.373 11659.0 25.501800537109375 50 20 10 10 10 8.37917709432101 11.9343461624382 0.0 3 0.9957149064001648 18.846339432163894 11659.0 22.71538141941935 0.0 - - - - - - - 700.8333333333334 23 12 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1751 223 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17710.[MT7]-LAIQC[CAM]R.2y3_1.heavy 452.761 / 463.208 15639.0 25.501800537109375 50 20 10 10 10 8.37917709432101 11.9343461624382 0.0 3 0.9957149064001648 18.846339432163894 15639.0 32.222285096551424 0.0 - - - - - - - 698.6923076923077 31 13 TAF9B;TAF9 TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa;TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa 1753 224 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17941.[MT7]-FLSLEPVK[MT7].2y4_1.heavy 610.878 / 616.379 4139.0 38.16499900817871 45 20 10 5 10 9.063400043552633 11.033386976131137 0.041400909423828125 3 0.9975837436892404 25.1017143484937 4139.0 9.695263476303591 0.0 - - - - - - - 252.66666666666666 8 9 CCND1 cyclin D1 1755 224 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17941.[MT7]-FLSLEPVK[MT7].2y6_1.heavy 610.878 / 816.495 4243.0 38.16499900817871 45 20 10 5 10 9.063400043552633 11.033386976131137 0.041400909423828125 3 0.9975837436892404 25.1017143484937 4243.0 25.143703703703707 0.0 - - - - - - - 206.75 8 12 CCND1 cyclin D1 1757 224 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17941.[MT7]-FLSLEPVK[MT7].2b5_1.heavy 610.878 / 734.42 6519.0 38.16499900817871 45 20 10 5 10 9.063400043552633 11.033386976131137 0.041400909423828125 3 0.9975837436892404 25.1017143484937 6519.0 34.93562272089761 0.0 - - - - - - - 244.45454545454547 13 11 CCND1 cyclin D1 1759 224 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17941.[MT7]-FLSLEPVK[MT7].2y7_1.heavy 610.878 / 929.579 6933.0 38.16499900817871 45 20 10 5 10 9.063400043552633 11.033386976131137 0.041400909423828125 3 0.9975837436892404 25.1017143484937 6933.0 31.288714352501167 0.0 - - - - - - - 282.6666666666667 13 15 CCND1 cyclin D1 1761 225 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17804.[MT7]-EAGITEK[MT7].2y5_1.heavy 518.3 / 691.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - TPI1 triosephosphate isomerase 1 1763 225 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17804.[MT7]-EAGITEK[MT7].2b4_1.heavy 518.3 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - TPI1 triosephosphate isomerase 1 1765 225 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17804.[MT7]-EAGITEK[MT7].2y3_1.heavy 518.3 / 521.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - TPI1 triosephosphate isomerase 1 1767 225 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17804.[MT7]-EAGITEK[MT7].2y6_1.heavy 518.3 / 762.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - TPI1 triosephosphate isomerase 1 1769 226 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17805.[MT7]-VTGANTGK[MT7].2y4_1.heavy 518.305 / 563.327 3840.0 17.100749969482422 46 20 10 6 10 7.070427437818718 14.143416487822805 0.03189849853515625 3 0.9951600144823861 17.73229787411037 3840.0 18.17519623233909 0.0 - - - - - - - 154.34782608695653 7 23 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1771 226 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17805.[MT7]-VTGANTGK[MT7].2y5_1.heavy 518.305 / 634.364 1920.0 17.100749969482422 46 20 10 6 10 7.070427437818718 14.143416487822805 0.03189849853515625 3 0.9951600144823861 17.73229787411037 1920.0 20.50813186813187 0.0 - - - - - - - 125.61904761904762 3 21 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1773 226 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17805.[MT7]-VTGANTGK[MT7].2y6_1.heavy 518.305 / 691.385 4263.0 17.100749969482422 46 20 10 6 10 7.070427437818718 14.143416487822805 0.03189849853515625 3 0.9951600144823861 17.73229787411037 4263.0 72.14307692307693 0.0 - - - - - - - 128.23529411764707 8 17 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1775 226 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17805.[MT7]-VTGANTGK[MT7].2y7_1.heavy 518.305 / 792.433 12172.0 17.100749969482422 46 20 10 6 10 7.070427437818718 14.143416487822805 0.03189849853515625 3 0.9951600144823861 17.73229787411037 12172.0 83.66643266619732 0.0 - - - - - - - 200.77777777777777 24 18 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1777 227 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17806.[MT7]-TLGTGSFGR.2y8_1.heavy 520.286 / 794.416 30701.0 27.72624969482422 43 17 10 6 10 3.412311328142021 29.30564956816214 0.034099578857421875 3 0.9771631739815032 8.151068137754315 30701.0 28.78744616709733 0.0 - - - - - - - 252.41666666666666 61 12 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 1779 227 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17806.[MT7]-TLGTGSFGR.2y5_1.heavy 520.286 / 523.262 11287.0 27.72624969482422 43 17 10 6 10 3.412311328142021 29.30564956816214 0.034099578857421875 3 0.9771631739815032 8.151068137754315 11287.0 29.311201550387594 0.0 - - - - - - - 718.4285714285714 22 7 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 1781 227 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17806.[MT7]-TLGTGSFGR.2y6_1.heavy 520.286 / 624.31 7288.0 27.72624969482422 43 17 10 6 10 3.412311328142021 29.30564956816214 0.034099578857421875 3 0.9771631739815032 8.151068137754315 7288.0 43.111483134186315 0.0 - - - - - - - 666.2222222222222 14 9 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 1783 227 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17806.[MT7]-TLGTGSFGR.2y7_1.heavy 520.286 / 681.331 26766.0 27.72624969482422 43 17 10 6 10 3.412311328142021 29.30564956816214 0.034099578857421875 3 0.9771631739815032 8.151068137754315 26766.0 41.174157407571904 0.0 - - - - - - - 238.4 53 10 PRKACA;PRKACB protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta 1785 228 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18258.[MT7]-VVLAYEPVWAIGTGK[MT7].2y4_1.heavy 946.05 / 506.306 836.0 44.473350524902344 39 13 10 6 10 1.378536337620566 46.68449122073861 0.03730010986328125 3 0.9099603115222558 4.081610571027241 836.0 4.29 0.0 - - - - - - - 0.0 1 0 TPI1 triosephosphate isomerase 1 1787 228 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18258.[MT7]-VVLAYEPVWAIGTGK[MT7].2y5_1.heavy 946.05 / 619.39 1977.0 44.473350524902344 39 13 10 6 10 1.378536337620566 46.68449122073861 0.03730010986328125 3 0.9099603115222558 4.081610571027241 1977.0 10.570013157894735 0.0 - - - - - - - 200.85714285714286 3 14 TPI1 triosephosphate isomerase 1 1789 228 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18258.[MT7]-VVLAYEPVWAIGTGK[MT7].2y9_1.heavy 946.05 / 1072.63 2433.0 44.473350524902344 39 13 10 6 10 1.378536337620566 46.68449122073861 0.03730010986328125 3 0.9099603115222558 4.081610571027241 2433.0 14.619342105263156 0.0 - - - - - - - 209.0 4 16 TPI1 triosephosphate isomerase 1 1791 228 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18258.[MT7]-VVLAYEPVWAIGTGK[MT7].2b4_1.heavy 946.05 / 527.367 3498.0 44.473350524902344 39 13 10 6 10 1.378536337620566 46.68449122073861 0.03730010986328125 3 0.9099603115222558 4.081610571027241 3498.0 18.410526315789475 0.0 - - - - - - - 159.6 6 10 TPI1 triosephosphate isomerase 1 1793 229 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18062.[MT7]-HINWEELLAR.3y6_1.heavy 475.597 / 730.409 8532.0 40.138474464416504 41 15 10 6 10 2.270684089601788 34.83038556916747 0.034099578857421875 3 0.9570030122288703 5.93027492109087 8532.0 105.58272661348803 0.0 - - - - - - - 121.66666666666667 17 9 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1795 229 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18062.