Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585342.[MT7]-AGLGSGLSLSGLVHPELSR.3b6_1.heavy 665.377 / 587.327 1982.0 40.46780014038086 29 3 10 10 6 0.3408996627541061 125.43976381295323 0.0 6 0.5695619200356147 1.8089621221631913 1982.0 2.9328171249459523 2.0 - - - - - - - 711.0 3 9 ACADVL acyl-CoA dehydrogenase, very long chain 3 1 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585342.[MT7]-AGLGSGLSLSGLVHPELSR.3b8_1.heavy 665.377 / 787.443 16309.0 40.46780014038086 29 3 10 10 6 0.3408996627541061 125.43976381295323 0.0 6 0.5695619200356147 1.8089621221631913 16309.0 52.546768530425844 0.0 - - - - - - - 277.5833333333333 32 12 ACADVL acyl-CoA dehydrogenase, very long chain 5 1 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585342.[MT7]-AGLGSGLSLSGLVHPELSR.3y5_1.heavy 665.377 / 601.33 5677.0 40.46780014038086 29 3 10 10 6 0.3408996627541061 125.43976381295323 0.0 6 0.5695619200356147 1.8089621221631913 5677.0 7.406251220773251 3.0 - - - - - - - 1248.5714285714287 34 7 ACADVL acyl-CoA dehydrogenase, very long chain 7 1 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585342.[MT7]-AGLGSGLSLSGLVHPELSR.3y10_1.heavy 665.377 / 1094.6 34780.0 40.46780014038086 29 3 10 10 6 0.3408996627541061 125.43976381295323 0.0 6 0.5695619200356147 1.8089621221631913 34780.0 106.41907291423648 0.0 - - - - - - - 658.0 69 10 ACADVL acyl-CoA dehydrogenase, very long chain 9 2 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21224.[MT7]-IVIPLIEEASK[MT7].3b4_1.heavy 500.648 / 567.399 5069.0 43.900075912475586 32 11 10 3 8 0.758748305689616 75.57519326245668 0.07270050048828125 4 0.8559583544250245 3.211899079696396 5069.0 7.473525641025642 1.0 - - - - - - - 246.0 10 13 PDE1A phosphodiesterase 1A, calmodulin-dependent 11 2 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21224.[MT7]-IVIPLIEEASK[MT7].3b5_1.heavy 500.648 / 680.483 7408.0 43.900075912475586 32 11 10 3 8 0.758748305689616 75.57519326245668 0.07270050048828125 4 0.8559583544250245 3.211899079696396 7408.0 25.203554036435392 0.0 - - - - - - - 156.0 14 10 PDE1A phosphodiesterase 1A, calmodulin-dependent 13 2 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21224.[MT7]-IVIPLIEEASK[MT7].3y4_1.heavy 500.648 / 578.327 15284.0 43.900075912475586 32 11 10 3 8 0.758748305689616 75.57519326245668 0.07270050048828125 4 0.8559583544250245 3.211899079696396 15284.0 221.8419413919414 0.0 - - - - - - - 276.54545454545456 30 11 PDE1A phosphodiesterase 1A, calmodulin-dependent 15 2 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21224.[MT7]-IVIPLIEEASK[MT7].3y5_1.heavy 500.648 / 707.369 9670.0 43.900075912475586 32 11 10 3 8 0.758748305689616 75.57519326245668 0.07270050048828125 4 0.8559583544250245 3.211899079696396 9670.0 0.3729630700993154 1.0 - - - - - - - 351.0 20 6 PDE1A phosphodiesterase 1A, calmodulin-dependent 17 3 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543048.[MT7]-NVNLEYQVK[MT7].3b4_1.heavy 465.601 / 585.348 69765.0 29.294300079345703 50 20 10 10 10 10.943533215791533 9.137816647342 0.0 3 0.9949017531049501 17.276957051389463 69765.0 140.83214306454988 0.0 - - - - - - - 384.57142857142856 139 7 IL5RA interleukin 5 receptor, alpha 19 3 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543048.[MT7]-NVNLEYQVK[MT7].3b5_1.heavy 465.601 / 714.39 69531.0 29.294300079345703 50 20 10 10 10 10.943533215791533 9.137816647342 0.0 3 0.9949017531049501 17.276957051389463 69531.0 145.7958766327941 0.0 - - - - - - - 636.5 139 8 IL5RA interleukin 5 receptor, alpha 21 3 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543048.[MT7]-NVNLEYQVK[MT7].3y4_1.heavy 465.601 / 681.405 38980.0 29.294300079345703 50 20 10 10 10 10.943533215791533 9.137816647342 0.0 3 0.9949017531049501 17.276957051389463 38980.0 125.12888784657079 0.0 - - - - - - - 317.85714285714283 77 14 IL5RA interleukin 5 receptor, alpha 23 3 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543048.[MT7]-NVNLEYQVK[MT7].3b3_1.heavy 465.601 / 472.264 111613.0 29.294300079345703 50 20 10 10 10 10.943533215791533 9.137816647342 0.0 3 0.9949017531049501 17.276957051389463 111613.0 80.99216882597719 0.0 - - - - - - - 721.7777777777778 223 9 IL5RA interleukin 5 receptor, alpha 25 4 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21221.[MT7]-NITC[CAM]ITC[CAM]TDVR.2y8_1.heavy 748.87 / 1024.45 9102.0 29.7858247756958 44 18 10 6 10 6.614816310082176 15.11757776970797 0.034900665283203125 3 0.9857735610940973 10.33470413457134 9102.0 47.275681938559316 0.0 - - - - - - - 226.5 18 18 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 27 4 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21221.[MT7]-NITC[CAM]ITC[CAM]TDVR.2b4_1.heavy 748.87 / 633.315 4255.0 29.7858247756958 44 18 10 6 10 6.614816310082176 15.11757776970797 0.034900665283203125 3 0.9857735610940973 10.33470413457134 4255.0 18.85827067669173 0.0 - - - - - - - 298.5 8 20 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 29 4 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21221.[MT7]-NITC[CAM]ITC[CAM]TDVR.2y9_1.heavy 748.87 / 1125.5 9634.0 29.7858247756958 44 18 10 6 10 6.614816310082176 15.11757776970797 0.034900665283203125 3 0.9857735610940973 10.33470413457134 9634.0 46.72181029849142 0.0 - - - - - - - 257.29411764705884 19 17 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 31 4 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21221.[MT7]-NITC[CAM]ITC[CAM]TDVR.2y6_1.heavy 748.87 / 751.34 4374.0 29.7858247756958 44 18 10 6 10 6.614816310082176 15.11757776970797 0.034900665283203125 3 0.9857735610940973 10.33470413457134 4374.0 19.100722596448254 0.0 - - - - - - - 233.8695652173913 8 23 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 33 5 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21361.[MT7]-AQLDAAVTFGPSQVAR.3y6_1.heavy 592.324 / 657.368 13683.0 35.1432991027832 47 17 10 10 10 3.140967197060628 25.423247544334785 0.0 3 0.9761931626923265 7.982632467785287 13683.0 31.910325979442074 0.0 - - - - - - - 280.8888888888889 27 9 ARSA arylsulfatase A 35 5 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21361.[MT7]-AQLDAAVTFGPSQVAR.3b4_1.heavy 592.324 / 572.316 13788.0 35.1432991027832 47 17 10 10 10 3.140967197060628 25.423247544334785 0.0 3 0.9761931626923265 7.982632467785287 13788.0 34.90075045027016 0.0 - - - - - - - 666.6666666666666 27 9 ARSA arylsulfatase A 37 5 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21361.[MT7]-AQLDAAVTFGPSQVAR.3b5_1.heavy 592.324 / 643.353 18104.0 35.1432991027832 47 17 10 10 10 3.140967197060628 25.423247544334785 0.0 3 0.9761931626923265 7.982632467785287 18104.0 53.98351417501331 0.0 - - - - - - - 289.625 36 8 ARSA arylsulfatase A 39 5 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21361.[MT7]-AQLDAAVTFGPSQVAR.3y8_1.heavy 592.324 / 861.458 8947.0 35.1432991027832 47 17 10 10 10 3.140967197060628 25.423247544334785 0.0 3 0.9761931626923265 7.982632467785287 8947.0 55.748870253164554 0.0 - - - - - - - 255.71428571428572 17 7 ARSA arylsulfatase A 41 6 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544188.[MT7]-SIVHAVQAGIFVER.3y7_1.heavy 557.322 / 791.441 12181.0 36.562599182128906 50 20 10 10 10 16.121353063705705 6.202953288401817 0.0 3 0.9977435491012473 25.975728029582886 12181.0 77.45592432543958 0.0 - - - - - - - 241.3 24 10 PDE1A;PDE1C;PDE1B phosphodiesterase 1A, calmodulin-dependent;phosphodiesterase 1C, calmodulin-dependent 70kDa;phosphodiesterase 1B, calmodulin-dependent 43 6 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544188.[MT7]-SIVHAVQAGIFVER.3y6_1.heavy 557.322 / 720.404 10010.0 36.562599182128906 50 20 10 10 10 16.121353063705705 6.202953288401817 0.0 3 0.9977435491012473 25.975728029582886 10010.0 13.080265339966832 1.0 - - - - - - - 263.09090909090907 20 11 PDE1A;PDE1C;PDE1B phosphodiesterase 1A, calmodulin-dependent;phosphodiesterase 1C, calmodulin-dependent 70kDa;phosphodiesterase 1B, calmodulin-dependent 45 6 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544188.[MT7]-SIVHAVQAGIFVER.3b4_1.heavy 557.322 / 581.353 7960.0 36.562599182128906 50 20 10 10 10 16.121353063705705 6.202953288401817 0.0 3 0.9977435491012473 25.975728029582886 7960.0 22.765492060874266 0.0 - - - - - - - 254.66666666666666 15 9 PDE1A;PDE1C;PDE1B phosphodiesterase 1A, calmodulin-dependent;phosphodiesterase 1C, calmodulin-dependent 70kDa;phosphodiesterase 1B, calmodulin-dependent 47 6 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544188.[MT7]-SIVHAVQAGIFVER.3y8_1.heavy 557.322 / 919.5 10734.0 36.562599182128906 50 20 10 10 10 16.121353063705705 6.202953288401817 0.0 3 0.9977435491012473 25.975728029582886 10734.0 56.17349676761192 0.0 - - - - - - - 241.33333333333334 21 3 PDE1A;PDE1C;PDE1B phosphodiesterase 1A, calmodulin-dependent;phosphodiesterase 1C, calmodulin-dependent 70kDa;phosphodiesterase 1B, calmodulin-dependent 49 7 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544436.[MT7]-LVSHLTAQLNELK[MT7].3y3_1.heavy 585.352 / 533.341 11100.0 38.02360153198242 45 15 10 10 10 2.524308853643232 32.33616931727792 0.0 3 0.9536542954164805 5.710391469288378 11100.0 25.763178123415603 0.0 - - - - - - - 251.6 22 10 ITPR3 inositol 1,4,5-triphosphate receptor, type 3 51 7 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544436.[MT7]-LVSHLTAQLNELK[MT7].3b4_1.heavy 585.352 / 581.353 11901.0 38.02360153198242 45 15 10 10 10 2.524308853643232 32.33616931727792 0.0 3 0.9536542954164805 5.710391469288378 11901.0 32.52563882559388 0.0 - - - - - - - 228.71428571428572 23 7 ITPR3 inositol 1,4,5-triphosphate receptor, type 3 53 7 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544436.[MT7]-LVSHLTAQLNELK[MT7].3y4_1.heavy 585.352 / 647.385 18767.0 38.02360153198242 45 15 10 10 10 2.524308853643232 32.33616931727792 0.0 3 0.9536542954164805 5.710391469288378 18767.0 52.63027487493779 0.0 - - - - - - - 670.2857142857143 37 7 ITPR3 inositol 1,4,5-triphosphate receptor, type 3 55 7 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544436.[MT7]-LVSHLTAQLNELK[MT7].3y5_1.heavy 585.352 / 760.469 11443.0 38.02360153198242 45 15 10 10 10 2.524308853643232 32.33616931727792 0.0 3 0.9536542954164805 5.710391469288378 11443.0 29.48196506550218 0.0 - - - - - - - 305.1111111111111 22 9 ITPR3 inositol 1,4,5-triphosphate receptor, type 3 57 8 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540470.[MT7]-TQFGEK[MT7].2b3_1.heavy 499.281 / 521.284 1394.0 21.265299797058105 41 16 10 7 8 1.1688391717884388 53.04206161300141 0.029600143432617188 4 0.9628885971534009 6.38640336085769 1394.0 1.807656292742462 1.0 - - - - - - - 250.47826086956522 2 23 ACADVL acyl-CoA dehydrogenase, very long chain 59 8 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540470.[MT7]-TQFGEK[MT7].2y4_1.heavy 499.281 / 624.347 2882.0 21.265299797058105 41 16 10 7 8 1.1688391717884388 53.04206161300141 0.029600143432617188 4 0.9628885971534009 6.38640336085769 2882.0 5.85655447700263 0.0 - - - - - - - 632.7692307692307 5 13 ACADVL acyl-CoA dehydrogenase, very long chain 61 8 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540470.[MT7]-TQFGEK[MT7].2y5_1.heavy 499.281 / 752.406 976.0 21.265299797058105 41 16 10 7 8 1.1688391717884388 53.04206161300141 0.029600143432617188 4 0.9628885971534009 6.38640336085769 976.0 3.3827168115792903 1.0 - - - - - - - 169.07142857142858 2 28 ACADVL acyl-CoA dehydrogenase, very long chain 63 8 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540470.[MT7]-TQFGEK[MT7].2b5_1.heavy 499.281 / 707.348 790.0 21.265299797058105 41 16 10 7 8 1.1688391717884388 53.04206161300141 0.029600143432617188 4 0.9628885971534009 6.38640336085769 790.0 0.9059306911854698 8.0 - - - - - - - 285.1818181818182 2 22 ACADVL acyl-CoA dehydrogenase, very long chain 65 9 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21099.[MT7]-VPITYLELLN.2b8_2.heavy 659.891 / 537.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3GLB1 SH3-domain GRB2-like endophilin B1 67 9 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21099.[MT7]-VPITYLELLN.2b6_1.heavy 659.891 / 831.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3GLB1 SH3-domain GRB2-like endophilin B1 69 9 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21099.[MT7]-VPITYLELLN.2b7_1.heavy 659.891 / 960.552 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3GLB1 SH3-domain GRB2-like endophilin B1 71 9 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21099.[MT7]-VPITYLELLN.2b5_1.heavy 659.891 / 718.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3GLB1 SH3-domain GRB2-like endophilin B1 73 10 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21358.[MT7]-TELDAHLENLLSK[MT7].4b4_1.heavy 443.501 / 603.311 3633.0 38.21145057678223 25 0 10 5 10 0.22131655071374137 171.95070555853889 0.041301727294921875 3 0.3310785419641504 1.4151127294384924 3633.0 22.246123348017623 0.0 - - - - - - - 261.2 7 10 SH3GLB1 SH3-domain GRB2-like endophilin B1 75 10 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21358.[MT7]-TELDAHLENLLSK[MT7].4b5_1.heavy 443.501 / 674.348 12829.0 38.21145057678223 25 0 10 5 10 0.22131655071374137 171.95070555853889 0.041301727294921875 3 0.3310785419641504 1.4151127294384924 12829.0 83.2218540958828 0.0 - - - - - - - 243.5 25 14 SH3GLB1 SH3-domain GRB2-like endophilin B1 77 10 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21358.[MT7]-TELDAHLENLLSK[MT7].4b6_1.heavy 443.501 / 811.407 3633.0 38.21145057678223 25 0 10 5 10 0.22131655071374137 171.95070555853889 0.041301727294921875 3 0.3310785419641504 1.4151127294384924 3633.0 42.122471597495945 0.0 - - - - - - - 184.75 7 8 SH3GLB1 SH3-domain GRB2-like endophilin B1 79 10 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21358.[MT7]-TELDAHLENLLSK[MT7].4b9_2.heavy 443.501 / 584.292 59261.0 38.21145057678223 25 0 10 5 10 0.22131655071374137 171.95070555853889 0.041301727294921875 3 0.3310785419641504 1.4151127294384924 59261.0 311.73719291829445 0.0 - - - - - - - 272.7 118 10 SH3GLB1 SH3-domain GRB2-like endophilin B1 81 11 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21357.[MT7]-VDPVVFVTLTC[CAM]AFR.2y8_1.heavy 884.483 / 967.503 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB2 arrestin, beta 2 83 11 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21357.[MT7]-VDPVVFVTLTC[CAM]AFR.2b4_1.heavy 884.483 / 555.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB2 arrestin, beta 2 85 11 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21357.[MT7]-VDPVVFVTLTC[CAM]AFR.2y10_1.heavy 884.483 / 1213.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB2 arrestin, beta 2 87 11 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21357.[MT7]-VDPVVFVTLTC[CAM]AFR.2y7_1.heavy 884.483 / 868.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB2 arrestin, beta 2 89 12 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21210.[MT7]-FFEEVNDPAK[MT7].3b4_1.heavy 495.261 / 697.331 52068.0 33.97570037841797 50 20 10 10 10 6.174781951747724 16.19490384947047 0.0 3 0.9947405343936914 17.00987138461121 52068.0 193.68646331038826 0.0 - - - - - - - 252.33333333333334 104 12 ACADVL acyl-CoA dehydrogenase, very long chain 91 12 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21210.[MT7]-FFEEVNDPAK[MT7].3b5_1.heavy 495.261 / 796.4 9887.0 33.97570037841797 50 20 10 10 10 6.174781951747724 16.19490384947047 0.0 3 0.9947405343936914 17.00987138461121 9887.0 56.40858934169279 0.0 - - - - - - - 212.6 19 15 ACADVL acyl-CoA dehydrogenase, very long chain 93 12 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21210.[MT7]-FFEEVNDPAK[MT7].3y4_1.heavy 495.261 / 574.332 7336.0 33.97570037841797 50 20 10 10 10 6.174781951747724 16.19490384947047 0.0 3 0.9947405343936914 17.00987138461121 7336.0 8.820339092378003 0.0 - - - - - - - 717.8571428571429 14 7 ACADVL acyl-CoA dehydrogenase, very long chain 95 12 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21210.[MT7]-FFEEVNDPAK[MT7].3b3_1.heavy 495.261 / 568.289 32453.0 33.97570037841797 50 20 10 10 10 6.174781951747724 16.19490384947047 0.0 3 0.9947405343936914 17.00987138461121 32453.0 88.79302782611916 0.0 - - - - - - - 326.09090909090907 64 11 ACADVL acyl-CoA dehydrogenase, very long chain 97 13 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21212.[MT7]-ELIINEILVMR.2b3_1.heavy 743.943 / 500.32 3245.0 48.37040042877197 35 13 6 6 10 1.1818885505306687 51.25783015627691 0.039997100830078125 3 0.9279753785539987 4.570672458499932 3245.0 8.980176275950924 0.0 - - - - - - - 286.3529411764706 6 17 PAK1;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 3 99 13 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21212.[MT7]-ELIINEILVMR.2y8_1.heavy 743.943 / 987.566 4747.0 48.37040042877197 35 13 6 6 10 1.1818885505306687 51.25783015627691 0.039997100830078125 3 0.9279753785539987 4.570672458499932 4747.0 27.103046906740538 0.0 - - - - - - - 206.3125 9 16 PAK1;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 3 101 13 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21212.[MT7]-ELIINEILVMR.2y10_1.heavy 743.943 / 1213.73 1622.0 48.37040042877197 35 13 6 6 10 1.1818885505306687 51.25783015627691 0.039997100830078125 3 0.9279753785539987 4.570672458499932 1622.0 7.323711911357341 3.0 - - - - - - - 192.8421052631579 13 19 PAK1;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 3 103 13 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21212.[MT7]-ELIINEILVMR.2y7_1.heavy 743.943 / 874.482 1923.0 48.37040042877197 35 13 6 6 10 1.1818885505306687 51.25783015627691 0.039997100830078125 3 0.9279753785539987 4.570672458499932 1923.0 7.553668889757245 0.0 - - - - - - - 196.94444444444446 3 18 PAK1;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 3 105 14 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21359.[MT7]-TELDAHLENLLSK[MT7].3y6_1.heavy 591 / 847.5 8562.0 38.190799713134766 47 17 10 10 10 3.00072459384901 28.035644874433935 0.0 3 0.9787630303408145 8.453654510041925 8562.0 89.71792064954509 0.0 - - - - - - - 228.22222222222223 17 9 SH3GLB1 SH3-domain GRB2-like endophilin B1 107 14 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21359.[MT7]-TELDAHLENLLSK[MT7].3b4_1.heavy 591 / 603.311 21347.0 38.190799713134766 47 17 10 10 10 3.00072459384901 28.035644874433935 0.0 3 0.9787630303408145 8.453654510041925 21347.0 56.091034677760504 0.0 - - - - - - - 199.5 42 8 SH3GLB1 SH3-domain GRB2-like endophilin B1 109 14 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21359.[MT7]-TELDAHLENLLSK[MT7].3b5_1.heavy 591 / 674.348 15183.0 38.190799713134766 47 17 10 10 10 3.00072459384901 28.035644874433935 0.0 3 0.9787630303408145 8.453654510041925 15183.0 93.82346769549696 0.0 - - - - - - - 263.8125 30 16 SH3GLB1 SH3-domain GRB2-like endophilin B1 111 14 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21359.[MT7]-TELDAHLENLLSK[MT7].3y4_1.heavy 591 / 604.415 7420.0 38.190799713134766 47 17 10 10 10 3.00072459384901 28.035644874433935 0.0 3 0.9787630303408145 8.453654510041925 7420.0 27.538914927220727 0.0 - - - - - - - 248.8181818181818 14 11 SH3GLB1 SH3-domain GRB2-like endophilin B1 113 15 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21499.[MT7]-K[MT7]NPQAVLDVLEFYNSK[MT7].3y6_1.heavy 766.434 / 931.464 4567.0 42.455299377441406 42 16 10 6 10 2.5513764565126977 31.122071095100097 0.03479766845703125 3 0.9621388016303497 6.322449041642875 4567.0 6.398598949211909 1.0 - - - - - - - 305.875 9 16 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 115 15 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21499.[MT7]-K[MT7]NPQAVLDVLEFYNSK[MT7].3b5_1.heavy 766.434 / 827.498 1876.0 42.455299377441406 42 16 10 6 10 2.5513764565126977 31.122071095100097 0.03479766845703125 3 0.9621388016303497 6.322449041642875 1876.0 5.54359918200409 0.0 - - - - - - - 266.04347826086956 3 23 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 117 15 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21499.[MT7]-K[MT7]NPQAVLDVLEFYNSK[MT7].3y5_1.heavy 766.434 / 802.422 4323.0 42.455299377441406 42 16 10 6 10 2.5513764565126977 31.122071095100097 0.03479766845703125 3 0.9621388016303497 6.322449041642875 4323.0 8.175860203976512 0.0 - - - - - - - 274.7894736842105 8 19 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 119 15 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21499.[MT7]-K[MT7]NPQAVLDVLEFYNSK[MT7].3b8_2.heavy 766.434 / 577.842 14436.0 42.455299377441406 42 16 10 6 10 2.5513764565126977 31.122071095100097 0.03479766845703125 3 0.9621388016303497 6.322449041642875 14436.0 17.21288343558282 1.0 - - - - - - - 239.07142857142858 28 14 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 121 16 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21498.[MT7]-K[MT7]NPQAVLDVLEFYNSK[MT7].4b8_1.heavy 575.077 / 1154.68 1636.0 42.463998794555664 37 11 10 6 10 2.0594688099906024 48.5562099872036 0.03479766845703125 3 0.8647622743426004 3.317362573378331 1636.0 19.79160975609756 0.0 - - - - - - - 147.4 3 5 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 123 16 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21498.[MT7]-K[MT7]NPQAVLDVLEFYNSK[MT7].4b8_2.heavy 575.077 / 577.842 53424.0 42.463998794555664 37 11 10 6 10 2.0594688099906024 48.5562099872036 0.03479766845703125 3 0.8647622743426004 3.317362573378331 53424.0 161.63067759082372 0.0 - - - - - - - 245.41666666666666 106 12 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 125 16 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21498.[MT7]-K[MT7]NPQAVLDVLEFYNSK[MT7].4b5_2.heavy 575.077 / 414.253 12108.0 42.463998794555664 37 11 10 6 10 2.0594688099906024 48.5562099872036 0.03479766845703125 3 0.8647622743426004 3.317362573378331 12108.0 38.96260692464358 0.0 - - - - - - - 313.55555555555554 24 18 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 127 16 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21498.[MT7]-K[MT7]NPQAVLDVLEFYNSK[MT7].4b5_1.heavy 575.077 / 827.498 2127.0 42.463998794555664 37 11 10 6 10 2.0594688099906024 48.5562099872036 0.03479766845703125 3 0.8647622743426004 3.317362573378331 2127.0 14.318587530425015 0.0 - - - - - - - 201.3846153846154 4 13 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 129 17 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21356.[MT7]-AIQLEPAEPGQAWGR.2y10_1.heavy 883.969 / 1068.52 9757.0 35.270301818847656 45 15 10 10 10 1.266283926914318 50.58110741226492 0.0 3 0.95339377800135 5.694283484928661 9757.0 51.432019151614924 0.0 - - - - - - - 190.44444444444446 19 9 MAP3K11 mitogen-activated protein kinase kinase kinase 11 131 17 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21356.[MT7]-AIQLEPAEPGQAWGR.2b5_1.heavy 883.969 / 699.416 6433.0 35.270301818847656 45 15 10 10 10 1.266283926914318 50.58110741226492 0.0 3 0.95339377800135 5.694283484928661 6433.0 45.742748882568065 0.0 - - - - - - - 227.625 12 8 MAP3K11 mitogen-activated protein kinase kinase kinase 11 133 17 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21356.[MT7]-AIQLEPAEPGQAWGR.2y11_1.heavy 883.969 / 1197.56 2573.0 35.270301818847656 45 15 10 10 10 1.266283926914318 50.58110741226492 0.0 3 0.95339377800135 5.694283484928661 2573.0 46.41018691588785 0.0 - - - - - - - 133.75 5 8 MAP3K11 mitogen-activated protein kinase kinase kinase 11 135 17 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21356.[MT7]-AIQLEPAEPGQAWGR.2y7_1.heavy 883.969 / 771.39 4718.0 35.270301818847656 45 15 10 10 10 1.266283926914318 50.58110741226492 0.0 3 0.95339377800135 5.694283484928661 4718.0 9.974502777487851 0.0 - - - - - - - 263.09090909090907 9 11 MAP3K11 mitogen-activated protein kinase kinase kinase 11 137 18 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21494.[MT7]-ILGLC[CAM]LLQNELC[CAM]PITLNR.2b4_1.heavy 1142.64 / 541.383 2336.0 50.99800109863281 48 18 10 10 10 3.3995431793315145 29.415716972791618 0.0 3 0.9810382051766549 8.948165333210131 2336.0 32.83138641463249 0.0 - - - - - - - 109.73333333333333 4 15 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 139 18 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21494.[MT7]-ILGLC[CAM]LLQNELC[CAM]PITLNR.2b6_1.heavy 1142.64 / 814.498 1876.0 50.99800109863281 48 18 10 10 10 3.3995431793315145 29.415716972791618 0.0 3 0.9810382051766549 8.948165333210131 1876.0 31.254336030461687 0.0 - - - - - - - 167.5625 3 16 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 141 18 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21494.[MT7]-ILGLC[CAM]LLQNELC[CAM]PITLNR.2y10_1.heavy 1142.64 / 1229.63 1417.0 50.99800109863281 48 18 10 10 10 3.3995431793315145 29.415716972791618 0.0 3 0.9810382051766549 8.948165333210131 1417.0 29.618580463015242 0.0 - - - - - - - 121.33333333333333 2 18 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 143 18 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21494.[MT7]-ILGLC[CAM]LLQNELC[CAM]PITLNR.2b5_1.heavy 1142.64 / 701.414 2182.0 50.99800109863281 48 18 10 10 10 3.3995431793315145 29.415716972791618 0.0 3 0.9810382051766549 8.948165333210131 2182.0 45.04209824957651 0.0 - - - - - - - 85.46153846153847 4 13 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 145 19 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21493.[MT7]-ALDSDAVVVAVFSGLPAVEK[MT7].3b6_1.heavy 759.098 / 717.354 5569.0 49.81990051269531 40 10 10 10 10 0.7353533535813277 78.03028133940145 0.0 3 0.8398257465572937 3.0415219569483707 5569.0 64.70342412617221 0.0 - - - - - - - 178.71428571428572 11 14 TRIM37 tripartite motif-containing 37 147 19 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21493.[MT7]-ALDSDAVVVAVFSGLPAVEK[MT7].3b5_1.heavy 759.098 / 646.316 2912.0 49.81990051269531 40 10 10 10 10 0.7353533535813277 78.03028133940145 0.0 3 0.8398257465572937 3.0415219569483707 2912.0 3.9469879518072295 1.0 - - - - - - - 649.6428571428571 5 14 TRIM37 tripartite motif-containing 37 149 19 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21493.[MT7]-ALDSDAVVVAVFSGLPAVEK[MT7].3y5_1.heavy 759.098 / 687.416 13489.0 49.81990051269531 40 10 10 10 10 0.7353533535813277 78.03028133940145 0.0 3 0.8398257465572937 3.0415219569483707 13489.0 68.443624693231 0.0 - - - - - - - 243.69230769230768 26 13 TRIM37 tripartite motif-containing 37 151 19 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21493.[MT7]-ALDSDAVVVAVFSGLPAVEK[MT7].3b7_1.heavy 759.098 / 816.422 7766.0 49.81990051269531 40 10 10 10 10 0.7353533535813277 78.03028133940145 0.0 3 0.8398257465572937 3.0415219569483707 7766.0 58.47341176470587 0.0 - - - - - - - 183.05882352941177 15 17 TRIM37 tripartite motif-containing 37 153 20 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21351.[MT7]-LVSHLTAQLNELK[MT7].4b8_2.heavy 439.266 / 497.794 44875.0 38.00195121765137 25 0 10 5 10 0.31034792328263106 131.14913570152984 0.043300628662109375 3 0.35424323221745546 1.4439822458737288 44875.0 175.8546918767507 0.0 - - - - - - - 251.22222222222223 89 9 ITPR3 inositol 1,4,5-triphosphate receptor, type 3 155 20 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21351.[MT7]-LVSHLTAQLNELK[MT7].4b4_1.heavy 439.266 / 581.353 1309.0 38.00195121765137 25 0 10 5 10 0.31034792328263106 131.14913570152984 0.043300628662109375 3 0.35424323221745546 1.4439822458737288 1309.0 16.456 0.0 - - - - - - - 297.5 2 2 ITPR3 inositol 1,4,5-triphosphate receptor, type 3 157 20 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21351.[MT7]-LVSHLTAQLNELK[MT7].4y3_1.heavy 439.266 / 533.341 17736.0 38.00195121765137 25 0 10 5 10 0.31034792328263106 131.14913570152984 0.043300628662109375 3 0.35424323221745546 1.4439822458737288 17736.0 95.9830588235294 0.0 - - - - - - - 257.8333333333333 35 12 ITPR3 inositol 1,4,5-triphosphate receptor, type 3 159 20 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21351.[MT7]-LVSHLTAQLNELK[MT7].4b3_1.heavy 439.266 / 444.294 4047.0 38.00195121765137 25 0 10 5 10 0.31034792328263106 131.14913570152984 0.043300628662109375 3 0.35424323221745546 1.4439822458737288 4047.0 42.73722689075631 0.0 - - - - - - - 226.1 8 10 ITPR3 inositol 1,4,5-triphosphate receptor, type 3 161 21 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21492.[MT7]-ESATSPGQYVLSGLQGGQAK[MT7].3b9_1.heavy 756.069 / 1065.5 9062.0 36.619675636291504 42 17 10 5 10 4.334345236519048 23.071535501475402 0.046298980712890625 3 0.977126428790518 8.144493224494958 9062.0 19.548330902407457 0.0 - - - - - - - 226.75 18 8 SHC4 SHC (Src homology 2 domain containing) family, member 4 163 21 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21492.[MT7]-ESATSPGQYVLSGLQGGQAK[MT7].3b5_1.heavy 756.069 / 620.301 13896.0 36.619675636291504 42 17 10 5 10 4.334345236519048 23.071535501475402 0.046298980712890625 3 0.977126428790518 8.144493224494958 13896.0 124.2533589537899 0.0 - - - - - - - 258.85714285714283 27 7 SHC4 SHC (Src homology 2 domain containing) family, member 4 165 21 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21492.[MT7]-ESATSPGQYVLSGLQGGQAK[MT7].3y5_1.heavy 756.069 / 604.354 23925.0 36.619675636291504 42 17 10 5 10 4.334345236519048 23.071535501475402 0.046298980712890625 3 0.977126428790518 8.144493224494958 23925.0 61.08405813436336 0.0 - - - - - - - 327.7142857142857 47 7 SHC4 SHC (Src homology 2 domain containing) family, member 4 167 21 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21492.[MT7]-ESATSPGQYVLSGLQGGQAK[MT7].3y9_1.heavy 756.069 / 989.55 7129.0 36.619675636291504 42 17 10 5 10 4.334345236519048 23.071535501475402 0.046298980712890625 3 0.977126428790518 8.144493224494958 7129.0 28.732302438620938 1.0 - - - - - - - 241.8 20 5 SHC4 SHC (Src homology 2 domain containing) family, member 4 169 22 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584332.[MT7]-LTVYLGK[MT7].2y4_1.heavy 541.347 / 624.384 23305.0 34.65399932861328 47 17 10 10 10 3.857621075866776 25.92271195986527 0.0 3 0.9789955316574167 8.500479056399659 23305.0 66.76107692307691 0.0 - - - - - - - 280.0 46 12 ARRB1;ARRB2 arrestin, beta 1;arrestin, beta 2 171 22 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584332.[MT7]-LTVYLGK[MT7].2y5_1.heavy 541.347 / 723.452 7385.0 34.65399932861328 47 17 10 10 10 3.857621075866776 25.92271195986527 0.0 3 0.9789955316574167 8.500479056399659 7385.0 24.00125 0.0 - - - - - - - 262.7368421052632 14 19 ARRB1;ARRB2 arrestin, beta 1;arrestin, beta 2 173 22 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584332.[MT7]-LTVYLGK[MT7].2b4_1.heavy 541.347 / 621.373 10358.0 34.65399932861328 47 17 10 10 10 3.857621075866776 25.92271195986527 0.0 3 0.9789955316574167 8.500479056399659 10358.0 33.27524380704041 0.0 - - - - - - - 295.38461538461536 20 13 ARRB1;ARRB2 arrestin, beta 1;arrestin, beta 2 175 22 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584332.[MT7]-LTVYLGK[MT7].2y6_1.heavy 541.347 / 824.5 19373.0 34.65399932861328 47 17 10 10 10 3.857621075866776 25.92271195986527 0.0 3 0.9789955316574167 8.500479056399659 19373.0 131.9785625 0.0 - - - - - - - 210.0 38 16 ARRB1;ARRB2 arrestin, beta 1;arrestin, beta 2 177 23 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543692.[MT7]-NSLEDLTAEDFR.3y6_1.heavy 518.59 / 738.342 11515.0 37.89189910888672 43 13 10 10 10 1.309424128591268 50.28911436232475 0.0 3 0.9000838938153141 3.8713319312914543 11515.0 5.221481118195194 1.0 - - - - - - - 312.0 23 10 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 179 23 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543692.[MT7]-NSLEDLTAEDFR.3b4_1.heavy 518.59 / 588.311 8996.0 37.89189910888672 43 13 10 10 10 1.309424128591268 50.28911436232475 0.0 3 0.9000838938153141 3.8713319312914543 8996.0 18.581023809523806 0.0 - - - - - - - 346.6666666666667 17 9 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 181 23 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543692.[MT7]-NSLEDLTAEDFR.3b5_1.heavy 518.59 / 703.338 14874.0 37.89189910888672 43 13 10 10 10 1.309424128591268 50.28911436232475 0.0 3 0.9000838938153141 3.8713319312914543 14874.0 123.13497627018512 1.0 - - - - - - - 240.0 30 6 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 183 23 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543692.[MT7]-NSLEDLTAEDFR.3y5_1.heavy 518.59 / 637.294 16553.0 37.89189910888672 43 13 10 10 10 1.309424128591268 50.28911436232475 0.0 3 0.9000838938153141 3.8713319312914543 16553.0 38.667978482099066 0.0 - - - - - - - 274.2857142857143 33 7 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 185 24 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 898857.0 31.011699676513672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 898857.0 1954.9196970729563 0.0 - - - - - - - 684.0 1797 2 187 24 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 295930.0 31.011699676513672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 295930.0 451.6970289791233 0.0 - - - - - - - 779.0 591 6 189 24 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 323813.0 31.011699676513672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 323813.0 359.51272909685576 0.0 - - - - - - - 1670.2857142857142 647 7 191 25 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21246.[MT7]-ELVVTQLGYDTR.2y8_1.heavy 769.421 / 953.469 26020.0 35.93339920043945 46 16 10 10 10 2.1035130839978557 42.74276089005345 0.0 3 0.9638055048925719 6.467291047339219 26020.0 127.27859420844494 0.0 - - - - - - - 277.0 52 11 PFKP phosphofructokinase, platelet 193 25 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21246.[MT7]-ELVVTQLGYDTR.2b4_1.heavy 769.421 / 585.373 17581.0 35.93339920043945 46 16 10 10 10 2.1035130839978557 42.74276089005345 0.0 3 0.9638055048925719 6.467291047339219 17581.0 28.20160409556314 0.0 - - - - - - - 287.6363636363636 35 11 PFKP phosphofructokinase, platelet 195 25 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21246.[MT7]-ELVVTQLGYDTR.2y9_1.heavy 769.421 / 1052.54 23676.0 35.93339920043945 46 16 10 10 10 2.1035130839978557 42.74276089005345 0.0 3 0.9638055048925719 6.467291047339219 23676.0 111.5204882244621 0.0 - - - - - - - 301.42857142857144 47 14 PFKP phosphofructokinase, platelet 197 25 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21246.[MT7]-ELVVTQLGYDTR.2y10_1.heavy 769.421 / 1151.61 11017.0 35.93339920043945 46 16 10 10 10 2.1035130839978557 42.74276089005345 0.0 3 0.9638055048925719 6.467291047339219 11017.0 71.95397872960372 0.0 - - - - - - - 191.63636363636363 22 11 PFKP phosphofructokinase, platelet 199 26 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21245.[MT7]-VYTITPLLSDNR.2b3_1.heavy 768.431 / 508.289 4885.0 39.06010055541992 48 18 10 10 10 4.526594431734609 22.09166328198738 0.0 3 0.9863526999549046 10.55222024295614 4885.0 8.523792706892145 0.0 - - - - - - - 236.36363636363637 9 11 ARRB2 arrestin, beta 2 201 26 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21245.[MT7]-VYTITPLLSDNR.2y9_1.heavy 768.431 / 1028.57 4366.0 39.06010055541992 48 18 10 10 10 4.526594431734609 22.09166328198738 0.0 3 0.9863526999549046 10.55222024295614 4366.0 17.35205128205128 0.0 - - - - - - - 268.6666666666667 8 12 ARRB2 arrestin, beta 2 203 26 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21245.[MT7]-VYTITPLLSDNR.2y10_1.heavy 768.431 / 1129.62 3846.0 39.06010055541992 48 18 10 10 10 4.526594431734609 22.09166328198738 0.0 3 0.9863526999549046 10.55222024295614 3846.0 11.563358241758241 0.0 - - - - - - - 226.9090909090909 7 11 ARRB2 arrestin, beta 2 205 26 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21245.[MT7]-VYTITPLLSDNR.2y7_1.heavy 768.431 / 814.442 6341.0 39.06010055541992 48 18 10 10 10 4.526594431734609 22.09166328198738 0.0 3 0.9863526999549046 10.55222024295614 6341.0 30.587195512820514 0.0 - - - - - - - 277.3333333333333 12 9 ARRB2 arrestin, beta 2 207 27 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21348.[MT7]-NPFGNAGLLLGEAGK[MT7].3b5_1.heavy 582.664 / 674.338 5944.0 41.986873626708984 38 12 10 6 10 1.7224934810366475 45.943283648574294 0.0345001220703125 3 0.8982782057082963 3.836218036403785 5944.0 8.199848599545799 0.0 - - - - - - - 227.25 11 16 ACADVL acyl-CoA dehydrogenase, very long chain 209 27 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21348.