[MT7]-HINWEELLAR.3b4_1.heavy 475.597 / 695.375 5575.0 40.138474464416504 41 15 10 6 10 2.270684089601788 34.83038556916747 0.034099578857421875 3 0.9570030122288703 5.93027492109087 5575.0 17.269388460036645 0.0 - - - - - - - 168.77777777777777 11 9 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1797 229 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18062.[MT7]-HINWEELLAR.3b3_1.heavy 475.597 / 509.295 20696.0 40.138474464416504 41 15 10 6 10 2.270684089601788 34.83038556916747 0.034099578857421875 3 0.9570030122288703 5.93027492109087 20696.0 75.73752825373678 0.0 - - - - - - - 233.69230769230768 41 13 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1799 229 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18062.[MT7]-HINWEELLAR.3y5_1.heavy 475.597 / 601.367 11235.0 40.138474464416504 41 15 10 6 10 2.270684089601788 34.83038556916747 0.034099578857421875 3 0.9570030122288703 5.93027492109087 11235.0 90.41183431952663 0.0 - - - - - - - 161.66666666666666 22 12 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1801 230 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588142.[MT7]-VQVEDIVFLIR.2y8_1.heavy 737.941 / 1004.58 30951.0 48.59149932861328 44 14 10 10 10 3.3495186248653384 29.855036260328397 0.0 3 0.9455896610154509 5.266626684062129 30951.0 202.24386381279805 0.0 - - - - - - - 169.0 61 18 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 1803 230 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588142.[MT7]-VQVEDIVFLIR.2y6_1.heavy 737.941 / 760.508 15475.0 48.59149932861328 44 14 10 10 10 3.3495186248653384 29.855036260328397 0.0 3 0.9455896610154509 5.266626684062129 15475.0 78.00826978592197 0.0 - - - - - - - 175.8 30 15 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 1805 230 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588142.[MT7]-VQVEDIVFLIR.2y10_1.heavy 737.941 / 1231.7 25928.0 48.59149932861328 44 14 10 10 10 3.3495186248653384 29.855036260328397 0.0 3 0.9455896610154509 5.266626684062129 25928.0 262.94960930117907 0.0 - - - - - - - 184.85714285714286 51 14 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 1807 230 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588142.[MT7]-VQVEDIVFLIR.2b5_1.heavy 737.941 / 715.374 17809.0 48.59149932861328 44 14 10 10 10 3.3495186248653384 29.855036260328397 0.0 3 0.9455896610154509 5.266626684062129 17809.0 93.30912676056337 0.0 - - - - - - - 219.77777777777777 35 18 TAF13 TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa 1809 231 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18262.[MT7]-WFATTSWIAIYEK[MT7].2y4_1.heavy 952.513 / 696.405 942.0 48.05813344319662 33 15 2 6 10 2.8409981557141353 35.198896486035636 0.038299560546875 3 0.9554170733417527 5.8230593971258475 942.0 8.074285714285715 0.0 - - - - - - - 0.0 1 0 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1811 231 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18262.[MT7]-WFATTSWIAIYEK[MT7].2b3_1.heavy 952.513 / 549.294 2145.0 48.05813344319662 33 15 2 6 10 2.8409981557141353 35.198896486035636 0.038299560546875 3 0.9554170733417527 5.8230593971258475 2145.0 7.058917197452228 0.0 - - - - - - - 173.25 4 16 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1813 231 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18262.[MT7]-WFATTSWIAIYEK[MT7].2y8_1.heavy 952.513 / 1153.64 N/A 48.05813344319662 33 15 2 6 10 2.8409981557141353 35.198896486035636 0.038299560546875 3 0.9554170733417527 5.8230593971258475 1255.0 1.2778757815022455 4.0 - - - - - - - 225.6875 11 16 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1815 231 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18262.[MT7]-WFATTSWIAIYEK[MT7].2y3_1.heavy 952.513 / 583.321 2616.0 48.05813344319662 33 15 2 6 10 2.8409981557141353 35.198896486035636 0.038299560546875 3 0.9554170733417527 5.8230593971258475 2616.0 38.16646405823476 0.0 - - - - - - - 148.27777777777777 5 18 PRKACG protein kinase, cAMP-dependent, catalytic, gamma 1817 232 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18069.[MT7]-DRFQAEGSLK[MT7].3y6_1.heavy 480.268 / 748.432 1770.0 24.66837501525879 37 13 10 6 8 2.531694273348025 39.49924011470609 0.03530120849609375 4 0.9135874809299338 4.167694764438288 1770.0 7.444230375076861 0.0 - - - - - - - 179.8 3 20 CDC7 cell division cycle 7 homolog (S. cerevisiae) 1819 232 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18069.[MT7]-DRFQAEGSLK[MT7].3b4_1.heavy 480.268 / 691.364 1341.0 24.66837501525879 37 13 10 6 8 2.531694273348025 39.49924011470609 0.03530120849609375 4 0.9135874809299338 4.167694764438288 1341.0 5.7040151116341 0.0 - - - - - - - 248.125 2 24 CDC7 cell division cycle 7 homolog (S. cerevisiae) 1821 232 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18069.[MT7]-DRFQAEGSLK[MT7].3b3_1.heavy 480.268 / 563.306 2575.0 24.66837501525879 37 13 10 6 8 2.531694273348025 39.49924011470609 0.03530120849609375 4 0.9135874809299338 4.167694764438288 2575.0 6.664078674948241 2.0 - - - - - - - 304.94736842105266 6 19 CDC7 cell division cycle 7 homolog (S. cerevisiae) 1823 232 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18069.[MT7]-DRFQAEGSLK[MT7].3y4_1.heavy 480.268 / 548.352 12177.0 24.66837501525879 37 13 10 6 8 2.531694273348025 39.49924011470609 0.03530120849609375 4 0.9135874809299338 4.167694764438288 12177.0 25.030332054435895 0.0 - - - - - - - 712.0 24 11 CDC7 cell division cycle 7 homolog (S. cerevisiae) 1825 233 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540495.[MT7]-AVLC[CAM]PQPTR.2y8_1.heavy 593.33 / 970.514 8261.0 24.304675579071045 46 20 10 6 10 23.54564848953114 4.247069263964506 0.03930091857910156 3 0.995098584645041 17.6207369747898 8261.0 66.14199346405228 0.0 - - - - - - - 150.0 16 17 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1827 233 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540495.[MT7]-AVLC[CAM]PQPTR.2y5_1.heavy 593.33 / 598.331 9842.0 24.304675579071045 46 20 10 6 10 23.54564848953114 4.247069263964506 0.03930091857910156 3 0.995098584645041 17.6207369747898 9842.0 138.94588235294117 0.0 - - - - - - - 192.23076923076923 19 13 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1829 233 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540495.[MT7]-AVLC[CAM]PQPTR.2y6_1.heavy 593.33 / 758.361 6731.0 24.304675579071045 46 20 10 6 10 23.54564848953114 4.247069263964506 0.03930091857910156 3 0.995098584645041 17.6207369747898 6731.0 28.133820261437908 0.0 - - - - - - - 141.23076923076923 13 13 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1831 233 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB540495.[MT7]-AVLC[CAM]PQPTR.2y7_1.heavy 593.33 / 871.445 8924.0 24.304675579071045 46 20 10 6 10 23.54564848953114 4.247069263964506 0.03930091857910156 3 0.995098584645041 17.6207369747898 8924.0 53.806470588235285 0.0 - - - - - - - 184.875 17 16 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1833 234 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17811.[MT7]-GTAHDQK[MT7].2y5_1.heavy 522.787 / 742.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKACB protein kinase, cAMP-dependent, catalytic, beta 1835 234 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17811.[MT7]-GTAHDQK[MT7].2b4_1.heavy 522.787 / 511.275 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKACB protein kinase, cAMP-dependent, catalytic, beta 1837 234 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17811.[MT7]-GTAHDQK[MT7].2y3_1.heavy 522.787 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKACB protein kinase, cAMP-dependent, catalytic, beta 1839 234 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17811.[MT7]-GTAHDQK[MT7].2b5_1.heavy 522.787 / 626.302 N/A N/A - - - - - - - - - 0.0 - - - - - - - PRKACB protein kinase, cAMP-dependent, catalytic, beta 1841 235 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543998.[MT7]-K[MT7]LAPITYPQGLALAK[MT7].3y6_1.heavy 672.758 / 716.479 6672.0 36.0890007019043 42 12 10 10 10 1.027993702818085 64.85124031782524 0.0 3 0.8955791805376356 3.785429855707911 6672.0 41.03942513517611 0.0 - - - - - - - 296.2307692307692 13 13 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1843 235 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543998.[MT7]-K[MT7]LAPITYPQGLALAK[MT7].3y4_1.heavy 672.758 / 546.373 5902.0 36.0890007019043 42 12 10 10 10 1.027993702818085 64.85124031782524 0.0 3 0.8955791805376356 3.785429855707911 5902.0 10.702036604924835 0.0 - - - - - - - 280.09090909090907 11 11 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1845 235 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543998.[MT7]-K[MT7]LAPITYPQGLALAK[MT7].3b3_1.heavy 672.758 / 601.427 6158.0 36.0890007019043 42 12 10 10 10 1.027993702818085 64.85124031782524 0.0 3 0.8955791805376356 3.785429855707911 6158.0 10.43621975916242 0.0 - - - - - - - 737.5 12 8 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1847 235 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB543998.[MT7]-K[MT7]LAPITYPQGLALAK[MT7].3y8_1.heavy 672.758 / 941.59 11419.0 36.0890007019043 42 12 10 10 10 1.027993702818085 64.85124031782524 0.0 3 0.8955791805376356 3.785429855707911 11419.0 52.44119056041235 0.0 - - - - - - - 199.66666666666666 22 9 RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) 1849 236 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17912.[MT7]-SQDVGRPK[MT7].2y4_1.heavy 587.843 / 601.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA7 ubiquitin-like modifier activating enzyme 7 1851 236 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17912.[MT7]-SQDVGRPK[MT7].2y5_1.heavy 587.843 / 700.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA7 ubiquitin-like modifier activating enzyme 7 1853 236 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17912.[MT7]-SQDVGRPK[MT7].2y6_1.heavy 587.843 / 815.486 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA7 ubiquitin-like modifier activating enzyme 7 1855 236 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17912.[MT7]-SQDVGRPK[MT7].2y7_1.heavy 587.843 / 943.544 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA7 ubiquitin-like modifier activating enzyme 7 1857 237 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17749.[MT7]-DTAHTK[MT7].2y4_1.heavy 480.771 / 600.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1859 237 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17749.[MT7]-DTAHTK[MT7].2y5_1.heavy 480.771 / 701.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1861 237 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17749.[MT7]-DTAHTK[MT7].2b4_1.heavy 480.771 / 569.28 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1863 237 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17749.[MT7]-DTAHTK[MT7].2y3_1.heavy 480.771 / 529.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 1865 238 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17816.[MT7]-LEEQLK[MT7].2b3_1.heavy 524.318 / 516.279 2538.0 26.680099487304688 44 20 10 6 8 24.740918429595357 4.041887138691623 0.0373992919921875 4 0.9971129920634626 22.963275762470875 2538.0 1.3227361563517916 4.0 - - - - - - - 1204.5 5 10 UBA7;GRPEL1;EEA1 ubiquitin-like modifier activating enzyme 7;GrpE-like 1, mitochondrial (E. coli);early endosome antigen 1 1867 238 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17816.[MT7]-LEEQLK[MT7].2y4_1.heavy 524.318 / 661.4 2361.0 26.680099487304688 44 20 10 6 8 24.740918429595357 4.041887138691623 0.0373992919921875 4 0.9971129920634626 22.963275762470875 2361.0 9.283932203389831 0.0 - - - - - - - 295.0 4 19 UBA7;GRPEL1;EEA1 ubiquitin-like modifier activating enzyme 7;GrpE-like 1, mitochondrial (E. coli);early endosome antigen 1 1869 238 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17816.[MT7]-LEEQLK[MT7].2y5_1.heavy 524.318 / 790.443 4427.0 26.680099487304688 44 20 10 6 8 24.740918429595357 4.041887138691623 0.0373992919921875 4 0.9971129920634626 22.963275762470875 4427.0 19.43377966101695 0.0 - - - - - - - 286.15 8 20 UBA7;GRPEL1;EEA1 ubiquitin-like modifier activating enzyme 7;GrpE-like 1, mitochondrial (E. coli);early endosome antigen 1 1871 238 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17816.[MT7]-LEEQLK[MT7].2b4_1.heavy 524.318 / 644.337 2361.0 26.680099487304688 44 20 10 6 8 24.740918429595357 4.041887138691623 0.0373992919921875 4 0.9971129920634626 22.963275762470875 2361.0 4.906840193704602 0.0 - - - - - - - 702.1 4 10 UBA7;GRPEL1;EEA1 ubiquitin-like modifier activating enzyme 7;GrpE-like 1, mitochondrial (E. coli);early endosome antigen 1 1873 239 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541333.[MT7]-LTLSALVDGK[MT7].2y4_1.heavy 652.905 / 562.332 6028.0 40.5348014831543 50 20 10 10 10 4.490200528753941 17.829639330803737 0.0 3 0.9921574898461276 13.926775860334455 6028.0 16.641169475808653 0.0 - - - - - - - 630.4285714285714 12 7 VDAC2 voltage-dependent anion channel 2 1875 239 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541333.[MT7]-LTLSALVDGK[MT7].2y9_1.heavy 652.905 / 1047.62 6708.0 40.5348014831543 50 20 10 10 10 4.490200528753941 17.829639330803737 0.0 3 0.9921574898461276 13.926775860334455 6708.0 21.296604634581104 0.0 - - - - - - - 225.0 13 17 VDAC2 voltage-dependent anion channel 2 1877 239 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541333.[MT7]-LTLSALVDGK[MT7].2y6_1.heavy 652.905 / 746.453 3821.0 40.5348014831543 50 20 10 10 10 4.490200528753941 17.829639330803737 0.0 3 0.9921574898461276 13.926775860334455 3821.0 23.158378237893096 0.0 - - - - - - - 235.0 7 17 VDAC2 voltage-dependent anion channel 2 1879 239 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB541333.[MT7]-LTLSALVDGK[MT7].2y7_1.heavy 652.905 / 833.485 6538.0 40.5348014831543 50 20 10 10 10 4.490200528753941 17.829639330803737 0.0 3 0.9921574898461276 13.926775860334455 6538.0 41.535529411764706 0.0 - - - - - - - 233.75 13 12 VDAC2 voltage-dependent anion channel 2 1881 240 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542018.[MT7]-LC[CAM]LPQIENVK[MT7].3y3_1.heavy 501.293 / 504.326 7667.0 38.05049991607666 43 20 10 5 8 20.344263113902944 4.915390616023915 0.042400360107421875 4 0.994107716202837 16.06967383830286 7667.0 19.0072121813656 0.0 - - - - - - - 732.0 15 8 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 1883 240 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542018.[MT7]-LC[CAM]LPQIENVK[MT7].3b5_1.heavy 501.293 / 756.419 5218.0 38.05049991607666 43 20 10 5 8 20.344263113902944 4.915390616023915 0.042400360107421875 4 0.994107716202837 16.06967383830286 5218.0 15.63385852663027 1.0 - - - - - - - 202.0 10 10 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 1885 240 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542018.[MT7]-LC[CAM]LPQIENVK[MT7].3b3_1.heavy 501.293 / 531.308 20764.0 38.05049991607666 43 20 10 5 8 20.344263113902944 4.915390616023915 0.042400360107421875 4 0.994107716202837 16.06967383830286 20764.0 22.69781583511102 1.0 - - - - - - - 228.0 41 7 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 1887 240 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542018.