[MT7]-NPFGNAGLLLGEAGK[MT7].3b8_1.heavy 582.664 / 915.481 12631.0 41.986873626708984 38 12 10 6 10 1.7224934810366475 45.943283648574294 0.0345001220703125 3 0.8982782057082963 3.836218036403785 12631.0 20.760294117647057 1.0 - - - - - - - 234.08333333333334 25 12 ACADVL acyl-CoA dehydrogenase, very long chain 211 27 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21348.[MT7]-NPFGNAGLLLGEAGK[MT7].3y5_1.heavy 582.664 / 605.338 33105.0 41.986873626708984 38 12 10 6 10 1.7224934810366475 45.943283648574294 0.0345001220703125 3 0.8982782057082963 3.836218036403785 33105.0 167.806690943429 0.0 - - - - - - - 223.0 66 10 ACADVL acyl-CoA dehydrogenase, very long chain 213 27 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21348.[MT7]-NPFGNAGLLLGEAGK[MT7].3b7_1.heavy 582.664 / 802.396 18328.0 41.986873626708984 38 12 10 6 10 1.7224934810366475 45.943283648574294 0.0345001220703125 3 0.8982782057082963 3.836218036403785 18328.0 81.22011785676838 0.0 - - - - - - - 235.15384615384616 36 13 ACADVL acyl-CoA dehydrogenase, very long chain 215 28 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585360.[MT7]-SRGFAFVTFESPADAK[MT7].3y6_1.heavy 673.358 / 732.401 6202.0 37.61589813232422 43 13 10 10 10 1.00510452193248 60.137025108404316 0.0 3 0.9201473163783748 4.337948406855598 6202.0 36.75259259259259 0.0 - - - - - - - 243.25 12 12 RBMXL3;RBMXL2;RBMX;RBMXL1 RNA binding motif protein, X-linked-like 3;RNA binding motif protein, X-linked-like 2;RNA binding motif protein, X-linked;RNA binding motif protein, X-linked-like 1 217 28 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585360.[MT7]-SRGFAFVTFESPADAK[MT7].3b6_1.heavy 673.358 / 810.438 5473.0 37.61589813232422 43 13 10 10 10 1.00510452193248 60.137025108404316 0.0 3 0.9201473163783748 4.337948406855598 5473.0 51.56332932854255 0.0 - - - - - - - 243.375 10 8 RBMXL3;RBMXL2;RBMX;RBMXL1 RNA binding motif protein, X-linked-like 3;RNA binding motif protein, X-linked-like 2;RNA binding motif protein, X-linked;RNA binding motif protein, X-linked-like 1 219 28 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585360.[MT7]-SRGFAFVTFESPADAK[MT7].3b5_1.heavy 673.358 / 663.37 2189.0 37.61589813232422 43 13 10 10 10 1.00510452193248 60.137025108404316 0.0 3 0.9201473163783748 4.337948406855598 2189.0 4.657872146118722 1.0 - - - - - - - 243.33333333333334 4 9 RBMXL3;RBMXL2;RBMX;RBMXL1 RNA binding motif protein, X-linked-like 3;RNA binding motif protein, X-linked-like 2;RNA binding motif protein, X-linked;RNA binding motif protein, X-linked-like 1 221 28 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585360.[MT7]-SRGFAFVTFESPADAK[MT7].3y5_1.heavy 673.358 / 645.369 N/A 37.61589813232422 43 13 10 10 10 1.00510452193248 60.137025108404316 0.0 3 0.9201473163783748 4.337948406855598 16053.0 3.7648904183309724 1.0 - - - - - - - 243.0 32 1 RBMXL3;RBMXL2;RBMX;RBMXL1 RNA binding motif protein, X-linked-like 3;RNA binding motif protein, X-linked-like 2;RNA binding motif protein, X-linked;RNA binding motif protein, X-linked-like 1 223 29 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21244.[MT7]-NIIGQVC[CAM]DTPK[MT7].3b4_1.heavy 511.616 / 542.342 15224.0 29.597999572753906 48 18 10 10 10 3.545140156872126 28.207629480079543 0.0 3 0.9878203765639421 11.171298496960404 15224.0 34.2854272055628 0.0 - - - - - - - 759.1333333333333 30 15 MAP3K4 mitogen-activated protein kinase kinase kinase 4 225 29 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21244.[MT7]-NIIGQVC[CAM]DTPK[MT7].3b5_1.heavy 511.616 / 670.4 32514.0 29.597999572753906 48 18 10 10 10 3.545140156872126 28.207629480079543 0.0 3 0.9878203765639421 11.171298496960404 32514.0 154.85481355932203 0.0 - - - - - - - 737.5 65 8 MAP3K4 mitogen-activated protein kinase kinase kinase 4 227 29 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21244.[MT7]-NIIGQVC[CAM]DTPK[MT7].3y4_1.heavy 511.616 / 604.342 12274.0 29.597999572753906 48 18 10 10 10 3.545140156872126 28.207629480079543 0.0 3 0.9878203765639421 11.171298496960404 12274.0 32.82312617702448 0.0 - - - - - - - 725.7 24 10 MAP3K4 mitogen-activated protein kinase kinase kinase 4 229 29 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21244.[MT7]-NIIGQVC[CAM]DTPK[MT7].3y5_1.heavy 511.616 / 764.373 10209.0 29.597999572753906 48 18 10 10 10 3.545140156872126 28.207629480079543 0.0 3 0.9878203765639421 11.171298496960404 10209.0 17.243527092963532 1.0 - - - - - - - 309.75 44 12 MAP3K4 mitogen-activated protein kinase kinase kinase 4 231 30 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21241.[MT7]-AEDEQEEGQPVR.2y5_1.heavy 765.861 / 556.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK2 interleukin-1 receptor-associated kinase 2 233 30 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21241.[MT7]-AEDEQEEGQPVR.2b4_1.heavy 765.861 / 589.259 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK2 interleukin-1 receptor-associated kinase 2 235 30 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21241.[MT7]-AEDEQEEGQPVR.2y9_1.heavy 765.861 / 1071.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK2 interleukin-1 receptor-associated kinase 2 237 30 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21241.[MT7]-AEDEQEEGQPVR.2y10_1.heavy 765.861 / 1186.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRAK2 interleukin-1 receptor-associated kinase 2 239 31 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 662952.0 16.881799697875977 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 662952.0 3976.484605249581 0.0 - - - - - - - 747.9 1325 10 241 31 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 1134220.0 16.881799697875977 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1134220.0 4254.53785118367 0.0 - - - - - - - 785.0 2268 9 243 31 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 537704.0 16.881799697875977 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 537704.0 4053.972980887393 0.0 - - - - - - - 618.5714285714286 1075 7 245 32 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542837.[MT7]-IFEGTNDILR.3b4_1.heavy 441.246 / 591.326 8592.0 37.57040023803711 41 11 10 10 10 3.4146690985074244 23.292569560665275 0.0 3 0.8519538424761629 3.167044521670592 8592.0 12.2660202020202 0.0 - - - - - - - 278.3 17 10 ACADVL acyl-CoA dehydrogenase, very long chain 247 32 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542837.[MT7]-IFEGTNDILR.3b3_1.heavy 441.246 / 534.304 11254.0 37.57040023803711 41 11 10 10 10 3.4146690985074244 23.292569560665275 0.0 3 0.8519538424761629 3.167044521670592 11254.0 48.05426997245179 0.0 - - - - - - - 198.0 22 11 ACADVL acyl-CoA dehydrogenase, very long chain 249 32 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542837.[MT7]-IFEGTNDILR.3y4_1.heavy 441.246 / 516.314 2662.0 37.57040023803711 41 11 10 10 10 3.4146690985074244 23.292569560665275 0.0 3 0.8519538424761629 3.167044521670592 2662.0 2.2750000000000004 1.0 - - - - - - - 255.44444444444446 5 9 ACADVL acyl-CoA dehydrogenase, very long chain 251 32 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542837.[MT7]-IFEGTNDILR.3y5_1.heavy 441.246 / 630.357 14522.0 37.57040023803711 41 11 10 10 10 3.4146690985074244 23.292569560665275 0.0 3 0.8519538424761629 3.167044521670592 14522.0 79.2109090909091 0.0 - - - - - - - 242.0 29 8 ACADVL acyl-CoA dehydrogenase, very long chain 253 33 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21345.[MT7]-MLAIYDGFDGFAK[MT7].3y3_1.heavy 579.304 / 509.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - PFKP phosphofructokinase, platelet 255 33 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21345.[MT7]-MLAIYDGFDGFAK[MT7].3b4_1.heavy 579.304 / 573.355 N/A N/A - - - - - - - - - 0.0 - - - - - - - PFKP phosphofructokinase, platelet 257 33 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21345.[MT7]-MLAIYDGFDGFAK[MT7].3y4_1.heavy 579.304 / 566.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PFKP phosphofructokinase, platelet 259 33 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21345.[MT7]-MLAIYDGFDGFAK[MT7].3y5_1.heavy 579.304 / 681.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - PFKP phosphofructokinase, platelet 261 34 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21247.[MT7]-K[MT7]LAADAGTFLSR.3y7_1.heavy 513.303 / 751.41 33135.0 32.69627666473389 45 18 10 7 10 4.870594496429279 16.83192588270623 0.024700164794921875 3 0.9880120791494962 11.260446779396101 33135.0 188.7043695923225 0.0 - - - - - - - 273.3529411764706 66 17 SH3GLB1 SH3-domain GRB2-like endophilin B1 263 34 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21247.[MT7]-K[MT7]LAADAGTFLSR.3y6_1.heavy 513.303 / 680.373 41966.0 32.69627666473389 45 18 10 7 10 4.870594496429279 16.83192588270623 0.024700164794921875 3 0.9880120791494962 11.260446779396101 41966.0 114.91352776550302 0.0 - - - - - - - 616.4285714285714 83 7 SH3GLB1 SH3-domain GRB2-like endophilin B1 265 34 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21247.[MT7]-K[MT7]LAADAGTFLSR.3y8_1.heavy 513.303 / 866.437 14741.0 32.69627666473389 45 18 10 7 10 4.870594496429279 16.83192588270623 0.024700164794921875 3 0.9880120791494962 11.260446779396101 14741.0 60.98285795132993 0.0 - - - - - - - 182.6 29 20 SH3GLB1 SH3-domain GRB2-like endophilin B1 267 34 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21247.[MT7]-K[MT7]LAADAGTFLSR.3y9_1.heavy 513.303 / 937.474 10624.0 32.69627666473389 45 18 10 7 10 4.870594496429279 16.83192588270623 0.024700164794921875 3 0.9880120791494962 11.260446779396101 10624.0 39.95702805400598 0.0 - - - - - - - 176.93333333333334 21 15 SH3GLB1 SH3-domain GRB2-like endophilin B1 269 35 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20908.[MT7]-EDDYETR.2y4_1.heavy 536.239 / 568.273 9923.0 18.03660011291504 50 20 10 10 10 6.476205448866625 15.44114077132939 0.0 3 0.9912912375472261 13.215039404081912 9923.0 94.00318913575597 0.0 - - - - - - - 145.75 19 24 IL5RA interleukin 5 receptor, alpha 271 35 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20908.[MT7]-EDDYETR.2b3_1.heavy 536.239 / 504.206 11915.0 18.03660011291504 50 20 10 10 10 6.476205448866625 15.44114077132939 0.0 3 0.9912912375472261 13.215039404081912 11915.0 56.4369645546978 0.0 - - - - - - - 243.57142857142858 23 21 IL5RA interleukin 5 receptor, alpha 273 35 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20908.[MT7]-EDDYETR.2y6_1.heavy 536.239 / 798.326 3157.0 18.03660011291504 50 20 10 10 10 6.476205448866625 15.44114077132939 0.0 3 0.9912912375472261 13.215039404081912 3157.0 46.24679056047198 0.0 - - - - - - - 125.38888888888889 6 18 IL5RA interleukin 5 receptor, alpha 275 35 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20908.[MT7]-EDDYETR.2b5_1.heavy 536.239 / 796.312 5450.0 18.03660011291504 50 20 10 10 10 6.476205448866625 15.44114077132939 0.0 3 0.9912912375472261 13.215039404081912 5450.0 136.44038192827202 0.0 - - - - - - - 108.72222222222223 10 18 IL5RA interleukin 5 receptor, alpha 277 36 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540047.[MT7]-YDVQVR.2b3_1.heavy 462.257 / 522.268 13135.0 24.86400032043457 46 16 10 10 10 4.0164842832739485 24.89739606760946 0.0 3 0.9689072918918334 6.980738060611911 13135.0 33.1895354706022 0.0 - - - - - - - 353.8 26 15 IL5RA interleukin 5 receptor, alpha 279 36 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540047.[MT7]-YDVQVR.2y4_1.heavy 462.257 / 501.314 38994.0 24.86400032043457 46 16 10 10 10 4.0164842832739485 24.89739606760946 0.0 3 0.9689072918918334 6.980738060611911 38994.0 51.46723602484472 0.0 - - - - - - - 1273.7272727272727 77 11 IL5RA interleukin 5 receptor, alpha 281 36 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540047.[MT7]-YDVQVR.2y5_1.heavy 462.257 / 616.341 31009.0 24.86400032043457 46 16 10 10 10 4.0164842832739485 24.89739606760946 0.0 3 0.9689072918918334 6.980738060611911 31009.0 34.1035624618214 0.0 - - - - - - - 669.6428571428571 62 14 IL5RA interleukin 5 receptor, alpha 283 36 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540047.[MT7]-YDVQVR.2b4_1.heavy 462.257 / 650.327 18647.0 24.86400032043457 46 16 10 10 10 4.0164842832739485 24.89739606760946 0.0 3 0.9689072918918334 6.980738060611911 18647.0 43.76069117942535 0.0 - - - - - - - 624.0 37 9 IL5RA interleukin 5 receptor, alpha 285 37 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584748.[MT7]-ELTLLLQQVDR.2b4_1.heavy 736.434 / 601.368 2874.0 44.496676445007324 41 15 10 6 10 3.5942917114353787 27.821893165166898 0.038501739501953125 3 0.9572377729936887 5.946649175096517 2874.0 6.9136519069053355 0.0 - - - - - - - 687.8571428571429 5 7 MAP3K11 mitogen-activated protein kinase kinase kinase 11 287 37 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584748.[MT7]-ELTLLLQQVDR.2y9_1.heavy 736.434 / 1085.63 6757.0 44.496676445007324 41 15 10 6 10 3.5942917114353787 27.821893165166898 0.038501739501953125 3 0.9572377729936887 5.946649175096517 6757.0 24.89590206185567 0.0 - - - - - - - 260.47058823529414 13 17 MAP3K11 mitogen-activated protein kinase kinase kinase 11 289 37 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584748.[MT7]-ELTLLLQQVDR.2y10_1.heavy 736.434 / 1198.72 3417.0 44.496676445007324 41 15 10 6 10 3.5942917114353787 27.821893165166898 0.038501739501953125 3 0.9572377729936887 5.946649175096517 3417.0 16.524691873620345 0.0 - - - - - - - 289.6363636363636 6 11 MAP3K11 mitogen-activated protein kinase kinase kinase 11 291 37 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584748.[MT7]-ELTLLLQQVDR.2y7_1.heavy 736.434 / 871.5 5747.0 44.496676445007324 41 15 10 6 10 3.5942917114353787 27.821893165166898 0.038501739501953125 3 0.9572377729936887 5.946649175096517 5747.0 17.525892140997676 0.0 - - - - - - - 306.27777777777777 11 18 MAP3K11 mitogen-activated protein kinase kinase kinase 11 293 38 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585879.[MT7]-GQLTTDQVFPYPSVLNEEQTQFLK[MT7].4b8_1.heavy 768.405 / 987.523 22729.0 44.41957473754883 40 14 10 6 10 3.001508030283848 33.3165858598563 0.0384979248046875 3 0.9476150454805905 5.368398349413844 22729.0 84.17362873134329 0.0 - - - - - - - 717.625 45 8 ACADVL acyl-CoA dehydrogenase, very long chain 295 38 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585879.[MT7]-GQLTTDQVFPYPSVLNEEQTQFLK[MT7].4b7_1.heavy 768.405 / 888.454 28545.0 44.41957473754883 40 14 10 6 10 3.001508030283848 33.3165858598563 0.0384979248046875 3 0.9476150454805905 5.368398349413844 28545.0 50.223931736976596 0.0 - - - - - - - 746.125 57 8 ACADVL acyl-CoA dehydrogenase, very long chain 297 38 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585879.[MT7]-GQLTTDQVFPYPSVLNEEQTQFLK[MT7].4y3_1.heavy 768.405 / 551.367 22882.0 44.41957473754883 40 14 10 6 10 3.001508030283848 33.3165858598563 0.0384979248046875 3 0.9476150454805905 5.368398349413844 22882.0 76.62644286957602 0.0 - - - - - - - 813.125 45 8 ACADVL acyl-CoA dehydrogenase, very long chain 299 38 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585879.[MT7]-GQLTTDQVFPYPSVLNEEQTQFLK[MT7].4b6_1.heavy 768.405 / 760.396 17372.0 44.41957473754883 40 14 10 6 10 3.001508030283848 33.3165858598563 0.0384979248046875 3 0.9476150454805905 5.368398349413844 17372.0 29.32356862112689 0.0 - - - - - - - 813.0 34 8 ACADVL acyl-CoA dehydrogenase, very long chain 301 39 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21233.[MT7]-ELLSREEELTR.3y10_2.heavy 506.946 / 623.344 18676.0 29.634000778198242 48 18 10 10 10 3.504124815334607 22.78011390375046 0.0 3 0.9863065250943926 10.534373258007033 18676.0 25.959092763621527 0.0 - - - - - - - 716.625 37 8 MAP3K11 mitogen-activated protein kinase kinase kinase 11 303 39 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21233.[MT7]-ELLSREEELTR.3y4_1.heavy 506.946 / 518.293 16430.0 29.634000778198242 48 18 10 10 10 3.504124815334607 22.78011390375046 0.0 3 0.9863065250943926 10.534373258007033 16430.0 52.42585887796414 0.0 - - - - - - - 641.7142857142857 32 7 MAP3K11 mitogen-activated protein kinase kinase kinase 11 305 39 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21233.[MT7]-ELLSREEELTR.3y5_1.heavy 506.946 / 647.336 10579.0 29.634000778198242 48 18 10 10 10 3.504124815334607 22.78011390375046 0.0 3 0.9863065250943926 10.534373258007033 10579.0 35.67752709820236 0.0 - - - - - - - 236.44444444444446 21 18 MAP3K11 mitogen-activated protein kinase kinase kinase 11 307 39 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21233.[MT7]-ELLSREEELTR.3b8_2.heavy 506.946 / 565.794 13948.0 29.634000778198242 48 18 10 10 10 3.504124815334607 22.78011390375046 0.0 3 0.9863065250943926 10.534373258007033 13948.0 70.48109380443915 0.0 - - - - - - - 731.375 27 8 MAP3K11 mitogen-activated protein kinase kinase kinase 11 309 40 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544813.[MT7]-VYTITPLLSDNREK[MT7].3y6_1.heavy 646.37 / 892.461 5991.0 35.61539840698242 40 10 10 10 10 0.7600701224439859 73.53339543334488 0.0 3 0.8360103026116276 3.0049146721056883 5991.0 40.50060542849962 0.0 - - - - - - - 249.58333333333334 11 12 ARRB2 arrestin, beta 2 311 40 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544813.[MT7]-VYTITPLLSDNREK[MT7].3y4_1.heavy 646.37 / 690.401 4609.0 35.61539840698242 40 10 10 10 10 0.7600701224439859 73.53339543334488 0.0 3 0.8360103026116276 3.0049146721056883 4609.0 23.96413583815029 0.0 - - - - - - - 259.1666666666667 9 12 ARRB2 arrestin, beta 2 313 40 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544813.[MT7]-VYTITPLLSDNREK[MT7].3y9_2.heavy 646.37 / 608.344 12328.0 35.61539840698242 40 10 10 10 10 0.7600701224439859 73.53339543334488 0.0 3 0.8360103026116276 3.0049146721056883 12328.0 26.702322726598428 0.0 - - - - - - - 374.5 24 4 ARRB2 arrestin, beta 2 315 40 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544813.[MT7]-VYTITPLLSDNREK[MT7].3y9_1.heavy 646.37 / 1215.68 7028.0 35.61539840698242 40 10 10 10 10 0.7600701224439859 73.53339543334488 0.0 3 0.8360103026116276 3.0049146721056883 7028.0 24.02266564685132 0.0 - - - - - - - 230.35714285714286 14 14 ARRB2 arrestin, beta 2 317 41 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584896.[MT7]-GK[MT7]VPITYLELLN.2b3_1.heavy 824.5 / 573.396 4961.0 44.47742557525635 29 3 10 6 10 0.3323108978715211 125.96097563285113 0.038501739501953125 3 0.5277005951160344 1.7196970965119789 4961.0 6.091655607384534 0.0 - - - - - - - 682.2 9 10 SH3GLB1 SH3-domain GRB2-like endophilin B1 319 41 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584896.[MT7]-GK[MT7]VPITYLELLN.2b6_1.heavy 824.5 / 884.581 1085.0 44.47742557525635 29 3 10 6 10 0.3323108978715211 125.96097563285113 0.038501739501953125 3 0.5277005951160344 1.7196970965119789 1085.0 3.255 2.0 - - - - - - - 219.83333333333334 3 18 SH3GLB1 SH3-domain GRB2-like endophilin B1 321 41 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584896.[MT7]-GK[MT7]VPITYLELLN.2b7_2.heavy 824.5 / 524.326 5892.0 44.47742557525635 29 3 10 6 10 0.3323108978715211 125.96097563285113 0.038501739501953125 3 0.5277005951160344 1.7196970965119789 5892.0 25.451010309278352 0.0 - - - - - - - 243.78571428571428 11 14 SH3GLB1 SH3-domain GRB2-like endophilin B1 323 41 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584896.[MT7]-GK[MT7]VPITYLELLN.2b9_2.heavy 824.5 / 645.389 27132.0 44.47742557525635 29 3 10 6 10 0.3323108978715211 125.96097563285113 0.038501739501953125 3 0.5277005951160344 1.7196970965119789 27132.0 108.35656401729298 0.0 - - - - - - - 296.1818181818182 54 11 SH3GLB1 SH3-domain GRB2-like endophilin B1 325 42 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544812.[MT7]-FTDFYVPVSLC[CAM]TPSR.3y7_1.heavy 644.993 / 820.398 16191.0 43.342498779296875 45 15 10 10 10 1.637320521391764 43.99413140924038 0.0 3 0.9530934944045248 5.675883022403492 16191.0 63.61952182952183 0.0 - - - - - - - 327.25 32 12 ARSA arylsulfatase A 327 42 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544812.[MT7]-FTDFYVPVSLC[CAM]TPSR.3b4_1.heavy 644.993 / 655.321 20760.0 43.342498779296875 45 15 10 10 10 1.637320521391764 43.99413140924038 0.0 3 0.9530934944045248 5.675883022403492 20760.0 89.23481732259786 0.0 - - - - - - - 261.8 41 15 ARSA arylsulfatase A 329 42 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544812.[MT7]-FTDFYVPVSLC[CAM]TPSR.3b3_1.heavy 644.993 / 508.252 22203.0 43.342498779296875 45 15 10 10 10 1.637320521391764 43.99413140924038 0.0 3 0.9530934944045248 5.675883022403492 22203.0 64.91814428860688 0.0 - - - - - - - 258.84615384615387 44 13 ARSA arylsulfatase A 331 42 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544812.[MT7]-FTDFYVPVSLC[CAM]TPSR.3y9_1.heavy 644.993 / 1016.52 27974.0 43.342498779296875 45 15 10 10 10 1.637320521391764 43.99413140924038 0.0 3 0.9530934944045248 5.675883022403492 27974.0 146.81500138696256 0.0 - - - - - - - 171.57142857142858 55 14 ARSA arylsulfatase A 333 43 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584497.[MT7]-NFIEGDYK[MT7].3y3_1.heavy 425.227 / 569.305 9933.0 30.42770004272461 45 15 10 10 10 2.712014399260229 28.48435736137825 0.0 3 0.9597575147974473 6.131301649269712 9933.0 12.678489795918367 0.0 - - - - - - - 712.8888888888889 19 18 SH3GLB1 SH3-domain GRB2-like endophilin B1 335 43 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584497.[MT7]-NFIEGDYK[MT7].3b5_1.heavy 425.227 / 705.369 N/A 30.42770004272461 45 15 10 10 10 2.712014399260229 28.48435736137825 0.0 3 0.9597575147974473 6.131301649269712 94898.0 38.737234075585675 1.0 - - - - - - - 2204.714285714286 265 7 SH3GLB1 SH3-domain GRB2-like endophilin B1 337 43 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584497.[MT7]-NFIEGDYK[MT7].3y4_1.heavy 425.227 / 626.327 30628.0 30.42770004272461 45 15 10 10 10 2.712014399260229 28.48435736137825 0.0 3 0.9597575147974473 6.131301649269712 30628.0 51.94164264281932 0.0 - - - - - - - 1138.0 61 8 SH3GLB1 SH3-domain GRB2-like endophilin B1 339 43 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584497.[MT7]-NFIEGDYK[MT7].3b3_1.heavy 425.227 / 519.305 27080.0 30.42770004272461 45 15 10 10 10 2.712014399260229 28.48435736137825 0.0 3 0.9597575147974473 6.131301649269712 27080.0 34.352874940975624 0.0 - - - - - - - 753.9166666666666 54 12 SH3GLB1 SH3-domain GRB2-like endophilin B1 341 44 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20911.[MT7]-ELVEPVSR.2y5_1.heavy 536.81 / 587.315 14100.0 26.279199600219727 43 17 10 6 10 2.653891753205987 37.68051197988643 0.032199859619140625 3 0.973498237579751 7.564168007758133 14100.0 38.01188372234749 0.0 - - - - - - - 310.47058823529414 28 17 ACADVL acyl-CoA dehydrogenase, very long chain 343 44 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20911.[MT7]-ELVEPVSR.2b4_1.heavy 536.81 / 615.347 17652.0 26.279199600219727 43 17 10 6 10 2.653891753205987 37.68051197988643 0.032199859619140625 3 0.973498237579751 7.564168007758133 17652.0 78.90903345724908 0.0 - - - - - - - 269.1333333333333 35 15 ACADVL acyl-CoA dehydrogenase, very long chain 345 44 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20911.[MT7]-ELVEPVSR.2y6_1.heavy 536.81 / 686.383 12109.0 26.279199600219727 43 17 10 6 10 2.653891753205987 37.68051197988643 0.032199859619140625 3 0.973498237579751 7.564168007758133 12109.0 39.79101589972872 0.0 - - - - - - - 615.0 24 7 ACADVL acyl-CoA dehydrogenase, very long chain 347 44 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20911.[MT7]-ELVEPVSR.2y7_1.heavy 536.81 / 799.467 18351.0 26.279199600219727 43 17 10 6 10 2.653891753205987 37.68051197988643 0.032199859619140625 3 0.973498237579751 7.564168007758133 18351.0 54.31478919212984 0.0 - - - - - - - 232.0625 36 16 ACADVL acyl-CoA dehydrogenase, very long chain 349 45 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543153.[MT7]-TPVTDPATGAVK[MT7].3b5_1.heavy 482.28 / 658.353 56077.0 24.961000442504883 47 17 10 10 10 4.051957179818383 24.679431583845663 0.0 3 0.9741165545441791 7.654381362071686 56077.0 190.61758655035754 0.0 - - - - - - - 377.3333333333333 112 9 ACADVL acyl-CoA dehydrogenase, very long chain 351 45 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543153.[MT7]-TPVTDPATGAVK[MT7].3y4_1.heavy 482.28 / 518.342 41929.0 24.961000442504883 47 17 10 10 10 4.051957179818383 24.679431583845663 0.0 3 0.9741165545441791 7.654381362071686 41929.0 45.59616059122008 0.0 - - - - - - - 751.0 83 10 ACADVL acyl-CoA dehydrogenase, very long chain 353 45 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543153.[MT7]-TPVTDPATGAVK[MT7].3b7_1.heavy 482.28 / 826.443 3498.0 24.961000442504883 47 17 10 10 10 4.051957179818383 24.679431583845663 0.0 3 0.9741165545441791 7.654381362071686 3498.0 20.654124689799296 0.0 - - - - - - - 137.89473684210526 6 19 ACADVL acyl-CoA dehydrogenase, very long chain 355 45 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543153.[MT7]-TPVTDPATGAVK[MT7].3y5_1.heavy 482.28 / 619.39 24334.0 24.961000442504883 47 17 10 10 10 4.051957179818383 24.679431583845663 0.0 3 0.9741165545441791 7.654381362071686 24334.0 32.622296806213036 0.0 - - - - - - - 712.8571428571429 48 7 ACADVL acyl-CoA dehydrogenase, very long chain 357 46 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584491.[MT7]-LAADAGTFLSR.3b6_1.heavy 422.571 / 643.353 17152.0 36.42879867553711 40 10 10 10 10 1.12455151329116 56.67723205310313 0.0 3 0.8276323574035173 2.928796835571506 17152.0 109.97450478352371 0.0 - - - - - - - 248.0 34 8 SH3GLB1 SH3-domain GRB2-like endophilin B1 359 46 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584491.[MT7]-LAADAGTFLSR.3b4_1.heavy 422.571 / 515.295 24270.0 36.42879867553711 40 10 10 10 10 1.12455151329116 56.67723205310313 0.0 3 0.8276323574035173 2.928796835571506 24270.0 84.51486401732743 0.0 - - - - - - - 250.14285714285714 48 7 SH3GLB1 SH3-domain GRB2-like endophilin B1 361 46 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584491.[MT7]-LAADAGTFLSR.3b5_1.heavy 422.571 / 586.332 15285.0 36.42879867553711 40 10 10 10 10 1.12455151329116 56.67723205310313 0.0 3 0.8276323574035173 2.928796835571506 15285.0 62.19485747783784 1.0 - - - - - - - 259.22222222222223 48 9 SH3GLB1 SH3-domain GRB2-like endophilin B1 363 46 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584491.[MT7]-LAADAGTFLSR.3y4_1.heavy 422.571 / 522.304 32088.0 36.42879867553711 40 10 10 10 10 1.12455151329116 56.67723205310313 0.0 3 0.8276323574035173 2.928796835571506 32088.0 120.2441113490364 0.0 - - - - - - - 326.8 64 5 SH3GLB1 SH3-domain GRB2-like endophilin B1 365 47 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544402.[MT7]-INAPK[MT7]EDDYETR.3y4_1.heavy 580.3 / 568.273 1862.0 23.756325244903564 39 13 10 6 10 2.131543075969249 37.37155321577831 0.03289985656738281 3 0.9192260447966176 4.312797909755364 1862.0 6.604195106747702 0.0 - - - - - - - 206.8 3 20 IL5RA interleukin 5 receptor, alpha 367 47 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544402.[MT7]-INAPK[MT7]EDDYETR.3y9_2.heavy 580.3 / 648.813 1758.0 23.756325244903564 39 13 10 6 10 2.131543075969249 37.37155321577831 0.03289985656738281 3 0.9192260447966176 4.312797909755364 1758.0 21.644678936911948 0.0 - - - - - - - 129.35714285714286 3 14 IL5RA interleukin 5 receptor, alpha 369 47 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544402.[MT7]-INAPK[MT7]EDDYETR.3y5_1.heavy 580.3 / 683.299 931.0 23.756325244903564 39 13 10 6 10 2.131543075969249 37.37155321577831 0.03289985656738281 3 0.9192260447966176 4.312797909755364 931.0 6.65 0.0 - - - - - - - 0.0 1 0 IL5RA interleukin 5 receptor, alpha 371 47 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544402.[MT7]-INAPK[MT7]EDDYETR.3b8_2.heavy 580.3 / 586.313 2534.0 23.756325244903564 39 13 10 6 10 2.131543075969249 37.37155321577831 0.03289985656738281 3 0.9192260447966176 4.312797909755364 2534.0 13.465700483091787 0.0 - - - - - - - 179.8095238095238 5 21 IL5RA interleukin 5 receptor, alpha 373 48 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 593606.0 19.509300231933594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 593606.0 7337.473723588773 0.0 - - - - - - - 238.66666666666666 1187 6 375 48 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 310925.0 19.509300231933594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 310925.0 1616.1667085045592 0.0 - - - - - - - 227.5 621 10 377 48 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 383926.0 19.509300231933594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 383926.0 3292.989862192094 0.0 - - - - - - - 796.1111111111111 767 9 379 49 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21238.[MT7]-TSAAYLPEDFIR.2y8_1.heavy 763.902 / 1052.54 12357.0 39.83919906616211 50 20 10 10 10 8.764999174953177 11.409014194292174 0.0 3 0.9948799068072522 17.24002774115544 12357.0 36.12128238341969 0.0 - - - - - - - 227.71428571428572 24 14 IRAK2 interleukin-1 receptor-associated kinase 2 381 49 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21238.[MT7]-TSAAYLPEDFIR.2y9_1.heavy 763.902 / 1123.58 8013.0 39.83919906616211 50 20 10 10 10 8.764999174953177 11.409014194292174 0.0 3 0.9948799068072522 17.24002774115544 8013.0 24.584022221864643 0.0 - - - - - - - 231.86666666666667 16 15 IRAK2 interleukin-1 receptor-associated kinase 2 383 49 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21238.[MT7]-TSAAYLPEDFIR.2y6_1.heavy 763.902 / 776.394 15350.0 39.83919906616211 50 20 10 10 10 8.764999174953177 11.409014194292174 0.0 3 0.9948799068072522 17.24002774115544 15350.0 56.75940661948401 0.0 - - - - - - - 260.0 30 13 IRAK2 interleukin-1 receptor-associated kinase 2 385 49 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21238.[MT7]-TSAAYLPEDFIR.2b5_1.heavy 763.902 / 638.327 8785.0 39.83919906616211 50 20 10 10 10 8.764999174953177 11.409014194292174 0.0 3 0.9948799068072522 17.24002774115544 8785.0 19.942688884119733 0.0 - - - - - - - 267.46153846153845 17 13 IRAK2 interleukin-1 receptor-associated kinase 2 387 50 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584756.[MT7]-ELIINEILVMR.3b4_1.heavy 496.298 / 613.404 2252.0 48.37040042877197 34 8 10 6 10 4.968980797494382 15.302682823005231 0.039997100830078125 3 0.7995613077354322 2.7091630112442573 2252.0 44.62359675785208 0.0 - - - - - - - 160.0 4 9 PAK1;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 3 389 50 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584756.[MT7]-ELIINEILVMR.3y4_1.heavy 496.298 / 518.312 6131.0 48.37040042877197 34 8 10 6 10 4.968980797494382 15.302682823005231 0.039997100830078125 3 0.7995613077354322 2.7091630112442573 6131.0 76.4340029787234 0.0 - - - - - - - 143.14285714285714 12 14 PAK1;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 3 391 50 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584756.[MT7]-ELIINEILVMR.3b3_1.heavy 496.298 / 500.32 1001.0 48.37040042877197 34 8 10 6 10 4.968980797494382 15.302682823005231 0.039997100830078125 3 0.7995613077354322 2.7091630112442573 1001.0 30.18888888888889 0.0 - - - - - - - 187.75 2 4 PAK1;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 3 393 50 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584756.[MT7]-ELIINEILVMR.3y5_1.heavy 496.298 / 631.396 1752.0 48.37040042877197 34 8 10 6 10 4.968980797494382 15.302682823005231 0.039997100830078125 3 0.7995613077354322 2.7091630112442573 1752.0 17.729643574468085 0.0 - - - - - - - 116.28571428571429 3 7 PAK1;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 3 395 51 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20918.[MT7]-ITAFVVER.2y5_1.heavy 539.823 / 649.367 17746.0 35.486000061035156 50 20 10 10 10 8.129790838622727 12.300439455948052 0.0 3 0.9980050014010831 27.626053239107783 17746.0 47.53875190258752 0.0 - - - - - - - 643.625 35 8 ACADVL acyl-CoA dehydrogenase, very long chain 397 51 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20918.[MT7]-ITAFVVER.2b4_1.heavy 539.823 / 577.347 20484.0 35.486000061035156 50 20 10 10 10 8.129790838622727 12.300439455948052 0.0 3 0.9980050014010831 27.626053239107783 20484.0 32.306185414653555 0.0 - - - - - - - 249.0909090909091 40 11 ACADVL acyl-CoA dehydrogenase, very long chain 399 51 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20918.[MT7]-ITAFVVER.2y6_1.heavy 539.823 / 720.404 17527.0 35.486000061035156 50 20 10 10 10 8.129790838622727 12.300439455948052 0.0 3 0.9980050014010831 27.626053239107783 17527.0 55.24736904087369 0.0 - - - - - - - 287.875 35 8 ACADVL acyl-CoA dehydrogenase, very long chain 401 51 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20918.[MT7]-ITAFVVER.2y7_1.heavy 539.823 / 821.452 72188.0 35.486000061035156 50 20 10 10 10 8.129790838622727 12.300439455948052 0.0 3 0.9980050014010831 27.626053239107783 72188.0 114.96666839559002 0.0 - - - - - - - 273.8333333333333 144 6 ACADVL acyl-CoA dehydrogenase, very long chain 403 52 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540927.[MT7]-GLLLFTAR.2y5_1.heavy 517.828 / 607.356 17017.0 41.96099853515625 50 20 10 10 10 19.43145502261746 5.146295008974052 0.0 3 0.9978259827208976 26.463797355097817 17017.0 58.654941860465115 0.0 - - - - - - - 240.8 34 10 LAMA5 laminin, alpha 5 405 52 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540927.[MT7]-GLLLFTAR.2b4_1.heavy 517.828 / 541.383 15041.0 41.96099853515625 50 20 10 10 10 19.43145502261746 5.146295008974052 0.0 3 0.9978259827208976 26.463797355097817 15041.0 86.16510852713179 0.0 - - - - - - - 223.6 30 10 LAMA5 laminin, alpha 5 407 52 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540927.[MT7]-GLLLFTAR.2y6_1.heavy 517.828 / 720.44 15900.0 41.96099853515625 50 20 10 10 10 19.43145502261746 5.146295008974052 0.0 3 0.9978259827208976 26.463797355097817 15900.0 85.97093023255815 0.0 - - - - - - - 198.46153846153845 31 13 LAMA5 laminin, alpha 5 409 52 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540927.[MT7]-GLLLFTAR.2y7_1.heavy 517.828 / 833.524 7649.0 41.96099853515625 50 20 10 10 10 19.43145502261746 5.146295008974052 0.0 3 0.9978259827208976 26.463797355097817 7649.0 85.38418604651163 0.0 - - - - - - - 177.73333333333332 15 15 LAMA5 laminin, alpha 5 411 53 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584612.[MT7]-LYVPLYSSK[MT7].2b3_1.heavy 679.402 / 520.325 20216.0 37.382598876953125 45 15 10 10 10 1.04503942303852 59.898260593367176 0.0 3 0.9544413681103031 5.759890984514948 20216.0 38.17622703246917 1.0 - - - - - - - 284.3333333333333 40 6 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 413 53 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584612.[MT7]-LYVPLYSSK[MT7].2y4_1.heavy 679.402 / 628.342 3654.0 37.382598876953125 45 15 10 10 10 1.04503942303852 59.898260593367176 0.0 3 0.9544413681103031 5.759890984514948 3654.0 7.955997843170539 0.0 - - - - - - - 835.2857142857143 7 7 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 415 53 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584612.[MT7]-LYVPLYSSK[MT7].2y5_1.heavy 679.402 / 741.426 2801.0 37.382598876953125 45 15 10 10 10 1.04503942303852 59.898260593367176 0.0 3 0.9544413681103031 5.759890984514948 2801.0 8.797495849684127 0.0 - - - - - - - 304.4166666666667 5 12 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 417 53 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584612.[MT7]-LYVPLYSSK[MT7].2y6_1.heavy 679.402 / 838.479 36170.0 37.382598876953125 45 15 10 10 10 1.04503942303852 59.898260593367176 0.0 3 0.9544413681103031 5.759890984514948 36170.0 123.38917399304846 0.0 - - - - - - - 280.2 72 10 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 419 54 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21517.[MT7]-TPDSPPTPAPLLLDLGIPVGQR.2y8_1.heavy 1199.68 / 839.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 421 54 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21517.[MT7]-TPDSPPTPAPLLLDLGIPVGQR.2y5_1.heavy 1199.68 / 556.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 423 54 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21517.[MT7]-TPDSPPTPAPLLLDLGIPVGQR.2b4_1.heavy 1199.68 / 545.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 425 54 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21517.[MT7]-TPDSPPTPAPLLLDLGIPVGQR.2b7_1.heavy 1199.68 / 840.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 427 55 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20984.[MT7]-GDRVEVLSR.2b5_2.heavy 587.837 / 351.189 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 429 55 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20984.[MT7]-GDRVEVLSR.2y5_1.heavy 587.837 / 603.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 431 55 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20984.[MT7]-GDRVEVLSR.2y6_1.heavy 587.837 / 702.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 433 55 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20984.[MT7]-GDRVEVLSR.2b5_1.heavy 587.837 / 701.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 435 56 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 289407.0 38.56650161743164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 289407.0 324.9840256754823 1.0 - - - - - - - 272.3333333333333 601 9 437 56 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 248778.0 38.56650161743164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 248778.0 853.4903573870274 0.0 - - - - - - - 250.25 497 4 439 56 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 364764.0 38.56650161743164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 364764.0 162.94357006225687 0.0 - - - - - - - 302.14285714285717 729 7 441 57 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20823.[MT7]-VADFGLAR.2y5_1.heavy 496.786 / 563.33 96309.0 32.98320007324219 50 20 10 10 10 7.366941939102748 13.57415340403503 0.0 3 0.9945247288535739 16.670982602643992 96309.0 115.71080842810696 0.0 - - - - - - - 810.7 192 10 FRK;MET;MST1R;SRC;SRMS fyn-related kinase;met proto-oncogene (hepatocyte growth factor receptor);macrophage stimulating 1 receptor (c-met-related tyrosine kinase);v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites 443 57 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20823.[MT7]-VADFGLAR.2y6_1.heavy 496.786 / 678.357 18891.0 32.98320007324219 50 20 10 10 10 7.366941939102748 13.57415340403503 0.0 3 0.9945247288535739 16.670982602643992 18891.0 58.37136836063987 0.0 - - - - - - - 262.09090909090907 37 22 FRK;MET;MST1R;SRC;SRMS fyn-related kinase;met proto-oncogene (hepatocyte growth factor receptor);macrophage stimulating 1 receptor (c-met-related tyrosine kinase);v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites 445 57 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20823.[MT7]-VADFGLAR.2b5_1.heavy 496.786 / 634.332 23974.0 32.98320007324219 50 20 10 10 10 7.366941939102748 13.57415340403503 0.0 3 0.9945247288535739 16.670982602643992 23974.0 60.26787340484165 0.0 - - - - - - - 681.25 47 12 FRK;MET;MST1R;SRC;SRMS fyn-related kinase;met proto-oncogene (hepatocyte growth factor receptor);macrophage stimulating 1 receptor (c-met-related tyrosine kinase);v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites 447 57 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20823.[MT7]-VADFGLAR.2y7_1.heavy 496.786 / 749.394 71442.0 32.98320007324219 50 20 10 10 10 7.366941939102748 13.57415340403503 0.0 3 0.9945247288535739 16.670982602643992 71442.0 197.17795783287642 0.0 - - - - - - - 250.07142857142858 142 14 FRK;MET;MST1R;SRC;SRMS fyn-related kinase;met proto-oncogene (hepatocyte growth factor receptor);macrophage stimulating 1 receptor (c-met-related tyrosine kinase);v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites 449 58 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21328.[MT7]-TPPYLQLQVTEK[MT7].2y4_1.heavy 852.992 / 620.374 1667.0 36.18910026550293 34 9 10 5 10 1.705293004812889 58.64094892652912 0.043201446533203125 3 0.8024761723392793 2.7297951257603494 1667.0 3.887331932773109 1.0 - - - - - - - 281.27272727272725 3 11 LAMA5 laminin, alpha 5 451 58 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21328.[MT7]-TPPYLQLQVTEK[MT7].2y3_1.heavy 852.992 / 521.305 3095.0 36.18910026550293 34 9 10 5 10 1.705293004812889 58.64094892652912 0.043201446533203125 3 0.8024761723392793 2.7297951257603494 3095.0 6.5021008403361344 0.0 - - - - - - - 255.0 6 7 LAMA5 laminin, alpha 5 453 58 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21328.[MT7]-TPPYLQLQVTEK[MT7].2y6_1.heavy 852.992 / 861.516 2024.0 36.18910026550293 34 9 10 5 10 1.705293004812889 58.64094892652912 0.043201446533203125 3 0.8024761723392793 2.7297951257603494 2024.0 15.307563025210083 0.0 - - - - - - - 221.0 4 7 LAMA5 laminin, alpha 5 455 58 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21328.[MT7]-TPPYLQLQVTEK[MT7].2y11_2.heavy 852.992 / 730.417 17618.0 36.18910026550293 34 9 10 5 10 1.705293004812889 58.64094892652912 0.043201446533203125 3 0.8024761723392793 2.7297951257603494 17618.0 116.46633053221288 0.0 - - - - - - - 238.0 35 13 LAMA5 laminin, alpha 5 457 59 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21326.[MT7]-RNVIFQPVAELK[MT7].3b6_1.heavy 568.013 / 902.533 6726.0 35.31370162963867 46 16 10 10 10 19.158886298819148 5.219510071739581 0.0 3 0.9683320421361152 6.916709347426014 6726.0 87.0568714797747 0.0 - - - - - - - 168.44444444444446 13 9 PFKP phosphofructokinase, platelet 459 59 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21326.[MT7]-RNVIFQPVAELK[MT7].3b4_1.heavy 568.013 / 627.406 4990.0 35.31370162963867 46 16 10 10 10 19.158886298819148 5.219510071739581 0.0 3 0.9683320421361152 6.916709347426014 4990.0 21.481233605104574 0.0 - - - - - - - 266.7692307692308 9 13 PFKP phosphofructokinase, platelet 461 59 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21326.[MT7]-RNVIFQPVAELK[MT7].3b5_1.heavy 568.013 / 774.474 3255.0 35.31370162963867 46 16 10 10 10 19.158886298819148 5.219510071739581 0.0 3 0.9683320421361152 6.916709347426014 3255.0 15.185106382978724 0.0 - - - - - - - 204.77777777777777 6 9 PFKP phosphofructokinase, platelet 463 59 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21326.[MT7]-RNVIFQPVAELK[MT7].3y4_1.heavy 568.013 / 604.379 12910.0 35.31370162963867 46 16 10 10 10 19.158886298819148 5.219510071739581 0.0 3 0.9683320421361152 6.916709347426014 12910.0 23.440276497695855 0.0 - - - - - - - 745.5 25 8 PFKP phosphofructokinase, platelet 465 60 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21327.[MT7]-HEDTNLASSTIVK[MT7].3y3_1.heavy 568.312 / 503.367 2099.0 25.885700225830078 31 17 0 10 4 1.759278276532225 43.445383006190404 0.0 8 0.9700274743420149 7.110660558348259 2099.0 5.886024133904243 6.0 - - - - - - - 295.36842105263156 36 19 ARRB2 arrestin, beta 2 467 60 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21327.[MT7]-HEDTNLASSTIVK[MT7].3b6_1.heavy 568.312 / 854.412 840.0 25.885700225830078 31 17 0 10 4 1.759278276532225 43.445383006190404 0.0 8 0.9700274743420149 7.110660558348259 840.0 5.527151030983482 0.0 - - - - - - - 0.0 1 0 ARRB2 arrestin, beta 2 469 60 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21327.[MT7]-HEDTNLASSTIVK[MT7].3b5_1.heavy 568.312 / 741.328 4251.0 25.885700225830078 31 17 0 10 4 1.759278276532225 43.445383006190404 0.0 8 0.9700274743420149 7.110660558348259 4251.0 9.383425052366988 0.0 - - - - - - - 200.52941176470588 8 17 ARRB2 arrestin, beta 2 471 60 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21327.[MT7]-HEDTNLASSTIVK[MT7].3b3_1.heavy 568.312 / 526.238 945.0 25.885700225830078 31 17 0 10 4 1.759278276532225 43.445383006190404 0.0 8 0.9700274743420149 7.110660558348259 945.0 0.0 3.0 - - - - - - - 281.3636363636364 2 22 ARRB2 arrestin, beta 2 473 61 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB541971.[MT7]-GGVVTSNPLGF.2b8_1.heavy 596.328 / 856.464 351.0 41.76297378540039 44 20 10 6 8 10.605157739027419 9.429374127269778 0.0343017578125 4 0.9978924139143904 26.8777804962159 351.0 4.245789911308204 11.0 - - - - - - - 0.0 1 0 ACADVL acyl-CoA dehydrogenase, very long chain 475 61 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB541971.[MT7]-GGVVTSNPLGF.2b6_1.heavy 596.328 / 645.369 3778.0 41.76297378540039 44 20 10 6 8 10.605157739027419 9.429374127269778 0.0343017578125 4 0.9978924139143904 26.8777804962159 3778.0 41.174987681694994 0.0 - - - - - - - 244.71428571428572 7 14 ACADVL acyl-CoA dehydrogenase, very long chain 477 61 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB541971.[MT7]-GGVVTSNPLGF.2b7_1.heavy 596.328 / 759.412 29167.0 41.76297378540039 44 20 10 6 8 10.605157739027419 9.429374127269778 0.0343017578125 4 0.9978924139143904 26.8777804962159 29167.0 117.41824348132486 0.0 - - - - - - - 239.72727272727272 58 11 ACADVL acyl-CoA dehydrogenase, very long chain 479 61 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB541971.[MT7]-GGVVTSNPLGF.2b5_1.heavy 596.328 / 558.337 4568.0 41.76297378540039 44 20 10 6 8 10.605157739027419 9.429374127269778 0.0343017578125 4 0.9978924139143904 26.8777804962159 4568.0 1.9493598862019914 2.0 - - - - - - - 230.75 9 16 ACADVL acyl-CoA dehydrogenase, very long chain 481 62 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20981.[MT7]-VTILGHVQR.2y8_1.heavy 583.86 / 923.542 3016.0 28.451449394226074 46 20 10 6 10 9.868282403162302 10.133475706770904 0.037799835205078125 3 0.9957991914525627 19.03460091638528 3016.0 20.02 0.0 - - - - - - - 201.2941176470588 6 17 PFKP phosphofructokinase, platelet 483 62 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20981.[MT7]-VTILGHVQR.2y5_1.heavy 583.86 / 596.326 1914.0 28.451449394226074 46 20 10 6 10 9.868282403162302 10.133475706770904 0.037799835205078125 3 0.9957991914525627 19.03460091638528 1914.0 3.9785714285714286 1.0 - - - - - - - 208.27272727272728 3 22 PFKP phosphofructokinase, platelet 485 62 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20981.[MT7]-VTILGHVQR.2y6_1.heavy 583.86 / 709.41 1392.0 28.451449394226074 46 20 10 6 10 9.868282403162302 10.133475706770904 0.037799835205078125 3 0.9957991914525627 19.03460091638528 1392.0 3.3600000000000003 0.0 - - - - - - - 217.5 2 16 PFKP phosphofructokinase, platelet 487 62 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20981.[MT7]-VTILGHVQR.2y7_1.heavy 583.86 / 822.494 812.0 28.451449394226074 46 20 10 6 10 9.868282403162302 10.133475706770904 0.037799835205078125 3 0.9957991914525627 19.03460091638528 812.0 0.6199999999999999 3.0 - - - - - - - 0.0 1 0 PFKP phosphofructokinase, platelet 489 63 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584568.[MT7]-LRVQC[CAM]STC[CAM]R.3y6_1.heavy 441.896 / 811.318 2818.0 20.224300384521484 46 16 10 10 10 4.036343994909507 24.774895332537668 0.0 3 0.9655814195982609 6.633035281230839 2818.0 72.48115584415585 0.0 - - - - - - - 116.28571428571429 5 14 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 491 63 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584568.[MT7]-LRVQC[CAM]STC[CAM]R.3b3_1.heavy 441.896 / 513.363 6076.0 20.224300384521484 46 16 10 10 10 4.036343994909507 24.774895332537668 0.0 3 0.9655814195982609 6.633035281230839 6076.0 17.444443653877727 0.0 - - - - - - - 656.1818181818181 12 11 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 493 63 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584568.[MT7]-LRVQC[CAM]STC[CAM]R.3y4_1.heavy 441.896 / 523.229 22630.0 20.224300384521484 46 16 10 10 10 4.036343994909507 24.774895332537668 0.0 3 0.9655814195982609 6.633035281230839 22630.0 58.60154882154882 0.0 - - - - - - - 742.0 45 7 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 495 63 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584568.[MT7]-LRVQC[CAM]STC[CAM]R.3y5_1.heavy 441.896 / 683.26 10567.0 20.224300384521484 46 16 10 10 10 4.036343994909507 24.774895332537668 0.0 3 0.9655814195982609 6.633035281230839 10567.0 84.08724394482458 0.0 - - - - - - - 184.8 21 20 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 497 64 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585102.[MT7]-VDPVVFVTLTC[CAM]AFR.3y7_1.heavy 589.991 / 868.435 5992.0 50.7505989074707 47 17 10 10 10 2.275898437198112 38.63505411749916 0.0 3 0.9713540499792862 7.274255235018427 5992.0 148.34189164370983 0.0 - - - - - - - 166.44444444444446 11 9 ARRB2 arrestin, beta 2 499 64 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585102.[MT7]-VDPVVFVTLTC[CAM]AFR.3y6_1.heavy 589.991 / 767.387 4086.0 50.7505989074707 47 17 10 10 10 2.275898437198112 38.63505411749916 0.0 3 0.9713540499792862 7.274255235018427 4086.0 86.88362637362636 0.0 - - - - - - - 136.0 8 10 ARRB2 arrestin, beta 2 501 64 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585102.[MT7]-VDPVVFVTLTC[CAM]AFR.3b6_1.heavy 589.991 / 801.463 3314.0 50.7505989074707 47 17 10 10 10 2.275898437198112 38.63505411749916 0.0 3 0.9713540499792862 7.274255235018427 3314.0 146.69973333333334 0.0 - - - - - - - 201.0 6 7 ARRB2 arrestin, beta 2 503 64 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585102.[MT7]-VDPVVFVTLTC[CAM]AFR.3b4_1.heavy 589.991 / 555.326 4358.0 50.7505989074707 47 17 10 10 10 2.275898437198112 38.63505411749916 0.0 3 0.9713540499792862 7.274255235018427 4358.0 32.32646296613884 1.0 - - - - - - - 158.875 8 8 ARRB2 arrestin, beta 2 505 65 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20828.[MT7]-IFEGIK[MT7].2b3_1.heavy 497.812 / 534.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K4 mitogen-activated protein kinase kinase kinase 4 507 65 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20828.[MT7]-IFEGIK[MT7].2y4_1.heavy 497.812 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K4 mitogen-activated protein kinase kinase kinase 4 509 65 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20828.[MT7]-IFEGIK[MT7].2y5_1.heavy 497.812 / 737.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K4 mitogen-activated protein kinase kinase kinase 4 511 65 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20828.[MT7]-IFEGIK[MT7].2b4_1.heavy 497.812 / 591.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K4 mitogen-activated protein kinase kinase kinase 4 513 66 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20827.[MT7]-DVYLSPR.2y4_1.heavy 497.278 / 472.288 5767.0 27.175833384195965 43 17 10 6 10 2.990601876723831 33.43808508190626 0.03159904479980469 3 0.976305250146076 8.001566415239216 5767.0 4.2242356687898095 0.0 - - - - - - - 1238.9 11 10 RBMX;RBMXL1 RNA binding motif protein, X-linked;RNA binding motif protein, X-linked-like 1 515 66 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20827.[MT7]-DVYLSPR.2b3_1.heavy 497.278 / 522.268 6338.0 27.175833384195965 43 17 10 6 10 2.990601876723831 33.43808508190626 0.03159904479980469 3 0.976305250146076 8.001566415239216 6338.0 17.208618671947885 0.0 - - - - - - - 649.9230769230769 12 13 RBMX;RBMXL1 RNA binding motif protein, X-linked;RNA binding motif protein, X-linked-like 1 517 66 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20827.[MT7]-DVYLSPR.2y6_1.heavy 497.278 / 734.42 8564.0 27.175833384195965 43 17 10 6 10 2.990601876723831 33.43808508190626 0.03159904479980469 3 0.976305250146076 8.001566415239216 8564.0 25.52943209393013 0.0 - - - - - - - 294.8888888888889 17 18 RBMX;RBMXL1 RNA binding motif protein, X-linked;RNA binding motif protein, X-linked-like 1 519 67 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584566.[MT7]-TLLWTELFR.3y6_1.heavy 441.591 / 851.441 991.0 49.894500732421875 40 10 10 10 10 0.7161428868068037 80.62814462770648 0.0 3 0.8292615796810674 2.943163880154407 991.0 0.0 0.0 - - - - - - - 0.0 1 0 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 521 67 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584566.[MT7]-TLLWTELFR.3y4_1.heavy 441.591 / 564.314 17892.0 49.894500732421875 40 10 10 10 10 0.7161428868068037 80.62814462770648 0.0 3 0.8292615796810674 2.943163880154407 17892.0 132.29236363636363 0.0 - - - - - - - 165.0 35 3 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 523 67 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584566.[MT7]-TLLWTELFR.3b3_1.heavy 441.591 / 472.325 4459.0 49.894500732421875 40 10 10 10 10 0.7161428868068037 80.62814462770648 0.0 3 0.8292615796810674 2.943163880154407 4459.0 117.55545454545455 0.0 - - - - - - - 125.71428571428571 8 7 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 525 67 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584566.[MT7]-TLLWTELFR.3y5_1.heavy 441.591 / 665.362 8148.0 49.894500732421875 40 10 10 10 10 0.7161428868068037 80.62814462770648 0.0 3 0.8292615796810674 2.943163880154407 8148.0 214.8109090909091 0.0 - - - - - - - 172.85714285714286 16 7 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 527 68 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543665.[MT7]-ELVVTQLGYDTR.3y6_1.heavy 513.283 / 724.362 20289.0 35.93339920043945 45 15 10 10 10 2.354057800911807 33.818859613752075 0.0 3 0.9589836505439776 6.072788359404518 20289.0 116.90237080627705 0.0 - - - - - - - 209.54545454545453 40 11 PFKP phosphofructokinase, platelet 529 68 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543665.[MT7]-ELVVTQLGYDTR.3b4_1.heavy 513.283 / 585.373 33892.0 35.93339920043945 45 15 10 10 10 2.354057800911807 33.818859613752075 0.0 3 0.9589836505439776 6.072788359404518 33892.0 78.55432227966793 0.0 - - - - - - - 317.125 67 8 PFKP phosphofructokinase, platelet 531 68 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543665.[MT7]-ELVVTQLGYDTR.3y4_1.heavy 513.283 / 554.257 9914.0 35.93339920043945 45 15 10 10 10 2.354057800911807 33.818859613752075 0.0 3 0.9589836505439776 6.072788359404518 9914.0 29.24514591361593 0.0 - - - - - - - 317.0833333333333 19 12 PFKP phosphofructokinase, platelet 533 68 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543665.[MT7]-ELVVTQLGYDTR.3y5_1.heavy 513.283 / 611.278 33546.0 35.93339920043945 45 15 10 10 10 2.354057800911807 33.818859613752075 0.0 3 0.9589836505439776 6.072788359404518 33546.0 59.63136192405841 0.0 - - - - - - - 314.45454545454544 67 11 PFKP phosphofructokinase, platelet 535 69 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21125.[MT7]-EIQGLFDELR.3b4_1.heavy 455.249 / 572.316 22223.0 43.22740173339844 44 14 10 10 10 1.2800657736672778 46.30288071243338 0.0 3 0.9389212833987138 4.968001608739686 22223.0 65.01616845661782 1.0 - - - - - - - 195.07692307692307 49 13 MAP3K11 mitogen-activated protein kinase kinase kinase 11 537 69 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21125.[MT7]-EIQGLFDELR.3b3_1.heavy 455.249 / 515.295 8651.0 43.22740173339844 44 14 10 10 10 1.2800657736672778 46.30288071243338 0.0 3 0.9389212833987138 4.968001608739686 8651.0 67.2451680672269 0.0 - - - - - - - 224.0 17 17 MAP3K11 mitogen-activated protein kinase kinase kinase 11 539 69 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21125.[MT7]-EIQGLFDELR.3y4_1.heavy 455.249 / 532.273 17540.0 43.22740173339844 44 14 10 10 10 1.2800657736672778 46.30288071243338 0.0 3 0.9389212833987138 4.968001608739686 17540.0 102.43949579831934 0.0 - - - - - - - 218.08333333333334 35 12 MAP3K11 mitogen-activated protein kinase kinase kinase 11 541 69 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21125.[MT7]-EIQGLFDELR.3y5_1.heavy 455.249 / 679.341 11032.0 43.22740173339844 44 14 10 10 10 1.2800657736672778 46.30288071243338 0.0 3 0.9389212833987138 4.968001608739686 11032.0 162.41096323693523 0.0 - - - - - - - 188.375 22 8 MAP3K11 mitogen-activated protein kinase kinase kinase 11 543 70 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21124.[MT7]-FMIYELFTR.2y8_1.heavy 682.364 / 1072.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDE1A phosphodiesterase 1A, calmodulin-dependent 545 70 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21124.[MT7]-FMIYELFTR.2y5_1.heavy 682.364 / 665.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDE1A phosphodiesterase 1A, calmodulin-dependent 547 71 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20926.[MT7]-SAPGTPGTPR.2y8_1.heavy 542.797 / 782.416 4512.0 18.19587516784668 41 18 10 3 10 4.588269783014135 21.794707968176144 0.06349945068359375 3 0.9876705955468682 11.103095926626356 4512.0 138.03444555444554 0.0 - - - - - - - 96.57142857142857 9 14 MAP3K11 mitogen-activated protein kinase kinase kinase 11 549 71 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20926.[MT7]-SAPGTPGTPR.2y5_1.heavy 542.797 / 527.294 2083.0 18.19587516784668 41 18 10 3 10 4.588269783014135 21.794707968176144 0.06349945068359375 3 0.9876705955468682 11.103095926626356 2083.0 5.402593659942363 1.0 - - - - - - - 205.66666666666666 4 18 MAP3K11 mitogen-activated protein kinase kinase kinase 11 551 71 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20926.[MT7]-SAPGTPGTPR.2y9_1.heavy 542.797 / 853.453 1736.0 18.19587516784668 41 18 10 3 10 4.588269783014135 21.794707968176144 0.06349945068359375 3 0.9876705955468682 11.103095926626356 1736.0 5.6524200592926634 0.0 - - - - - - - 118.4 3 15 MAP3K11 mitogen-activated protein kinase kinase kinase 11 553 71 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20926.[MT7]-SAPGTPGTPR.2y7_1.heavy 542.797 / 685.363 771.0 18.19587516784668 41 18 10 3 10 4.588269783014135 21.794707968176144 0.06349945068359375 3 0.9876705955468682 11.103095926626356 771.0 8.157131661442005 0.0 - - - - - - - 0.0 1 0 MAP3K11 mitogen-activated protein kinase kinase kinase 11 555 72 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21122.[MT7]-LYVPLYSSK[MT7].3y3_1.heavy 453.271 / 465.279 65591.0 37.382598876953125 50 20 10 10 10 7.031811838829991 14.22108587260475 0.0 3 0.9958632250182465 19.181456978354273 65591.0 81.80783174876366 0.0 - - - - - - - 304.3333333333333 131 6 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 557 72 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21122.[MT7]-LYVPLYSSK[MT7].3b5_1.heavy 453.271 / 730.462 16793.0 37.382598876953125 50 20 10 10 10 7.031811838829991 14.22108587260475 0.0 3 0.9958632250182465 19.181456978354273 16793.0 89.74158751902587 0.0 - - - - - - - 243.44444444444446 33 9 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 559 72 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21122.[MT7]-LYVPLYSSK[MT7].3y4_1.heavy 453.271 / 628.342 43078.0 37.382598876953125 50 20 10 10 10 7.031811838829991 14.22108587260475 0.0 3 0.9958632250182465 19.181456978354273 43078.0 156.47461981249324 0.0 - - - - - - - 273.875 86 8 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 561 72 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21122.[MT7]-LYVPLYSSK[MT7].3b3_1.heavy 453.271 / 520.325 107331.0 37.382598876953125 50 20 10 10 10 7.031811838829991 14.22108587260475 0.0 3 0.9958632250182465 19.181456978354273 107331.0 169.15282202764843 0.0 - - - - - - - 413.8 214 5 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 563 73 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21120.[MT7]-NTSTMIGAGSK[MT7].3y3_1.heavy 452.246 / 435.268 N/A 23.229766845703125 31 17 2 6 6 2.9641388111973255 33.73661166684913 0.03440093994140625 5 0.9776794402179028 8.245152536438699 8230.0 5.526507524484864 2.0 - - - - - - - 1773.375 33 8 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 565 73 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21120.[MT7]-NTSTMIGAGSK[MT7].3b4_1.heavy 452.246 / 548.28 4393.0 23.229766845703125 31 17 2 6 6 2.9641388111973255 33.73661166684913 0.03440093994140625 5 0.9776794402179028 8.245152536438699 4393.0 4.693741726631679 1.0 - - - - - - - 774.1666666666666 10 12 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 567 73 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21120.[MT7]-NTSTMIGAGSK[MT7].3b5_1.heavy 452.246 / 679.32 3787.0 23.229766845703125 31 17 2 6 6 2.9641388111973255 33.73661166684913 0.03440093994140625 5 0.9776794402179028 8.245152536438699 3787.0 19.83095111210838 0.0 - - - - - - - 193.375 7 24 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 569 73 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21120.[MT7]-NTSTMIGAGSK[MT7].3y5_1.heavy 452.246 / 563.327 6109.0 23.229766845703125 31 17 2 6 6 2.9641388111973255 33.73661166684913 0.03440093994140625 5 0.9776794402179028 8.245152536438699 6109.0 13.688038577966118 1.0 - - - - - - - 711.9 12 10 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 571 74 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21526.[MT7]-LDLLANEGYLNPQNDTVILR.3y7_1.heavy 805.772 / 830.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM37 tripartite motif-containing 37 573 74 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21526.[MT7]-LDLLANEGYLNPQNDTVILR.3b6_1.heavy 805.772 / 784.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM37 tripartite motif-containing 37 575 74 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21526.[MT7]-LDLLANEGYLNPQNDTVILR.3b4_1.heavy 805.772 / 599.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM37 tripartite motif-containing 37 577 74 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21526.[MT7]-LDLLANEGYLNPQNDTVILR.3y9_1.heavy 805.772 / 1055.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM37 tripartite motif-containing 37 579 75 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543519.[MT7]-IVIPLIEEASK[MT7].2y4_1.heavy 750.468 / 578.327 1645.0 43.899749755859375 44 18 10 6 10 3.2022843324402723 23.39698843930308 0.0370025634765625 3 0.9802676897900053 8.771152639708722 1645.0 2.1091846783605686 1.0 - - - - - - - 790.4545454545455 3 11 PDE1A phosphodiesterase 1A, calmodulin-dependent 581 75 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543519.[MT7]-IVIPLIEEASK[MT7].2y8_1.heavy 750.468 / 1030.59 21781.0 43.899749755859375 44 18 10 6 10 3.2022843324402723 23.39698843930308 0.0370025634765625 3 0.9802676897900053 8.771152639708722 21781.0 40.39118625899648 0.0 - - - - - - - 269.77777777777777 43 9 PDE1A phosphodiesterase 1A, calmodulin-dependent 583 75 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543519.[MT7]-IVIPLIEEASK[MT7].2y9_1.heavy 750.468 / 1143.67 2821.0 43.899749755859375 44 18 10 6 10 3.2022843324402723 23.39698843930308 0.0370025634765625 3 0.9802676897900053 8.771152639708722 2821.0 0.0 1.0 - - - - - - - 235.0 5 15 PDE1A phosphodiesterase 1A, calmodulin-dependent 585 75 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543519.[MT7]-IVIPLIEEASK[MT7].2y6_1.heavy 750.468 / 820.453 1880.0 43.899749755859375 44 18 10 6 10 3.2022843324402723 23.39698843930308 0.0370025634765625 3 0.9802676897900053 8.771152639708722 1880.0 1.5266821345707655 0.0 - - - - - - - 284.0625 3 16 PDE1A phosphodiesterase 1A, calmodulin-dependent 587 76 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21310.[MT7]-SIVHAVQAGIFVER.2y8_1.heavy 835.479 / 919.5 1088.0 36.562599182128906 43 13 10 10 10 1.8558725778846956 36.09045076229276 0.0 3 0.9173486780125935 4.2628478256474125 1088.0 5.245075781307847 1.0 - - - - - - - 196.625 2 8 PDE1A;PDE1C;PDE1B phosphodiesterase 1A, calmodulin-dependent;phosphodiesterase 1C, calmodulin-dependent 70kDa;phosphodiesterase 1B, calmodulin-dependent 589 76 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21310.[MT7]-SIVHAVQAGIFVER.2y9_1.heavy 835.479 / 1018.57 4110.0 36.562599182128906 43 13 10 10 10 1.8558725778846956 36.09045076229276 0.0 3 0.9173486780125935 4.2628478256474125 4110.0 5.216574560401918 0.0 - - - - - - - 272.25 8 8 PDE1A;PDE1C;PDE1B phosphodiesterase 1A, calmodulin-dependent;phosphodiesterase 1C, calmodulin-dependent 70kDa;phosphodiesterase 1B, calmodulin-dependent 591 76 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21310.[MT7]-SIVHAVQAGIFVER.2y10_1.heavy 835.479 / 1089.61 5440.0 36.562599182128906 43 13 10 10 10 1.8558725778846956 36.09045076229276 0.0 3 0.9173486780125935 4.2628478256474125 5440.0 21.28974256673316 0.0 - - - - - - - 297.0 10 11 PDE1A;PDE1C;PDE1B phosphodiesterase 1A, calmodulin-dependent;phosphodiesterase 1C, calmodulin-dependent 70kDa;phosphodiesterase 1B, calmodulin-dependent 593 76 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21310.[MT7]-SIVHAVQAGIFVER.2y11_1.heavy 835.479 / 1226.66 3989.0 36.562599182128906 43 13 10 10 10 1.8558725778846956 36.09045076229276 0.0 3 0.9173486780125935 4.2628478256474125 3989.0 11.627396831043729 0.0 - - - - - - - 242.0 7 6 PDE1A;PDE1C;PDE1B phosphodiesterase 1A, calmodulin-dependent;phosphodiesterase 1C, calmodulin-dependent 70kDa;phosphodiesterase 1B, calmodulin-dependent 595 77 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21527.[MT7]-VNWHDFAFFDPVMYESLR.3y6_1.heavy 806.388 / 798.381 869.0 50.34239959716797 41 16 10 5 10 1.7868903679636956 43.352667901786084 0.0449981689453125 3 0.9689816537985357 6.989144506105676 869.0 9.831751824817518 0.0 - - - - - - - 0.0 1 0 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 597 77 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21527.[MT7]-VNWHDFAFFDPVMYESLR.3b5_1.heavy 806.388 / 796.386 595.0 50.34239959716797 41 16 10 5 10 1.7868903679636956 43.352667901786084 0.0449981689453125 3 0.9689816537985357 6.989144506105676 595.0 12.756929347826087 3.0 - - - - - - - 0.0 1 0 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 599 77 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21527.[MT7]-VNWHDFAFFDPVMYESLR.3y8_1.heavy 806.388 / 994.503 2516.0 50.34239959716797 41 16 10 5 10 1.7868903679636956 43.352667901786084 0.0449981689453125 3 0.9689816537985357 6.989144506105676 2516.0 35.798572029063834 0.0 - - - - - - - 144.72222222222223 5 18 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 601 77 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21527.[MT7]-VNWHDFAFFDPVMYESLR.3b7_2.heavy 806.388 / 507.749 1464.0 50.34239959716797 41 16 10 5 10 1.7868903679636956 43.352667901786084 0.0449981689453125 3 0.9689816537985357 6.989144506105676 1464.0 13.60943231441048 0.0 - - - - - - - 129.11764705882354 2 17 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 603 78 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20931.[MT7]-NLDWFPR.2y4_1.heavy 546.291 / 605.319 40078.0 39.27090072631836 50 20 10 10 10 22.14431970100902 4.5158307570606215 0.0 3 0.995116575266835 17.653191200723672 40078.0 81.23298078666329 0.0 - - - - - - - 721.0 80 7 ITPR1;ITPR2;ITPR3 inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-triphosphate receptor, type 2;inositol 1,4,5-triphosphate receptor, type 3 605 78 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20931.[MT7]-NLDWFPR.2y5_1.heavy 546.291 / 720.346 9066.0 39.27090072631836 50 20 10 10 10 22.14431970100902 4.5158307570606215 0.0 3 0.995116575266835 17.653191200723672 9066.0 62.933883495145636 0.0 - - - - - - - 263.22222222222223 18 9 ITPR1;ITPR2;ITPR3 inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-triphosphate receptor, type 2;inositol 1,4,5-triphosphate receptor, type 3 607 78 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20931.[MT7]-NLDWFPR.2b4_1.heavy 546.291 / 673.343 7727.0 39.27090072631836 50 20 10 10 10 22.14431970100902 4.5158307570606215 0.0 3 0.995116575266835 17.653191200723672 7727.0 12.859015586336568 0.0 - - - - - - - 257.5 15 6 ITPR1;ITPR2;ITPR3 inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-triphosphate receptor, type 2;inositol 1,4,5-triphosphate receptor, type 3 609 78 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20931.[MT7]-NLDWFPR.2y6_1.heavy 546.291 / 833.43 10818.0 39.27090072631836 50 20 10 10 10 22.14431970100902 4.5158307570606215 0.0 3 0.995116575266835 17.653191200723672 10818.0 53.6365610012867 0.0 - - - - - - - 188.83333333333334 21 6 ITPR1;ITPR2;ITPR3 inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-triphosphate receptor, type 2;inositol 1,4,5-triphosphate receptor, type 3 611 79 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20930.[MT7]-AAC[CAM]NLLQR.2b4_1.heavy 545.301 / 561.257 5448.0 27.596200942993164 50 20 10 10 10 10.590574461919141 9.442358425369003 0.0 3 0.9959684103274559 19.430241194479784 5448.0 7.285116279069768 0.0 - - - - - - - 688.0 10 8 PFKP phosphofructokinase, platelet 613 79 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20930.[MT7]-AAC[CAM]NLLQR.2y6_1.heavy 545.301 / 803.419 2753.0 27.596200942993164 50 20 10 10 10 10.590574461919141 9.442358425369003 0.0 3 0.9959684103274559 19.430241194479784 2753.0 20.950650753054845 0.0 - - - - - - - 165.61111111111111 5 18 PFKP phosphofructokinase, platelet 615 79 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20930.[MT7]-AAC[CAM]NLLQR.2b5_1.heavy 545.301 / 674.341 N/A 27.596200942993164 50 20 10 10 10 10.590574461919141 9.442358425369003 0.0 3 0.9959684103274559 19.430241194479784 5563.0 2.848221751861469 1.0 - - - - - - - 238.83333333333334 16 12 PFKP phosphofructokinase, platelet 617 79 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20930.[MT7]-AAC[CAM]NLLQR.2y7_1.heavy 545.301 / 874.456 8831.0 27.596200942993164 50 20 10 10 10 10.590574461919141 9.442358425369003 0.0 3 0.9959684103274559 19.430241194479784 8831.0 20.62834113441197 0.0 - - - - - - - 648.0 17 10 PFKP phosphofructokinase, platelet 619 80 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20933.[MT7]-ETADELK[MT7].2b4_1.heavy 547.303 / 561.264 6081.0 21.90489959716797 50 20 10 10 10 11.093015763099299 9.014681141322097 0.0 3 0.9934143920307236 15.199377560195941 6081.0 25.499301120947187 0.0 - - - - - - - 218.88888888888889 12 18 MAP3K4 mitogen-activated protein kinase kinase kinase 4 621 80 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20933.[MT7]-ETADELK[MT7].2y3_1.heavy 547.303 / 533.341 4865.0 21.90489959716797 50 20 10 10 10 11.093015763099299 9.014681141322097 0.0 3 0.9934143920307236 15.199377560195941 4865.0 14.8568652624141 0.0 - - - - - - - 667.1428571428571 9 7 MAP3K4 mitogen-activated protein kinase kinase kinase 4 623 80 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20933.[MT7]-ETADELK[MT7].2y6_1.heavy 547.303 / 820.453 5546.0 21.90489959716797 50 20 10 10 10 11.093015763099299 9.014681141322097 0.0 3 0.9934143920307236 15.199377560195941 5546.0 143.2316130835896 0.0 - - - - - - - 149.26666666666668 11 15 MAP3K4 mitogen-activated protein kinase kinase kinase 4 625 80 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20933.[MT7]-ETADELK[MT7].2b5_1.heavy 547.303 / 690.306 2967.0 21.90489959716797 50 20 10 10 10 11.093015763099299 9.014681141322097 0.0 3 0.9934143920307236 15.199377560195941 2967.0 27.490620666328432 0.0 - - - - - - - 173.76190476190476 5 21 MAP3K4 mitogen-activated protein kinase kinase kinase 4 627 81 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21522.[MT7]-EIGWTDVGGWTGQGGSILGTK[MT7].3b9_1.heavy 803.088 / 1059.52 9787.0 42.542301177978516 44 14 10 10 10 1.7957459986162456 44.36338781747207 0.0 3 0.937782344381698 4.921842161614523 9787.0 64.47264367096531 0.0 - - - - - - - 234.5 19 16 PFKP phosphofructokinase, platelet 629 81 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21522.[MT7]-EIGWTDVGGWTGQGGSILGTK[MT7].3b6_1.heavy 803.088 / 846.411 9787.0 42.542301177978516 44 14 10 10 10 1.7957459986162456 44.36338781747207 0.0 3 0.937782344381698 4.921842161614523 9787.0 59.96942281206961 0.0 - - - - - - - 223.06666666666666 19 15 PFKP phosphofructokinase, platelet 631 81 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21522.[MT7]-EIGWTDVGGWTGQGGSILGTK[MT7].3y4_1.heavy 803.088 / 562.368 18758.0 42.542301177978516 44 14 10 10 10 1.7957459986162456 44.36338781747207 0.0 3 0.937782344381698 4.921842161614523 18758.0 55.69375760649088 0.0 - - - - - - - 296.2631578947368 37 19 PFKP phosphofructokinase, platelet 633 81 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21522.[MT7]-EIGWTDVGGWTGQGGSILGTK[MT7].3y8_1.heavy 803.088 / 876.527 8564.0 42.542301177978516 44 14 10 10 10 1.7957459986162456 44.36338781747207 0.0 3 0.937782344381698 4.921842161614523 8564.0 31.048331997649193 0.0 - - - - - - - 249.10526315789474 17 19 PFKP phosphofructokinase, platelet 635 82 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB539372.[MT7]-ALAQAAR.2y5_1.heavy 422.76 / 516.289 64880.0 19.20549964904785 50 20 10 10 10 6.693269296182222 14.940381982992834 0.0 3 0.9936095509707766 15.429971810716593 64880.0 128.02866590269596 0.0 - - - - - - - 735.6 129 10 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 637 82 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB539372.