[MT7]-LC[CAM]LPQIENVK[MT7].3y4_1.heavy 501.293 / 633.369 6069.0 38.05049991607666 43 20 10 5 8 20.344263113902944 4.915390616023915 0.042400360107421875 4 0.994107716202837 16.06967383830286 6069.0 3.995596006957114 1.0 - - - - - - - 227.85714285714286 12 7 TNFRSF1A tumor necrosis factor receptor superfamily, member 1A 1889 241 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588138.[MT7]-LALPPYLTPDAR.2y8_1.heavy 735.925 / 932.484 21736.0 41.271674156188965 44 18 10 6 10 5.195021120134895 19.249199894957 0.035297393798828125 3 0.9890949647347905 11.807375494920016 21736.0 30.263574364997798 0.0 - - - - - - - 730.0 43 7 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 1891 241 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588138.[MT7]-LALPPYLTPDAR.2y9_1.heavy 735.925 / 1029.54 186538.0 41.271674156188965 44 18 10 6 10 5.195021120134895 19.249199894957 0.035297393798828125 3 0.9890949647347905 11.807375494920016 186538.0 95.71630261104565 0.0 - - - - - - - 351.3333333333333 373 3 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 1893 241 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588138.[MT7]-LALPPYLTPDAR.2y10_1.heavy 735.925 / 1142.62 11030.0 41.271674156188965 44 18 10 6 10 5.195021120134895 19.249199894957 0.035297393798828125 3 0.9890949647347905 11.807375494920016 11030.0 22.153343486419907 0.0 - - - - - - - 718.4285714285714 22 7 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 1895 241 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588138.[MT7]-LALPPYLTPDAR.2y11_1.heavy 735.925 / 1213.66 10219.0 41.271674156188965 44 18 10 6 10 5.195021120134895 19.249199894957 0.035297393798828125 3 0.9890949647347905 11.807375494920016 10219.0 23.889970611513476 0.0 - - - - - - - 679.375 20 8 RPS6KB2 ribosomal protein S6 kinase, 70kDa, polypeptide 2 1897 242 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588132.[MT7]-FIDSDFSESK[MT7].3y3_1.heavy 488.248 / 507.289 57944.0 33.16640090942383 44 14 10 10 10 1.9438133917245635 47.27935345073013 0.0 3 0.9337235431566434 4.767101668126054 57944.0 67.48136645962734 0.0 - - - - - - - 1242.0 115 8 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 1899 242 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588132.[MT7]-FIDSDFSESK[MT7].3b5_1.heavy 488.248 / 722.348 77167.0 33.16640090942383 44 14 10 10 10 1.9438133917245635 47.27935345073013 0.0 3 0.9337235431566434 4.767101668126054 77167.0 176.1420652173913 0.0 - - - - - - - 306.6666666666667 154 6 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 1901 242 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588132.[MT7]-FIDSDFSESK[MT7].3y4_1.heavy 488.248 / 594.321 57760.0 33.16640090942383 44 14 10 10 10 1.9438133917245635 47.27935345073013 0.0 3 0.9337235431566434 4.767101668126054 57760.0 65.82814851760354 0.0 - - - - - - - 460.0 115 3 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 1903 242 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB588132.[MT7]-FIDSDFSESK[MT7].3b3_1.heavy 488.248 / 520.289 57392.0 33.16640090942383 44 14 10 10 10 1.9438133917245635 47.27935345073013 0.0 3 0.9337235431566434 4.767101668126054 57392.0 111.34509316770188 0.0 - - - - - - - 414.0 114 6 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 1905 243 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18375.[MT7]-FISNPPSMVAAGSVVAAVQGLNLR.3b4_1.heavy 848.136 / 606.337 4763.0 49.098649978637695 40 17 10 3 10 4.346964351306393 23.004559485275514 0.07180023193359375 3 0.9798338954429285 8.675985418167752 4763.0 1.0817975340687864 1.0 - - - - - - - 285.44444444444446 9 9 CCND1 cyclin D1 1907 243 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18375.[MT7]-FISNPPSMVAAGSVVAAVQGLNLR.3y5_1.heavy 848.136 / 572.352 2521.0 49.098649978637695 40 17 10 3 10 4.346964351306393 23.004559485275514 0.07180023193359375 3 0.9798338954429285 8.675985418167752 2521.0 16.606785714285714 1.0 - - - - - - - 229.69230769230768 5 13 CCND1 cyclin D1 1909 243 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18375.[MT7]-FISNPPSMVAAGSVVAAVQGLNLR.3y10_1.heavy 848.136 / 1040.62 4576.0 49.098649978637695 40 17 10 3 10 4.346964351306393 23.004559485275514 0.07180023193359375 3 0.9798338954429285 8.675985418167752 4576.0 15.070952092177075 0.0 - - - - - - - 233.4 9 10 CCND1 cyclin D1 1911 243 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18375.[MT7]-FISNPPSMVAAGSVVAAVQGLNLR.3y9_1.heavy 848.136 / 941.553 3175.0 49.098649978637695 40 17 10 3 10 4.346964351306393 23.004559485275514 0.07180023193359375 3 0.9798338954429285 8.675985418167752 3175.0 22.56517857142857 0.0 - - - - - - - 229.58333333333334 6 12 CCND1 cyclin D1 1913 244 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18075.[MT7]-VC[CAM]DVPLDQLPR.2y4_1.heavy 728.391 / 513.314 13026.0 35.0703010559082 50 20 10 10 10 4.036308477823046 19.628845677905076 0.0 3 0.9909272419732629 12.946840688827152 13026.0 50.39461467038068 0.0 - - - - - - - 179.625 26 8 BPGM 2,3-bisphosphoglycerate mutase 1915 244 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18075.[MT7]-VC[CAM]DVPLDQLPR.2b3_1.heavy 728.391 / 519.235 24140.0 35.0703010559082 50 20 10 10 10 4.036308477823046 19.628845677905076 0.0 3 0.9909272419732629 12.946840688827152 24140.0 46.97539512016499 0.0 - - - - - - - 287.0 48 5 BPGM 2,3-bisphosphoglycerate mutase 1917 244 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18075.[MT7]-VC[CAM]DVPLDQLPR.2y8_1.heavy 728.391 / 937.547 11831.0 35.0703010559082 50 20 10 10 10 4.036308477823046 19.628845677905076 0.0 3 0.9909272419732629 12.946840688827152 11831.0 92.35027789400279 0.0 - - - - - - - 159.66666666666666 23 9 BPGM 2,3-bisphosphoglycerate mutase 1919 244 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18075.[MT7]-VC[CAM]DVPLDQLPR.2y7_1.heavy 728.391 / 838.478 14341.0 35.0703010559082 50 20 10 10 10 4.036308477823046 19.628845677905076 0.0 3 0.9909272419732629 12.946840688827152 14341.0 67.00286153424786 0.0 - - - - - - - 252.66666666666666 28 9 BPGM 2,3-bisphosphoglycerate mutase 1921 245 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539321.[MT7]-VEDQGK[MT7].2y4_1.heavy 482.271 / 591.322 575.0 16.3552508354187 38 14 10 6 8 2.414304257264761 31.941295486184593 0.03339958190917969 4 0.9429497486448613 5.1421759149655974 575.0 2.286424425445133 4.0 - - - - - - - 0.0 1 0 BPGM 2,3-bisphosphoglycerate mutase 1923 245 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539321.[MT7]-VEDQGK[MT7].2b3_1.heavy 482.271 / 488.247 2168.0 16.3552508354187 38 14 10 6 8 2.414304257264761 31.941295486184593 0.03339958190917969 4 0.9429497486448613 5.1421759149655974 2168.0 16.11888138862102 1.0 - - - - - - - 170.25925925925927 4 27 BPGM 2,3-bisphosphoglycerate mutase 1925 245 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539321.[MT7]-VEDQGK[MT7].2y5_1.heavy 482.271 / 720.364 1776.0 16.3552508354187 38 14 10 6 8 2.414304257264761 31.941295486184593 0.03339958190917969 4 0.9429497486448613 5.1421759149655974 1776.0 20.92986974686655 1.0 - - - - - - - 118.39285714285714 3 28 BPGM 2,3-bisphosphoglycerate mutase 1927 245 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB539321.[MT7]-VEDQGK[MT7].2b4_1.heavy 482.271 / 616.306 183.0 16.3552508354187 38 14 10 6 8 2.414304257264761 31.941295486184593 0.03339958190917969 4 0.9429497486448613 5.1421759149655974 183.0 0.4662420382165605 27.0 - - - - - - - 0.0 1 0 BPGM 2,3-bisphosphoglycerate mutase 1929 246 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18378.