[MT7]-ALAQAAR.2b4_1.heavy 422.76 / 528.326 37926.0 19.20549964904785 50 20 10 10 10 6.693269296182222 14.940381982992834 0.0 3 0.9936095509707766 15.429971810716593 37926.0 75.53302132410406 0.0 - - - - - - - 670.875 75 8 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 639 82 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB539372.[MT7]-ALAQAAR.2y6_1.heavy 422.76 / 629.373 112944.0 19.20549964904785 50 20 10 10 10 6.693269296182222 14.940381982992834 0.0 3 0.9936095509707766 15.429971810716593 112944.0 416.17169458649266 0.0 - - - - - - - 294.2 225 5 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 641 82 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB539372.[MT7]-ALAQAAR.2b5_1.heavy 422.76 / 599.363 31764.0 19.20549964904785 50 20 10 10 10 6.693269296182222 14.940381982992834 0.0 3 0.9936095509707766 15.429971810716593 31764.0 90.64578653567042 0.0 - - - - - - - 294.7647058823529 63 17 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 643 83 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584572.[MT7]-NETHNPTVK[MT7].3y3_1.heavy 443.245 / 491.331 8779.0 16.621474742889404 38 12 10 6 10 3.2642131486881083 30.63525433079949 0.03289985656738281 3 0.8898286316515204 3.6834747033674025 8779.0 80.09014617940198 0.0 - - - - - - - 248.2962962962963 17 27 MET met proto-oncogene (hepatocyte growth factor receptor) 645 83 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584572.[MT7]-NETHNPTVK[MT7].3b5_1.heavy 443.245 / 740.344 2946.0 16.621474742889404 38 12 10 6 10 3.2642131486881083 30.63525433079949 0.03289985656738281 3 0.8898286316515204 3.6834747033674025 2946.0 35.78218126888218 0.0 - - - - - - - 273.08 5 25 MET met proto-oncogene (hepatocyte growth factor receptor) 647 83 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584572.[MT7]-NETHNPTVK[MT7].3b3_1.heavy 443.245 / 489.242 9109.0 16.621474742889404 38 12 10 6 10 3.2642131486881083 30.63525433079949 0.03289985656738281 3 0.8898286316515204 3.6834747033674025 9109.0 43.69630111658694 0.0 - - - - - - - 246.52 18 25 MET met proto-oncogene (hepatocyte growth factor receptor) 649 83 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584572.[MT7]-NETHNPTVK[MT7].3y4_1.heavy 443.245 / 588.384 22067.0 16.621474742889404 38 12 10 6 10 3.2642131486881083 30.63525433079949 0.03289985656738281 3 0.8898286316515204 3.6834747033674025 22067.0 103.45753146782862 0.0 - - - - - - - 180.3 44 20 MET met proto-oncogene (hepatocyte growth factor receptor) 651 84 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21521.[MT7]-EIGWTDVGGWTGQGGSILGTK[MT7].4y4_1.heavy 602.568 / 562.368 8639.0 42.55130100250244 39 13 10 6 10 1.952694226729659 38.425053317398856 0.035999298095703125 3 0.9067671221980691 4.010000358548958 8639.0 40.352880482186386 0.0 - - - - - - - 228.9375 17 16 PFKP phosphofructokinase, platelet 653 84 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21521.[MT7]-EIGWTDVGGWTGQGGSILGTK[MT7].4b7_1.heavy 602.568 / 945.48 1711.0 42.55130100250244 39 13 10 6 10 1.952694226729659 38.425053317398856 0.035999298095703125 3 0.9067671221980691 4.010000358548958 1711.0 6.6001765149069 0.0 - - - - - - - 157.26666666666668 3 15 PFKP phosphofructokinase, platelet 655 84 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21521.[MT7]-EIGWTDVGGWTGQGGSILGTK[MT7].4b5_1.heavy 602.568 / 731.385 1548.0 42.55130100250244 39 13 10 6 10 1.952694226729659 38.425053317398856 0.035999298095703125 3 0.9067671221980691 4.010000358548958 1548.0 5.58045676078463 0.0 - - - - - - - 195.3 3 20 PFKP phosphofructokinase, platelet 657 84 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21521.[MT7]-EIGWTDVGGWTGQGGSILGTK[MT7].4b6_1.heavy 602.568 / 846.411 5623.0 42.55130100250244 39 13 10 6 10 1.952694226729659 38.425053317398856 0.035999298095703125 3 0.9067671221980691 4.010000358548958 5623.0 28.100861912903554 0.0 - - - - - - - 237.92307692307693 11 13 PFKP phosphofructokinase, platelet 659 85 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20991.[MT7]-SIVSVGDPK[MT7].2b4_1.heavy 595.355 / 531.326 1835.0 27.52750015258789 46 16 10 10 10 3.868241377093418 25.85154085579314 0.0 3 0.9650366432960613 6.580853959979916 1835.0 3.7328494705375688 2.0 - - - - - - - 758.2222222222222 3 9 PAK1;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 3 661 85 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20991.[MT7]-SIVSVGDPK[MT7].2y6_1.heavy 595.355 / 746.417 1548.0 27.52750015258789 46 16 10 10 10 3.868241377093418 25.85154085579314 0.0 3 0.9650366432960613 6.580853959979916 1548.0 15.754845629450083 0.0 - - - - - - - 197.44444444444446 3 18 PAK1;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 3 663 85 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20991.[MT7]-SIVSVGDPK[MT7].2b7_1.heavy 595.355 / 802.443 9921.0 27.52750015258789 46 16 10 10 10 3.868241377093418 25.85154085579314 0.0 3 0.9650366432960613 6.580853959979916 9921.0 41.15498304647477 0.0 - - - - - - - 581.5714285714286 19 7 PAK1;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 3 665 85 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20991.[MT7]-SIVSVGDPK[MT7].2y7_1.heavy 595.355 / 845.485 803.0 27.52750015258789 46 16 10 10 10 3.868241377093418 25.85154085579314 0.0 3 0.9650366432960613 6.580853959979916 803.0 2.9049276372387807 1.0 - - - - - - - 0.0 1 0 PAK1;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 3 667 86 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20831.[MT7]-TFILSK[MT7].2b3_1.heavy 498.82 / 506.31 11444.0 32.961673736572266 45 18 10 7 10 3.910747156159201 21.434334173761084 0.0287017822265625 3 0.9835800071572958 9.617890572986024 11444.0 18.138239128357533 0.0 - - - - - - - 707.9333333333333 22 15 IL5RA interleukin 5 receptor, alpha 669 86 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20831.[MT7]-TFILSK[MT7].2y4_1.heavy 498.82 / 604.415 11170.0 32.961673736572266 45 18 10 7 10 3.910747156159201 21.434334173761084 0.0287017822265625 3 0.9835800071572958 9.617890572986024 11170.0 16.452163712200207 0.0 - - - - - - - 1116.142857142857 22 7 IL5RA interleukin 5 receptor, alpha 671 86 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20831.[MT7]-TFILSK[MT7].2y5_1.heavy 498.82 / 751.483 14322.0 32.961673736572266 45 18 10 7 10 3.910747156159201 21.434334173761084 0.0287017822265625 3 0.9835800071572958 9.617890572986024 14322.0 58.48457321614777 0.0 - - - - - - - 668.0 28 8 IL5RA interleukin 5 receptor, alpha 673 86 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20831.[MT7]-TFILSK[MT7].2b4_1.heavy 498.82 / 619.394 4728.0 32.961673736572266 45 18 10 7 10 3.910747156159201 21.434334173761084 0.0287017822265625 3 0.9835800071572958 9.617890572986024 4728.0 3.8248038670276547 1.0 - - - - - - - 665.5714285714286 9 14 IL5RA interleukin 5 receptor, alpha 675 87 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543510.[MT7]-LSAIFRDFLNR.3y10_2.heavy 499.288 / 619.836 21720.0 46.2218017578125 39 9 10 10 10 1.1228943273768672 62.350044430139036 0.0 3 0.8072827463800881 2.764820877531754 21720.0 346.1986876281613 0.0 - - - - - - - 139.45454545454547 43 11 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 677 87 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543510.[MT7]-LSAIFRDFLNR.3b5_1.heavy 499.288 / 676.415 6613.0 46.2218017578125 39 9 10 10 10 1.1228943273768672 62.350044430139036 0.0 3 0.8072827463800881 2.764820877531754 6613.0 97.51801913875597 0.0 - - - - - - - 250.6 13 5 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 679 87 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543510.[MT7]-LSAIFRDFLNR.3y4_1.heavy 499.288 / 549.314 10930.0 46.2218017578125 39 9 10 10 10 1.1228943273768672 62.350044430139036 0.0 3 0.8072827463800881 2.764820877531754 10930.0 300.10657142857144 0.0 - - - - - - - 166.07692307692307 21 13 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 681 87 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543510.[MT7]-LSAIFRDFLNR.3y5_1.heavy 499.288 / 664.341 15733.0 46.2218017578125 39 9 10 10 10 1.1228943273768672 62.350044430139036 0.0 3 0.8072827463800881 2.764820877531754 15733.0 126.40394013975421 0.0 - - - - - - - 179.83333333333334 31 12 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 683 88 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584776.[MT7]-LEEVIGIGGFGK[MT7].3b6_1.heavy 502.964 / 785.453 24458.0 41.295424461364746 42 16 10 6 10 2.1009917946892545 32.93722554295417 0.036098480224609375 3 0.9696379747887209 7.064671866090475 24458.0 79.82819444444445 0.0 - - - - - - - 182.33333333333334 48 9 MAP3K11 mitogen-activated protein kinase kinase kinase 11 685 88 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584776.[MT7]-LEEVIGIGGFGK[MT7].3b4_1.heavy 502.964 / 615.347 63091.0 41.295424461364746 42 16 10 6 10 2.1009917946892545 32.93722554295417 0.036098480224609375 3 0.9696379747887209 7.064671866090475 63091.0 229.12444819265392 0.0 - - - - - - - 267.9 126 10 MAP3K11 mitogen-activated protein kinase kinase kinase 11 687 88 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584776.[MT7]-LEEVIGIGGFGK[MT7].3b3_1.heavy 502.964 / 516.279 43818.0 41.295424461364746 42 16 10 6 10 2.1009917946892545 32.93722554295417 0.036098480224609375 3 0.9696379747887209 7.064671866090475 43818.0 104.12777011326335 0.0 - - - - - - - 680.625 87 8 MAP3K11 mitogen-activated protein kinase kinase kinase 11 689 88 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584776.[MT7]-LEEVIGIGGFGK[MT7].3y5_1.heavy 502.964 / 609.348 50386.0 41.295424461364746 42 16 10 6 10 2.1009917946892545 32.93722554295417 0.036098480224609375 3 0.9696379747887209 7.064671866090475 50386.0 219.78766295707476 0.0 - - - - - - - 224.66666666666666 100 15 MAP3K11 mitogen-activated protein kinase kinase kinase 11 691 89 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20938.[MT7]-ILLVTDGAR.2y8_1.heavy 551.341 / 844.489 33532.0 34.742000579833984 48 18 10 10 10 2.7165212317720364 28.445557134718424 0.0 3 0.986742174381711 10.706443545506033 33532.0 91.57984141357069 0.0 - - - - - - - 254.0 67 9 LAMA5 laminin, alpha 5 693 89 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20938.[MT7]-ILLVTDGAR.2y5_1.heavy 551.341 / 519.252 9050.0 34.742000579833984 48 18 10 10 10 2.7165212317720364 28.445557134718424 0.0 3 0.986742174381711 10.706443545506033 9050.0 20.592705615696087 0.0 - - - - - - - 679.0 18 8 LAMA5 laminin, alpha 5 695 89 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20938.[MT7]-ILLVTDGAR.2y6_1.heavy 551.341 / 618.321 16766.0 34.742000579833984 48 18 10 10 10 2.7165212317720364 28.445557134718424 0.0 3 0.986742174381711 10.706443545506033 16766.0 70.64580881867346 0.0 - - - - - - - 294.3636363636364 33 11 LAMA5 laminin, alpha 5 697 89 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20938.[MT7]-ILLVTDGAR.2y7_1.heavy 551.341 / 731.405 13908.0 34.742000579833984 48 18 10 10 10 2.7165212317720364 28.445557134718424 0.0 3 0.986742174381711 10.706443545506033 13908.0 50.78562316816582 0.0 - - - - - - - 292.57142857142856 27 14 LAMA5 laminin, alpha 5 699 90 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 429431.0 35.70309829711914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 429431.0 115.39818730803924 0.0 - - - - - - - 228.0 858 1 701 90 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 79486.0 35.70309829711914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 79486.0 5.15933616738347 1.0 - - - - - - - 733.6666666666666 168 9 703 90 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 130617.0 35.70309829711914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 130617.0 186.66206701906768 0.0 - - - - - - - 683.0 261 9 705 91 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21113.[MT7]-IEEFVYEK[MT7].2b3_1.heavy 672.868 / 516.279 8894.0 35.00910186767578 48 18 10 10 10 4.353753771778156 22.968685240818772 0.0 3 0.9868346131421373 10.7440477973163 8894.0 11.658666666666669 1.0 - - - - - - - 812.0 17 8 SH3GLB1 SH3-domain GRB2-like endophilin B1 707 91 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21113.[MT7]-IEEFVYEK[MT7].2b4_1.heavy 672.868 / 663.347 13292.0 35.00910186767578 48 18 10 10 10 4.353753771778156 22.968685240818772 0.0 3 0.9868346131421373 10.7440477973163 13292.0 28.177938940191755 0.0 - - - - - - - 699.5 26 10 SH3GLB1 SH3-domain GRB2-like endophilin B1 709 91 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21113.[MT7]-IEEFVYEK[MT7].2y3_1.heavy 672.868 / 583.321 14491.0 35.00910186767578 48 18 10 10 10 4.353753771778156 22.968685240818772 0.0 3 0.9868346131421373 10.7440477973163 14491.0 36.18820442219442 0.0 - - - - - - - 642.5714285714286 28 7 SH3GLB1 SH3-domain GRB2-like endophilin B1 711 91 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21113.[MT7]-IEEFVYEK[MT7].2y7_1.heavy 672.868 / 1087.54 9094.0 35.00910186767578 48 18 10 10 10 4.353753771778156 22.968685240818772 0.0 3 0.9868346131421373 10.7440477973163 9094.0 6.676106000237621 1.0 - - - - - - - 266.6666666666667 23 12 SH3GLB1 SH3-domain GRB2-like endophilin B1 713 92 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584779.[MT7]-DWLASTFTRK[MT7].3y7_1.heavy 504.952 / 954.549 5605.0 36.099050521850586 45 20 10 5 10 3.361798513884366 29.74598257063768 0.046298980712890625 2 0.9979333650553909 27.142863528078944 5605.0 23.531195335276966 0.0 - - - - - - - 215.88888888888889 11 9 PDE1A phosphodiesterase 1A, calmodulin-dependent 715 92 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584779.[MT7]-DWLASTFTRK[MT7].3y6_1.heavy 504.952 / 883.512 3203.0 36.099050521850586 45 20 10 5 10 3.361798513884366 29.74598257063768 0.046298980712890625 2 0.9979333650553909 27.142863528078944 3203.0 30.857063510304144 0.0 - - - - - - - 190.55555555555554 6 9 PDE1A phosphodiesterase 1A, calmodulin-dependent 717 92 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584779.[MT7]-DWLASTFTRK[MT7].3b3_1.heavy 504.952 / 559.3 N/A 36.099050521850586 45 20 10 5 10 3.361798513884366 29.74598257063768 0.046298980712890625 2 0.9979333650553909 27.142863528078944 3203.0 4.000562054390012 1.0 - - - - - - - 751.5714285714286 6 7 PDE1A phosphodiesterase 1A, calmodulin-dependent 719 92 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584779.[MT7]-DWLASTFTRK[MT7].3y8_1.heavy 504.952 / 1067.63 N/A 36.099050521850586 45 20 10 5 10 3.361798513884366 29.74598257063768 0.046298980712890625 2 0.9979333650553909 27.142863528078944 0.0 0.0 4.0 - - - - - - - 0.0 0 0 PDE1A phosphodiesterase 1A, calmodulin-dependent 721 93 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542874.[MT7]-IEEFVYEK[MT7].3y3_1.heavy 448.914 / 583.321 150539.0 35.00910186767578 43 13 10 10 10 1.084558077256526 53.71252672322305 0.0 3 0.9216826585746682 4.380840122887744 150539.0 273.8857882878416 0.0 - - - - - - - 758.0 301 7 SH3GLB1 SH3-domain GRB2-like endophilin B1 723 93 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542874.[MT7]-IEEFVYEK[MT7].3b4_1.heavy 448.914 / 663.347 131625.0 35.00910186767578 43 13 10 10 10 1.084558077256526 53.71252672322305 0.0 3 0.9216826585746682 4.380840122887744 131625.0 443.86496113989637 0.0 - - - - - - - 183.0 263 10 SH3GLB1 SH3-domain GRB2-like endophilin B1 725 93 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542874.[MT7]-IEEFVYEK[MT7].3b5_1.heavy 448.914 / 762.415 21037.0 35.00910186767578 43 13 10 10 10 1.084558077256526 53.71252672322305 0.0 3 0.9216826585746682 4.380840122887744 21037.0 201.64999999999998 0.0 - - - - - - - 217.0 42 8 SH3GLB1 SH3-domain GRB2-like endophilin B1 727 93 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542874.[MT7]-IEEFVYEK[MT7].3b3_1.heavy 448.914 / 516.279 72954.0 35.00910186767578 43 13 10 10 10 1.084558077256526 53.71252672322305 0.0 3 0.9216826585746682 4.380840122887744 72954.0 187.7415557129845 0.0 - - - - - - - 308.5 145 10 SH3GLB1 SH3-domain GRB2-like endophilin B1 729 94 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20941.[MT7]-NSSEQELR.2y4_1.heavy 553.782 / 545.304 N/A 18.156200408935547 46 16 10 10 10 3.6887677169032234 27.109324217343648 0.0 3 0.9665493155336385 6.728864009295472 4697.0 9.685434908549201 0.0 - - - - - - - 1267.2857142857142 9 7 SH3GLB1 SH3-domain GRB2-like endophilin B1 731 94 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20941.[MT7]-NSSEQELR.2b4_1.heavy 553.782 / 562.259 1606.0 18.156200408935547 46 16 10 10 10 3.6887677169032234 27.109324217343648 0.0 3 0.9665493155336385 6.728864009295472 1606.0 5.315231316725979 0.0 - - - - - - - 101.26315789473684 3 19 SH3GLB1 SH3-domain GRB2-like endophilin B1 733 94 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20941.[MT7]-NSSEQELR.2b5_1.heavy 553.782 / 690.318 1646.0 18.156200408935547 46 16 10 10 10 3.6887677169032234 27.109324217343648 0.0 3 0.9665493155336385 6.728864009295472 1646.0 23.915662863070537 0.0 - - - - - - - 162.61111111111111 3 18 SH3GLB1 SH3-domain GRB2-like endophilin B1 735 94 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20941.[MT7]-NSSEQELR.2y7_1.heavy 553.782 / 848.411 3814.0 18.156200408935547 46 16 10 10 10 3.6887677169032234 27.109324217343648 0.0 3 0.9665493155336385 6.728864009295472 3814.0 36.53418869492934 0.0 - - - - - - - 154.78571428571428 7 14 SH3GLB1 SH3-domain GRB2-like endophilin B1 737 95 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20961.[MT7]-IGEGQYGK[MT7].2y5_1.heavy 570.319 / 696.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K4 mitogen-activated protein kinase kinase kinase 4 739 95 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20961.[MT7]-IGEGQYGK[MT7].2y3_1.heavy 570.319 / 511.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K4 mitogen-activated protein kinase kinase kinase 4 741 95 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20961.[MT7]-IGEGQYGK[MT7].2b5_1.heavy 570.319 / 629.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K4 mitogen-activated protein kinase kinase kinase 4 743 95 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20961.[MT7]-IGEGQYGK[MT7].2y7_1.heavy 570.319 / 882.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K4 mitogen-activated protein kinase kinase kinase 4 745 96 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543858.[MT7]-ALEQFATVVEAK[MT7].3b6_1.heavy 531.975 / 804.437 10299.0 39.7599983215332 43 13 10 10 10 1.7186362934463963 46.51355527006025 0.0 3 0.9181074887685235 4.282831194269026 10299.0 68.48835 0.0 - - - - - - - 200.0 20 12 ACADVL acyl-CoA dehydrogenase, very long chain 747 96 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543858.[MT7]-ALEQFATVVEAK[MT7].3b4_1.heavy 531.975 / 586.332 47697.0 39.7599983215332 43 13 10 10 10 1.7186362934463963 46.51355527006025 0.0 3 0.9181074887685235 4.282831194269026 47697.0 140.01719333333335 0.0 - - - - - - - 250.0 95 12 ACADVL acyl-CoA dehydrogenase, very long chain 749 96 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543858.[MT7]-ALEQFATVVEAK[MT7].3b5_1.heavy 531.975 / 733.4 20299.0 39.7599983215332 43 13 10 10 10 1.7186362934463963 46.51355527006025 0.0 3 0.9181074887685235 4.282831194269026 20299.0 86.37224499999999 0.0 - - - - - - - 227.27272727272728 40 11 ACADVL acyl-CoA dehydrogenase, very long chain 751 96 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543858.[MT7]-ALEQFATVVEAK[MT7].3y4_1.heavy 531.975 / 590.363 64796.0 39.7599983215332 43 13 10 10 10 1.7186362934463963 46.51355527006025 0.0 3 0.9181074887685235 4.282831194269026 64796.0 214.93758857142856 0.0 - - - - - - - 542.8571428571429 129 7 ACADVL acyl-CoA dehydrogenase, very long chain 753 97 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20964.[MT7]-GLLDVLPK[MT7].2y4_1.heavy 571.873 / 600.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 755 97 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20964.[MT7]-GLLDVLPK[MT7].2b4_1.heavy 571.873 / 543.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 757 97 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20964.[MT7]-GLLDVLPK[MT7].2y3_1.heavy 571.873 / 501.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 759 97 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20964.[MT7]-GLLDVLPK[MT7].2b5_1.heavy 571.873 / 642.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 761 98 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21305.[MT7]-GK[MT7]VPITYLELLN.3b9_2.heavy 550.002 / 645.389 38139.0 44.458149909973145 33 7 10 6 10 2.0339664319408555 39.06933253867649 0.038600921630859375 3 0.7443247520673759 2.3866993819672784 38139.0 119.14960053205183 0.0 - - - - - - - 196.8181818181818 76 11 SH3GLB1 SH3-domain GRB2-like endophilin B1 763 98 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21305.[MT7]-GK[MT7]VPITYLELLN.3b3_1.heavy 550.002 / 573.396 3172.0 44.458149909973145 33 7 10 6 10 2.0339664319408555 39.06933253867649 0.038600921630859375 3 0.7443247520673759 2.3866993819672784 3172.0 32.43008342602892 0.0 - - - - - - - 224.3 6 10 SH3GLB1 SH3-domain GRB2-like endophilin B1 765 98 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21305.[MT7]-GK[MT7]VPITYLELLN.3b8_2.heavy 550.002 / 580.868 19185.0 44.458149909973145 33 7 10 6 10 2.0339664319408555 39.06933253867649 0.038600921630859375 3 0.7443247520673759 2.3866993819672784 19185.0 271.7407641251737 0.0 - - - - - - - 167.33333333333334 38 6 SH3GLB1 SH3-domain GRB2-like endophilin B1 767 98 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21305.[MT7]-GK[MT7]VPITYLELLN.3b7_2.heavy 550.002 / 524.326 23904.0 44.458149909973145 33 7 10 6 10 2.0339664319408555 39.06933253867649 0.038600921630859375 3 0.7443247520673759 2.3866993819672784 23904.0 186.76274082313682 0.0 - - - - - - - 154.66666666666666 47 9 SH3GLB1 SH3-domain GRB2-like endophilin B1 769 99 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20960.[MT7]-ITQSEFDR.2y5_1.heavy 570.294 / 653.289 9190.0 27.301575660705566 46 20 10 6 10 5.655301518014883 17.68252314778468 0.033100128173828125 3 0.9970543987334967 22.73362690912975 9190.0 198.31052631578947 0.0 - - - - - - - 205.7391304347826 18 23 SH3GLB1 SH3-domain GRB2-like endophilin B1 771 99 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20960.[MT7]-ITQSEFDR.2b4_1.heavy 570.294 / 574.332 3596.0 27.301575660705566 46 20 10 6 10 5.655301518014883 17.68252314778468 0.033100128173828125 3 0.9970543987334967 22.73362690912975 3596.0 8.304381322957198 0.0 - - - - - - - 262.9130434782609 7 23 SH3GLB1 SH3-domain GRB2-like endophilin B1 773 99 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20960.[MT7]-ITQSEFDR.2y6_1.heavy 570.294 / 781.347 4281.0 27.301575660705566 46 20 10 6 10 5.655301518014883 17.68252314778468 0.033100128173828125 3 0.9970543987334967 22.73362690912975 4281.0 19.56492105263158 0.0 - - - - - - - 151.2173913043478 8 23 SH3GLB1 SH3-domain GRB2-like endophilin B1 775 99 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20960.[MT7]-ITQSEFDR.2y7_1.heavy 570.294 / 882.395 32934.0 27.301575660705566 46 20 10 6 10 5.655301518014883 17.68252314778468 0.033100128173828125 3 0.9970543987334967 22.73362690912975 32934.0 108.709380405958 0.0 - - - - - - - 666.0 65 9 SH3GLB1 SH3-domain GRB2-like endophilin B1 777 100 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542668.[MT7]-LAADAGTFLSR.2y9_1.heavy 633.352 / 937.474 14077.0 36.4073486328125 39 14 10 5 10 1.94733536884678 40.829579726093286 0.04290008544921875 3 0.940294019571339 5.025376117414481 14077.0 94.90727006652975 0.0 - - - - - - - 174.375 28 8 SH3GLB1 SH3-domain GRB2-like endophilin B1 779 100 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542668.[MT7]-LAADAGTFLSR.2b4_1.heavy 633.352 / 515.295 22919.0 36.4073486328125 39 14 10 5 10 1.94733536884678 40.829579726093286 0.04290008544921875 3 0.940294019571339 5.025376117414481 22919.0 48.92987720720299 0.0 - - - - - - - 320.0 45 8 SH3GLB1 SH3-domain GRB2-like endophilin B1 781 100 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542668.[MT7]-LAADAGTFLSR.2y10_1.heavy 633.352 / 1008.51 41417.0 36.4073486328125 39 14 10 5 10 1.94733536884678 40.829579726093286 0.04290008544921875 3 0.940294019571339 5.025376117414481 41417.0 370.06648083193363 0.0 - - - - - - - 206.66666666666666 82 9 SH3GLB1 SH3-domain GRB2-like endophilin B1 783 100 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542668.[MT7]-LAADAGTFLSR.2y7_1.heavy 633.352 / 751.41 23850.0 36.4073486328125 39 14 10 5 10 1.94733536884678 40.829579726093286 0.04290008544921875 3 0.940294019571339 5.025376117414481 23850.0 90.52741935483871 0.0 - - - - - - - 265.7142857142857 47 7 SH3GLB1 SH3-domain GRB2-like endophilin B1 785 101 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21307.[MT7]-K[MT7]NPQAVLDVLK[MT7].3y3_1.heavy 553.017 / 503.367 4110.0 34.569400787353516 47 17 10 10 10 3.895460864087124 25.67090351796779 0.0 3 0.9765394740765528 8.041568347628324 4110.0 4.2979480164158685 1.0 - - - - - - - 740.7777777777778 8 9 PAK2;PAK3 p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3 787 101 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21307.[MT7]-K[MT7]NPQAVLDVLK[MT7].3y4_1.heavy 553.017 / 618.394 8129.0 34.569400787353516 47 17 10 10 10 3.895460864087124 25.67090351796779 0.0 3 0.9765394740765528 8.041568347628324 8129.0 22.127074826596942 0.0 - - - - - - - 283.2 16 10 PAK2;PAK3 p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3 789 101 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21307.[MT7]-K[MT7]NPQAVLDVLK[MT7].3y5_1.heavy 553.017 / 731.478 4384.0 34.569400787353516 47 17 10 10 10 3.895460864087124 25.67090351796779 0.0 3 0.9765394740765528 8.041568347628324 4384.0 6.417380265856949 0.0 - - - - - - - 258.75 8 12 PAK2;PAK3 p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3 791 101 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21307.[MT7]-K[MT7]NPQAVLDVLK[MT7].3b8_2.heavy 553.017 / 577.842 3471.0 34.569400787353516 47 17 10 10 10 3.895460864087124 25.67090351796779 0.0 3 0.9765394740765528 8.041568347628324 3471.0 24.0950012555153 0.0 - - - - - - - 257.0 6 16 PAK2;PAK3 p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3 793 102 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20804.[MT7]-GGC[CAM]SGLLR.2y5_1.heavy 482.262 / 545.341 2693.0 25.103149890899658 42 18 8 6 10 9.488807207316762 10.538732404942383 0.03380012512207031 3 0.9881520833277803 11.326915206326547 2693.0 4.638472994663838 0.0 - - - - - - - 719.2222222222222 5 9 ARSA arylsulfatase A 795 102 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20804.[MT7]-GGC[CAM]SGLLR.2b6_1.heavy 482.262 / 676.32 3418.0 25.103149890899658 42 18 8 6 10 9.488807207316762 10.538732404942383 0.03380012512207031 3 0.9881520833277803 11.326915206326547 3418.0 12.350843797596887 0.0 - - - - - - - 264.42105263157896 6 19 ARSA arylsulfatase A 797 102 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20804.[MT7]-GGC[CAM]SGLLR.2b5_1.heavy 482.262 / 563.236 3780.0 25.103149890899658 42 18 8 6 10 9.488807207316762 10.538732404942383 0.03380012512207031 3 0.9881520833277803 11.326915206326547 3780.0 8.080473438956197 0.0 - - - - - - - 657.1538461538462 7 13 ARSA arylsulfatase A 799 102 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20804.[MT7]-GGC[CAM]SGLLR.2y7_1.heavy 482.262 / 762.393 1864.0 25.103149890899658 42 18 8 6 10 9.488807207316762 10.538732404942383 0.03380012512207031 3 0.9881520833277803 11.326915206326547 1864.0 8.746485423954688 1.0 - - - - - - - 235.6 10 20 ARSA arylsulfatase A 801 103 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543643.[MT7]-AEDEQEEGQPVR.3y6_1.heavy 510.91 / 685.363 6746.0 18.426549911499023 39 13 10 6 10 2.5671668940348518 38.953447176482015 0.03350067138671875 3 0.9147768788677547 4.197106310086783 6746.0 42.05036427806138 0.0 - - - - - - - 182.66666666666666 13 21 IRAK2 interleukin-1 receptor-associated kinase 2 803 103 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543643.[MT7]-AEDEQEEGQPVR.3b4_1.heavy 510.91 / 589.259 8479.0 18.426549911499023 39 13 10 6 10 2.5671668940348518 38.953447176482015 0.03350067138671875 3 0.9147768788677547 4.197106310086783 8479.0 40.165650206255755 0.0 - - - - - - - 241.3181818181818 16 22 IRAK2 interleukin-1 receptor-associated kinase 2 805 103 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543643.[MT7]-AEDEQEEGQPVR.3b5_1.heavy 510.91 / 717.317 3834.0 18.426549911499023 39 13 10 6 10 2.5671668940348518 38.953447176482015 0.03350067138671875 3 0.9147768788677547 4.197106310086783 3834.0 32.44153846153846 0.0 - - - - - - - 151.42105263157896 7 19 IRAK2 interleukin-1 receptor-associated kinase 2 807 103 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543643.[MT7]-AEDEQEEGQPVR.3y5_1.heavy 510.91 / 556.32 22304.0 18.426549911499023 39 13 10 6 10 2.5671668940348518 38.953447176482015 0.03350067138671875 3 0.9147768788677547 4.197106310086783 22304.0 47.26923532768017 0.0 - - - - - - - 325.2352941176471 44 17 IRAK2 interleukin-1 receptor-associated kinase 2 809 104 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20808.[MT7]-SLDFGMR.2y4_1.heavy 485.251 / 510.249 22503.0 33.2239990234375 50 20 10 10 10 7.666512922374917 13.043739834853394 0.0 3 0.9981939149472319 29.03540475553018 22503.0 44.158670196736836 0.0 - - - - - - - 704.9 45 10 SHC4 SHC (Src homology 2 domain containing) family, member 4 811 104 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20808.[MT7]-SLDFGMR.2b4_1.heavy 485.251 / 607.321 N/A 33.2239990234375 50 20 10 10 10 7.666512922374917 13.043739834853394 0.0 3 0.9981939149472319 29.03540475553018 15738.0 40.07594517491434 1.0 - - - - - - - 224.73684210526315 42 19 SHC4 SHC (Src homology 2 domain containing) family, member 4 813 104 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20808.[MT7]-SLDFGMR.2y6_1.heavy 485.251 / 738.36 3774.0 33.2239990234375 50 20 10 10 10 7.666512922374917 13.043739834853394 0.0 3 0.9981939149472319 29.03540475553018 3774.0 12.34485981308411 1.0 - - - - - - - 210.1904761904762 7 21 SHC4 SHC (Src homology 2 domain containing) family, member 4 815 104 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20808.[MT7]-SLDFGMR.2b5_1.heavy 485.251 / 664.342 5554.0 33.2239990234375 50 20 10 10 10 7.666512922374917 13.043739834853394 0.0 3 0.9981939149472319 29.03540475553018 5554.0 16.117511663052763 0.0 - - - - - - - 284.6666666666667 11 21 SHC4 SHC (Src homology 2 domain containing) family, member 4 817 105 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 403754.0 23.715200424194336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 403754.0 436.45277327572956 0.0 - - - - - - - 742.6 807 5 819 105 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 628892.0 23.715200424194336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 628892.0 2632.516322285769 0.0 - - - - - - - 670.3333333333334 1257 3 821 105 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 1894770.0 23.715200424194336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1894770.0 1053.111138519776 0.0 - - - - - - - 2294.5 3789 2 823 106 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20949.[MT7]-AAESLLVK[MT7].2y5_1.heavy 559.855 / 703.483 5135.0 30.928633371988933 32 18 2 6 6 7.5973163210373205 13.16254263668019 0.03070068359375 5 0.9893405269030109 11.942849665669637 5135.0 23.648026315789473 1.0 - - - - - - - 171.0 24 21 SHC4 SHC (Src homology 2 domain containing) family, member 4 825 106 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20949.[MT7]-AAESLLVK[MT7].2b6_1.heavy 559.855 / 729.426 5649.0 30.928633371988933 32 18 2 6 6 7.5973163210373205 13.16254263668019 0.03070068359375 5 0.9893405269030109 11.942849665669637 5649.0 18.86606256206554 0.0 - - - - - - - 717.5714285714286 11 7 SHC4 SHC (Src homology 2 domain containing) family, member 4 827 106 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20949.[MT7]-AAESLLVK[MT7].2y6_1.heavy 559.855 / 832.526 1598.0 30.928633371988933 32 18 2 6 6 7.5973163210373205 13.16254263668019 0.03070068359375 5 0.9893405269030109 11.942849665669637 1598.0 3.424912280701754 3.0 - - - - - - - 171.0 3 21 SHC4 SHC (Src homology 2 domain containing) family, member 4 829 106 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20949.[MT7]-AAESLLVK[MT7].2y7_1.heavy 559.855 / 903.563 N/A 30.928633371988933 32 18 2 6 6 7.5973163210373205 13.16254263668019 0.03070068359375 5 0.9893405269030109 11.942849665669637 3880.0 36.87134502923976 0.0 - - - - - - - 154.375 7 24 SHC4 SHC (Src homology 2 domain containing) family, member 4 831 107 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21103.[MT7]-TLLWTELFR.2y8_1.heavy 661.883 / 1077.61 56991.0 49.894500732421875 50 20 10 10 10 6.99363203187633 14.298721972246927 0.0 3 0.992606819817951 14.344281282896173 56991.0 281.8849290500591 0.0 - - - - - - - 137.66666666666666 113 12 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 833 107 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21103.[MT7]-TLLWTELFR.2y5_1.heavy 661.883 / 665.362 36239.0 49.894500732421875 50 20 10 10 10 6.99363203187633 14.298721972246927 0.0 3 0.992606819817951 14.344281282896173 36239.0 336.672 0.0 - - - - - - - 163.41666666666666 72 12 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 835 107 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21103.[MT7]-TLLWTELFR.2y6_1.heavy 661.883 / 851.441 72374.0 49.894500732421875 50 20 10 10 10 6.99363203187633 14.298721972246927 0.0 3 0.992606819817951 14.344281282896173 72374.0 596.1127311827956 0.0 - - - - - - - 176.41666666666666 144 12 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 837 107 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21103.[MT7]-TLLWTELFR.2y7_1.heavy 661.883 / 964.525 52035.0 49.894500732421875 50 20 10 10 10 6.99363203187633 14.298721972246927 0.0 3 0.992606819817951 14.344281282896173 52035.0 301.26690547636906 0.0 - - - - - - - 195.42857142857142 104 14 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 839 108 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21007.[MT7]-AC[CAM]GVDFEIR.2y4_1.heavy 605.804 / 564.314 10639.0 33.192501068115234 46 16 10 10 10 1.852177225029827 36.37184722337621 0.0 3 0.9600762439338006 6.155893398947073 10639.0 20.63885871109848 0.0 - - - - - - - 261.4736842105263 21 19 ARRB2 arrestin, beta 2 841 108 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21007.[MT7]-AC[CAM]GVDFEIR.2y8_1.heavy 605.804 / 995.461 12625.0 33.192501068115234 46 16 10 10 10 1.852177225029827 36.37184722337621 0.0 3 0.9600762439338006 6.155893398947073 12625.0 36.26805448882062 0.0 - - - - - - - 205.47368421052633 25 19 ARRB2 arrestin, beta 2 843 108 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21007.[MT7]-AC[CAM]GVDFEIR.2b5_1.heavy 605.804 / 647.294 9291.0 33.192501068115234 46 16 10 10 10 1.852177225029827 36.37184722337621 0.0 3 0.9600762439338006 6.155893398947073 9291.0 32.40783515910277 0.0 - - - - - - - 235.54545454545453 18 22 ARRB2 arrestin, beta 2 845 108 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21007.[MT7]-AC[CAM]GVDFEIR.2y7_1.heavy 605.804 / 835.431 2908.0 33.192501068115234 46 16 10 10 10 1.852177225029827 36.37184722337621 0.0 3 0.9600762439338006 6.155893398947073 2908.0 12.814473536810162 0.0 - - - - - - - 185.33333333333334 11 18 ARRB2 arrestin, beta 2 847 109 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21101.[MT7]-IFEGTNDILR.2y4_1.heavy 661.365 / 516.314 2431.0 37.593149185180664 30 7 10 5 8 0.46377862540077697 97.81928790140756 0.045497894287109375 4 0.7249692011033706 2.297070254866228 2431.0 5.083841442206771 2.0 - - - - - - - 364.77777777777777 5 9 ACADVL acyl-CoA dehydrogenase, very long chain 849 109 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21101.[MT7]-IFEGTNDILR.2b3_1.heavy 661.365 / 534.304 7049.0 37.593149185180664 30 7 10 5 8 0.46377862540077697 97.81928790140756 0.045497894287109375 4 0.7249692011033706 2.297070254866228 7049.0 9.714675449953036 0.0 - - - - - - - 376.8 14 10 ACADVL acyl-CoA dehydrogenase, very long chain 851 109 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21101.[MT7]-IFEGTNDILR.2b5_1.heavy 661.365 / 692.374 2431.0 37.593149185180664 30 7 10 5 8 0.46377862540077697 97.81928790140756 0.045497894287109375 4 0.7249692011033706 2.297070254866228 2431.0 15.330963977676308 1.0 - - - - - - - 213.0 4 8 ACADVL acyl-CoA dehydrogenase, very long chain 853 109 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21101.[MT7]-IFEGTNDILR.2y7_1.heavy 661.365 / 788.426 9237.0 37.593149185180664 30 7 10 5 8 0.46377862540077697 97.81928790140756 0.045497894287109375 4 0.7249692011033706 2.297070254866228 9237.0 28.192906513970108 0.0 - - - - - - - 287.3636363636364 18 11 ACADVL acyl-CoA dehydrogenase, very long chain 855 110 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21005.[MT7]-NIAC[CAM]WFPR.2y5_1.heavy 604.312 / 765.35 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL5RA interleukin 5 receptor, alpha 857 110 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21005.[MT7]-NIAC[CAM]WFPR.2b4_1.heavy 604.312 / 603.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL5RA interleukin 5 receptor, alpha 859 110 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21005.[MT7]-NIAC[CAM]WFPR.2y6_1.heavy 604.312 / 836.387 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL5RA interleukin 5 receptor, alpha 861 110 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21005.[MT7]-NIAC[CAM]WFPR.2y7_1.heavy 604.312 / 949.471 N/A N/A - - - - - - - - - 0.0 - - - - - - - IL5RA interleukin 5 receptor, alpha 863 111 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584784.[MT7]-SLHSSAVAATYK[MT7].3b6_2.heavy 508.287 / 364.196 28729.0 23.35449981689453 43 13 10 10 10 1.419623710590619 47.814042859785744 0.0 3 0.9218120742647588 4.384512867459303 28729.0 31.792497962888213 0.0 - - - - - - - 734.8888888888889 57 9 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 865 111 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584784.[MT7]-SLHSSAVAATYK[MT7].3y3_1.heavy 508.287 / 555.326 22771.0 23.35449981689453 43 13 10 10 10 1.419623710590619 47.814042859785744 0.0 3 0.9218120742647588 4.384512867459303 22771.0 16.50072463768116 0.0 - - - - - - - 774.2222222222222 45 9 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 867 111 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584784.[MT7]-SLHSSAVAATYK[MT7].3y4_1.heavy 508.287 / 626.363 17116.0 23.35449981689453 43 13 10 10 10 1.419623710590619 47.814042859785744 0.0 3 0.9218120742647588 4.384512867459303 17116.0 48.49448661140204 0.0 - - - - - - - 277.4 34 10 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 869 111 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584784.[MT7]-SLHSSAVAATYK[MT7].3y5_1.heavy 508.287 / 697.4 14693.0 23.35449981689453 43 13 10 10 10 1.419623710590619 47.814042859785744 0.0 3 0.9218120742647588 4.384512867459303 14693.0 13.69333208542093 0.0 - - - - - - - 723.4444444444445 29 9 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 871 112 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584791.[MT7]-RWFWSIVEK[MT7].3y3_1.heavy 513.629 / 519.326 33428.0 41.69272422790527 42 16 10 6 10 9.239471230498923 10.823130188436128 0.03530120849609375 3 0.9632280543997576 6.415997416417375 33428.0 91.37561811698419 0.0 - - - - - - - 646.875 66 8 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 873 112 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584791.[MT7]-RWFWSIVEK[MT7].3b5_1.heavy 513.629 / 907.469 3773.0 41.69272422790527 42 16 10 6 10 9.239471230498923 10.823130188436128 0.03530120849609375 3 0.9632280543997576 6.415997416417375 3773.0 45.701326520912545 0.0 - - - - - - - 117.0 7 6 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 875 112 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584791.[MT7]-RWFWSIVEK[MT7].3y4_1.heavy 513.629 / 632.41 5440.0 41.69272422790527 42 16 10 6 10 9.239471230498923 10.823130188436128 0.03530120849609375 3 0.9632280543997576 6.415997416417375 5440.0 8.505537459283389 0.0 - - - - - - - 245.6 10 15 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 877 112 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584791.[MT7]-RWFWSIVEK[MT7].3y5_1.heavy 513.629 / 719.442 4738.0 41.69272422790527 42 16 10 6 10 9.239471230498923 10.823130188436128 0.03530120849609375 3 0.9632280543997576 6.415997416417375 4738.0 17.73599904672148 0.0 - - - - - - - 233.83333333333334 9 12 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 879 113 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20956.[MT7]-FRGEHALR.2b4_1.heavy 565.321 / 634.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 881 113 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20956.[MT7]-FRGEHALR.2y6_1.heavy 565.321 / 682.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 883 113 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20956.[MT7]-FRGEHALR.2b7_1.heavy 565.321 / 955.523 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 885 113 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20956.[MT7]-FRGEHALR.2b5_1.heavy 565.321 / 771.402 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 887 114 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20974.[MT7]-YSQIC[CAM]AK[MT7].2y4_1.heavy 579.315 / 635.367 1128.0 23.731650352478027 42 16 10 6 10 3.0752434501304045 32.51775074775284 0.03289985656738281 3 0.9692354265788278 7.018061672446228 1128.0 2.013649025069638 1.0 - - - - - - - 164.05 2 20 ATP5E ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit 889 114 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20974.[MT7]-YSQIC[CAM]AK[MT7].2b3_1.heavy 579.315 / 523.263 1641.0 23.731650352478027 42 16 10 6 10 3.0752434501304045 32.51775074775284 0.03289985656738281 3 0.9692354265788278 7.018061672446228 1641.0 6.1742360214688485 0.0 - - - - - - - 207.52380952380952 3 21 ATP5E ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit 891 114 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20974.[MT7]-YSQIC[CAM]AK[MT7].2y3_1.heavy 579.315 / 522.283 2769.0 23.731650352478027 42 16 10 6 10 3.0752434501304045 32.51775074775284 0.03289985656738281 3 0.9692354265788278 7.018061672446228 2769.0 4.727560975609756 0.0 - - - - - - - 680.5454545454545 5 11 ATP5E ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit 893 114 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20974.[MT7]-YSQIC[CAM]AK[MT7].2y6_1.heavy 579.315 / 850.457 3077.0 23.731650352478027 42 16 10 6 10 3.0752434501304045 32.51775074775284 0.03289985656738281 3 0.9692354265788278 7.018061672446228 3077.0 20.184017721036582 0.0 - - - - - - - 126.4 6 15 ATP5E ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit 895 115 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20950.[MT7]-ETVNNQK[MT7].2y4_1.heavy 560.814 / 647.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAK3 p21 protein (Cdc42/Rac)-activated kinase 3 897 115 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20950.[MT7]-ETVNNQK[MT7].2b6_1.heavy 560.814 / 830.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAK3 p21 protein (Cdc42/Rac)-activated kinase 3 899 115 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20950.[MT7]-ETVNNQK[MT7].2y3_1.heavy 560.814 / 533.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAK3 p21 protein (Cdc42/Rac)-activated kinase 3 901 115 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20950.[MT7]-ETVNNQK[MT7].2y6_1.heavy 560.814 / 847.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAK3 p21 protein (Cdc42/Rac)-activated kinase 3 903 116 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20952.[MT7]-DRDRDFR.2b3_1.heavy 562.29 / 531.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 905 116 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20952.[MT7]-DRDRDFR.2y3_1.heavy 562.29 / 437.214 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 907 116 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20952.[MT7]-DRDRDFR.2b6_1.heavy 562.29 / 949.461 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 909 117 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20972.[MT7]-DSPPAGSPAGR.2y8_1.heavy 578.297 / 712.374 5709.0 17.312700271606445 43 17 10 6 10 2.5063229893505086 31.96216417246013 0.032199859619140625 3 0.9716680605023837 7.314648847553807 5709.0 11.324224120824606 0.0 - - - - - - - 0.0 11 0 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 911 117 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20972.[MT7]-DSPPAGSPAGR.2y9_1.heavy 578.297 / 809.426 6280.0 17.312700271606445 43 17 10 6 10 2.5063229893505086 31.96216417246013 0.032199859619140625 3 0.9716680605023837 7.314648847553807 6280.0 17.311619699655644 0.0 - - - - - - - 0.0 12 0 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 913 117 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20972.[MT7]-DSPPAGSPAGR.2y6_1.heavy 578.297 / 544.284 1612.0 17.312700271606445 43 17 10 6 10 2.5063229893505086 31.96216417246013 0.032199859619140625 3 0.9716680605023837 7.314648847553807 1612.0 0.35545755237045196 2.0 - - - - - - - 0.0 3 0 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 915 117 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20972.[MT7]-DSPPAGSPAGR.2y10_1.heavy 578.297 / 896.458 5507.0 17.312700271606445 43 17 10 6 10 2.5063229893505086 31.96216417246013 0.032199859619140625 3 0.9716680605023837 7.314648847553807 5507.0 7.112021545990209 0.0 - - - - - - - 0.0 11 0 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 917 118 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540150.[MT7]-LLLAIK[MT7].2b3_1.heavy 479.849 / 484.362 12978.0 39.01959991455078 50 20 10 10 10 7.4235948505022336 13.470562714401721 0.0 3 0.9962032203416776 20.022447653636124 12978.0 39.0726288098129 1.0 - - - - - - - 324.3333333333333 28 9 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 919 118 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540150.[MT7]-LLLAIK[MT7].2y4_1.heavy 479.849 / 588.42 20224.0 39.01959991455078 50 20 10 10 10 7.4235948505022336 13.470562714401721 0.0 3 0.9962032203416776 20.022447653636124 20224.0 34.41999450743716 0.0 - - - - - - - 252.16666666666666 40 12 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 921 118 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540150.[MT7]-LLLAIK[MT7].2y5_1.heavy 479.849 / 701.504 18277.0 39.01959991455078 50 20 10 10 10 7.4235948505022336 13.470562714401721 0.0 3 0.9962032203416776 20.022447653636124 18277.0 29.071926022857646 0.0 - - - - - - - 288.22222222222223 36 9 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 923 118 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540150.[MT7]-LLLAIK[MT7].2b4_1.heavy 479.849 / 555.399 7895.0 39.01959991455078 50 20 10 10 10 7.4235948505022336 13.470562714401721 0.0 3 0.9962032203416776 20.022447653636124 7895.0 23.349353049907577 0.0 - - - - - - - 273.8666666666667 15 15 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 925 119 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544918.[MT7]-SVGDGETVEFDVVEGEK[MT7].3b6_1.heavy 695.347 / 689.322 5648.0 35.270301818847656 43 13 10 10 10 1.7872454767169068 46.89230962433554 0.0 3 0.9250824253588597 4.480444780709824 5648.0 24.397639549427563 0.0 - - - - - - - 760.375 11 8 YBX1;YBX2;CSDA Y box binding protein 1;Y box binding protein 2;cold shock domain protein A 927 119 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544918.[MT7]-SVGDGETVEFDVVEGEK[MT7].3b4_1.heavy 695.347 / 503.258 4670.0 35.270301818847656 43 13 10 10 10 1.7872454767169068 46.89230962433554 0.0 3 0.9250824253588597 4.480444780709824 4670.0 9.308836508449037 0.0 - - - - - - - 713.7142857142857 9 7 YBX1;YBX2;CSDA Y box binding protein 1;Y box binding protein 2;cold shock domain protein A 929 119 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544918.[MT7]-SVGDGETVEFDVVEGEK[MT7].3y4_1.heavy 695.347 / 606.321 14337.0 35.270301818847656 43 13 10 10 10 1.7872454767169068 46.89230962433554 0.0 3 0.9250824253588597 4.480444780709824 14337.0 49.26270126983977 0.0 - - - - - - - 636.1428571428571 28 7 YBX1;YBX2;CSDA Y box binding protein 1;Y box binding protein 2;cold shock domain protein A 931 119 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544918.[MT7]-SVGDGETVEFDVVEGEK[MT7].3y5_1.heavy 695.347 / 705.39 10644.0 35.270301818847656 43 13 10 10 10 1.7872454767169068 46.89230962433554 0.0 3 0.9250824253588597 4.480444780709824 10644.0 104.22890668558973 0.0 - - - - - - - 217.25 21 8 YBX1;YBX2;CSDA Y box binding protein 1;Y box binding protein 2;cold shock domain protein A 933 120 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20815.[MT7]-SSPNC[CAM]K[MT7].2y4_1.heavy 490.757 / 662.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB2 arrestin, beta 2 935 120 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20815.[MT7]-SSPNC[CAM]K[MT7].2y5_1.heavy 490.757 / 749.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB2 arrestin, beta 2 937 120 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20815.[MT7]-SSPNC[CAM]K[MT7].2y3_1.heavy 490.757 / 565.288 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB2 arrestin, beta 2 939 121 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584652.[MT7]-NVNLEYQVK[MT7].2y4_1.heavy 697.898 / 681.405 6200.0 29.30394983291626 44 20 10 6 8 10.231828524096382 9.773424150384836 0.03859901428222656 4 0.9969543898324262 22.357072081039295 6200.0 7.605288388462123 0.0 - - - - - - - 712.1176470588235 12 17 IL5RA interleukin 5 receptor, alpha 941 121 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584652.[MT7]-NVNLEYQVK[MT7].2y5_1.heavy 697.898 / 810.448 4036.0 29.30394983291626 44 20 10 6 8 10.231828524096382 9.773424150384836 0.03859901428222656 4 0.9969543898324262 22.357072081039295 4036.0 13.316247033100655 0.0 - - - - - - - 185.58823529411765 8 17 IL5RA interleukin 5 receptor, alpha 943 121 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584652.[MT7]-NVNLEYQVK[MT7].2b4_1.heavy 697.898 / 585.348 4621.0 29.30394983291626 44 20 10 6 8 10.231828524096382 9.773424150384836 0.03859901428222656 4 0.9969543898324262 22.357072081039295 4621.0 9.613478999567938 2.0 - - - - - - - 706.5833333333334 10 12 IL5RA interleukin 5 receptor, alpha 945 121 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584652.[MT7]-NVNLEYQVK[MT7].2b5_1.heavy 697.898 / 714.39 4212.0 29.30394983291626 44 20 10 6 8 10.231828524096382 9.773424150384836 0.03859901428222656 4 0.9969543898324262 22.357072081039295 4212.0 28.247999999999998 0.0 - - - - - - - 169.3 8 20 IL5RA interleukin 5 receptor, alpha 947 122 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20819.[MT7]-ELHHFR.2y4_1.heavy 491.771 / 596.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 949 122 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20819.[MT7]-ELHHFR.2b3_1.heavy 491.771 / 524.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 951 122 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20819.[MT7]-ELHHFR.2y5_1.heavy 491.771 / 709.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 953 122 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20819.[MT7]-ELHHFR.2y3_1.heavy 491.771 / 459.246 N/A N/A - - - - - - - - - 0.0 - - - - - - - PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 955 123 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585113.[MT7]-NAAGGC[CAM]EREPQSLTR.3y7_1.heavy 597.296 / 830.437 469.0 20.152099609375 43 13 10 10 10 0.9429895588042215 68.72036979116143 0.0 3 0.923560619666281 4.435042145735868 469.0 -0.5 2.0 - - - - - - - 0.0 0 0 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 957 123 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585113.[MT7]-NAAGGC[CAM]EREPQSLTR.3y12_2.heavy 597.296 / 695.331 N/A 20.152099609375 43 13 10 10 10 0.9429895588042215 68.72036979116143 0.0 3 0.923560619666281 4.435042145735868 1578.0 18.379058823529412 1.0 - - - - - - - 136.5 3 10 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 959 123 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585113.[MT7]-NAAGGC[CAM]EREPQSLTR.3y13_2.heavy 597.296 / 730.849 1621.0 20.152099609375 43 13 10 10 10 0.9429895588042215 68.72036979116143 0.0 3 0.923560619666281 4.435042145735868 1621.0 38.554321571772256 0.0 - - - - - - - 182.36363636363637 3 11 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 961 123 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585113.[MT7]-NAAGGC[CAM]EREPQSLTR.3y14_2.heavy 597.296 / 766.368 2218.0 20.152099609375 43 13 10 10 10 0.9429895588042215 68.72036979116143 0.0 3 0.923560619666281 4.435042145735868 2218.0 74.8876902872777 0.0 - - - - - - - 113.77777777777777 4 9 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 963 124 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543435.[MT7]-ELTLLLQQVDR.3b4_1.heavy 491.292 / 601.368 3900.0 44.50630187988281 42 12 10 10 10 2.7408175872189977 29.17514386233959 0.0 3 0.8878410408034756 3.6500605686654772 3900.0 92.5 0.0 - - - - - - - 182.0 7 6 MAP3K11 mitogen-activated protein kinase kinase kinase 11 965 124 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543435.[MT7]-ELTLLLQQVDR.3b5_1.heavy 491.292 / 714.452 6552.0 44.50630187988281 42 12 10 10 10 2.7408175872189977 29.17514386233959 0.0 3 0.8878410408034756 3.6500605686654772 6552.0 33.29454545454546 0.0 - - - - - - - 208.0 13 15 MAP3K11 mitogen-activated protein kinase kinase kinase 11 967 124 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543435.[MT7]-ELTLLLQQVDR.3y4_1.heavy 491.292 / 517.273 9126.0 44.50630187988281 42 12 10 10 10 2.7408175872189977 29.17514386233959 0.0 3 0.8878410408034756 3.6500605686654772 9126.0 32.3505 0.0 - - - - - - - 250.71428571428572 18 14 MAP3K11 mitogen-activated protein kinase kinase kinase 11 969 124 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543435.[MT7]-ELTLLLQQVDR.3y5_1.heavy 491.292 / 645.331 6552.0 44.50630187988281 42 12 10 10 10 2.7408175872189977 29.17514386233959 0.0 3 0.8878410408034756 3.6500605686654772 6552.0 121.38 0.0 - - - - - - - 185.25 13 8 MAP3K11 mitogen-activated protein kinase kinase kinase 11 971 125 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585631.[MT7]-TPDSPPTPAPLLLDLGIPVGQR.3y7_1.heavy 800.12 / 726.426 14003.0 48.59400177001953 47 17 10 10 10 4.670000827550232 21.413272436711225 0.0 3 0.9727104740898013 7.453697350017925 14003.0 62.66005554620433 0.0 - - - - - - - 207.72727272727272 28 11 MAP3K11 mitogen-activated protein kinase kinase kinase 11 973 125 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585631.[MT7]-TPDSPPTPAPLLLDLGIPVGQR.3y8_1.heavy 800.12 / 839.51 4915.0 48.59400177001953 47 17 10 10 10 4.670000827550232 21.413272436711225 0.0 3 0.9727104740898013 7.453697350017925 4915.0 26.17864993211752 0.0 - - - - - - - 241.0 9 14 MAP3K11 mitogen-activated protein kinase kinase kinase 11 975 125 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585631.[MT7]-TPDSPPTPAPLLLDLGIPVGQR.3y5_1.heavy 800.12 / 556.32 19718.0 48.59400177001953 47 17 10 10 10 4.670000827550232 21.413272436711225 0.0 3 0.9727104740898013 7.453697350017925 19718.0 33.66786829931995 1.0 - - - - - - - 321.5 39 8 MAP3K11 mitogen-activated protein kinase kinase kinase 11 977 125 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585631.[MT7]-TPDSPPTPAPLLLDLGIPVGQR.3y9_1.heavy 800.12 / 954.537 7601.0 48.59400177001953 47 17 10 10 10 4.670000827550232 21.413272436711225 0.0 3 0.9727104740898013 7.453697350017925 7601.0 42.92120920144178 1.0 - - - - - - - 276.84615384615387 15 13 MAP3K11 mitogen-activated protein kinase kinase kinase 11 979 126 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 286791.0 33.062201182047524 24 -3 10 7 10 null 0.0 0.02970123291015625 3 0.0 0.0 286791.0 777.8038647469939 0.0 - - - - - - - 730.4285714285714 573 7 981 126 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 271173.0 33.062201182047524 24 -3 10 7 10 null 0.0 0.02970123291015625 3 0.0 0.0 271173.0 544.6992476759312 0.0 - - - - - - - 365.42857142857144 542 7 983 126 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 600194.0 33.062201182047524 24 -3 10 7 10 null 0.0 0.02970123291015625 3 0.0 0.0 600194.0 395.13996052631575 0.0 - - - - - - - 276.0 1200 1 985 127 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20958.[MT7]-GILLFGTK[MT7].2y4_1.heavy 568.868 / 596.352 15131.0 40.238624572753906 44 18 10 6 10 4.828739905116762 20.709336589870013 0.0363006591796875 3 0.9888740538033272 11.689351194652126 15131.0 69.6347197360872 0.0 - - - - - - - 288.72727272727275 30 11 ACADVL acyl-CoA dehydrogenase, very long chain 987 127 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20958.[MT7]-GILLFGTK[MT7].2y5_1.heavy 568.868 / 709.437 11208.0 40.238624572753906 44 18 10 6 10 4.828739905116762 20.709336589870013 0.0363006591796875 3 0.9888740538033272 11.689351194652126 11208.0 134.55791654335601 0.0 - - - - - - - 186.58823529411765 22 17 ACADVL acyl-CoA dehydrogenase, very long chain 989 127 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20958.[MT7]-GILLFGTK[MT7].2b4_1.heavy 568.868 / 541.383 10087.0 40.238624572753906 44 18 10 6 10 4.828739905116762 20.709336589870013 0.0363006591796875 3 0.9888740538033272 11.689351194652126 10087.0 18.509373264612538 0.0 - - - - - - - 643.2222222222222 20 9 ACADVL acyl-CoA dehydrogenase, very long chain 991 127 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20958.[MT7]-GILLFGTK[MT7].2y6_1.heavy 568.868 / 822.521 6444.0 40.238624572753906 44 18 10 6 10 4.828739905116762 20.709336589870013 0.0363006591796875 3 0.9888740538033272 11.689351194652126 6444.0 36.564407944996184 0.0 - - - - - - - 221.6875 12 16 ACADVL acyl-CoA dehydrogenase, very long chain 993 128 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20959.[MT7]-RYPSGEER.2y6_1.heavy 569.292 / 674.31 517.0 16.264150142669678 37 11 10 6 10 1.8892494132486821 52.93107373686768 0.030599594116210938 3 0.8697039350861939 3.381148756771256 517.0 12.756596091205212 1.0 - - - - - - - 0.0 1 0 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 995 128 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20959.[MT7]-RYPSGEER.2b7_1.heavy 569.292 / 963.465 840.0 16.264150142669678 37 11 10 6 10 1.8892494132486821 52.93107373686768 0.030599594116210938 3 0.8697039350861939 3.381148756771256 840.0 3.7962119395828338 1.0 - - - - - - - 0.0 1 0 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 997 128 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20959.[MT7]-RYPSGEER.2b6_1.heavy 569.292 / 834.423 1292.0 16.264150142669678 37 11 10 6 10 1.8892494132486821 52.93107373686768 0.030599594116210938 3 0.8697039350861939 3.381148756771256 1292.0 17.902423417290674 0.0 - - - - - - - 146.6153846153846 2 13 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 999 128 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20959.[MT7]-RYPSGEER.2y7_1.heavy 569.292 / 837.374 1228.0 16.264150142669678 37 11 10 6 10 1.8892494132486821 52.93107373686768 0.030599594116210938 3 0.8697039350861939 3.381148756771256 1228.0 41.89841538461538 0.0 - - - - - - - 62.666666666666664 2 18 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1001 129 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 261674.0 27.45870018005371 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 261674.0 646.9814945384118 0.0 - - - - - - - 1547.0 523 1 1003 129 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 354494.0 27.45870018005371 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 354494.0 1566.8745087317502 0.0 - - - - - - - 1833.0 708 1 1005 129 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 449836.0 27.45870018005371 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 449836.0 955.3339113065782 0.0 - - - - - - - 2636.0 899 1 1007 130 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543620.[MT7]-REIQGLFDELR.3y7_1.heavy 507.283 / 849.446 5174.0 38.648799896240234 44 14 10 10 10 1.231315068281405 49.01684882982465 0.0 3 0.946807600967861 5.327131655820887 5174.0 91.42273214285714 0.0 - - - - - - - 224.57142857142858 10 7 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1009 130 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543620.[MT7]-REIQGLFDELR.3b5_1.heavy 507.283 / 728.417 7198.0 38.648799896240234 44 14 10 10 10 1.231315068281405 49.01684882982465 0.0 3 0.946807600967861 5.327131655820887 7198.0 31.43352925647064 0.0 - - - - - - - 213.5 14 10 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1011 130 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543620.[MT7]-REIQGLFDELR.3y4_1.heavy 507.283 / 532.273 14621.0 38.648799896240234 44 14 10 10 10 1.231315068281405 49.01684882982465 0.0 3 0.946807600967861 5.327131655820887 14621.0 25.32913978821503 0.0 - - - - - - - 674.7 29 10 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1013 130 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543620.[MT7]-REIQGLFDELR.3y5_1.heavy 507.283 / 679.341 12484.0 38.648799896240234 44 14 10 10 10 1.231315068281405 49.01684882982465 0.0 3 0.946807600967861 5.327131655820887 12484.0 35.49154962962963 0.0 - - - - - - - 289.14285714285717 24 7 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1015 131 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540681.[MT7]-GSSSGTPK[MT7].2y5_1.heavy 504.782 / 633.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 1017 131 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540681.[MT7]-GSSSGTPK[MT7].2b6_1.heavy 504.782 / 621.296 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 1019 131 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540681.[MT7]-GSSSGTPK[MT7].2b5_1.heavy 504.782 / 520.248 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 1021 131 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540681.[MT7]-GSSSGTPK[MT7].2y7_1.heavy 504.782 / 807.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 1023 132 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20753.[MT7]-FQDAVR.2b3_1.heavy 440.244 / 535.263 11281.0 24.51759958267212 46 20 10 6 10 6.177797452031947 16.18699880927771 0.030801773071289062 3 0.9937963901539613 15.66085106917401 11281.0 40.866313853049974 0.0 - - - - - - - 743.4285714285714 22 14 PFKP phosphofructokinase, platelet 1025 132 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20753.[MT7]-FQDAVR.2y5_1.heavy 440.244 / 588.31 7623.0 24.51759958267212 46 20 10 6 10 6.177797452031947 16.18699880927771 0.030801773071289062 3 0.9937963901539613 15.66085106917401 7623.0 8.421199025511642 0.0 - - - - - - - 1222.1818181818182 15 11 PFKP phosphofructokinase, platelet 1027 132 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20753.[MT7]-FQDAVR.2b4_1.heavy 440.244 / 606.3 5306.0 24.51759958267212 46 20 10 6 10 6.177797452031947 16.18699880927771 0.030801773071289062 3 0.9937963901539613 15.66085106917401 5306.0 16.801284589186885 0.0 - - - - - - - 726.3 10 10 PFKP phosphofructokinase, platelet 1029 132 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20753.[MT7]-FQDAVR.2y3_1.heavy 440.244 / 345.224 11023.0 24.51759958267212 46 20 10 6 10 6.177797452031947 16.18699880927771 0.030801773071289062 3 0.9937963901539613 15.66085106917401 11023.0 19.852592421441777 0.0 - - - - - - - 1096.4285714285713 22 7 PFKP phosphofructokinase, platelet 1031 133 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21298.[MT7]-SDNILLGMDGSVK[MT7].2y8_1.heavy 818.945 / 950.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAK1;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 3 1033 133 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21298.[MT7]-SDNILLGMDGSVK[MT7].2y9_1.heavy 818.945 / 1063.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAK1;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 3 1035 133 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21298.[MT7]-SDNILLGMDGSVK[MT7].2b4_1.heavy 818.945 / 574.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAK1;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 3 1037 133 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21298.[MT7]-SDNILLGMDGSVK[MT7].2b5_1.heavy 818.945 / 687.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAK1;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 3 1039 134 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21295.[MT7]-ISLLPPVNFTIK[MT7].2y8_1.heavy 815.513 / 1059.63 54001.0 46.11740016937256 38 12 10 6 10 0.810505445486292 76.83201713648498 0.038799285888671875 3 0.8964590299424436 3.801769204284102 54001.0 32.963696930602296 0.0 - - - - - - - 269.0 108 1 IL5RA interleukin 5 receptor, alpha 1041 134 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21295.[MT7]-ISLLPPVNFTIK[MT7].2b4_1.heavy 815.513 / 571.394 34003.0 46.11740016937256 38 12 10 6 10 0.810505445486292 76.83201713648498 0.038799285888671875 3 0.8964590299424436 3.801769204284102 34003.0 29.38637300627835 0.0 - - - - - - - 202.0 68 1 IL5RA interleukin 5 receptor, alpha 1043 134 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21295.[MT7]-ISLLPPVNFTIK[MT7].2y3_1.heavy 815.513 / 505.347 2020.0 46.11740016937256 38 12 10 6 10 0.810505445486292 76.83201713648498 0.038799285888671875 3 0.8964590299424436 3.801769204284102 2020.0 6.574480712166172 0.0 - - - - - - - 255.9 4 20 IL5RA interleukin 5 receptor, alpha 1045 134 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21295.[MT7]-ISLLPPVNFTIK[MT7].2y7_1.heavy 815.513 / 962.579 4646.0 46.11740016937256 38 12 10 6 10 0.810505445486292 76.83201713648498 0.038799285888671875 3 0.8964590299424436 3.801769204284102 4646.0 13.607456902414308 0.0 - - - - - - - 259.0 9 13 IL5RA interleukin 5 receptor, alpha 1047 135 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21294.[MT7]-ISLLPPVNFTIK[MT7].3y3_1.heavy 544.011 / 505.347 19707.0 46.11740016937256 42 16 10 6 10 3.5395580649829164 28.25211457591462 0.038799285888671875 3 0.9652576688420283 6.601877153429222 19707.0 16.82096875279792 0.0 - - - - - - - 386.3333333333333 39 6 IL5RA interleukin 5 receptor, alpha 1049 135 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21294.[MT7]-ISLLPPVNFTIK[MT7].3b4_1.heavy 544.011 / 571.394 31709.0 46.11740016937256 42 16 10 6 10 3.5395580649829164 28.25211457591462 0.038799285888671875 3 0.9652576688420283 6.601877153429222 31709.0 22.09629430430087 0.0 - - - - - - - 181.66666666666666 63 3 IL5RA interleukin 5 receptor, alpha 1051 135 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21294.[MT7]-ISLLPPVNFTIK[MT7].3y4_1.heavy 544.011 / 652.415 7910.0 46.11740016937256 42 16 10 6 10 3.5395580649829164 28.25211457591462 0.038799285888671875 3 0.9652576688420283 6.601877153429222 7910.0 15.90881142074217 0.0 - - - - - - - 227.55555555555554 15 9 IL5RA interleukin 5 receptor, alpha 1053 135 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21294.[MT7]-ISLLPPVNFTIK[MT7].3y5_1.heavy 544.011 / 766.458 10024.0 46.11740016937256 42 16 10 6 10 3.5395580649829164 28.25211457591462 0.038799285888671875 3 0.9652576688420283 6.601877153429222 10024.0 35.26869770199718 0.0 - - - - - - - 190.9 20 10 IL5RA interleukin 5 receptor, alpha 1055 136 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542647.[MT7]-ELSGLGSALK[MT7].3b6_1.heavy 421.59 / 701.395 15306.0 33.87934970855713 38 12 10 6 10 2.237266133807067 44.69740925717852 0.033802032470703125 3 0.89744884983121 3.820399961684926 15306.0 41.949662476929035 0.0 - - - - - - - 211.0909090909091 30 11 ACADVL acyl-CoA dehydrogenase, very long chain 1057 136 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542647.[MT7]-ELSGLGSALK[MT7].3y3_1.heavy 421.59 / 475.336 32053.0 33.87934970855713 38 12 10 6 10 2.237266133807067 44.69740925717852 0.033802032470703125 3 0.89744884983121 3.820399961684926 32053.0 28.69346238689056 0.0 - - - - - - - 176.2 64 5 ACADVL acyl-CoA dehydrogenase, very long chain 1059 136 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542647.[MT7]-ELSGLGSALK[MT7].3b4_1.heavy 421.59 / 531.289 34217.0 33.87934970855713 38 12 10 6 10 2.237266133807067 44.69740925717852 0.033802032470703125 3 0.89744884983121 3.820399961684926 34217.0 91.59611528582867 0.0 - - - - - - - 326.84615384615387 68 13 ACADVL acyl-CoA dehydrogenase, very long chain 1061 136 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542647.[MT7]-ELSGLGSALK[MT7].3b5_1.heavy 421.59 / 644.374 18671.0 33.87934970855713 38 12 10 6 10 2.237266133807067 44.69740925717852 0.033802032470703125 3 0.89744884983121 3.820399961684926 18671.0 83.80168855127509 0.0 - - - - - - - 200.16666666666666 37 12 ACADVL acyl-CoA dehydrogenase, very long chain 1063 137 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21418.[MT7]-DFSHPNVLSLLGIC[CAM]LR.3y6_1.heavy 662.363 / 731.423 9755.0 49.28110122680664 47 17 10 10 10 3.3373854858829044 29.963574907063823 0.0 3 0.9747243150352741 7.746256556016191 9755.0 67.38516771488469 0.0 - - - - - - - 222.6 19 10 MET met proto-oncogene (hepatocyte growth factor receptor) 1065 137 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21418.[MT7]-DFSHPNVLSLLGIC[CAM]LR.3y8_1.heavy 662.363 / 931.539 14314.0 49.28110122680664 47 17 10 10 10 3.3373854858829044 29.963574907063823 0.0 3 0.9747243150352741 7.746256556016191 14314.0 116.49255345911949 0.0 - - - - - - - 231.875 28 8 MET met proto-oncogene (hepatocyte growth factor receptor) 1067 137 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21418.[MT7]-DFSHPNVLSLLGIC[CAM]LR.3y5_1.heavy 662.363 / 618.339 13837.0 49.28110122680664 47 17 10 10 10 3.3373854858829044 29.963574907063823 0.0 3 0.9747243150352741 7.746256556016191 13837.0 13.6718385662807 0.0 - - - - - - - 377.625 27 8 MET met proto-oncogene (hepatocyte growth factor receptor) 1069 137 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21418.[MT7]-DFSHPNVLSLLGIC[CAM]LR.3y9_1.heavy 662.363 / 1044.62 9861.0 49.28110122680664 47 17 10 10 10 3.3373854858829044 29.963574907063823 0.0 3 0.9747243150352741 7.746256556016191 9861.0 39.97045561749571 0.0 - - - - - - - 287.0833333333333 19 12 MET met proto-oncogene (hepatocyte growth factor receptor) 1071 138 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21559.[MT7]-DPGENYNLLGGVAGATPEVLQALK[MT7].4b8_1.heavy 679.371 / 1047.49 8625.0 46.96439838409424 40 14 10 6 10 1.7906894807749634 47.601536236031464 0.033199310302734375 3 0.9354634027714684 4.831650857508058 8625.0 40.16007160354249 0.0 - - - - - - - 180.84615384615384 17 13 ARSA arylsulfatase A 1073 138 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21559.[MT7]-DPGENYNLLGGVAGATPEVLQALK[MT7].4y8_1.heavy 679.371 / 1041.64 11239.0 46.96439838409424 40 14 10 6 10 1.7906894807749634 47.601536236031464 0.033199310302734375 3 0.9354634027714684 4.831650857508058 11239.0 38.06373071477395 0.0 - - - - - - - 662.7142857142857 22 7 ARSA arylsulfatase A 1075 138 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21559.[MT7]-DPGENYNLLGGVAGATPEVLQALK[MT7].4b7_1.heavy 679.371 / 934.402 11696.0 46.96439838409424 40 14 10 6 10 1.7906894807749634 47.601536236031464 0.033199310302734375 3 0.9354634027714684 4.831650857508058 11696.0 105.61617911929122 0.0 - - - - - - - 180.92307692307693 23 13 ARSA arylsulfatase A 1077 138 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21559.[MT7]-DPGENYNLLGGVAGATPEVLQALK[MT7].4b5_1.heavy 679.371 / 657.296 7906.0 46.96439838409424 40 14 10 6 10 1.7906894807749634 47.601536236031464 0.033199310302734375 3 0.9354634027714684 4.831650857508058 7906.0 46.700816687098865 0.0 - - - - - - - 206.0 15 13 ARSA arylsulfatase A 1079 139 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543230.[MT7]-GIVNEQFLLQR.2y8_1.heavy 730.921 / 1047.56 12459.0 37.98030090332031 48 18 10 10 10 3.2011810214615064 31.23847084234704 0.0 3 0.9830103314167483 9.454816737369946 12459.0 123.0139859580519 0.0 - - - - - - - 174.33333333333334 24 6 ACADVL acyl-CoA dehydrogenase, very long chain 1081 139 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543230.[MT7]-GIVNEQFLLQR.2y9_1.heavy 730.921 / 1146.63 N/A 37.98030090332031 48 18 10 10 10 3.2011810214615064 31.23847084234704 0.0 3 0.9830103314167483 9.454816737369946 8151.0 12.734202051954803 1.0 - - - - - - - 222.27272727272728 21 11 ACADVL acyl-CoA dehydrogenase, very long chain 1083 139 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543230.