[MT7]-K[MT7]LQQTQEYFIIQYQESLR.4b7_2.heavy 651.607 / 572.832 36474.0 39.87862586975098 42 16 10 6 10 27.817722143109957 3.5948306437724824 0.03569793701171875 3 0.961425401172845 6.263334699973497 36474.0 228.84142100534356 0.0 - - - - - - - 228.26666666666668 72 15 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1931 246 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18378.[MT7]-K[MT7]LQQTQEYFIIQYQESLR.4b4_1.heavy 651.607 / 786.508 2740.0 39.87862586975098 42 16 10 6 10 27.817722143109957 3.5948306437724824 0.03569793701171875 3 0.961425401172845 6.263334699973497 2740.0 4.183169545624578 1.0 - - - - - - - 611.5714285714286 5 7 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1933 246 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18378.[MT7]-K[MT7]LQQTQEYFIIQYQESLR.4y7_1.heavy 651.607 / 923.458 13528.0 39.87862586975098 42 16 10 6 10 27.817722143109957 3.5948306437724824 0.03569793701171875 3 0.961425401172845 6.263334699973497 13528.0 124.6353999135322 0.0 - - - - - - - 182.73333333333332 27 15 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1935 246 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18378.[MT7]-K[MT7]LQQTQEYFIIQYQESLR.4y6_1.heavy 651.607 / 795.399 19264.0 39.87862586975098 42 16 10 6 10 27.817722143109957 3.5948306437724824 0.03569793701171875 3 0.961425401172845 6.263334699973497 19264.0 56.59305321954035 0.0 - - - - - - - 245.4 38 15 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1937 247 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18172.[MT7]-ATTATSVC[CAM]PSPFK[MT7].3b6_1.heavy 552.295 / 677.359 6145.0 29.1653995513916 48 18 10 10 10 5.016720219462467 19.933342029329836 0.0 3 0.9895563830773777 12.065858009254312 6145.0 17.906727676095397 0.0 - - - - - - - 262.64285714285717 12 14 PTPRR protein tyrosine phosphatase, receptor type, R 1939 247 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18172.[MT7]-ATTATSVC[CAM]PSPFK[MT7].3b5_1.heavy 552.295 / 590.327 7948.0 29.1653995513916 48 18 10 10 10 5.016720219462467 19.933342029329836 0.0 3 0.9895563830773777 12.065858009254312 7948.0 19.517958934310833 0.0 - - - - - - - 310.14285714285717 15 14 PTPRR protein tyrosine phosphatase, receptor type, R 1941 247 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18172.[MT7]-ATTATSVC[CAM]PSPFK[MT7].3y4_1.heavy 552.295 / 622.368 8950.0 29.1653995513916 48 18 10 10 10 5.016720219462467 19.933342029329836 0.0 3 0.9895563830773777 12.065858009254312 8950.0 23.608079186730873 0.0 - - - - - - - 656.75 17 12 PTPRR protein tyrosine phosphatase, receptor type, R 1943 247 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18172.[MT7]-ATTATSVC[CAM]PSPFK[MT7].3y5_1.heavy 552.295 / 719.421 20838.0 29.1653995513916 48 18 10 10 10 5.016720219462467 19.933342029329836 0.0 3 0.9895563830773777 12.065858009254312 20838.0 57.71002994011976 0.0 - - - - - - - 293.0 41 13 PTPRR protein tyrosine phosphatase, receptor type, R 1945 248 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18371.[MT7]-TWTLC[CAM]GTPEYLAPEIILSK[MT7].3y7_1.heavy 827.45 / 943.594 5931.0 47.36670112609863 45 18 10 7 10 4.357781745236016 22.947454885578267 0.027599334716796875 3 0.9872444090591026 10.915643778786086 5931.0 23.14905612244898 0.0 - - - - - - - 184.8 11 20 PRKACA;PRKACB;PRKACG protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta;protein kinase, cAMP-dependent, catalytic, gamma 1947 248 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18371.[MT7]-TWTLC[CAM]GTPEYLAPEIILSK[MT7].3b4_1.heavy 827.45 / 646.368 1790.0 47.36670112609863 45 18 10 7 10 4.357781745236016 22.947454885578267 0.027599334716796875 3 0.9872444090591026 10.915643778786086 1790.0 4.024975575935206 1.0 - - - - - - - 216.36363636363637 3 22 PRKACA;PRKACB;PRKACG protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta;protein kinase, cAMP-dependent, catalytic, gamma 1949 248 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18371.[MT7]-TWTLC[CAM]GTPEYLAPEIILSK[MT7].3y4_1.heavy 827.45 / 604.415 2742.0 47.36670112609863 45 18 10 7 10 4.357781745236016 22.947454885578267 0.027599334716796875 3 0.9872444090591026 10.915643778786086 2742.0 0.4962133725889597 1.0 - - - - - - - 671.2222222222222 5 9 PRKACA;PRKACB;PRKACG protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta;protein kinase, cAMP-dependent, catalytic, gamma 1951 248 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18371.[MT7]-TWTLC[CAM]GTPEYLAPEIILSK[MT7].3b7_1.heavy 827.45 / 964.468 4756.0 47.36670112609863 45 18 10 7 10 4.357781745236016 22.947454885578267 0.027599334716796875 3 0.9872444090591026 10.915643778786086 4756.0 12.799455782312926 0.0 - - - - - - - 199.36 9 25 PRKACA;PRKACB;PRKACG protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta;protein kinase, cAMP-dependent, catalytic, gamma 1953 249 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18373.[MT7]-WIGLPTNSAQEC[CAM]QNLEIEK[MT7].3y6_1.heavy 840.1 / 889.511 2652.0 38.84239959716797 47 17 10 10 10 3.501842761294361 28.556393538080425 0.0 3 0.9702911722434742 7.142306921222454 2652.0 8.415994163595894 1.0 - - - - - - - 174.92307692307693 6 13 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 1955 249 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18373.[MT7]-WIGLPTNSAQEC[CAM]QNLEIEK[MT7].3y3_1.heavy 840.1 / 533.341 7105.0 38.84239959716797 47 17 10 10 10 3.501842761294361 28.556393538080425 0.0 3 0.9702911722434742 7.142306921222454 7105.0 41.582172665623375 0.0 - - - - - - - 250.28571428571428 14 14 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 1957 249 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18373.[MT7]-WIGLPTNSAQEC[CAM]QNLEIEK[MT7].3b4_1.heavy 840.1 / 614.378 15347.0 38.84239959716797 47 17 10 10 10 3.501842761294361 28.556393538080425 0.0 3 0.9702911722434742 7.142306921222454 15347.0 23.09345697899844 0.0 - - - - - - - 363.3333333333333 30 6 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 1959 249 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18373.[MT7]-WIGLPTNSAQEC[CAM]QNLEIEK[MT7].3b3_1.heavy 840.1 / 501.294 8526.0 38.84239959716797 47 17 10 10 10 3.501842761294361 28.556393538080425 0.0 3 0.9702911722434742 7.142306921222454 8526.0 17.624508432743728 0.0 - - - - - - - 694.5555555555555 17 9 TFDP2 transcription factor Dp-2 (E2F dimerization partner 2) 1961 250 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18374.[MT7]-DDAVALVDVIAPPDFVLDSPIGR.3b6_1.heavy 846.791 / 729.39 4455.0 51.98659896850586 50 20 10 10 10 5.667558964911565 17.64428047755836 0.0 3 0.9910059729539593 13.003469171951643 4455.0 57.5286923076923 0.0 - - - - - - - 120.35 8 20 ACOX3 acyl-CoA oxidase 3, pristanoyl 1963 250 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18374.[MT7]-DDAVALVDVIAPPDFVLDSPIGR.3b5_1.heavy 846.791 / 616.306 9160.0 51.98659896850586 50 20 10 10 10 5.667558964911565 17.64428047755836 0.0 3 0.9910059729539593 13.003469171951643 9160.0 83.36629213483145 0.0 - - - - - - - 150.88235294117646 18 17 ACOX3 acyl-CoA oxidase 3, pristanoyl 1965 250 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18374.[MT7]-DDAVALVDVIAPPDFVLDSPIGR.3b8_1.heavy 846.791 / 943.485 7111.0 51.98659896850586 50 20 10 10 10 5.667558964911565 17.64428047755836 0.0 3 0.9910059729539593 13.003469171951643 7111.0 102.2705617977528 0.0 - - - - - - - 142.52380952380952 14 21 ACOX3 acyl-CoA oxidase 3, pristanoyl 1967 250 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18374.[MT7]-DDAVALVDVIAPPDFVLDSPIGR.3y5_1.heavy 846.791 / 529.309 6041.0 51.98659896850586 50 20 10 10 10 5.667558964911565 17.64428047755836 0.0 3 0.9910059729539593 13.003469171951643 6041.0 88.2171876923077 0.0 - - - - - - - 155.33333333333334 12 21 ACOX3 acyl-CoA oxidase 3, pristanoyl 1969 251 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17820.[MT7]-ETIQAAK[MT7].2y4_1.heavy 524.816 / 561.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC7 cell division cycle 7 homolog (S. cerevisiae) 1971 251 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17820.[MT7]-ETIQAAK[MT7].2b4_1.heavy 524.816 / 616.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC7 cell division cycle 7 homolog (S. cerevisiae) 1973 251 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17820.[MT7]-ETIQAAK[MT7].2y6_1.heavy 524.816 / 775.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC7 cell division cycle 7 homolog (S. cerevisiae) 1975 251 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17820.[MT7]-ETIQAAK[MT7].2b5_1.heavy 524.816 / 687.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC7 cell division cycle 7 homolog (S. cerevisiae) 1977 252 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17731.[MT7]-ELNFLR.2y4_1.heavy 468.275 / 549.314 10920.0 36.997751235961914 23 2 10 5 6 0.375341591038886 128.74438564064292 0.042301177978515625 5 0.4636357146834208 1.603128371044547 10920.0 19.013871983260476 0.0 - - - - - - - 205.2 21 10 ACOX3 acyl-CoA oxidase 3, pristanoyl 1979 252 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17731.[MT7]-ELNFLR.2b3_1.heavy 468.275 / 501.279 1285.0 36.997751235961914 23 2 10 5 6 0.375341591038886 128.74438564064292 0.042301177978515625 5 0.4636357146834208 1.603128371044547 1285.0 1.5342679127725856 20.0 - - - - - - - 1172.5 8 8 ACOX3 acyl-CoA oxidase 3, pristanoyl 1981 252 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17731.[MT7]-ELNFLR.2y5_1.heavy 468.275 / 662.398 2312.0 36.997751235961914 23 2 10 5 6 0.375341591038886 128.74438564064292 0.042301177978515625 5 0.4636357146834208 1.603128371044547 2312.0 5.338210116731518 1.0 - - - - - - - 271.0 8 9 ACOX3 acyl-CoA oxidase 3, pristanoyl 1983 252 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17731.[MT7]-ELNFLR.2b4_1.heavy 468.275 / 648.347 2312.0 36.997751235961914 23 2 10 5 6 0.375341591038886 128.74438564064292 0.042301177978515625 5 0.4636357146834208 1.603128371044547 2312.0 11.913538674133605 1.0 - - - - - - - 243.8 6 10 ACOX3 acyl-CoA oxidase 3, pristanoyl 1985 253 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17823.[MT7]-LEYAFK[MT7].2b3_1.heavy 529.81 / 550.299 3836.0 33.75270080566406 48 18 10 10 10 4.289673381883125 23.311798148161333 0.0 3 0.9897400623872168 12.173570909826221 3836.0 16.584686468646865 0.0 - - - - - - - 527.4444444444445 7 9 PRKACB protein kinase, cAMP-dependent, catalytic, beta 1987 253 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17823.[MT7]-LEYAFK[MT7].2y4_1.heavy 529.81 / 672.384 4240.0 33.75270080566406 48 18 10 10 10 4.289673381883125 23.311798148161333 0.0 3 0.9897400623872168 12.173570909826221 4240.0 10.351783749803552 0.0 - - - - - - - 707.0 8 10 PRKACB protein kinase, cAMP-dependent, catalytic, beta 1989 253 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17823.[MT7]-LEYAFK[MT7].2y5_1.heavy 529.81 / 801.426 3634.0 33.75270080566406 48 18 10 10 10 4.289673381883125 23.311798148161333 0.0 3 0.9897400623872168 12.173570909826221 3634.0 12.281240924092408 0.0 - - - - - - - 256.38461538461536 7 13 PRKACB protein kinase, cAMP-dependent, catalytic, beta 1991 253 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17823.[MT7]-LEYAFK[MT7].2y3_1.heavy 529.81 / 509.32 4543.0 33.75270080566406 48 18 10 10 10 4.289673381883125 23.311798148161333 0.0 3 0.9897400623872168 12.173570909826221 4543.0 8.521924003211131 0.0 - - - - - - - 656.5 9 10 PRKACB protein kinase, cAMP-dependent, catalytic, beta 1993 254 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18379.[MT7]-K[MT7]LQQTQEYFIIQYQESLR.3y7_1.heavy 868.474 / 923.458 9263.0 39.87862586975098 40 14 10 6 10 2.045024198619791 39.13957301031856 0.03569793701171875 3 0.9444406719652159 5.211374908191712 9263.0 79.99615984978735 0.0 - - - - - - - 196.8235294117647 18 17 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1995 254 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18379.[MT7]-K[MT7]LQQTQEYFIIQYQESLR.3y6_1.heavy 868.474 / 795.399 7462.0 39.87862586975098 40 14 10 6 10 2.045024198619791 39.13957301031856 0.03569793701171875 3 0.9444406719652159 5.211374908191712 7462.0 6.316598639455782 1.0 - - - - - - - 198.5 14 16 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1997 254 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18379.[MT7]-K[MT7]LQQTQEYFIIQYQESLR.3y8_1.heavy 868.474 / 1036.54 20327.0 39.87862586975098 40 14 10 6 10 2.045024198619791 39.13957301031856 0.03569793701171875 3 0.9444406719652159 5.211374908191712 20327.0 121.75769463761046 0.0 - - - - - - - 205.93333333333334 40 15 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 1999 254 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18379.[MT7]-K[MT7]LQQTQEYFIIQYQESLR.3b7_2.heavy 868.474 / 572.832 15352.0 39.87862586975098 40 14 10 6 10 2.045024198619791 39.13957301031856 0.03569793701171875 3 0.9444406719652159 5.211374908191712 15352.0 64.7171094266278 0.0 - - - - - - - 202.28571428571428 30 14 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 2001 255 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17738.[MT7]-AEVQSNR.2y4_1.heavy 474.255 / 504.253 1222.0 14.941800117492676 45 15 10 10 10 2.5064672482092902 39.896791019888084 0.0 3 0.9544778046187877 5.762213460161674 1222.0 12.884575369458128 0.0 - - - - - - - 89.78947368421052 2 19 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 2003 255 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17738.[MT7]-AEVQSNR.2y5_1.heavy 474.255 / 603.321 1416.0 14.941800117492676 45 15 10 10 10 2.5064672482092902 39.896791019888084 0.0 3 0.9544778046187877 5.762213460161674 1416.0 7.124137931034483 1.0 - - - - - - - 126.57142857142857 2 21 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 2005 255 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17738.[MT7]-AEVQSNR.2b4_1.heavy 474.255 / 572.316 1280.0 14.941800117492676 45 15 10 10 10 2.5064672482092902 39.896791019888084 0.0 3 0.9544778046187877 5.762213460161674 1280.0 8.124478178368122 0.0 - - - - - - - 169.47826086956522 2 23 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 2007 255 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB17738.[MT7]-AEVQSNR.2y6_1.heavy 474.255 / 732.364 2211.0 14.941800117492676 45 15 10 10 10 2.5064672482092902 39.896791019888084 0.0 3 0.9544778046187877 5.762213460161674 2211.0 27.289929006085192 0.0 - - - - - - - 104.33333333333333 4 21 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 2009 256 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542007.[MT7]-HLLLVDPEGVVR.3y6_1.heavy 497.632 / 656.373 14574.0 36.58879852294922 44 20 4 10 10 8.275873156422294 12.083317144898164 0.0 3 0.9957863596807114 19.005575488885036 14574.0 47.73267441860465 0.0 - - - - - - - 232.2 29 10 LOC100291393;SHC2;SHC1 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2;SHC (Src homology 2 domain containing) transforming protein 1 2011 256 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542007.[MT7]-HLLLVDPEGVVR.3b4_1.heavy 497.632 / 621.42 5159.0 36.58879852294922 44 20 4 10 10 8.275873156422294 12.083317144898164 0.0 3 0.9957863596807114 19.005575488885036 5159.0 13.419621016365204 0.0 - - - - - - - 193.5 10 6 LOC100291393;SHC2;SHC1 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2;SHC (Src homology 2 domain containing) transforming protein 1 2013 256 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542007.