[MT7]-GIVNEQFLLQR.2b6_1.heavy 730.921 / 785.427 2911.0 37.98030090332031 48 18 10 10 10 3.2011810214615064 31.23847084234704 0.0 3 0.9830103314167483 9.454816737369946 2911.0 0.7690885072655216 0.0 - - - - - - - 268.53846153846155 5 13 ACADVL acyl-CoA dehydrogenase, very long chain 1085 139 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543230.[MT7]-GIVNEQFLLQR.2y7_1.heavy 730.921 / 933.515 6986.0 37.98030090332031 48 18 10 10 10 3.2011810214615064 31.23847084234704 0.0 3 0.9830103314167483 9.454816737369946 6986.0 23.914101110468902 0.0 - - - - - - - 268.46153846153845 13 13 ACADVL acyl-CoA dehydrogenase, very long chain 1087 140 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20854.[MT7]-C[CAM]GETQK[MT7].2y5_1.heavy 505.763 / 706.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3GLB1 SH3-domain GRB2-like endophilin B1 1089 140 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20854.[MT7]-C[CAM]GETQK[MT7].2b4_1.heavy 505.763 / 592.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3GLB1 SH3-domain GRB2-like endophilin B1 1091 140 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20854.[MT7]-C[CAM]GETQK[MT7].2y3_1.heavy 505.763 / 520.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3GLB1 SH3-domain GRB2-like endophilin B1 1093 140 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20854.[MT7]-C[CAM]GETQK[MT7].2b5_1.heavy 505.763 / 720.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3GLB1 SH3-domain GRB2-like endophilin B1 1095 141 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585552.[MT7]-EAGLWSEWSQPIYVGFSR.3y6_1.heavy 752.712 / 728.373 10249.0 48.05065155029297 46 20 10 6 10 5.445180500628296 18.364864119465174 0.03350067138671875 3 0.9950298597254005 17.498386591368323 10249.0 41.67568935427574 0.0 - - - - - - - 228.52941176470588 20 17 IL5RA interleukin 5 receptor, alpha 1097 141 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585552.[MT7]-EAGLWSEWSQPIYVGFSR.3b4_1.heavy 752.712 / 515.295 14642.0 48.05065155029297 46 20 10 6 10 5.445180500628296 18.364864119465174 0.03350067138671875 3 0.9950298597254005 17.498386591368323 14642.0 38.778729318549814 0.0 - - - - - - - 600.2857142857143 29 7 IL5RA interleukin 5 receptor, alpha 1099 141 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585552.[MT7]-EAGLWSEWSQPIYVGFSR.3y8_1.heavy 752.712 / 938.509 27310.0 48.05065155029297 46 20 10 6 10 5.445180500628296 18.364864119465174 0.03350067138671875 3 0.9950298597254005 17.498386591368323 27310.0 79.706330495525 0.0 - - - - - - - 215.53846153846155 54 13 IL5RA interleukin 5 receptor, alpha 1101 141 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585552.[MT7]-EAGLWSEWSQPIYVGFSR.3b7_1.heavy 752.712 / 917.448 12668.0 48.05065155029297 46 20 10 6 10 5.445180500628296 18.364864119465174 0.03350067138671875 3 0.9950298597254005 17.498386591368323 12668.0 68.75233823965227 0.0 - - - - - - - 239.7058823529412 25 17 IL5RA interleukin 5 receptor, alpha 1103 142 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21162.[MT7]-HLLLVDPEGK[MT7].3y3_1.heavy 470.285 / 477.279 17788.0 32.68390083312988 45 18 10 7 10 4.245808780681365 19.118744788387783 0.02480316162109375 3 0.9809928789696443 8.937455642113372 17788.0 26.243268474471883 0.0 - - - - - - - 789.5 35 8 SHC4 SHC (Src homology 2 domain containing) family, member 4 1105 142 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21162.[MT7]-HLLLVDPEGK[MT7].3b4_1.heavy 470.285 / 621.42 14461.0 32.68390083312988 45 18 10 7 10 4.245808780681365 19.118744788387783 0.02480316162109375 3 0.9809928789696443 8.937455642113372 14461.0 17.576921789439137 0.0 - - - - - - - 703.7272727272727 28 11 SHC4 SHC (Src homology 2 domain containing) family, member 4 1107 142 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21162.[MT7]-HLLLVDPEGK[MT7].3y4_1.heavy 470.285 / 574.332 21319.0 32.68390083312988 45 18 10 7 10 4.245808780681365 19.118744788387783 0.02480316162109375 3 0.9809928789696443 8.937455642113372 21319.0 33.91599979085696 0.0 - - - - - - - 773.1538461538462 42 13 SHC4 SHC (Src homology 2 domain containing) family, member 4 1109 142 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21162.[MT7]-HLLLVDPEGK[MT7].3b3_1.heavy 470.285 / 508.336 20504.0 32.68390083312988 45 18 10 7 10 4.245808780681365 19.118744788387783 0.02480316162109375 3 0.9809928789696443 8.937455642113372 20504.0 23.28173444390005 0.0 - - - - - - - 346.8888888888889 41 9 SHC4 SHC (Src homology 2 domain containing) family, member 4 1111 143 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585566.[MT7]-ILGLC[CAM]LLQNELC[CAM]PITLNR.3y7_1.heavy 762.093 / 873.461 36243.0 50.99800109863281 50 20 10 10 10 7.369969717749488 13.5685767825022 0.0 3 0.994491457674165 16.620514438390064 36243.0 115.27551047120419 0.0 - - - - - - - 210.08333333333334 72 12 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 1113 143 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585566.[MT7]-ILGLC[CAM]LLQNELC[CAM]PITLNR.3y6_1.heavy 762.093 / 713.43 43767.0 50.99800109863281 50 20 10 10 10 7.369969717749488 13.5685767825022 0.0 3 0.994491457674165 16.620514438390064 43767.0 124.27020240095274 0.0 - - - - - - - 207.28571428571428 87 14 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 1115 143 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585566.[MT7]-ILGLC[CAM]LLQNELC[CAM]PITLNR.3b4_1.heavy 762.093 / 541.383 24442.0 50.99800109863281 50 20 10 10 10 7.369969717749488 13.5685767825022 0.0 3 0.994491457674165 16.620514438390064 24442.0 53.34157242582897 0.0 - - - - - - - 670.5555555555555 48 9 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 1117 143 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585566.[MT7]-ILGLC[CAM]LLQNELC[CAM]PITLNR.3b5_1.heavy 762.093 / 701.414 33340.0 50.99800109863281 50 20 10 10 10 7.369969717749488 13.5685767825022 0.0 3 0.994491457674165 16.620514438390064 33340.0 61.19090739008419 0.0 - - - - - - - 780.1428571428571 66 7 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 1119 144 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20849.[MT7]-AIGNVHPR.2b4_1.heavy 504.297 / 500.295 1824.0 19.239200592041016 45 15 10 10 10 1.3922556497274203 43.79216014292932 0.0 3 0.957929409669264 5.995682124479918 1824.0 3.2 0.0 - - - - - - - 677.4285714285714 3 7 SHC4 SHC (Src homology 2 domain containing) family, member 4 1121 144 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20849.[MT7]-AIGNVHPR.2y6_1.heavy 504.297 / 679.363 4013.0 19.239200592041016 45 15 10 10 10 1.3922556497274203 43.79216014292932 0.0 3 0.957929409669264 5.995682124479918 4013.0 13.784877061605155 0.0 - - - - - - - 177.6315789473684 8 19 SHC4 SHC (Src homology 2 domain containing) family, member 4 1123 144 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20849.[MT7]-AIGNVHPR.2b5_1.heavy 504.297 / 599.363 1414.0 19.239200592041016 45 15 10 10 10 1.3922556497274203 43.79216014292932 0.0 3 0.957929409669264 5.995682124479918 1414.0 0.4537942664418213 1.0 - - - - - - - 162.9047619047619 2 21 SHC4 SHC (Src homology 2 domain containing) family, member 4 1125 144 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20849.[MT7]-AIGNVHPR.2y7_1.heavy 504.297 / 792.448 3375.0 19.239200592041016 45 15 10 10 10 1.3922556497274203 43.79216014292932 0.0 3 0.957929409669264 5.995682124479918 3375.0 14.214554242749731 0.0 - - - - - - - 190.41176470588235 6 17 SHC4 SHC (Src homology 2 domain containing) family, member 4 1127 145 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584144.[MT7]-SGELAVR.2b3_1.heavy 438.257 / 418.205 N/A 22.1210994720459 46 18 8 10 10 4.63228904066393 21.587599375203787 0.0 3 0.9852435801764817 10.146969738284321 3550.0 1.4566050596413538 3.0 - - - - - - - 1220.7 14 10 ACADVL acyl-CoA dehydrogenase, very long chain 1129 145 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584144.[MT7]-SGELAVR.2b4_1.heavy 438.257 / 531.289 3647.0 22.1210994720459 46 18 8 10 10 4.63228904066393 21.587599375203787 0.0 3 0.9852435801764817 10.146969738284321 3647.0 4.751963283858933 0.0 - - - - - - - 720.6363636363636 7 11 ACADVL acyl-CoA dehydrogenase, very long chain 1131 145 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584144.[MT7]-SGELAVR.2y6_1.heavy 438.257 / 644.373 3258.0 22.1210994720459 46 18 8 10 10 4.63228904066393 21.587599375203787 0.0 3 0.9852435801764817 10.146969738284321 3258.0 16.10370941635723 0.0 - - - - - - - 264.375 6 16 ACADVL acyl-CoA dehydrogenase, very long chain 1133 145 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584144.[MT7]-SGELAVR.2b5_1.heavy 438.257 / 602.327 5446.0 22.1210994720459 46 18 8 10 10 4.63228904066393 21.587599375203787 0.0 3 0.9852435801764817 10.146969738284321 5446.0 12.617874636778748 0.0 - - - - - - - 769.1818181818181 10 11 ACADVL acyl-CoA dehydrogenase, very long chain 1135 146 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21029.[MT7]-ISMPLDFK[MT7].2b3_1.heavy 619.857 / 476.266 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 1137 146 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21029.[MT7]-ISMPLDFK[MT7].2y4_1.heavy 619.857 / 666.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 1139 146 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21029.[MT7]-ISMPLDFK[MT7].2y5_1.heavy 619.857 / 763.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 1141 146 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21029.[MT7]-ISMPLDFK[MT7].2y7_1.heavy 619.857 / 981.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 1143 147 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 198166.0 37.9370002746582 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 198166.0 61.42496646653448 1.0 - - - - - - - 379.0 421 5 1145 147 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 568274.0 37.9370002746582 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 568274.0 96.55765289509759 0.0 - - - - - - - 307.9 1136 10 1147 147 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 472687.0 37.9370002746582 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 472687.0 165.457999346588 0.0 - - - - - - - 408.0 945 9 1149 148 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21021.[MT7]-K[MT7]TSNSQK[MT7].3y3_1.heavy 408.914 / 506.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1151 148 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21021.[MT7]-K[MT7]TSNSQK[MT7].3b4_1.heavy 408.914 / 719.429 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1153 148 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21021.[MT7]-K[MT7]TSNSQK[MT7].3y4_1.heavy 408.914 / 620.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1155 148 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21021.[MT7]-K[MT7]TSNSQK[MT7].3y5_1.heavy 408.914 / 707.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1157 149 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544633.[MT7]-NFIRNETHNPTVK[MT7].4y4_1.heavy 465.26 / 588.384 13964.0 23.310199737548828 46 20 10 6 10 11.701914879568712 8.54560993043949 0.03449821472167969 3 0.9973878428221896 24.1417158830637 13964.0 27.617499040702423 0.0 - - - - - - - 711.8666666666667 27 15 MET met proto-oncogene (hepatocyte growth factor receptor) 1159 149 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544633.[MT7]-NFIRNETHNPTVK[MT7].4b7_1.heavy 465.26 / 1019.54 N/A 23.310199737548828 46 20 10 6 10 11.701914879568712 8.54560993043949 0.03449821472167969 3 0.9973878428221896 24.1417158830637 51.0 1.4 7.0 - - - - - - - 0.0 0 0 MET met proto-oncogene (hepatocyte growth factor receptor) 1161 149 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544633.[MT7]-NFIRNETHNPTVK[MT7].4b7_2.heavy 465.26 / 510.273 7547.0 23.310199737548828 46 20 10 6 10 11.701914879568712 8.54560993043949 0.03449821472167969 3 0.9973878428221896 24.1417158830637 7547.0 14.445606393606393 0.0 - - - - - - - 713.9090909090909 15 11 MET met proto-oncogene (hepatocyte growth factor receptor) 1163 149 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544633.[MT7]-NFIRNETHNPTVK[MT7].4y3_1.heavy 465.26 / 491.331 16069.0 23.310199737548828 46 20 10 6 10 11.701914879568712 8.54560993043949 0.03449821472167969 3 0.9973878428221896 24.1417158830637 16069.0 29.48720268881209 0.0 - - - - - - - 359.2 32 5 MET met proto-oncogene (hepatocyte growth factor receptor) 1165 150 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21426.[MT7]-RVPPHVLVNWAVQIAR.3y6_1.heavy 667.066 / 657.404 4779.0 38.02360153198242 46 16 10 10 10 7.589794031194796 13.175588110690516 0.0 3 0.9699514518512123 7.101614424375682 4779.0 8.689256203311837 0.0 - - - - - - - 179.0 9 6 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1167 150 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21426.[MT7]-RVPPHVLVNWAVQIAR.3b5_1.heavy 667.066 / 731.443 4540.0 38.02360153198242 46 16 10 10 10 7.589794031194796 13.175588110690516 0.0 3 0.9699514518512123 7.101614424375682 4540.0 17.366668224990846 0.0 - - - - - - - 278.44444444444446 9 9 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1169 150 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21426.[MT7]-RVPPHVLVNWAVQIAR.3y8_1.heavy 667.066 / 957.526 7408.0 38.02360153198242 46 16 10 10 10 7.589794031194796 13.175588110690516 0.0 3 0.9699514518512123 7.101614424375682 7408.0 18.824117238914233 0.0 - - - - - - - 253.75 14 8 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1171 150 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21426.[MT7]-RVPPHVLVNWAVQIAR.3y10_1.heavy 667.066 / 1169.68 2509.0 38.02360153198242 46 16 10 10 10 7.589794031194796 13.175588110690516 0.0 3 0.9699514518512123 7.101614424375682 2509.0 10.235460251046025 0.0 - - - - - - - 278.53333333333336 5 15 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1173 151 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20741.[MT7]-LSAIFR.2y4_1.heavy 425.767 / 506.309 4853.0 37.087249755859375 43 18 10 5 10 6.497396120598721 15.390780882663073 0.04470062255859375 3 0.9836012408029706 9.624132469842055 4853.0 49.29909317954772 0.0 - - - - - - - 188.55555555555554 9 9 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1175 151 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20741.[MT7]-LSAIFR.2y5_1.heavy 425.767 / 593.341 31786.0 37.087249755859375 43 18 10 5 10 6.497396120598721 15.390780882663073 0.04470062255859375 3 0.9836012408029706 9.624132469842055 31786.0 111.0652000543226 0.0 - - - - - - - 294.57142857142856 63 7 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1177 151 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20741.[MT7]-LSAIFR.2b4_1.heavy 425.767 / 529.347 12860.0 37.087249755859375 43 18 10 5 10 6.497396120598721 15.390780882663073 0.04470062255859375 3 0.9836012408029706 9.624132469842055 12860.0 53.91936737906194 0.0 - - - - - - - 212.25 25 8 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1179 151 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20741.[MT7]-LSAIFR.2b5_1.heavy 425.767 / 676.415 1820.0 37.087249755859375 43 18 10 5 10 6.497396120598721 15.390780882663073 0.04470062255859375 3 0.9836012408029706 9.624132469842055 1820.0 3.1773195876288662 3.0 - - - - - - - 259.92857142857144 11 14 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1181 152 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21563.[MT7]-ELGAFGLQVPSELGGVGLC[CAM]NTQYAR.3b6_1.heavy 927.477 / 719.385 8928.0 45.42919921875 42 12 10 10 10 1.0506801255785871 65.77861687335732 0.0 3 0.8866057542126003 3.6297348578396837 8928.0 133.95492142587145 0.0 - - - - - - - 257.2 17 10 ACADVL acyl-CoA dehydrogenase, very long chain 1183 152 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21563.[MT7]-ELGAFGLQVPSELGGVGLC[CAM]NTQYAR.3b4_1.heavy 927.477 / 515.295 7428.0 45.42919921875 42 12 10 10 10 1.0506801255785871 65.77861687335732 0.0 3 0.8866057542126003 3.6297348578396837 7428.0 17.192599270603807 0.0 - - - - - - - 258.9375 14 16 ACADVL acyl-CoA dehydrogenase, very long chain 1185 152 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21563.[MT7]-ELGAFGLQVPSELGGVGLC[CAM]NTQYAR.3b8_1.heavy 927.477 / 960.527 14071.0 45.42919921875 42 12 10 10 10 1.0506801255785871 65.77861687335732 0.0 3 0.8866057542126003 3.6297348578396837 14071.0 22.385098276211316 0.0 - - - - - - - 642.8888888888889 28 9 ACADVL acyl-CoA dehydrogenase, very long chain 1187 152 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21563.[MT7]-ELGAFGLQVPSELGGVGLC[CAM]NTQYAR.3y9_1.heavy 927.477 / 1082.5 17571.0 45.42919921875 42 12 10 10 10 1.0506801255785871 65.77861687335732 0.0 3 0.8866057542126003 3.6297348578396837 17571.0 29.320660038593132 0.0 - - - - - - - 683.7142857142857 35 7 ACADVL acyl-CoA dehydrogenase, very long chain 1189 153 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20744.[MT7]-QAEITR.2y4_1.heavy 431.249 / 518.293 3124.0 17.749624729156494 40 14 10 6 10 2.5761209513744943 38.81805314561989 0.030900955200195312 3 0.936319387616617 4.864370959636911 3124.0 3.5874273982852882 1.0 - - - - - - - 721.8571428571429 6 7 SH3GLB1 SH3-domain GRB2-like endophilin B1 1191 153 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20744.[MT7]-QAEITR.2b3_1.heavy 431.249 / 473.248 8099.0 17.749624729156494 40 14 10 6 10 2.5761209513744943 38.81805314561989 0.030900955200195312 3 0.936319387616617 4.864370959636911 8099.0 21.256748188128803 0.0 - - - - - - - 694.0 16 10 SH3GLB1 SH3-domain GRB2-like endophilin B1 1193 153 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20744.[MT7]-QAEITR.2y5_1.heavy 431.249 / 589.33 21791.0 17.749624729156494 40 14 10 6 10 2.5761209513744943 38.81805314561989 0.030900955200195312 3 0.936319387616617 4.864370959636911 21791.0 16.053057793807398 0.0 - - - - - - - 778.3636363636364 43 11 SH3GLB1 SH3-domain GRB2-like endophilin B1 1195 153 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20744.[MT7]-QAEITR.2b4_1.heavy 431.249 / 586.332 5361.0 17.749624729156494 40 14 10 6 10 2.5761209513744943 38.81805314561989 0.030900955200195312 3 0.936319387616617 4.864370959636911 5361.0 24.013983228511528 0.0 - - - - - - - 223.75 10 20 SH3GLB1 SH3-domain GRB2-like endophilin B1 1197 154 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21560.[MT7]-DPGENYNLLGGVAGATPEVLQALK[MT7].3b5_1.heavy 905.492 / 657.296 1833.0 46.96439838409424 38 12 10 6 10 1.1203034108168732 59.5076887412638 0.033199310302734375 3 0.8961371217457562 3.7957672400085105 1833.0 2.2984732824427483 2.0 - - - - - - - 173.25 3 20 ARSA arylsulfatase A 1199 154 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21560.[MT7]-DPGENYNLLGGVAGATPEVLQALK[MT7].3y8_1.heavy 905.492 / 1041.64 10605.0 46.96439838409424 38 12 10 6 10 1.1203034108168732 59.5076887412638 0.033199310302734375 3 0.8961371217457562 3.7957672400085105 10605.0 22.382424807814786 0.0 - - - - - - - 673.5714285714286 21 7 ARSA arylsulfatase A 1201 154 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21560.[MT7]-DPGENYNLLGGVAGATPEVLQALK[MT7].3b8_1.heavy 905.492 / 1047.49 7136.0 46.96439838409424 38 12 10 6 10 1.1203034108168732 59.5076887412638 0.033199310302734375 3 0.8961371217457562 3.7957672400085105 7136.0 16.6786598812553 0.0 - - - - - - - 214.44444444444446 14 18 ARSA arylsulfatase A 1203 154 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21560.[MT7]-DPGENYNLLGGVAGATPEVLQALK[MT7].3b7_1.heavy 905.492 / 934.402 6350.0 46.96439838409424 38 12 10 6 10 1.1203034108168732 59.5076887412638 0.033199310302734375 3 0.8961371217457562 3.7957672400085105 6350.0 47.01908396946565 0.0 - - - - - - - 220.3684210526316 12 19 ARSA arylsulfatase A 1205 155 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544218.[MT7]-TPPYLQLQVTEK[MT7].3b6_1.heavy 568.997 / 844.469 4913.0 36.21070098876953 43 13 10 10 10 1.088589930189794 54.08193272974397 0.0 3 0.9136066620797075 4.168164278410795 4913.0 33.38320512820513 0.0 - - - - - - - 210.6 9 10 LAMA5 laminin, alpha 5 1207 155 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544218.[MT7]-TPPYLQLQVTEK[MT7].3y3_1.heavy 568.997 / 521.305 17196.0 36.21070098876953 43 13 10 10 10 1.088589930189794 54.08193272974397 0.0 3 0.9136066620797075 4.168164278410795 17196.0 63.750128205128206 0.0 - - - - - - - 292.5 34 8 LAMA5 laminin, alpha 5 1209 155 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544218.[MT7]-TPPYLQLQVTEK[MT7].3b4_1.heavy 568.997 / 603.326 10762.0 36.21070098876953 43 13 10 10 10 1.088589930189794 54.08193272974397 0.0 3 0.9136066620797075 4.168164278410795 10762.0 38.8372269705603 0.0 - - - - - - - 286.0 21 9 LAMA5 laminin, alpha 5 1211 155 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544218.[MT7]-TPPYLQLQVTEK[MT7].3y4_1.heavy 568.997 / 620.374 12400.0 36.21070098876953 43 13 10 10 10 1.088589930189794 54.08193272974397 0.0 3 0.9136066620797075 4.168164278410795 12400.0 24.376068376068375 0.0 - - - - - - - 302.25 24 12 LAMA5 laminin, alpha 5 1213 156 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21427.[MT7]-AMSLVSNEGEGEQNEIR.2b3_1.heavy 1003.98 / 434.219 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITPR3 inositol 1,4,5-triphosphate receptor, type 3 1215 156 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21427.[MT7]-AMSLVSNEGEGEQNEIR.2b4_1.heavy 1003.98 / 547.303 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITPR3 inositol 1,4,5-triphosphate receptor, type 3 1217 156 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21427.[MT7]-AMSLVSNEGEGEQNEIR.2b5_1.heavy 1003.98 / 646.371 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITPR3 inositol 1,4,5-triphosphate receptor, type 3 1219 156 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21427.[MT7]-AMSLVSNEGEGEQNEIR.2y7_1.heavy 1003.98 / 845.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITPR3 inositol 1,4,5-triphosphate receptor, type 3 1221 157 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20846.[MT7]-LDTQLK[MT7].2y4_1.heavy 503.313 / 633.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM37 tripartite motif-containing 37 1223 157 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20846.[MT7]-LDTQLK[MT7].2y5_1.heavy 503.313 / 748.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM37 tripartite motif-containing 37 1225 157 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20846.[MT7]-LDTQLK[MT7].2b4_1.heavy 503.313 / 602.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM37 tripartite motif-containing 37 1227 157 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20846.[MT7]-LDTQLK[MT7].2b5_1.heavy 503.313 / 715.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM37 tripartite motif-containing 37 1229 158 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20847.[MT7]-LADFGLAR.2y5_1.heavy 503.794 / 563.33 64354.0 36.298500061035156 50 20 10 10 10 15.77823362751629 6.337845056724602 0.0 3 0.9963371674728565 20.38549151592163 64354.0 181.9729399812745 0.0 - - - - - - - 358.75 128 4 CDK2;CDK3;CDK4;CDK5;CDK6;CDK9;CDK16;CDK17;CDK18;CDK12;CDK14;CDK15;CDK13;CDK1 cyclin-dependent kinase 2;cyclin-dependent kinase 3;cyclin-dependent kinase 4;cyclin-dependent kinase 5;cyclin-dependent kinase 6;cyclin-dependent kinase 9;cyclin-dependent kinase 16;cyclin-dependent kinase 17;cyclin-dependent kinase 18;cyclin-dependent kinase 12;cyclin-dependent kinase 14;cyclin-dependent kinase 15;cyclin-dependent kinase 13;cyclin-dependent kinase 1 1231 158 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20847.[MT7]-LADFGLAR.2y6_1.heavy 503.794 / 678.357 12321.0 36.298500061035156 50 20 10 10 10 15.77823362751629 6.337845056724602 0.0 3 0.9963371674728565 20.38549151592163 12321.0 21.129443630094457 0.0 - - - - - - - 269.1666666666667 24 12 CDK2;CDK3;CDK4;CDK5;CDK6;CDK9;CDK16;CDK17;CDK18;CDK12;CDK14;CDK15;CDK13;CDK1 cyclin-dependent kinase 2;cyclin-dependent kinase 3;cyclin-dependent kinase 4;cyclin-dependent kinase 5;cyclin-dependent kinase 6;cyclin-dependent kinase 9;cyclin-dependent kinase 16;cyclin-dependent kinase 17;cyclin-dependent kinase 18;cyclin-dependent kinase 12;cyclin-dependent kinase 14;cyclin-dependent kinase 15;cyclin-dependent kinase 13;cyclin-dependent kinase 1 1233 158 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20847.[MT7]-LADFGLAR.2b5_1.heavy 503.794 / 648.347 18899.0 36.298500061035156 50 20 10 10 10 15.77823362751629 6.337845056724602 0.0 3 0.9963371674728565 20.38549151592163 18899.0 54.88286366692571 0.0 - - - - - - - 347.90909090909093 37 11 CDK2;CDK3;CDK4;CDK5;CDK6;CDK9;CDK16;CDK17;CDK18;CDK12;CDK14;CDK15;CDK13;CDK1 cyclin-dependent kinase 2;cyclin-dependent kinase 3;cyclin-dependent kinase 4;cyclin-dependent kinase 5;cyclin-dependent kinase 6;cyclin-dependent kinase 9;cyclin-dependent kinase 16;cyclin-dependent kinase 17;cyclin-dependent kinase 18;cyclin-dependent kinase 12;cyclin-dependent kinase 14;cyclin-dependent kinase 15;cyclin-dependent kinase 13;cyclin-dependent kinase 1 1235 158 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20847.[MT7]-LADFGLAR.2y7_1.heavy 503.794 / 749.394 37201.0 36.298500061035156 50 20 10 10 10 15.77823362751629 6.337845056724602 0.0 3 0.9963371674728565 20.38549151592163 37201.0 103.03680912280281 0.0 - - - - - - - 732.625 74 8 CDK2;CDK3;CDK4;CDK5;CDK6;CDK9;CDK16;CDK17;CDK18;CDK12;CDK14;CDK15;CDK13;CDK1 cyclin-dependent kinase 2;cyclin-dependent kinase 3;cyclin-dependent kinase 4;cyclin-dependent kinase 5;cyclin-dependent kinase 6;cyclin-dependent kinase 9;cyclin-dependent kinase 16;cyclin-dependent kinase 17;cyclin-dependent kinase 18;cyclin-dependent kinase 12;cyclin-dependent kinase 14;cyclin-dependent kinase 15;cyclin-dependent kinase 13;cyclin-dependent kinase 1 1237 159 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545056.[MT7]-NDALEMVEETTWQGLK[MT7].3b6_1.heavy 718.033 / 818.383 8662.0 45.526451110839844 44 18 10 6 10 4.439341593617814 22.525862876550036 0.035400390625 3 0.9804574714444881 8.813779407420013 8662.0 47.33223436219612 0.0 - - - - - - - 176.07142857142858 17 14 ACADVL acyl-CoA dehydrogenase, very long chain 1239 159 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545056.[MT7]-NDALEMVEETTWQGLK[MT7].3b4_1.heavy 718.033 / 558.3 3659.0 45.526451110839844 44 18 10 6 10 4.439341593617814 22.525862876550036 0.035400390625 3 0.9804574714444881 8.813779407420013 3659.0 11.32547619047619 0.0 - - - - - - - 634.7 7 10 ACADVL acyl-CoA dehydrogenase, very long chain 1241 159 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545056.[MT7]-NDALEMVEETTWQGLK[MT7].3b5_1.heavy 718.033 / 687.343 11798.0 45.526451110839844 44 18 10 6 10 4.439341593617814 22.525862876550036 0.035400390625 3 0.9804574714444881 8.813779407420013 11798.0 27.305939359811646 0.0 - - - - - - - 219.13333333333333 23 15 ACADVL acyl-CoA dehydrogenase, very long chain 1243 159 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545056.[MT7]-NDALEMVEETTWQGLK[MT7].3y5_1.heavy 718.033 / 775.458 4107.0 45.526451110839844 44 18 10 6 10 4.439341593617814 22.525862876550036 0.035400390625 3 0.9804574714444881 8.813779407420013 4107.0 12.309747871718592 0.0 - - - - - - - 255.42105263157896 8 19 ACADVL acyl-CoA dehydrogenase, very long chain 1245 160 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21170.[MT7]-RDFVDHLDK[MT7].3y3_1.heavy 478.264 / 519.326 12208.0 25.437525272369385 36 10 10 6 10 0.9074929681635099 64.24875050160341 0.03510093688964844 3 0.848951506722479 3.134581235246863 12208.0 20.239083444412675 0.0 - - - - - - - 733.9333333333333 24 15 ARRB2 arrestin, beta 2 1247 160 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21170.[MT7]-RDFVDHLDK[MT7].3b4_1.heavy 478.264 / 662.374 1455.0 25.437525272369385 36 10 10 6 10 0.9074929681635099 64.24875050160341 0.03510093688964844 3 0.848951506722479 3.134581235246863 1455.0 2.2427745664739884 0.0 - - - - - - - 299.6190476190476 2 21 ARRB2 arrestin, beta 2 1249 160 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21170.[MT7]-RDFVDHLDK[MT7].3b5_1.heavy 478.264 / 777.401 8779.0 25.437525272369385 36 10 10 6 10 0.9074929681635099 64.24875050160341 0.03510093688964844 3 0.848951506722479 3.134581235246863 8779.0 42.704167239010985 0.0 - - - - - - - 171.6 17 20 ARRB2 arrestin, beta 2 1251 160 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21170.[MT7]-RDFVDHLDK[MT7].3b5_2.heavy 478.264 / 389.204 14286.0 25.437525272369385 36 10 10 6 10 0.9074929681635099 64.24875050160341 0.03510093688964844 3 0.848951506722479 3.134581235246863 14286.0 20.50553922016528 0.0 - - - - - - - 789.4 28 15 ARRB2 arrestin, beta 2 1253 161 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21420.[MT7]-LM[OXI]TNAFISIIDDLSK[MT7].3b6_1.heavy 662.367 / 838.425 1295.0 52.7557487487793 44 16 10 8 10 3.6249719514474634 27.586420347354597 0.01869964599609375 3 0.9675014913821187 6.827275414361428 1295.0 42.8925925925926 0.0 - - - - - - - 67.25 2 48 IL5RA interleukin 5 receptor, alpha 1255 161 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21420.[MT7]-LM[OXI]TNAFISIIDDLSK[MT7].3b4_1.heavy 662.367 / 620.319 786.0 52.7557487487793 44 16 10 8 10 3.6249719514474634 27.586420347354597 0.01869964599609375 3 0.9675014913821187 6.827275414361428 786.0 -1.0542498430634022 1.0 - - - - - - - 0.0 1 0 IL5RA interleukin 5 receptor, alpha 1257 161 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21420.[MT7]-LM[OXI]TNAFISIIDDLSK[MT7].3b5_1.heavy 662.367 / 691.357 1919.0 52.7557487487793 44 16 10 8 10 3.6249719514474634 27.586420347354597 0.01869964599609375 3 0.9675014913821187 6.827275414361428 1919.0 8.929808773903263 0.0 - - - - - - - 86.17391304347827 3 46 IL5RA interleukin 5 receptor, alpha 1259 161 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21420.[MT7]-LM[OXI]TNAFISIIDDLSK[MT7].3y4_1.heavy 662.367 / 606.358 913.0 52.7557487487793 44 16 10 8 10 3.6249719514474634 27.586420347354597 0.01869964599609375 3 0.9675014913821187 6.827275414361428 913.0 9.981216478374986 0.0 - - - - - - - 0.0 1 0 IL5RA interleukin 5 receptor, alpha 1261 162 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545190.[MT7]-LASGETVAAFC[CAM]LTEPSSGSDAASIR.3b9_1.heavy 881.101 / 944.517 9838.0 38.999000549316406 41 16 10 5 10 3.201596227378371 24.273336745404062 0.04119873046875 3 0.9688313721044233 6.972186500234475 9838.0 51.6235460396298 0.0 - - - - - - - 211.7 19 10 ACADVL acyl-CoA dehydrogenase, very long chain 1263 162 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545190.[MT7]-LASGETVAAFC[CAM]LTEPSSGSDAASIR.3b6_1.heavy 881.101 / 703.374 6241.0 38.999000549316406 41 16 10 5 10 3.201596227378371 24.273336745404062 0.04119873046875 3 0.9688313721044233 6.972186500234475 6241.0 4.524323142673704 0.0 - - - - - - - 228.0 12 13 ACADVL acyl-CoA dehydrogenase, very long chain 1265 162 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545190.[MT7]-LASGETVAAFC[CAM]LTEPSSGSDAASIR.3y11_1.heavy 881.101 / 1047.51 27715.0 38.999000549316406 41 16 10 5 10 3.201596227378371 24.273336745404062 0.04119873046875 3 0.9688313721044233 6.972186500234475 27715.0 73.56720034995627 0.0 - - - - - - - 230.9090909090909 55 11 ACADVL acyl-CoA dehydrogenase, very long chain 1267 162 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545190.[MT7]-LASGETVAAFC[CAM]LTEPSSGSDAASIR.3b8_1.heavy 881.101 / 873.48 6664.0 38.999000549316406 41 16 10 5 10 3.201596227378371 24.273336745404062 0.04119873046875 3 0.9688313721044233 6.972186500234475 6664.0 61.19584905660377 0.0 - - - - - - - 195.53846153846155 13 13 ACADVL acyl-CoA dehydrogenase, very long chain 1269 163 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20842.[MT7]-GELVAVK[MT7].2y4_1.heavy 502.323 / 560.389 3789.0 26.872949600219727 47 20 10 7 10 12.406630067537884 8.06020647473413 0.02899932861328125 3 0.9907606742152972 12.829427566533738 3789.0 6.4033162564875274 0.0 - - - - - - - 1136.3636363636363 7 11 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1271 163 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20842.[MT7]-GELVAVK[MT7].2y5_1.heavy 502.323 / 673.473 2092.0 26.872949600219727 47 20 10 7 10 12.406630067537884 8.06020647473413 0.02899932861328125 3 0.9907606742152972 12.829427566533738 2092.0 3.3577804379702405 0.0 - - - - - - - 678.7692307692307 4 13 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1273 163 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20842.[MT7]-GELVAVK[MT7].2b4_1.heavy 502.323 / 543.326 4072.0 26.872949600219727 47 20 10 7 10 12.406630067537884 8.06020647473413 0.02899932861328125 3 0.9907606742152972 12.829427566533738 4072.0 7.804589517901415 0.0 - - - - - - - 683.9090909090909 8 11 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1275 163 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20842.[MT7]-GELVAVK[MT7].2b5_1.heavy 502.323 / 614.363 3224.0 26.872949600219727 47 20 10 7 10 12.406630067537884 8.06020647473413 0.02899932861328125 3 0.9907606742152972 12.829427566533738 3224.0 6.492162945435205 2.0 - - - - - - - 652.6923076923077 6 13 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1277 164 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543887.[MT7]-GANIFLTSSGLIK[MT7].3b4_1.heavy 536.99 / 500.295 60414.0 41.214599609375 48 18 10 10 10 3.9678371174187275 25.202647447648985 0.0 3 0.986392015418698 10.567487500914119 60414.0 72.68080719725664 0.0 - - - - - - - 765.125 120 8 MAP3K4 mitogen-activated protein kinase kinase kinase 4 1279 164 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543887.[MT7]-GANIFLTSSGLIK[MT7].3b5_1.heavy 536.99 / 647.363 41005.0 41.214599609375 48 18 10 10 10 3.9678371174187275 25.202647447648985 0.0 3 0.986392015418698 10.567487500914119 41005.0 46.42504701114252 0.0 - - - - - - - 821.9 82 10 MAP3K4 mitogen-activated protein kinase kinase kinase 4 1281 164 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543887.[MT7]-GANIFLTSSGLIK[MT7].3y4_1.heavy 536.99 / 574.404 27715.0 41.214599609375 48 18 10 10 10 3.9678371174187275 25.202647447648985 0.0 3 0.986392015418698 10.567487500914119 27715.0 37.78561793987461 0.0 - - - - - - - 675.6363636363636 55 11 MAP3K4 mitogen-activated protein kinase kinase kinase 4 1283 164 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543887.[MT7]-GANIFLTSSGLIK[MT7].3y5_1.heavy 536.99 / 661.437 16699.0 41.214599609375 48 18 10 10 10 3.9678371174187275 25.202647447648985 0.0 3 0.986392015418698 10.567487500914119 16699.0 63.09441471669245 0.0 - - - - - - - 279.6 33 10 MAP3K4 mitogen-activated protein kinase kinase kinase 4 1285 165 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21566.[MT7]-GLGMTLSYLFREPATINYPFEK[MT7].4b7_1.heavy 709.63 / 804.441 1238.0 49.36159896850586 47 17 10 10 10 1.7400203874856726 44.14251911377801 0.0 3 0.9759568629842824 7.943150527455266 1238.0 11.705858460691175 0.0 - - - - - - - 188.72222222222223 2 18 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1287 165 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21566.[MT7]-GLGMTLSYLFREPATINYPFEK[MT7].4b4_1.heavy 709.63 / 503.277 1992.0 49.36159896850586 47 17 10 10 10 1.7400203874856726 44.14251911377801 0.0 3 0.9759568629842824 7.943150527455266 1992.0 3.8921962148278784 3.0 - - - - - - - 223.21428571428572 3 14 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1289 165 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21566.[MT7]-GLGMTLSYLFREPATINYPFEK[MT7].4b14_2.heavy 709.63 / 840.949 2746.0 49.36159896850586 47 17 10 10 10 1.7400203874856726 44.14251911377801 0.0 3 0.9759568629842824 7.943150527455266 2746.0 7.983873322649318 0.0 - - - - - - - 222.25 5 16 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1291 165 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21566.[MT7]-GLGMTLSYLFREPATINYPFEK[MT7].4y3_1.heavy 709.63 / 567.326 6838.0 49.36159896850586 47 17 10 10 10 1.7400203874856726 44.14251911377801 0.0 3 0.9759568629842824 7.943150527455266 6838.0 20.288446027599065 0.0 - - - - - - - 265.57142857142856 13 14 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1293 166 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585537.[MT7]-LC[CAM]EAIC[CAM]PAQAITIEAEPR.3y7_1.heavy 729.374 / 815.426 32898.0 38.54570007324219 41 16 10 5 10 14.466924830748866 6.912319042914637 0.04160308837890625 3 0.9678297578147608 6.862209873489231 32898.0 138.47565091616886 0.0 - - - - - - - 185.25 65 8 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1295 166 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585537.[MT7]-LC[CAM]EAIC[CAM]PAQAITIEAEPR.3b4_1.heavy 729.374 / 618.304 83355.0 38.54570007324219 41 16 10 5 10 14.466924830748866 6.912319042914637 0.04160308837890625 3 0.9678297578147608 6.862209873489231 83355.0 89.18355500380893 0.0 - - - - - - - 211.5 166 2 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1297 166 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585537.[MT7]-LC[CAM]EAIC[CAM]PAQAITIEAEPR.3b5_1.heavy 729.374 / 731.388 39985.0 38.54570007324219 41 16 10 5 10 14.466924830748866 6.912319042914637 0.04160308837890625 3 0.9678297578147608 6.862209873489231 39985.0 75.62174940898345 0.0 - - - - - - - 710.2857142857143 79 7 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1299 166 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585537.[MT7]-LC[CAM]EAIC[CAM]PAQAITIEAEPR.3b3_1.heavy 729.374 / 547.267 13011.0 38.54570007324219 41 16 10 5 10 14.466924830748866 6.912319042914637 0.04160308837890625 3 0.9678297578147608 6.862209873489231 13011.0 44.28578705524763 0.0 - - - - - - - 687.625 26 8 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1301 167 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584416.[MT7]-RLDLDAAK[MT7].2b3_1.heavy 595.361 / 529.321 1192.0 25.65537452697754 40 14 10 6 10 1.3537692904997625 48.65818178454351 0.03730010986328125 3 0.9491525626711819 5.4496700109668 1192.0 2.9405609371295913 1.0 - - - - - - - 233.35 2 20 SH3GLB1 SH3-domain GRB2-like endophilin B1 1303 167 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584416.[MT7]-RLDLDAAK[MT7].2y5_1.heavy 595.361 / 661.4 1348.0 25.65537452697754 40 14 10 6 10 1.3537692904997625 48.65818178454351 0.03730010986328125 3 0.9491525626711819 5.4496700109668 1348.0 24.267506503158675 0.0 - - - - - - - 142.75 2 20 SH3GLB1 SH3-domain GRB2-like endophilin B1 1305 167 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584416.[MT7]-RLDLDAAK[MT7].2b6_1.heavy 595.361 / 828.47 207.0 25.65537452697754 40 14 10 6 10 1.3537692904997625 48.65818178454351 0.03730010986328125 3 0.9491525626711819 5.4496700109668 207.0 0.7193050193050193 21.0 - - - - - - - 0.0 0 0 SH3GLB1 SH3-domain GRB2-like endophilin B1 1307 167 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584416.[MT7]-RLDLDAAK[MT7].2b5_1.heavy 595.361 / 757.432 2333.0 25.65537452697754 40 14 10 6 10 1.3537692904997625 48.65818178454351 0.03730010986328125 3 0.9491525626711819 5.4496700109668 2333.0 34.32201923076923 0.0 - - - - - - - 123.05263157894737 4 19 SH3GLB1 SH3-domain GRB2-like endophilin B1 1309 168 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB586007.[MT7]-DAAISGDEGWWAGQVGGQVGIFPSNYVSR.3b9_1.heavy 1056.51 / 960.439 2901.0 45.59525108337402 43 17 10 6 10 2.3498252194158833 29.165025816072863 0.03420257568359375 3 0.9712001788676554 7.254702820423829 2901.0 24.82998463508323 0.0 - - - - - - - 204.11764705882354 5 17 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1311 168 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB586007.[MT7]-DAAISGDEGWWAGQVGGQVGIFPSNYVSR.3y7_1.heavy 1056.51 / 822.41 4034.0 45.59525108337402 43 17 10 6 10 2.3498252194158833 29.165025816072863 0.03420257568359375 3 0.9712001788676554 7.254702820423829 4034.0 12.539054920045517 0.0 - - - - - - - 199.125 8 16 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1313 168 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB586007.[MT7]-DAAISGDEGWWAGQVGGQVGIFPSNYVSR.3y8_1.heavy 1056.51 / 969.479 4529.0 45.59525108337402 43 17 10 6 10 2.3498252194158833 29.165025816072863 0.03420257568359375 3 0.9712001788676554 7.254702820423829 4529.0 25.615742508324086 0.0 - - - - - - - 232.0 9 18 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1315 168 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB586007.[MT7]-DAAISGDEGWWAGQVGGQVGIFPSNYVSR.3y10_1.heavy 1056.51 / 1139.58 5732.0 45.59525108337402 43 17 10 6 10 2.3498252194158833 29.165025816072863 0.03420257568359375 3 0.9712001788676554 7.254702820423829 5732.0 25.1006225843916 0.0 - - - - - - - 202.93333333333334 11 15 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1317 169 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21031.[MT7]-AVQFTEEK[MT7].2y4_1.heavy 620.345 / 650.348 4162.0 26.427099227905273 40 10 10 10 10 0.9990466312649438 62.87744360717887 0.0 3 0.8456576198646617 3.100050695622407 4162.0 31.793055555555554 1.0 - - - - - - - 224.52631578947367 8 19 SH3GLB1;SH3GLB2 SH3-domain GRB2-like endophilin B1;SH3-domain GRB2-like endophilin B2 1319 169 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21031.[MT7]-AVQFTEEK[MT7].2y5_1.heavy 620.345 / 797.416 5730.0 26.427099227905273 40 10 10 10 10 0.9990466312649438 62.87744360717887 0.0 3 0.8456576198646617 3.100050695622407 5730.0 70.88222222222223 0.0 - - - - - - - 164.8421052631579 11 19 SH3GLB1;SH3GLB2 SH3-domain GRB2-like endophilin B1;SH3-domain GRB2-like endophilin B2 1321 169 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21031.[MT7]-AVQFTEEK[MT7].2y6_1.heavy 620.345 / 925.475 5027.0 26.427099227905273 40 10 10 10 10 0.9990466312649438 62.87744360717887 0.0 3 0.8456576198646617 3.100050695622407 5027.0 136.8461111111111 0.0 - - - - - - - 154.28571428571428 10 14 SH3GLB1;SH3GLB2 SH3-domain GRB2-like endophilin B1;SH3-domain GRB2-like endophilin B2 1323 169 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21031.[MT7]-AVQFTEEK[MT7].2y7_1.heavy 620.345 / 1024.54 6811.0 26.427099227905273 40 10 10 10 10 0.9990466312649438 62.87744360717887 0.0 3 0.8456576198646617 3.100050695622407 6811.0 67.47935185185185 0.0 - - - - - - - 172.125 13 16 SH3GLB1;SH3GLB2 SH3-domain GRB2-like endophilin B1;SH3-domain GRB2-like endophilin B2 1325 170 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544226.[MT7]-SEGSPLVVLPYMK[MT7].3b6_1.heavy 569.991 / 715.374 5512.0 41.34987545013428 42 16 10 6 10 2.1382773475069 32.711010104405055 0.036502838134765625 3 0.9649770481646969 6.575219498920961 5512.0 25.91688794926004 0.0 - - - - - - - 172.0 11 13 MET met proto-oncogene (hepatocyte growth factor receptor) 1327 170 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544226.[MT7]-SEGSPLVVLPYMK[MT7].3b4_1.heavy 569.991 / 505.237 2928.0 41.34987545013428 42 16 10 6 10 2.1382773475069 32.711010104405055 0.036502838134765625 3 0.9649770481646969 6.575219498920961 2928.0 10.894181006551948 1.0 - - - - - - - 290.625 5 16 MET met proto-oncogene (hepatocyte growth factor receptor) 1329 170 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544226.[MT7]-SEGSPLVVLPYMK[MT7].3y4_1.heavy 569.991 / 682.371 8182.0 41.34987545013428 42 16 10 6 10 2.1382773475069 32.711010104405055 0.036502838134765625 3 0.9649770481646969 6.575219498920961 8182.0 37.56885846867749 0.0 - - - - - - - 218.06666666666666 16 15 MET met proto-oncogene (hepatocyte growth factor receptor) 1331 170 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544226.[MT7]-SEGSPLVVLPYMK[MT7].3b7_1.heavy 569.991 / 814.443 6115.0 41.34987545013428 42 16 10 6 10 2.1382773475069 32.711010104405055 0.036502838134765625 3 0.9649770481646969 6.575219498920961 6115.0 44.55891472868217 0.0 - - - - - - - 219.88888888888889 12 9 MET met proto-oncogene (hepatocyte growth factor receptor) 1333 171 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 565414.0 40.77389907836914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 565414.0 792.2833598126971 0.0 - - - - - - - 921.6666666666666 1130 3 1335 171 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 736465.0 40.77389907836914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 736465.0 270.84105044917226 0.0 - - - - - - - 892.0 1472 3 1337 171 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 994552.0 40.77389907836914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 994552.0 934.1279343990939 0.0 - - - - - - - 1293.0 1989 2 1339 172 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20870.[MT7]-AVDHATNR.2y6_1.heavy 514.274 / 713.333 514.0 14.246649742126465 42 16 10 6 10 3.3291479902253642 30.037715443593292 0.0373992919921875 3 0.9648993038363007 6.567890648037749 514.0 33.41 0.0 - - - - - - - 0.0 1 0 ACADVL acyl-CoA dehydrogenase, very long chain 1341 172 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20870.[MT7]-AVDHATNR.2b3_1.heavy 514.274 / 430.242 1587.0 14.246649742126465 42 16 10 6 10 3.3291479902253642 30.037715443593292 0.0373992919921875 3 0.9648993038363007 6.567890648037749 1587.0 11.689955357142857 0.0 - - - - - - - 118.81818181818181 3 22 ACADVL acyl-CoA dehydrogenase, very long chain 1343 172 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20870.[MT7]-AVDHATNR.2y5_1.heavy 514.274 / 598.306 1610.0 14.246649742126465 42 16 10 6 10 3.3291479902253642 30.037715443593292 0.0373992919921875 3 0.9648993038363007 6.567890648037749 1610.0 79.51988636363637 0.0 - - - - - - - 106.08333333333333 3 12 ACADVL acyl-CoA dehydrogenase, very long chain 1345 172 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20870.[MT7]-AVDHATNR.2b4_1.heavy 514.274 / 567.301 224.0 14.246649742126465 42 16 10 6 10 3.3291479902253642 30.037715443593292 0.0373992919921875 3 0.9648993038363007 6.567890648037749 224.0 5.505310986964618 7.0 - - - - - - - 0.0 0 0 ACADVL acyl-CoA dehydrogenase, very long chain 1347 173 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 200503.0 35.83980178833008 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 200503.0 435.28001709401707 0.0 - - - - - - - 267.42857142857144 401 7 1349 173 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 51003.0 35.83980178833008 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 51003.0 169.22757396449705 1.0 - - - - - - - 429.0 102 9 1351 173 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 47026.0 35.83980178833008 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 47026.0 78.84043392504931 0.0 - - - - - - - 286.0 94 9 1353 174 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584139.[MT7]-GFSASVR.2y5_1.heavy 434.244 / 519.289 16599.0 24.215999603271484 46 17 9 10 10 3.3364270545818666 29.9721823268012 0.0 3 0.9795573022398251 8.616891636793335 16599.0 23.732735481765708 0.0 - - - - - - - 667.1 33 10 IL5RA interleukin 5 receptor, alpha 1355 174 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584139.[MT7]-GFSASVR.2b4_1.heavy 434.244 / 507.268 9566.0 24.215999603271484 46 17 9 10 10 3.3364270545818666 29.9721823268012 0.0 3 0.9795573022398251 8.616891636793335 9566.0 19.57997369113391 0.0 - - - - - - - 690.6428571428571 19 14 IL5RA interleukin 5 receptor, alpha 1357 174 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584139.[MT7]-GFSASVR.2y6_1.heavy 434.244 / 666.357 19908.0 24.215999603271484 46 17 9 10 10 3.3364270545818666 29.9721823268012 0.0 3 0.9795573022398251 8.616891636793335 19908.0 47.457527448950536 0.0 - - - - - - - 687.1428571428571 39 7 IL5RA interleukin 5 receptor, alpha 1359 174 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584139.[MT7]-GFSASVR.2b5_1.heavy 434.244 / 594.3 N/A 24.215999603271484 46 17 9 10 10 3.3364270545818666 29.9721823268012 0.0 3 0.9795573022398251 8.616891636793335 20529.0 13.0017 1.0 - - - - - - - 705.0909090909091 45 11 IL5RA interleukin 5 receptor, alpha 1361 175 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21430.[MT7]-SRGFAFVTFESPADAK[MT7].4y4_1.heavy 505.27 / 548.316 14950.0 37.638648986816406 33 8 10 5 10 0.49674227112499114 96.01010245266548 0.045501708984375 3 0.7883393054527187 2.6336988479865306 14950.0 20.068709019185878 0.0 - - - - - - - 328.3 29 10 RBMXL3;RBMXL2;RBMX;RBMXL1 RNA binding motif protein, X-linked-like 3;RNA binding motif protein, X-linked-like 2;RNA binding motif protein, X-linked;RNA binding motif protein, X-linked-like 1 1363 175 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21430.[MT7]-SRGFAFVTFESPADAK[MT7].4y5_1.heavy 505.27 / 645.369 13613.0 37.638648986816406 33 8 10 5 10 0.49674227112499114 96.01010245266548 0.045501708984375 3 0.7883393054527187 2.6336988479865306 13613.0 30.81131687242798 0.0 - - - - - - - 291.9 27 10 RBMXL3;RBMXL2;RBMX;RBMXL1 RNA binding motif protein, X-linked-like 3;RNA binding motif protein, X-linked-like 2;RNA binding motif protein, X-linked;RNA binding motif protein, X-linked-like 1 1365 175 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21430.[MT7]-SRGFAFVTFESPADAK[MT7].4b8_1.heavy 505.27 / 1010.55 1702.0 37.638648986816406 33 8 10 5 10 0.49674227112499114 96.01010245266548 0.045501708984375 3 0.7883393054527187 2.6336988479865306 1702.0 3.052408069589451 1.0 - - - - - - - 243.4 3 5 RBMXL3;RBMXL2;RBMX;RBMXL1 RNA binding motif protein, X-linked-like 3;RNA binding motif protein, X-linked-like 2;RNA binding motif protein, X-linked;RNA binding motif protein, X-linked-like 1 1367 175 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21430.[MT7]-SRGFAFVTFESPADAK[MT7].4b6_1.heavy 505.27 / 810.438 4862.0 37.638648986816406 33 8 10 5 10 0.49674227112499114 96.01010245266548 0.045501708984375 3 0.7883393054527187 2.6336988479865306 4862.0 36.109646423155986 1.0 - - - - - - - 231.1 9 10 RBMXL3;RBMXL2;RBMX;RBMXL1 RNA binding motif protein, X-linked-like 3;RNA binding motif protein, X-linked-like 2;RNA binding motif protein, X-linked;RNA binding motif protein, X-linked-like 1 1369 176 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21433.[MT7]-NPQAVLDVLEFYNSK[MT7].3b4_1.heavy 675.701 / 555.301 8007.0 47.07350158691406 44 14 10 10 10 1.8878655229241803 52.96987459419595 0.0 3 0.9448476660493228 5.230749203014599 8007.0 36.02014657922722 0.0 - - - - - - - 260.3333333333333 16 15 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1371 176 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21433.[MT7]-NPQAVLDVLEFYNSK[MT7].3b5_1.heavy 675.701 / 654.369 10481.0 47.07350158691406 44 14 10 10 10 1.8878655229241803 52.96987459419595 0.0 3 0.9448476660493228 5.230749203014599 10481.0 48.346329745339986 0.0 - - - - - - - 190.8 20 15 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1373 176 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21433.[MT7]-NPQAVLDVLEFYNSK[MT7].3y4_1.heavy 675.701 / 655.353 9309.0 47.07350158691406 44 14 10 10 10 1.8878655229241803 52.96987459419595 0.0 3 0.9448476660493228 5.230749203014599 9309.0 34.615718521701766 0.0 - - - - - - - 229.64705882352942 18 17 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1375 176 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21433.[MT7]-NPQAVLDVLEFYNSK[MT7].3b7_1.heavy 675.701 / 882.48 11197.0 47.07350158691406 44 14 10 10 10 1.8878655229241803 52.96987459419595 0.0 3 0.9448476660493228 5.230749203014599 11197.0 58.96238033367784 0.0 - - - - - - - 190.42857142857142 22 14 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1377 177 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20874.[MT7]-ELAAQEAR.2y5_1.heavy 516.284 / 574.294 4301.0 20.01180076599121 38 18 0 10 10 5.184107568212957 19.28972319424143 0.0 3 0.9879960719502415 11.252921313089209 4301.0 46.14271359128913 2.0 - - - - - - - 154.85 311 20 PDE1A phosphodiesterase 1A, calmodulin-dependent 1379 177 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20874.[MT7]-ELAAQEAR.2b4_1.heavy 516.284 / 529.31 4532.0 20.01180076599121 38 18 0 10 10 5.184107568212957 19.28972319424143 0.0 3 0.9879960719502415 11.252921313089209 4532.0 24.357565421016687 0.0 - - - - - - - 177.47368421052633 9 19 PDE1A phosphodiesterase 1A, calmodulin-dependent 1381 177 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20874.[MT7]-ELAAQEAR.2y6_1.heavy 516.284 / 645.331 8972.0 20.01180076599121 38 18 0 10 10 5.184107568212957 19.28972319424143 0.0 3 0.9879960719502415 11.252921313089209 8972.0 79.65629081350303 0.0 - - - - - - - 166.3 17 20 PDE1A phosphodiesterase 1A, calmodulin-dependent 1383 177 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20874.[MT7]-ELAAQEAR.2y7_1.heavy 516.284 / 758.416 13781.0 20.01180076599121 38 18 0 10 10 5.184107568212957 19.28972319424143 0.0 3 0.9879960719502415 11.252921313089209 13781.0 80.38916666666665 0.0 - - - - - - - 218.33333333333334 27 18 PDE1A phosphodiesterase 1A, calmodulin-dependent 1385 178 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545182.[MT7]-VTGLAQVLLQWK[MT7]PNPDQEQR.4y4_1.heavy 652.867 / 560.279 17791.0 45.073500633239746 44 18 10 6 10 3.4146170383812295 23.460329644482673 0.037197113037109375 3 0.9847927437334927 9.995051303187994 17791.0 45.426604363083285 0.0 - - - - - - - 653.3333333333334 35 9 IL5RA interleukin 5 receptor, alpha 1387 178 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545182.[MT7]-VTGLAQVLLQWK[MT7]PNPDQEQR.4y8_1.heavy 652.867 / 983.454 28873.0 45.073500633239746 44 18 10 6 10 3.4146170383812295 23.460329644482673 0.037197113037109375 3 0.9847927437334927 9.995051303187994 28873.0 252.28297737795228 0.0 - - - - - - - 202.92307692307693 57 13 IL5RA interleukin 5 receptor, alpha 1389 178 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545182.[MT7]-VTGLAQVLLQWK[MT7]PNPDQEQR.4b4_1.heavy 652.867 / 515.331 32642.0 45.073500633239746 44 18 10 6 10 3.4146170383812295 23.460329644482673 0.037197113037109375 3 0.9847927437334927 9.995051303187994 32642.0 70.79892729104257 0.0 - - - - - - - 710.8571428571429 65 7 IL5RA interleukin 5 receptor, alpha 1391 178 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545182.[MT7]-VTGLAQVLLQWK[MT7]PNPDQEQR.4b6_1.heavy 652.867 / 714.427 42065.0 45.073500633239746 44 18 10 6 10 3.4146170383812295 23.460329644482673 0.037197113037109375 3 0.9847927437334927 9.995051303187994 42065.0 120.17364138623807 0.0 - - - - - - - 266.84615384615387 84 13 IL5RA interleukin 5 receptor, alpha 1393 179 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20879.[MT7]-RFQDAVR.2b4_1.heavy 518.294 / 691.364 4369.0 20.98365020751953 41 16 10 7 8 5.5855452428660755 17.903355116086686 0.02809906005859375 4 0.9649899542308821 6.576438493364675 4369.0 19.893213058419242 0.0 - - - - - - - 188.20833333333334 8 24 PFKP phosphofructokinase, platelet 1395 179 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20879.[MT7]-RFQDAVR.2b6_1.heavy 518.294 / 861.47 1068.0 20.98365020751953 41 16 10 7 8 5.5855452428660755 17.903355116086686 0.02809906005859375 4 0.9649899542308821 6.576438493364675 1068.0 11.750673284968817 0.0 - - - - - - - 121.53846153846153 2 26 PFKP phosphofructokinase, platelet 1397 179 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20879.[MT7]-RFQDAVR.2y6_1.heavy 518.294 / 735.378 1456.0 20.98365020751953 41 16 10 7 8 5.5855452428660755 17.903355116086686 0.02809906005859375 4 0.9649899542308821 6.576438493364675 1456.0 1.807012499007665 1.0 - - - - - - - 155.1153846153846 3 26 PFKP phosphofructokinase, platelet 1399 179 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20879.[MT7]-RFQDAVR.2b5_1.heavy 518.294 / 762.401 825.0 20.98365020751953 41 16 10 7 8 5.5855452428660755 17.903355116086686 0.02809906005859375 4 0.9649899542308821 6.576438493364675 825.0 1.8482498516823458 1.0 - - - - - - - 0.0 1 0 PFKP phosphofructokinase, platelet 1401 180 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545184.[MT7]-RIGTADRELIQTSALNFLTPLR.4y5_1.heavy 658.128 / 599.388 20922.0 43.22740173339844 44 14 10 10 10 1.7509336032508114 41.0183261592311 0.0 3 0.9499329100469365 5.4923390751869 20922.0 55.20123081694419 0.0 - - - - - - - 256.7142857142857 41 14 SH3GLB1 SH3-domain GRB2-like endophilin B1 1403 180 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545184.[MT7]-RIGTADRELIQTSALNFLTPLR.4b16_2.heavy 658.128 / 942.525 29626.0 43.22740173339844 44 14 10 10 10 1.7509336032508114 41.0183261592311 0.0 3 0.9499329100469365 5.4923390751869 29626.0 294.408375 0.0 - - - - - - - 186.46666666666667 59 15 SH3GLB1 SH3-domain GRB2-like endophilin B1 1405 180 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545184.[MT7]-RIGTADRELIQTSALNFLTPLR.4b14_2.heavy 658.128 / 828.961 20602.0 43.22740173339844 44 14 10 10 10 1.7509336032508114 41.0183261592311 0.0 3 0.9499329100469365 5.4923390751869 20602.0 18.266623282895782 1.0 - - - - - - - 209.07692307692307 42 13 SH3GLB1 SH3-domain GRB2-like endophilin B1 1407 180 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545184.[MT7]-RIGTADRELIQTSALNFLTPLR.4y7_1.heavy 658.128 / 860.499 16450.0 43.22740173339844 44 14 10 10 10 1.7509336032508114 41.0183261592311 0.0 3 0.9499329100469365 5.4923390751869 16450.0 82.50071569309226 0.0 - - - - - - - 173.33333333333334 32 12 SH3GLB1 SH3-domain GRB2-like endophilin B1 1409 181 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545186.[MT7]-DLFIATYQAFPPVPNPPRPPTR.4y12_2.heavy 660.362 / 662.878 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB2 arrestin, beta 2 1411 181 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545186.[MT7]-DLFIATYQAFPPVPNPPRPPTR.4b4_1.heavy 660.362 / 633.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB2 arrestin, beta 2 1413 181 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545186.[MT7]-DLFIATYQAFPPVPNPPRPPTR.4b5_1.heavy 660.362 / 704.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB2 arrestin, beta 2 1415 181 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545186.[MT7]-DLFIATYQAFPPVPNPPRPPTR.4b6_1.heavy 660.362 / 805.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - ARRB2 arrestin, beta 2 1417 182 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584120.[MT7]-QALGER.2y5_1.heavy 409.236 / 545.304 27850.0 17.786849975585938 43 20 10 7 6 3.427639762908844 29.174594448961475 0.02809906005859375 6 0.9903602113172285 12.559695752272816 27850.0 40.212033746378225 0.0 - - - - - - - 773.5454545454545 55 11 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 1419 182 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584120.[MT7]-QALGER.2b4_1.heavy 409.236 / 514.311 4545.0 17.786849975585938 43 20 10 7 6 3.427639762908844 29.174594448961475 0.02809906005859375 6 0.9903602113172285 12.559695752272816 4545.0 5.934950436605124 1.0 - - - - - - - 641.6666666666666 9 9 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 1421 182 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584120.[MT7]-QALGER.2y3_1.heavy 409.236 / 361.183 4237.0 17.786849975585938 43 20 10 7 6 3.427639762908844 29.174594448961475 0.02809906005859375 6 0.9903602113172285 12.559695752272816 4237.0 6.429805670558683 2.0 - - - - - - - 1243.0 21 8 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 1423 182 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584120.[MT7]-QALGER.2b5_1.heavy 409.236 / 643.353 9739.0 17.786849975585938 43 20 10 7 6 3.427639762908844 29.174594448961475 0.02809906005859375 6 0.9903602113172285 12.559695752272816 9739.0 16.42153585558082 2.0 - - - - - - - 664.4444444444445 24 9 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 1425 183 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545273.[MT7]-ASNTAEVFFDGVRVPSENVLGEVGSGFK[MT7].4y5_1.heavy 800.917 / 639.358 37391.0 44.82365036010742 37 11 10 6 10 0.7199059220595824 77.9902344335946 0.0373992919921875 3 0.8785796561669459 3.5052666627424545 37391.0 24.422203200269177 0.0 - - - - - - - 320.25 74 4 ACADVL acyl-CoA dehydrogenase, very long chain 1427 183 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545273.[MT7]-ASNTAEVFFDGVRVPSENVLGEVGSGFK[MT7].4b7_1.heavy 800.917 / 817.417 9725.0 44.82365036010742 37 11 10 6 10 0.7199059220595824 77.9902344335946 0.0373992919921875 3 0.8785796561669459 3.5052666627424545 9725.0 42.421463111194576 0.0 - - - - - - - 258.5 19 14 ACADVL acyl-CoA dehydrogenase, very long chain 1429 183 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545273.[MT7]-ASNTAEVFFDGVRVPSENVLGEVGSGFK[MT7].4b18_2.heavy 800.917 / 1033.01 39955.0 44.82365036010742 37 11 10 6 10 0.7199059220595824 77.9902344335946 0.0373992919921875 3 0.8785796561669459 3.5052666627424545 39955.0 25.138405499026366 0.0 - - - - - - - 743.1428571428571 79 7 ACADVL acyl-CoA dehydrogenase, very long chain 1431 183 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545273.[MT7]-ASNTAEVFFDGVRVPSENVLGEVGSGFK[MT7].4b6_1.heavy 800.917 / 718.349 12363.0 44.82365036010742 37 11 10 6 10 0.7199059220595824 77.9902344335946 0.0373992919921875 3 0.8785796561669459 3.5052666627424545 12363.0 17.59158473255347 0.0 - - - - - - - 284.0769230769231 24 13 ACADVL acyl-CoA dehydrogenase, very long chain 1433 184 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21042.[MT7]-C[CAM]LTTPMLLR.2y8_1.heavy 624.85 / 944.56 3284.0 37.554667154947914 35 14 10 5 6 1.7084022022268328 47.181395841660475 0.047199249267578125 6 0.9359120561229561 4.848719233703433 3284.0 29.62458567258028 0.0 - - - - - - - 228.125 6 8 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1435 184 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21042.[MT7]-C[CAM]LTTPMLLR.2y5_1.heavy 624.85 / 629.38 1338.0 37.554667154947914 35 14 10 5 6 1.7084022022268328 47.181395841660475 0.047199249267578125 6 0.9359120561229561 4.848719233703433 1338.0 4.92074074074074 7.0 - - - - - - - 251.46666666666667 4 15 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1437 184 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21042.[MT7]-C[CAM]LTTPMLLR.2y6_1.heavy 624.85 / 730.428 1946.0 37.554667154947914 35 14 10 5 6 1.7084022022268328 47.181395841660475 0.047199249267578125 6 0.9359120561229561 4.848719233703433 1946.0 4.960198962992133 3.0 - - - - - - - 267.7 5 10 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1439 184 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21042.[MT7]-C[CAM]LTTPMLLR.2y7_1.heavy 624.85 / 831.476 N/A 37.554667154947914 35 14 10 5 6 1.7084022022268328 47.181395841660475 0.047199249267578125 6 0.9359120561229561 4.848719233703433 1216.0 2.033333333333333 1.0 - - - - - - - 279.9 3 10 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1441 185 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB586017.[MT7]-AAGYANPVWTALFDYEPSGQDELALRK[MT7].4b8_1.heavy 818.422 / 888.47 7638.0 47.85164928436279 43 17 10 6 10 1.3472971144737023 44.80682037335242 0.034198760986328125 3 0.9779207898971705 8.290262384116904 7638.0 55.57610894941634 0.0 - - - - - - - 192.52941176470588 15 17 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1443 185 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB586017.[MT7]-AAGYANPVWTALFDYEPSGQDELALRK[MT7].4b4_1.heavy 818.422 / 507.268 5648.0 47.85164928436279 43 17 10 6 10 1.3472971144737023 44.80682037335242 0.034198760986328125 3 0.9779207898971705 8.290262384116904 5648.0 21.827496928413584 0.0 - - - - - - - 248.2 11 15 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1445 185 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB586017.[MT7]-AAGYANPVWTALFDYEPSGQDELALRK[MT7].4b5_1.heavy 818.422 / 578.305 5327.0 47.85164928436279 43 17 10 6 10 1.3472971144737023 44.80682037335242 0.034198760986328125 3 0.9779207898971705 8.290262384116904 5327.0 46.46425031753392 0.0 - - - - - - - 176.5 10 16 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1447 185 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB586017.[MT7]-AAGYANPVWTALFDYEPSGQDELALRK[MT7].4b6_1.heavy 818.422 / 692.348 20732.0 47.85164928436279 43 17 10 6 10 1.3472971144737023 44.80682037335242 0.034198760986328125 3 0.9779207898971705 8.290262384116904 20732.0 42.47982182628062 1.0 - - - - - - - 256.53333333333336 41 15 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1449 186 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21149.[MT7]-NSLQQPEGIDR.2b4_1.heavy 700.866 / 587.327 2735.0 24.464399337768555 43 16 10 7 10 2.08262183155491 38.01253439144854 0.029399871826171875 3 0.9600428151463261 6.153300406476324 2735.0 3.3599975898008756 0.0 - - - - - - - 665.1111111111111 5 9 PDE1A phosphodiesterase 1A, calmodulin-dependent 1451 186 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21149.[MT7]-NSLQQPEGIDR.2y6_1.heavy 700.866 / 686.347 4438.0 24.464399337768555 43 16 10 7 10 2.08262183155491 38.01253439144854 0.029399871826171875 3 0.9600428151463261 6.153300406476324 4438.0 16.637476876848677 0.0 - - - - - - - 651.5 8 8 PDE1A phosphodiesterase 1A, calmodulin-dependent 1453 186 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21149.[MT7]-NSLQQPEGIDR.2y10_1.heavy 700.866 / 1142.58 1600.0 24.464399337768555 43 16 10 7 10 2.08262183155491 38.01253439144854 0.029399871826171875 3 0.9600428151463261 6.153300406476324 1600.0 9.63709407432206 1.0 - - - - - - - 164.71428571428572 4 21 PDE1A phosphodiesterase 1A, calmodulin-dependent 1455 186 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21149.[MT7]-NSLQQPEGIDR.2b5_1.heavy 700.866 / 715.385 3096.0 24.464399337768555 43 16 10 7 10 2.08262183155491 38.01253439144854 0.029399871826171875 3 0.9600428151463261 6.153300406476324 3096.0 38.453592233009715 0.0 - - - - - - - 126.0 6 16 PDE1A phosphodiesterase 1A, calmodulin-dependent 1457 187 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21046.[MT7]-ERLTIELSR.3b6_2.heavy 420.918 / 443.759 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM37 tripartite motif-containing 37 1459 187 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21046.[MT7]-ERLTIELSR.3b6_1.heavy 420.918 / 886.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM37 tripartite motif-containing 37 1461 187 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21046.[MT7]-ERLTIELSR.3y4_1.heavy 420.918 / 504.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM37 tripartite motif-containing 37 1463 187 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21046.[MT7]-ERLTIELSR.3y5_1.heavy 420.918 / 617.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM37 tripartite motif-containing 37 1465 188 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21047.[MT7]-ELSGLGSALK[MT7].2y8_1.heavy 631.882 / 876.527 3057.0 33.862674713134766 40 14 10 6 10 5.905353123987402 16.933788361241668 0.03289794921875 3 0.9371196620436335 4.8955616275676315 3057.0 17.202037437507265 0.0 - - - - - - - 148.3684210526316 6 19 ACADVL acyl-CoA dehydrogenase, very long chain 1467 188 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21047.[MT7]-ELSGLGSALK[MT7].2y5_1.heavy 631.882 / 619.39 3371.0 33.862674713134766 40 14 10 6 10 5.905353123987402 16.933788361241668 0.03289794921875 3 0.9371196620436335 4.8955616275676315 3371.0 8.602232854864434 0.0 - - - - - - - 638.2857142857143 6 7 ACADVL acyl-CoA dehydrogenase, very long chain 1469 188 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21047.[MT7]-ELSGLGSALK[MT7].2y9_1.heavy 631.882 / 989.611 3057.0 33.862674713134766 40 14 10 6 10 5.905353123987402 16.933788361241668 0.03289794921875 3 0.9371196620436335 4.8955616275676315 3057.0 9.579759116761458 0.0 - - - - - - - 216.64705882352942 6 17 ACADVL acyl-CoA dehydrogenase, very long chain 1471 188 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21047.[MT7]-ELSGLGSALK[MT7].2b4_1.heavy 631.882 / 531.289 1176.0 33.862674713134766 40 14 10 6 10 5.905353123987402 16.933788361241668 0.03289794921875 3 0.9371196620436335 4.8955616275676315 1176.0 0.0 8.0 - - - - - - - 677.0 5 11 ACADVL acyl-CoA dehydrogenase, very long chain 1473 189 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584542.[MT7]-LLQTSNITK[MT7].3b6_1.heavy 435.938 / 801.459 27369.0 30.172300338745117 47 17 10 10 10 4.7081908441070945 21.23958083074794 0.0 3 0.9772512108679824 8.166885479379015 27369.0 55.458596900516575 0.0 - - - - - - - 191.41666666666666 54 12 PAK1;PAK2;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3 1475 189 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584542.[MT7]-LLQTSNITK[MT7].3y3_1.heavy 435.938 / 505.347 57210.0 30.172300338745117 47 17 10 10 10 4.7081908441070945 21.23958083074794 0.0 3 0.9772512108679824 8.166885479379015 57210.0 55.114541921905364 0.0 - - - - - - - 1210.7142857142858 114 7 PAK1;PAK2;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3 1477 189 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584542.[MT7]-LLQTSNITK[MT7].3y4_1.heavy 435.938 / 619.39 51383.0 30.172300338745117 47 17 10 10 10 4.7081908441070945 21.23958083074794 0.0 3 0.9772512108679824 8.166885479379015 51383.0 59.4996365756084 0.0 - - - - - - - 743.8181818181819 102 11 PAK1;PAK2;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3 1479 189 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584542.[MT7]-LLQTSNITK[MT7].3b3_1.heavy 435.938 / 499.336 86286.0 30.172300338745117 47 17 10 10 10 4.7081908441070945 21.23958083074794 0.0 3 0.9772512108679824 8.166885479379015 86286.0 29.665186548192622 0.0 - - - - - - - 559.5 172 2 PAK1;PAK2;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3 1481 190 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21048.[MT7]-ILGEEQYNR.2y4_1.heavy 633.334 / 580.284 1436.0 28.17655038833618 44 20 10 6 8 34.39857537368944 2.9070971374148056 0.03660011291503906 4 0.9984981594708642 31.841688636244395 1436.0 4.629476592805144 1.0 - - - - - - - 699.5454545454545 9 11 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1483 190 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21048.[MT7]-ILGEEQYNR.2y8_1.heavy 633.334 / 1008.47 12116.0 28.17655038833618 44 20 10 6 8 34.39857537368944 2.9070971374148056 0.03660011291503906 4 0.9984981594708642 31.841688636244395 12116.0 99.22705898213682 0.0 - - - - - - - 189.11764705882354 24 17 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1485 190 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21048.[MT7]-ILGEEQYNR.2y5_1.heavy 633.334 / 709.326 1321.0 28.17655038833618 44 20 10 6 8 34.39857537368944 2.9070971374148056 0.03660011291503906 4 0.9984981594708642 31.841688636244395 1321.0 9.212458058544486 0.0 - - - - - - - 172.125 2 16 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1487 190 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21048.[MT7]-ILGEEQYNR.2y7_1.heavy 633.334 / 895.39 5800.0 28.17655038833618 44 20 10 6 8 34.39857537368944 2.9070971374148056 0.03660011291503906 4 0.9984981594708642 31.841688636244395 5800.0 46.5160845960619 0.0 - - - - - - - 137.66666666666666 11 15 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1489 191 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545074.[MT7]-VQFAPEK[MT7]PGPQPSAETTR.4b4_1.heavy 557.803 / 590.342 17222.0 26.981700897216797 50 20 10 10 10 8.717470794737295 11.471217094339982 0.0 3 0.996435201613611 20.66406621097525 17222.0 81.45200292397661 0.0 - - - - - - - 216.6 34 20 ARRB2 arrestin, beta 2 1491 191 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545074.[MT7]-VQFAPEK[MT7]PGPQPSAETTR.4y7_1.heavy 557.803 / 761.379 44140.0 26.981700897216797 50 20 10 10 10 8.717470794737295 11.471217094339982 0.0 3 0.996435201613611 20.66406621097525 44140.0 296.84795321637426 0.0 - - - - - - - 207.0 88 19 ARRB2 arrestin, beta 2 1493 191 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545074.[MT7]-VQFAPEK[MT7]PGPQPSAETTR.4y6_1.heavy 557.803 / 664.326 14428.0 26.981700897216797 50 20 10 10 10 8.717470794737295 11.471217094339982 0.0 3 0.996435201613611 20.66406621097525 14428.0 110.10842105263158 0.0 - - - - - - - 173.71428571428572 28 21 ARRB2 arrestin, beta 2 1495 191 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545074.[MT7]-VQFAPEK[MT7]PGPQPSAETTR.4b3_1.heavy 557.803 / 519.305 22811.0 26.981700897216797 50 20 10 10 10 8.717470794737295 11.471217094339982 0.0 3 0.996435201613611 20.66406621097525 22811.0 48.56484816116104 0.0 - - - - - - - 658.6666666666666 45 9 ARRB2 arrestin, beta 2 1497 192 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21543.[MT7]-GITNLC[CAM]VIGGDGSLTGANLFRK[MT7].3b6_1.heavy 851.135 / 803.42 2891.0 40.868600845336914 46 20 10 6 10 7.6886108203654 13.006250717635817 0.03600311279296875 3 0.9947033224028038 16.949961684912086 2891.0 7.956232648302471 0.0 - - - - - - - 249.23076923076923 5 13 PFKP phosphofructokinase, platelet 1499 192 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21543.