[MT7]-HLLLVDPEGVVR.3b3_1.heavy 497.632 / 508.336 N/A 36.58879852294922 44 20 4 10 10 8.275873156422294 12.083317144898164 0.0 3 0.9957863596807114 19.005575488885036 12768.0 14.520995563138156 1.0 - - - - - - - 274.125 53 8 LOC100291393;SHC2;SHC1 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2;SHC (Src homology 2 domain containing) transforming protein 1 2015 256 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB542007.[MT7]-HLLLVDPEGVVR.3y5_1.heavy 497.632 / 559.32 5417.0 36.58879852294922 44 20 4 10 10 8.275873156422294 12.083317144898164 0.0 3 0.9957863596807114 19.005575488885036 5417.0 5.423970446388585 1.0 - - - - - - - 718.7142857142857 12 7 LOC100291393;SHC2;SHC1 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2;SHC (Src homology 2 domain containing) transforming protein 1 2017 257 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18285.[MT7]-SVDFLDAYPGILDQK[MT7].2y8_1.heavy 985.03 / 1077.61 933.0 44.21624946594238 41 17 10 6 8 2.602163510721991 31.533156700092036 0.036899566650390625 4 0.9702988634743666 7.143236255012546 933.0 6.236427863981512 0.0 - - - - - - - 0.0 1 0 ACOX3 acyl-CoA oxidase 3, pristanoyl 2019 257 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18285.[MT7]-SVDFLDAYPGILDQK[MT7].2b4_1.heavy 985.03 / 593.305 1089.0 44.21624946594238 41 17 10 6 8 2.602163510721991 31.533156700092036 0.036899566650390625 4 0.9702988634743666 7.143236255012546 1089.0 0.0 1.0 - - - - - - - 141.54545454545453 3 11 ACOX3 acyl-CoA oxidase 3, pristanoyl 2021 257 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18285.[MT7]-SVDFLDAYPGILDQK[MT7].2b6_1.heavy 985.03 / 821.416 1711.0 44.21624946594238 41 17 10 6 8 2.602163510721991 31.533156700092036 0.036899566650390625 4 0.9702988634743666 7.143236255012546 1711.0 7.6775641025641015 1.0 - - - - - - - 217.9 3 10 ACOX3 acyl-CoA oxidase 3, pristanoyl 2023 257 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18285.[MT7]-SVDFLDAYPGILDQK[MT7].2y7_1.heavy 985.03 / 914.543 3033.0 44.21624946594238 41 17 10 6 8 2.602163510721991 31.533156700092036 0.036899566650390625 4 0.9702988634743666 7.143236255012546 3033.0 23.343258935924894 0.0 - - - - - - - 227.46153846153845 6 13 ACOX3 acyl-CoA oxidase 3, pristanoyl 2025 258 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18286.[MT7]-LGAGPGDAGEVQAHPFFR.3y7_1.heavy 657.338 / 902.463 3862.0 34.029449462890625 40 16 10 6 8 1.6493869183313623 48.00800641487368 0.03890228271484375 4 0.9603387810339112 6.176371365141391 3862.0 25.10104752275025 0.0 - - - - - - - 185.36363636363637 7 11 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 2027 258 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18286.[MT7]-LGAGPGDAGEVQAHPFFR.3b10_1.heavy 657.338 / 969.476 6865.0 34.029449462890625 40 16 10 6 8 1.6493869183313623 48.00800641487368 0.03890228271484375 4 0.9603387810339112 6.176371365141391 6865.0 66.0686894102782 0.0 - - - - - - - 259.4166666666667 13 12 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 2029 258 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18286.[MT7]-LGAGPGDAGEVQAHPFFR.3y4_1.heavy 657.338 / 566.308 8582.0 34.029449462890625 40 16 10 6 8 1.6493869183313623 48.00800641487368 0.03890228271484375 4 0.9603387810339112 6.176371365141391 8582.0 20.635359600958935 0.0 - - - - - - - 281.625 17 16 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 2031 258 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18286.[MT7]-LGAGPGDAGEVQAHPFFR.3b7_1.heavy 657.338 / 712.375 4183.0 34.029449462890625 40 16 10 6 8 1.6493869183313623 48.00800641487368 0.03890228271484375 4 0.9603387810339112 6.176371365141391 4183.0 16.03334163970358 1.0 - - - - - - - 245.21428571428572 9 14 RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 2033 259 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587902.[MT7]-VEAPFIPK[MT7].2y5_1.heavy 594.865 / 745.473 8824.0 34.69419860839844 41 11 10 10 10 1.4619491385186387 53.15643181850245 0.0 3 0.8683718277257529 3.3636038756243347 8824.0 28.405162234380967 0.0 - - - - - - - 348.0 17 11 PRKACA;PRKACB;PRKACG protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta;protein kinase, cAMP-dependent, catalytic, gamma 2035 259 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587902.[MT7]-VEAPFIPK[MT7].2b4_1.heavy 594.865 / 541.31 1161.0 34.69419860839844 41 11 10 10 10 1.4619491385186387 53.15643181850245 0.0 3 0.8683718277257529 3.3636038756243347 1161.0 2.6082378475921213 8.0 - - - - - - - 685.4 3 10 PRKACA;PRKACB;PRKACG protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta;protein kinase, cAMP-dependent, catalytic, gamma 2037 259 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587902.[MT7]-VEAPFIPK[MT7].2y3_1.heavy 594.865 / 501.352 2438.0 34.69419860839844 41 11 10 10 10 1.4619491385186387 53.15643181850245 0.0 3 0.8683718277257529 3.3636038756243347 2438.0 2.77135855503491 1.0 - - - - - - - 255.2 4 10 PRKACA;PRKACB;PRKACG protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta;protein kinase, cAMP-dependent, catalytic, gamma 2039 259 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB587902.[MT7]-VEAPFIPK[MT7].2b5_1.heavy 594.865 / 688.379 4644.0 34.69419860839844 41 11 10 10 10 1.4619491385186387 53.15643181850245 0.0 3 0.8683718277257529 3.3636038756243347 4644.0 3.842273464629099 1.0 - - - - - - - 206.22222222222223 11 9 PRKACA;PRKACB;PRKACG protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta;protein kinase, cAMP-dependent, catalytic, gamma 2041 260 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18288.[MT7]-NVTDSLSTYINANYIR.3y7_1.heavy 663.345 / 863.473 5937.0 41.21872520446777 39 13 10 6 10 1.6806420640006934 49.0315704797362 0.03530120849609375 3 0.9238215786277381 4.442731458921049 5937.0 63.740797546012274 0.0 - - - - - - - 166.8421052631579 11 19 PTPRR protein tyrosine phosphatase, receptor type, R 2043 260 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18288.[MT7]-NVTDSLSTYINANYIR.3y6_1.heavy 663.345 / 750.389 10492.0 41.21872520446777 39 13 10 6 10 1.6806420640006934 49.0315704797362 0.03530120849609375 3 0.9238215786277381 4.442731458921049 10492.0 26.086666666666666 0.0 - - - - - - - 185.22222222222223 20 18 PTPRR protein tyrosine phosphatase, receptor type, R 2045 260 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18288.[MT7]-NVTDSLSTYINANYIR.3b4_1.heavy 663.345 / 574.295 5449.0 41.21872520446777 39 13 10 6 10 1.6806420640006934 49.0315704797362 0.03530120849609375 3 0.9238215786277381 4.442731458921049 5449.0 13.139568269568269 0.0 - - - - - - - 284.7 10 20 PTPRR protein tyrosine phosphatase, receptor type, R 2047 260 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18288.[MT7]-NVTDSLSTYINANYIR.3b5_1.heavy 663.345 / 661.327 6588.0 41.21872520446777 39 13 10 6 10 1.6806420640006934 49.0315704797362 0.03530120849609375 3 0.9238215786277381 4.442731458921049 6588.0 44.299107692307686 0.0 - - - - - - - 211.4 13 20 PTPRR protein tyrosine phosphatase, receptor type, R 2049 261 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18182.[MT7]-HLQINQTFEELR.3y6_1.heavy 557.969 / 794.404 17893.0 34.563899993896484 47 17 10 10 10 2.642205741597915 33.237493115389974 0.0 3 0.976416466168871 8.020486236427141 17893.0 48.70942513386555 0.0 - - - - - - - 211.25 35 8 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 2051 261 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18182.[MT7]-HLQINQTFEELR.3y4_1.heavy 557.969 / 546.288 22282.0 34.563899993896484 47 17 10 10 10 2.642205741597915 33.237493115389974 0.0 3 0.976416466168871 8.020486236427141 22282.0 24.091064936203267 0.0 - - - - - - - 662.8888888888889 44 9 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 2053 261 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18182.[MT7]-HLQINQTFEELR.3b3_1.heavy 557.969 / 523.311 29034.0 34.563899993896484 47 17 10 10 10 2.642205741597915 33.237493115389974 0.0 3 0.976416466168871 8.020486236427141 29034.0 59.31228364375246 0.0 - - - - - - - 687.7777777777778 58 9 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 2055 261 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18182.[MT7]-HLQINQTFEELR.3y5_1.heavy 557.969 / 693.357 30272.0 34.563899993896484 47 17 10 10 10 2.642205741597915 33.237493115389974 0.0 3 0.976416466168871 8.020486236427141 30272.0 149.3896331360947 0.0 - - - - - - - 285.9230769230769 60 13 STAT5A;STAT5B signal transducer and activator of transcription 5A;signal transducer and activator of transcription 5B 2057 262 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18389.[MT7]-TIFSALENDPLFARSPGADLSLEK[MT7].4y4_1.heavy 720.64 / 620.374 5543.0 48.06132507324219 41 15 10 6 10 2.409935141051808 35.29200065802747 0.038299560546875 3 0.9570527356909393 5.933731884874434 5543.0 20.07041800643087 0.0 - - - - - - - 264.4736842105263 11 19 ACOX3 acyl-CoA oxidase 3, pristanoyl 2059 262 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18389.[MT7]-TIFSALENDPLFARSPGADLSLEK[MT7].4y15_2.heavy 720.64 / 872.989 4973.0 48.06132507324219 41 15 10 6 10 2.409935141051808 35.29200065802747 0.038299560546875 3 0.9570527356909393 5.933731884874434 4973.0 50.06671994805837 0.0 - - - - - - - 199.23076923076923 9 13 ACOX3 acyl-CoA oxidase 3, pristanoyl 2061 262 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18389.[MT7]-TIFSALENDPLFARSPGADLSLEK[MT7].4b5_1.heavy 720.64 / 664.379 5129.0 48.06132507324219 41 15 10 6 10 2.409935141051808 35.29200065802747 0.038299560546875 3 0.9570527356909393 5.933731884874434 5129.0 22.795555555555556 0.0 - - - - - - - 284.8125 10 16 ACOX3 acyl-CoA oxidase 3, pristanoyl 2063 262 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18389.[MT7]-TIFSALENDPLFARSPGADLSLEK[MT7].4b3_1.heavy 720.64 / 506.31 3005.0 48.06132507324219 41 15 10 6 10 2.409935141051808 35.29200065802747 0.038299560546875 3 0.9570527356909393 5.933731884874434 3005.0 11.964361720994575 0.0 - - - - - - - 204.52631578947367 6 19 ACOX3 acyl-CoA oxidase 3, pristanoyl 2065 263 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18386.[MT7]-SLNINVLHQSLSQFGITEVSPEK[MT7].3b6_1.heavy 943.518 / 785.464 1215.0 43.612300872802734 42 14 10 10 8 1.6498280467172053 60.61237727106045 0.0 4 0.9382892707806754 4.942229839153137 1215.0 10.2 0.0 - - - - - - - 222.75 2 8 PTPRR protein tyrosine phosphatase, receptor type, R 2067 263 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18386.[MT7]-SLNINVLHQSLSQFGITEVSPEK[MT7].3y3_1.heavy 943.518 / 517.31 N/A 43.612300872802734 42 14 10 10 8 1.6498280467172053 60.61237727106045 0.0 4 0.9382892707806754 4.942229839153137 1620.0 3.590916334661354 1.0 - - - - - - - 183.6 5 15 PTPRR protein tyrosine phosphatase, receptor type, R 2069 263 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18386.[MT7]-SLNINVLHQSLSQFGITEVSPEK[MT7].3y4_1.heavy 943.518 / 604.342 2510.0 43.612300872802734 42 14 10 10 8 1.6498280467172053 60.61237727106045 0.0 4 0.9382892707806754 4.942229839153137 2510.0 10.771898883009994 0.0 - - - - - - - 202.5 5 18 PTPRR protein tyrosine phosphatase, receptor type, R 2071 263 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18386.[MT7]-SLNINVLHQSLSQFGITEVSPEK[MT7].3y9_1.heavy 943.518 / 1103.61 1134.0 43.612300872802734 42 14 10 10 8 1.6498280467172053 60.61237727106045 0.0 4 0.9382892707806754 4.942229839153137 1134.0 20.16 2.0 - - - - - - - 162.0 2 14 PTPRR protein tyrosine phosphatase, receptor type, R 2073 264 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB538860.[MT7]-FGIAAK[MT7].2y4_1.heavy 447.786 / 546.373 2330.0 28.243950366973877 44 20 10 6 8 6.84523334879748 14.608705781749173 0.03859901428222656 4 0.9975045383809481 24.69997804939992 2330.0 4.10687349995602 1.0 - - - - - - - 684.2857142857143 4 7 VDAC1;VDAC2;VDAC3 voltage-dependent anion channel 1;voltage-dependent anion channel 2;voltage-dependent anion channel 3 2075 264 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB538860.[MT7]-FGIAAK[MT7].2b3_1.heavy 447.786 / 462.283 5049.0 28.243950366973877 44 20 10 6 8 6.84523334879748 14.608705781749173 0.03859901428222656 4 0.9975045383809481 24.69997804939992 5049.0 4.079269394805131 0.0 - - - - - - - 1215.2222222222222 10 9 VDAC1;VDAC2;VDAC3 voltage-dependent anion channel 1;voltage-dependent anion channel 2;voltage-dependent anion channel 3 2077 264 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB538860.[MT7]-FGIAAK[MT7].2y5_1.heavy 447.786 / 603.395 11327.0 28.243950366973877 44 20 10 6 8 6.84523334879748 14.608705781749173 0.03859901428222656 4 0.9975045383809481 24.69997804939992 11327.0 13.673023090741317 0.0 - - - - - - - 735.4545454545455 22 11 VDAC1;VDAC2;VDAC3 voltage-dependent anion channel 1;voltage-dependent anion channel 2;voltage-dependent anion channel 3 2079 264 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB538860.[MT7]-FGIAAK[MT7].2b4_1.heavy 447.786 / 533.32 2654.0 28.243950366973877 44 20 10 6 8 6.84523334879748 14.608705781749173 0.03859901428222656 4 0.9975045383809481 24.69997804939992 2654.0 3.896908809891808 4.0 - - - - - - - 1230.0 5 7 VDAC1;VDAC2;VDAC3 voltage-dependent anion channel 1;voltage-dependent anion channel 2;voltage-dependent anion channel 3 2081 265 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18383.[MT7]-GRTWTLC[CAM]GTPEYLAPEIILSK[MT7].4y4_1.heavy 674.12 / 604.415 17185.0 43.89459991455078 44 14 10 10 10 3.238993843961804 24.443802096449275 0.0 3 0.9454210421325323 5.258409504734186 17185.0 74.41479750778817 0.0 - - - - - - - 676.5714285714286 34 7 PRKACA;PRKACB;PRKACG protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta;protein kinase, cAMP-dependent, catalytic, gamma 2083 265 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18383.[MT7]-GRTWTLC[CAM]GTPEYLAPEIILSK[MT7].4b11_2.heavy 674.12 / 702.346 22967.0 43.89459991455078 44 14 10 10 10 3.238993843961804 24.443802096449275 0.0 3 0.9454210421325323 5.258409504734186 22967.0 194.0743791910015 0.0 - - - - - - - 246.78571428571428 45 14 PRKACA;PRKACB;PRKACG protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta;protein kinase, cAMP-dependent, catalytic, gamma 2085 265 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18383.[MT7]-GRTWTLC[CAM]GTPEYLAPEIILSK[MT7].4y7_1.heavy 674.12 / 943.594 11483.0 43.89459991455078 44 14 10 10 10 3.238993843961804 24.443802096449275 0.0 3 0.9454210421325323 5.258409504734186 11483.0 91.16434947282332 0.0 - - - - - - - 208.8 22 10 PRKACA;PRKACB;PRKACG protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta;protein kinase, cAMP-dependent, catalytic, gamma 2087 265 C20140311_KEGG1700_set07_03 C20140311_KEGG1700_set07_03 TB18383.[MT7]-GRTWTLC[CAM]GTPEYLAPEIILSK[MT7].4b9_1.heavy 674.12 / 1177.59 4176.0 43.89459991455078 44 14 10 10 10 3.238993843961804 24.443802096449275 0.0 3 0.9454210421325323 5.258409504734186 4176.0 24.08564315352697 0.0 - - - - - - - 228.53846153846155 8 13 PRKACA;PRKACB;PRKACG protein kinase, cAMP-dependent, catalytic, alpha;protein kinase, cAMP-dependent, catalytic, beta;protein kinase, cAMP-dependent, catalytic, gamma