[MT7]-GITNLC[CAM]VIGGDGSLTGANLFRK[MT7].3b4_1.heavy 851.135 / 530.305 5256.0 40.868600845336914 46 20 10 6 10 7.6886108203654 13.006250717635817 0.03600311279296875 3 0.9947033224028038 16.949961684912086 5256.0 10.00507614213198 0.0 - - - - - - - 242.23529411764707 10 17 PFKP phosphofructokinase, platelet 1501 192 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21543.[MT7]-GITNLC[CAM]VIGGDGSLTGANLFRK[MT7].3b5_1.heavy 851.135 / 643.39 3591.0 40.868600845336914 46 20 10 6 10 7.6886108203654 13.006250717635817 0.03600311279296875 3 0.9947033224028038 16.949961684912086 3591.0 6.144296577946768 1.0 - - - - - - - 713.5714285714286 9 7 PFKP phosphofructokinase, platelet 1503 192 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21543.[MT7]-GITNLC[CAM]VIGGDGSLTGANLFRK[MT7].3y8_1.heavy 851.135 / 1050.62 2715.0 40.868600845336914 46 20 10 6 10 7.6886108203654 13.006250717635817 0.03600311279296875 3 0.9947033224028038 16.949961684912086 2715.0 1.0492154065620543 1.0 - - - - - - - 285.89473684210526 5 19 PFKP phosphofructokinase, platelet 1505 193 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21051.[MT7]-GTALLASLGLGR.2y8_1.heavy 636.891 / 786.483 12006.0 42.87289810180664 44 18 10 10 6 6.065843108227603 16.48575444761533 0.0 5 0.9883427020596839 11.419330046369145 12006.0 37.76412431673807 0.0 - - - - - - - 206.0 24 9 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1507 193 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21051.[MT7]-GTALLASLGLGR.2y9_1.heavy 636.891 / 899.567 5479.0 42.87289810180664 44 18 10 10 6 6.065843108227603 16.48575444761533 0.0 5 0.9883427020596839 11.419330046369145 5479.0 27.54995530416288 2.0 - - - - - - - 207.28571428571428 15 14 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1509 193 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21051.[MT7]-GTALLASLGLGR.2y10_1.heavy 636.891 / 970.604 5318.0 42.87289810180664 44 18 10 10 6 6.065843108227603 16.48575444761533 0.0 5 0.9883427020596839 11.419330046369145 5318.0 36.84054668651506 0.0 - - - - - - - 172.78571428571428 10 14 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1511 193 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21051.[MT7]-GTALLASLGLGR.2y7_1.heavy 636.891 / 673.399 12006.0 42.87289810180664 44 18 10 10 6 6.065843108227603 16.48575444761533 0.0 5 0.9883427020596839 11.419330046369145 12006.0 104.4 1.0 - - - - - - - 254.07692307692307 24 13 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1513 194 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21540.[MT7]-QATLTLTQGPSC[CAM]WDDVLIPNR.3b9_1.heavy 843.768 / 1058.6 2364.0 43.246551513671875 37 13 10 6 8 1.5415551651907848 43.812027574685516 0.038299560546875 4 0.9243397246168862 4.458116156388639 2364.0 7.590000000000001 0.0 - - - - - - - 278.1764705882353 4 17 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1515 194 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21540.[MT7]-QATLTLTQGPSC[CAM]WDDVLIPNR.3b6_1.heavy 843.768 / 772.469 2758.0 43.246551513671875 37 13 10 6 8 1.5415551651907848 43.812027574685516 0.038299560546875 4 0.9243397246168862 4.458116156388639 2758.0 5.6000000000000005 1.0 - - - - - - - 333.70588235294116 5 17 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1517 194 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21540.[MT7]-QATLTLTQGPSC[CAM]WDDVLIPNR.3b4_1.heavy 843.768 / 558.337 5516.0 43.246551513671875 37 13 10 6 8 1.5415551651907848 43.812027574685516 0.038299560546875 4 0.9243397246168862 4.458116156388639 5516.0 22.390528541226214 0.0 - - - - - - - 669.75 11 8 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1519 194 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21540.[MT7]-QATLTLTQGPSC[CAM]WDDVLIPNR.3b5_1.heavy 843.768 / 659.385 4334.0 43.246551513671875 37 13 10 6 8 1.5415551651907848 43.812027574685516 0.038299560546875 4 0.9243397246168862 4.458116156388639 4334.0 9.010058834636155 0.0 - - - - - - - 267.8 8 15 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1521 195 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540381.[MT7]-TSGSNVK[MT7].2y5_1.heavy 490.784 / 648.38 1668.0 15.04787540435791 46 20 10 6 10 11.623796942634653 8.603040856057312 0.0345001220703125 3 0.9971033975771908 22.925194961557498 1668.0 19.03170868347339 0.0 - - - - - - - 121.22727272727273 3 22 ATP5E ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit 1523 195 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540381.[MT7]-TSGSNVK[MT7].2y3_1.heavy 490.784 / 504.326 932.0 15.04787540435791 46 20 10 6 10 11.623796942634653 8.603040856057312 0.0345001220703125 3 0.9971033975771908 22.925194961557498 932.0 14.819157088122605 0.0 - - - - - - - 0.0 1 0 ATP5E ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit 1525 195 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540381.[MT7]-TSGSNVK[MT7].2b6_1.heavy 490.784 / 690.354 975.0 15.04787540435791 46 20 10 6 10 11.623796942634653 8.603040856057312 0.0345001220703125 3 0.9971033975771908 22.925194961557498 975.0 11.777336223506744 0.0 - - - - - - - 0.0 1 0 ATP5E ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit 1527 195 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB540381.[MT7]-TSGSNVK[MT7].2y6_1.heavy 490.784 / 735.412 3423.0 15.04787540435791 46 20 10 6 10 11.623796942634653 8.603040856057312 0.0345001220703125 3 0.9971033975771908 22.925194961557498 3423.0 46.941727806309615 0.0 - - - - - - - 128.95 6 20 ATP5E ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit 1529 196 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20863.[MT7]-SILPGDK[MT7].2b3_1.heavy 509.313 / 458.31 30327.0 27.1968994140625 46 16 10 10 10 1.1568578347310674 53.11330665865699 0.0 3 0.9663054175801711 6.704328398816554 30327.0 55.92096243803745 0.0 - - - - - - - 1244.625 60 8 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1531 196 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20863.[MT7]-SILPGDK[MT7].2y4_1.heavy 509.313 / 560.316 62886.0 27.1968994140625 46 16 10 10 10 1.1568578347310674 53.11330665865699 0.0 3 0.9663054175801711 6.704328398816554 62886.0 91.76499102583081 0.0 - - - - - - - 703.8 125 10 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1533 196 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20863.[MT7]-SILPGDK[MT7].2y5_1.heavy 509.313 / 673.4 9155.0 27.1968994140625 46 16 10 10 10 1.1568578347310674 53.11330665865699 0.0 3 0.9663054175801711 6.704328398816554 9155.0 13.820863309352518 0.0 - - - - - - - 697.0 18 11 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1535 196 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20863.[MT7]-SILPGDK[MT7].2b6_1.heavy 509.313 / 727.411 4978.0 27.1968994140625 46 16 10 10 10 1.1568578347310674 53.11330665865699 0.0 3 0.9663054175801711 6.704328398816554 4978.0 17.398834951456312 0.0 - - - - - - - 246.94736842105263 9 19 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1537 197 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544752.[MT7]-RNVFEVGPGDSPTFPR.3y6_1.heavy 640.335 / 704.373 5297.0 34.742000579833984 48 18 10 10 10 3.907680931872084 25.59062567887092 0.0 3 0.9850518977121601 10.081539607549285 5297.0 16.647714285714287 0.0 - - - - - - - 231.25 10 16 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1539 197 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544752.[MT7]-RNVFEVGPGDSPTFPR.3b5_1.heavy 640.335 / 790.433 4897.0 34.742000579833984 48 18 10 10 10 3.907680931872084 25.59062567887092 0.0 3 0.9850518977121601 10.081539607549285 4897.0 11.134740197340196 0.0 - - - - - - - 677.4444444444445 9 9 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1541 197 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544752.[MT7]-RNVFEVGPGDSPTFPR.3y5_1.heavy 640.335 / 617.341 4797.0 34.742000579833984 48 18 10 10 10 3.907680931872084 25.59062567887092 0.0 3 0.9850518977121601 10.081539607549285 4797.0 7.457784408825103 0.0 - - - - - - - 854.6666666666666 9 9 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1543 197 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544752.[MT7]-RNVFEVGPGDSPTFPR.3y10_1.heavy 640.335 / 1030.5 3098.0 34.742000579833984 48 18 10 10 10 3.907680931872084 25.59062567887092 0.0 3 0.9850518977121601 10.081539607549285 3098.0 21.763450000000002 0.0 - - - - - - - 180.0 6 15 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1545 198 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545172.[MT7]-LLDTEDELSDIQTDSVPSEVR.3b6_1.heavy 835.749 / 831.422 6753.0 39.68119812011719 45 15 10 10 10 1.6603980926520854 48.064755919802366 0.0 3 0.9543741817496584 5.755615780425393 6753.0 24.679326538576547 0.0 - - - - - - - 288.2 13 10 PDE1A phosphodiesterase 1A, calmodulin-dependent 1547 198 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545172.[MT7]-LLDTEDELSDIQTDSVPSEVR.3b5_1.heavy 835.749 / 716.395 3376.0 39.68119812011719 45 15 10 10 10 1.6603980926520854 48.064755919802366 0.0 3 0.9543741817496584 5.755615780425393 3376.0 52.17454545454545 0.0 - - - - - - - 278.1333333333333 6 15 PDE1A phosphodiesterase 1A, calmodulin-dependent 1549 198 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545172.[MT7]-LLDTEDELSDIQTDSVPSEVR.3b7_1.heavy 835.749 / 960.464 10825.0 39.68119812011719 45 15 10 10 10 1.6603980926520854 48.064755919802366 0.0 3 0.9543741817496584 5.755615780425393 10825.0 37.0831234256927 0.0 - - - - - - - 260.8125 21 16 PDE1A phosphodiesterase 1A, calmodulin-dependent 1551 198 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB545172.[MT7]-LLDTEDELSDIQTDSVPSEVR.3y9_1.heavy 835.749 / 989.49 9434.0 39.68119812011719 45 15 10 10 10 1.6603980926520854 48.064755919802366 0.0 3 0.9543741817496584 5.755615780425393 9434.0 46.71307625986848 0.0 - - - - - - - 165.46666666666667 18 15 PDE1A phosphodiesterase 1A, calmodulin-dependent 1553 199 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544449.[MT7]-AQLDAAVTFGPSQVAR.2y12_1.heavy 887.982 / 1203.65 4802.0 35.165048599243164 37 12 10 5 10 0.8812241683001405 67.31563188017611 0.043498992919921875 3 0.8943875282082251 3.763624478505261 4802.0 47.32248134328358 0.0 - - - - - - - 178.8 9 10 ARSA arylsulfatase A 1555 199 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544449.[MT7]-AQLDAAVTFGPSQVAR.2y9_1.heavy 887.982 / 962.505 9938.0 35.165048599243164 37 12 10 5 10 0.8812241683001405 67.31563188017611 0.043498992919921875 3 0.8943875282082251 3.763624478505261 9938.0 53.39820895522388 0.0 - - - - - - - 139.83333333333334 19 12 ARSA arylsulfatase A 1557 199 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544449.[MT7]-AQLDAAVTFGPSQVAR.2b4_1.heavy 887.982 / 572.316 7370.0 35.165048599243164 37 12 10 5 10 0.8812241683001405 67.31563188017611 0.043498992919921875 3 0.8943875282082251 3.763624478505261 7370.0 41.51686098654709 0.0 - - - - - - - 191.42857142857142 14 7 ARSA arylsulfatase A 1559 199 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544449.[MT7]-AQLDAAVTFGPSQVAR.2y11_1.heavy 887.982 / 1132.61 3797.0 35.165048599243164 37 12 10 5 10 0.8812241683001405 67.31563188017611 0.043498992919921875 3 0.8943875282082251 3.763624478505261 3797.0 8.6361496544125 1.0 - - - - - - - 223.36363636363637 7 11 ARSA arylsulfatase A 1561 200 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21053.[MT7]-NFIEGDYK[MT7].2b3_1.heavy 637.337 / 519.305 4558.0 30.42770004272461 42 12 10 10 10 1.8689205506048039 42.57948345561696 0.0 3 0.8957014557927513 3.787688284074128 4558.0 27.8617866101971 0.0 - - - - - - - 233.77272727272728 9 22 SH3GLB1 SH3-domain GRB2-like endophilin B1 1563 200 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21053.[MT7]-NFIEGDYK[MT7].2y4_1.heavy 637.337 / 626.327 3916.0 30.42770004272461 42 12 10 10 10 1.8689205506048039 42.57948345561696 0.0 3 0.8957014557927513 3.787688284074128 3916.0 6.302049168799753 0.0 - - - - - - - 300.6666666666667 7 21 SH3GLB1 SH3-domain GRB2-like endophilin B1 1565 200 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21053.[MT7]-NFIEGDYK[MT7].2y5_1.heavy 637.337 / 755.369 3039.0 30.42770004272461 42 12 10 10 10 1.8689205506048039 42.57948345561696 0.0 3 0.8957014557927513 3.787688284074128 3039.0 10.140674394099053 0.0 - - - - - - - 238.44 6 25 SH3GLB1 SH3-domain GRB2-like endophilin B1 1567 200 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21053.[MT7]-NFIEGDYK[MT7].2y7_1.heavy 637.337 / 1015.52 3273.0 30.42770004272461 42 12 10 10 10 1.8689205506048039 42.57948345561696 0.0 3 0.8957014557927513 3.787688284074128 3273.0 18.74282051282051 0.0 - - - - - - - 199.22727272727272 6 22 SH3GLB1 SH3-domain GRB2-like endophilin B1 1569 201 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544860.[MT7]-QYADIC[CAM]LFSTAQYK[MT7].3y6_1.heavy 666.008 / 841.454 4784.0 39.64070129394531 48 18 10 10 10 5.144891545902176 19.43675568431533 0.0 3 0.984714633707348 9.969415390165702 4784.0 57.48198294551236 0.0 - - - - - - - 195.25 9 12 ARRB2 arrestin, beta 2 1571 201 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544860.[MT7]-QYADIC[CAM]LFSTAQYK[MT7].3b6_1.heavy 666.008 / 895.41 7226.0 39.64070129394531 48 18 10 10 10 5.144891545902176 19.43675568431533 0.0 3 0.984714633707348 9.969415390165702 7226.0 26.85926257756045 0.0 - - - - - - - 203.66666666666666 14 12 ARRB2 arrestin, beta 2 1573 201 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544860.[MT7]-QYADIC[CAM]LFSTAQYK[MT7].3b4_1.heavy 666.008 / 622.295 16387.0 39.64070129394531 48 18 10 10 10 5.144891545902176 19.43675568431533 0.0 3 0.984714633707348 9.969415390165702 16387.0 33.97879040730709 0.0 - - - - - - - 235.0 32 13 ARRB2 arrestin, beta 2 1575 201 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544860.[MT7]-QYADIC[CAM]LFSTAQYK[MT7].3b5_1.heavy 666.008 / 735.379 7532.0 39.64070129394531 48 18 10 10 10 5.144891545902176 19.43675568431533 0.0 3 0.984714633707348 9.969415390165702 7532.0 16.869312377210214 0.0 - - - - - - - 701.2222222222222 15 9 ARRB2 arrestin, beta 2 1577 202 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB539485.[MT7]-SVGAQK[MT7].2b3_1.heavy 439.271 / 388.231 N/A N/A - - - - - - - - - 0.0 - - - - - - - MDM2 Mdm2 p53 binding protein homolog (mouse) 1579 202 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB539485.[MT7]-SVGAQK[MT7].2y4_1.heavy 439.271 / 547.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - MDM2 Mdm2 p53 binding protein homolog (mouse) 1581 202 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB539485.[MT7]-SVGAQK[MT7].2y5_1.heavy 439.271 / 646.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - MDM2 Mdm2 p53 binding protein homolog (mouse) 1583 202 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB539485.[MT7]-SVGAQK[MT7].2y3_1.heavy 439.271 / 490.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - MDM2 Mdm2 p53 binding protein homolog (mouse) 1585 203 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21195.[MT7]-GIVNEQFLLQR.3b6_1.heavy 487.616 / 785.427 4331.0 37.9370002746582 47 17 10 10 10 2.992266264914875 33.41948581666239 0.0 3 0.9772314711868215 8.163330938856747 4331.0 23.943162211714753 0.0 - - - - - - - 250.58333333333334 8 12 ACADVL acyl-CoA dehydrogenase, very long chain 1587 203 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21195.[MT7]-GIVNEQFLLQR.3b5_1.heavy 487.616 / 657.369 7218.0 37.9370002746582 47 17 10 10 10 2.992266264914875 33.41948581666239 0.0 3 0.9772314711868215 8.163330938856747 7218.0 11.80821962057625 1.0 - - - - - - - 197.5 15 14 ACADVL acyl-CoA dehydrogenase, very long chain 1589 203 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21195.[MT7]-GIVNEQFLLQR.3y4_1.heavy 487.616 / 529.346 35009.0 37.9370002746582 47 17 10 10 10 2.992266264914875 33.41948581666239 0.0 3 0.9772314711868215 8.163330938856747 35009.0 101.60616216216218 0.0 - - - - - - - 390.875 70 8 ACADVL acyl-CoA dehydrogenase, very long chain 1591 203 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21195.[MT7]-GIVNEQFLLQR.3y5_1.heavy 487.616 / 676.414 31399.0 37.9370002746582 47 17 10 10 10 2.992266264914875 33.41948581666239 0.0 3 0.9772314711868215 8.163330938856747 31399.0 88.50756151893309 0.0 - - - - - - - 240.5 62 6 ACADVL acyl-CoA dehydrogenase, very long chain 1593 204 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21199.[MT7]-VQAMQPAFASK[MT7].3b4_1.heavy 489.274 / 574.314 7624.0 30.04390001296997 34 13 10 3 8 1.1344202988105387 53.2690347486192 0.06419944763183594 4 0.9168704108207436 4.250392736951899 7624.0 8.757920193470374 3.0 - - - - - - - 676.9090909090909 31 11 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 1595 204 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21199.[MT7]-VQAMQPAFASK[MT7].3b5_1.heavy 489.274 / 702.372 6442.0 30.04390001296997 34 13 10 3 8 1.1344202988105387 53.2690347486192 0.06419944763183594 4 0.9168704108207436 4.250392736951899 6442.0 3.8576099210822994 1.0 - - - - - - - 633.2857142857143 12 7 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 1597 204 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21199.[MT7]-VQAMQPAFASK[MT7].3y4_1.heavy 489.274 / 596.352 15544.0 30.04390001296997 34 13 10 3 8 1.1344202988105387 53.2690347486192 0.06419944763183594 4 0.9168704108207436 4.250392736951899 15544.0 51.539200480784714 0.0 - - - - - - - 692.2857142857143 31 7 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 1599 204 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21199.[MT7]-VQAMQPAFASK[MT7].3y5_1.heavy 489.274 / 667.39 2482.0 30.04390001296997 34 13 10 3 8 1.1344202988105387 53.2690347486192 0.06419944763183594 4 0.9168704108207436 4.250392736951899 2482.0 5.995894011881604 0.0 - - - - - - - 182.125 4 24 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 1601 205 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20790.[MT7]-ASTFSK[MT7].2y4_1.heavy 464.771 / 626.363 2926.0 21.11709976196289 43 16 10 7 10 3.876741396399293 25.79485959338937 0.0279998779296875 3 0.9685402456219929 6.939681122838907 2926.0 7.77865144979631 0.0 - - - - - - - 247.57894736842104 5 19 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1603 205 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20790.[MT7]-ASTFSK[MT7].2y5_1.heavy 464.771 / 713.395 5611.0 21.11709976196289 43 16 10 7 10 3.876741396399293 25.79485959338937 0.0279998779296875 3 0.9685402456219929 6.939681122838907 5611.0 23.379166666666663 0.0 - - - - - - - 262.7368421052632 11 19 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1605 205 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20790.[MT7]-ASTFSK[MT7].2b4_1.heavy 464.771 / 551.295 1631.0 21.11709976196289 43 16 10 7 10 3.876741396399293 25.79485959338937 0.0279998779296875 3 0.9685402456219929 6.939681122838907 1631.0 0.4258345495026573 4.0 - - - - - - - 664.5714285714286 4 7 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1607 205 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20790.[MT7]-ASTFSK[MT7].2y3_1.heavy 464.771 / 525.315 2542.0 21.11709976196289 43 16 10 7 10 3.876741396399293 25.79485959338937 0.0279998779296875 3 0.9685402456219929 6.939681122838907 2542.0 3.6286718918585654 2.0 - - - - - - - 618.3333333333334 5 9 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1609 206 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543081.[MT7]-ISQGTFADVYR.2y8_1.heavy 700.868 / 928.452 7514.0 33.96682548522949 46 20 10 6 10 12.671966792901438 7.891434820995414 0.03549957275390625 3 0.9923174928459879 14.07124262390906 7514.0 26.31369874804382 0.0 - - - - - - - 258.8235294117647 15 17 IRAK2 interleukin-1 receptor-associated kinase 2 1611 206 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543081.[MT7]-ISQGTFADVYR.2y5_1.heavy 700.868 / 623.315 1519.0 33.96682548522949 46 20 10 6 10 12.671966792901438 7.891434820995414 0.03549957275390625 3 0.9923174928459879 14.07124262390906 1519.0 1.690125173852573 3.0 - - - - - - - 336.8421052631579 3 19 IRAK2 interleukin-1 receptor-associated kinase 2 1613 206 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543081.[MT7]-ISQGTFADVYR.2y9_1.heavy 700.868 / 1056.51 4476.0 33.96682548522949 46 20 10 6 10 12.671966792901438 7.891434820995414 0.03549957275390625 3 0.9923174928459879 14.07124262390906 4476.0 30.725874999999995 0.0 - - - - - - - 230.58823529411765 8 17 IRAK2 interleukin-1 receptor-associated kinase 2 1615 206 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543081.[MT7]-ISQGTFADVYR.2y10_1.heavy 700.868 / 1143.54 16147.0 33.96682548522949 46 20 10 6 10 12.671966792901438 7.891434820995414 0.03549957275390625 3 0.9923174928459879 14.07124262390906 16147.0 32.300646037663256 0.0 - - - - - - - 789.125 32 8 IRAK2 interleukin-1 receptor-associated kinase 2 1617 207 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544445.[MT7]-NVFEVGPGDSPTFPR.3y6_1.heavy 588.301 / 704.373 7618.0 38.108299255371094 44 14 10 10 10 8.117645682430696 12.318842668439382 0.0 3 0.9497281107296311 5.481044918998006 7618.0 -0.3829185014293911 2.0 - - - - - - - 323.3 16 10 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1619 207 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544445.[MT7]-NVFEVGPGDSPTFPR.3b4_1.heavy 588.301 / 634.332 24586.0 38.108299255371094 44 14 10 10 10 8.117645682430696 12.318842668439382 0.0 3 0.9497281107296311 5.481044918998006 24586.0 86.02582203814117 0.0 - - - - - - - 205.0 49 9 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1621 207 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544445.[MT7]-NVFEVGPGDSPTFPR.3b3_1.heavy 588.301 / 505.289 9696.0 38.108299255371094 44 14 10 10 10 8.117645682430696 12.318842668439382 0.0 3 0.9497281107296311 5.481044918998006 9696.0 7.9028520348153375 0.0 - - - - - - - 231.0 19 4 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1623 207 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544445.[MT7]-NVFEVGPGDSPTFPR.3y5_1.heavy 588.301 / 617.341 16506.0 38.108299255371094 44 14 10 10 10 8.117645682430696 12.318842668439382 0.0 3 0.9497281107296311 5.481044918998006 16506.0 51.09020639672286 0.0 - - - - - - - 288.5 33 8 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1625 208 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543087.[MT7]-SLHLEASLDK[MT7].3y3_1.heavy 467.604 / 519.326 10760.0 29.597999572753906 36 20 0 10 6 9.775176707163352 10.229994095832453 0.0 5 0.9946923046399411 16.932344525899456 10760.0 25.85341868286861 0.0 - - - - - - - 701.0 21 14 ARRB2 arrestin, beta 2 1627 208 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543087.[MT7]-SLHLEASLDK[MT7].3y4_1.heavy 467.604 / 606.358 16909.0 29.597999572753906 36 20 0 10 6 9.775176707163352 10.229994095832453 0.0 5 0.9946923046399411 16.932344525899456 16909.0 24.645363856572022 1.0 - - - - - - - 694.625 382 8 ARRB2 arrestin, beta 2 1629 208 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543087.[MT7]-SLHLEASLDK[MT7].3b3_1.heavy 467.604 / 482.284 35000.0 29.597999572753906 36 20 0 10 6 9.775176707163352 10.229994095832453 0.0 5 0.9946923046399411 16.932344525899456 35000.0 40.479742303491236 1.0 - - - - - - - 414.0 677 2 ARRB2 arrestin, beta 2 1631 208 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543087.[MT7]-SLHLEASLDK[MT7].3y5_1.heavy 467.604 / 677.395 16554.0 29.597999572753906 36 20 0 10 6 9.775176707163352 10.229994095832453 0.0 5 0.9946923046399411 16.932344525899456 16554.0 42.81283088349212 0.0 - - - - - - - 285.2352941176471 33 17 ARRB2 arrestin, beta 2 1633 209 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21256.[MT7]-NSLEDLTAEDFR.2b4_1.heavy 777.382 / 588.311 4337.0 37.89189910888672 46 16 10 10 10 2.146841655371676 37.10263008250511 0.0 3 0.9631573263356085 6.409797662485612 4337.0 5.403583500361326 2.0 - - - - - - - 200.66666666666666 8 6 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 1635 209 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21256.[MT7]-NSLEDLTAEDFR.2y9_1.heavy 777.382 / 1095.5 6746.0 37.89189910888672 46 16 10 10 10 2.146841655371676 37.10263008250511 0.0 3 0.9631573263356085 6.409797662485612 6746.0 13.816378326762253 0.0 - - - - - - - 306.45454545454544 13 11 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 1637 209 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21256.[MT7]-NSLEDLTAEDFR.2b5_1.heavy 777.382 / 703.338 9998.0 37.89189910888672 46 16 10 10 10 2.146841655371676 37.10263008250511 0.0 3 0.9631573263356085 6.409797662485612 9998.0 2.38085161462468 1.0 - - - - - - - 317.45454545454544 23 11 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 1639 209 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21256.[MT7]-NSLEDLTAEDFR.2y7_1.heavy 777.382 / 851.426 5782.0 37.89189910888672 46 16 10 10 10 2.146841655371676 37.10263008250511 0.0 3 0.9631573263356085 6.409797662485612 5782.0 26.71312152623601 0.0 - - - - - - - 228.7 11 10 UBR5;LOC730429 ubiquitin protein ligase E3 component n-recognin 5;e3 ubiquitin-protein ligase UBR5-like 1641 210 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20894.[MT7]-QAGLSYIR.2b4_1.heavy 526.304 / 514.311 4703.0 28.861000061035156 48 18 10 10 10 7.53895648376904 13.264435232554337 0.0 3 0.9874059541264448 10.985577305133928 4703.0 11.863871450883995 0.0 - - - - - - - 714.8461538461538 9 13 ATP5E ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit 1643 210 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20894.[MT7]-QAGLSYIR.2y6_1.heavy 526.304 / 708.404 6038.0 28.861000061035156 48 18 10 10 10 7.53895648376904 13.264435232554337 0.0 3 0.9874059541264448 10.985577305133928 6038.0 19.53776247848537 0.0 - - - - - - - 259.06666666666666 12 15 ATP5E ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit 1645 210 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20894.[MT7]-QAGLSYIR.2b5_1.heavy 526.304 / 601.343 3774.0 28.861000061035156 48 18 10 10 10 7.53895648376904 13.264435232554337 0.0 3 0.9874059541264448 10.985577305133928 3774.0 16.47639162561576 0.0 - - - - - - - 314.85714285714283 7 14 ATP5E ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit 1647 210 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20894.[MT7]-QAGLSYIR.2y7_1.heavy 526.304 / 779.441 17592.0 28.861000061035156 48 18 10 10 10 7.53895648376904 13.264435232554337 0.0 3 0.9874059541264448 10.985577305133928 17592.0 79.2398275862069 0.0 - - - - - - - 261.0 35 16 ATP5E ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit 1649 211 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21596.[MT7]-LLDTEDELSDIQTDSVPSEVRDWLASTFTRK[MT7].4b7_1.heavy 964.494 / 960.464 3690.0 50.49589920043945 39 9 10 10 10 0.49075715391803876 94.85177627450898 0.0 3 0.8105053953053252 2.7890376908788674 3690.0 19.26887227366056 0.0 - - - - - - - 176.125 7 16 PDE1A phosphodiesterase 1A, calmodulin-dependent 1651 211 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21596.[MT7]-LLDTEDELSDIQTDSVPSEVRDWLASTFTRK[MT7].4b5_1.heavy 964.494 / 716.395 1202.0 50.49589920043945 39 9 10 10 10 0.49075715391803876 94.85177627450898 0.0 3 0.8105053953053252 2.7890376908788674 1202.0 5.424633998790078 0.0 - - - - - - - 147.16666666666666 2 18 PDE1A phosphodiesterase 1A, calmodulin-dependent 1653 211 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21596.[MT7]-LLDTEDELSDIQTDSVPSEVRDWLASTFTRK[MT7].4y19_2.heavy 964.494 / 1170.11 4437.0 50.49589920043945 39 9 10 10 10 0.49075715391803876 94.85177627450898 0.0 3 0.8105053953053252 2.7890376908788674 4437.0 17.46833475380622 0.0 - - - - - - - 162.93333333333334 8 15 PDE1A phosphodiesterase 1A, calmodulin-dependent 1655 211 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21596.[MT7]-LLDTEDELSDIQTDSVPSEVRDWLASTFTRK[MT7].4b6_1.heavy 964.494 / 831.422 1659.0 50.49589920043945 39 9 10 10 10 0.49075715391803876 94.85177627450898 0.0 3 0.8105053953053252 2.7890376908788674 1659.0 19.92247779336138 0.0 - - - - - - - 159.30769230769232 3 13 PDE1A phosphodiesterase 1A, calmodulin-dependent 1657 212 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20892.[MT7]-EDVFVHQTAIK[MT7].3b4_1.heavy 525.631 / 635.316 14964.0 28.901399612426758 44 14 10 10 10 1.6252135311926068 48.895710257563785 0.0 3 0.945987543890589 5.286168232994464 14964.0 60.16830093410755 0.0 - - - - - - - 308.2352941176471 29 17 YBX1;YBX2;CSDA Y box binding protein 1;Y box binding protein 2;cold shock domain protein A 1659 212 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20892.[MT7]-EDVFVHQTAIK[MT7].3b5_1.heavy 525.631 / 734.384 7860.0 28.901399612426758 44 14 10 10 10 1.6252135311926068 48.895710257563785 0.0 3 0.945987543890589 5.286168232994464 7860.0 48.18964227690307 0.0 - - - - - - - 256.70588235294116 15 17 YBX1;YBX2;CSDA Y box binding protein 1;Y box binding protein 2;cold shock domain protein A 1661 212 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20892.[MT7]-EDVFVHQTAIK[MT7].3y4_1.heavy 525.631 / 576.384 14091.0 28.901399612426758 44 14 10 10 10 1.6252135311926068 48.895710257563785 0.0 3 0.945987543890589 5.286168232994464 14091.0 35.496110791557896 0.0 - - - - - - - 633.8888888888889 28 9 YBX1;YBX2;CSDA Y box binding protein 1;Y box binding protein 2;cold shock domain protein A 1663 212 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20892.[MT7]-EDVFVHQTAIK[MT7].3y5_1.heavy 525.631 / 704.442 3202.0 28.901399612426758 44 14 10 10 10 1.6252135311926068 48.895710257563785 0.0 3 0.945987543890589 5.286168232994464 3202.0 11.96137030384673 0.0 - - - - - - - 756.8571428571429 6 7 YBX1;YBX2;CSDA Y box binding protein 1;Y box binding protein 2;cold shock domain protein A 1665 213 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB539078.[MT7]-GVQSQR.2y4_1.heavy 409.734 / 518.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHC4 SHC (Src homology 2 domain containing) family, member 4 1667 213 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB539078.[MT7]-GVQSQR.2b3_1.heavy 409.734 / 429.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHC4 SHC (Src homology 2 domain containing) family, member 4 1669 213 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB539078.[MT7]-GVQSQR.2y5_1.heavy 409.734 / 617.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHC4 SHC (Src homology 2 domain containing) family, member 4 1671 213 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB539078.[MT7]-GVQSQR.2b4_1.heavy 409.734 / 516.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHC4 SHC (Src homology 2 domain containing) family, member 4 1673 214 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21591.[MT7]-LLDTEDELSDIQTDSVPSEVRDWLASTFTR.4b7_1.heavy 896.445 / 960.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDE1A phosphodiesterase 1A, calmodulin-dependent 1675 214 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21591.[MT7]-LLDTEDELSDIQTDSVPSEVRDWLASTFTR.4b5_1.heavy 896.445 / 716.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDE1A phosphodiesterase 1A, calmodulin-dependent 1677 214 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21591.[MT7]-LLDTEDELSDIQTDSVPSEVRDWLASTFTR.4b6_1.heavy 896.445 / 831.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDE1A phosphodiesterase 1A, calmodulin-dependent 1679 214 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21591.[MT7]-LLDTEDELSDIQTDSVPSEVRDWLASTFTR.4y14_2.heavy 896.445 / 832.923 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDE1A phosphodiesterase 1A, calmodulin-dependent 1681 215 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542706.[MT7]-RQGVPADQLR.3y6_1.heavy 428.582 / 699.378 151921.0 20.623899459838867 50 20 10 10 10 6.76439953964325 14.78327816296817 0.0 3 0.9943449231080034 16.40356470190575 151921.0 296.1179078052319 0.0 - - - - - - - 266.8 303 5 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1683 215 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542706.[MT7]-RQGVPADQLR.3b4_1.heavy 428.582 / 585.359 112559.0 20.623899459838867 50 20 10 10 10 6.76439953964325 14.78327816296817 0.0 3 0.9943449231080034 16.40356470190575 112559.0 257.1632378046566 0.0 - - - - - - - 360.3333333333333 225 6 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1685 215 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542706.[MT7]-RQGVPADQLR.3y4_1.heavy 428.582 / 531.289 87285.0 20.623899459838867 50 20 10 10 10 6.76439953964325 14.78327816296817 0.0 3 0.9943449231080034 16.40356470190575 87285.0 203.78671923474667 0.0 - - - - - - - 322.0 174 3 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1687 215 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542706.[MT7]-RQGVPADQLR.3y5_1.heavy 428.582 / 602.326 116380.0 20.623899459838867 50 20 10 10 10 6.76439953964325 14.78327816296817 0.0 3 0.9943449231080034 16.40356470190575 116380.0 160.48552798302165 0.0 - - - - - - - 257.6 232 5 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1689 216 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21251.[MT7]-LGFVDVQNC[CAM]ISR.2y8_1.heavy 776.407 / 991.463 2799.0 37.24470138549805 40 10 10 10 10 1.6146079432011498 41.30208934213772 0.0 3 0.8369201703125071 3.013528820983944 2799.0 6.8969199178644764 0.0 - - - - - - - 297.3333333333333 5 9 ITPR3 inositol 1,4,5-triphosphate receptor, type 3 1691 216 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21251.[MT7]-LGFVDVQNC[CAM]ISR.2y9_1.heavy 776.407 / 1090.53 3164.0 37.24470138549805 40 10 10 10 10 1.6146079432011498 41.30208934213772 0.0 3 0.8369201703125071 3.013528820983944 3164.0 8.668493150684931 0.0 - - - - - - - 309.8181818181818 6 11 ITPR3 inositol 1,4,5-triphosphate receptor, type 3 1693 216 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21251.[MT7]-LGFVDVQNC[CAM]ISR.2b5_1.heavy 776.407 / 676.379 2921.0 37.24470138549805 40 10 10 10 10 1.6146079432011498 41.30208934213772 0.0 3 0.8369201703125071 3.013528820983944 2921.0 2.0801561216105178 1.0 - - - - - - - 256.8888888888889 5 9 ITPR3 inositol 1,4,5-triphosphate receptor, type 3 1695 216 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21251.[MT7]-LGFVDVQNC[CAM]ISR.2y7_1.heavy 776.407 / 876.436 1461.0 37.24470138549805 40 10 10 10 10 1.6146079432011498 41.30208934213772 0.0 3 0.8369201703125071 3.013528820983944 1461.0 2.2169409279046812 1.0 - - - - - - - 309.8181818181818 3 11 ITPR3 inositol 1,4,5-triphosphate receptor, type 3 1697 217 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 247001.0 44.195701599121094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 247001.0 554.2508694253752 0.0 - - - - - - - 208.92307692307693 494 13 1699 217 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 368405.0 44.195701599121094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 368405.0 422.3076006289876 0.0 - - - - - - - 241.55555555555554 736 9 1701 217 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 279313.0 44.195701599121094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 279313.0 524.4008291928361 0.0 - - - - - - - 199.78571428571428 558 14 1703 218 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21064.[MT7]-RQGVPADQLR.2y9_1.heavy 642.369 / 983.527 1715.0 20.615424633026123 36 14 10 6 6 1.6513610698828718 47.40656935552384 0.03389930725097656 6 0.935693296244817 4.840374596411835 1715.0 11.503380043116723 0.0 - - - - - - - 220.0 3 13 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1705 218 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21064.[MT7]-RQGVPADQLR.2b4_1.heavy 642.369 / 585.359 762.0 20.615424633026123 36 14 10 6 6 1.6513610698828718 47.40656935552384 0.03389930725097656 6 0.935693296244817 4.840374596411835 762.0 2.761960177227353 5.0 - - - - - - - 0.0 1 0 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1707 218 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21064.[MT7]-RQGVPADQLR.2y6_1.heavy 642.369 / 699.378 667.0 20.615424633026123 36 14 10 6 6 1.6513610698828718 47.40656935552384 0.03389930725097656 6 0.935693296244817 4.840374596411835 667.0 4.425013729725772 0.0 - - - - - - - 0.0 1 0 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1709 218 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21064.[MT7]-RQGVPADQLR.2b7_1.heavy 642.369 / 868.476 2382.0 20.615424633026123 36 14 10 6 6 1.6513610698828718 47.40656935552384 0.03389930725097656 6 0.935693296244817 4.840374596411835 2382.0 47.55869630369631 0.0 - - - - - - - 99.07692307692308 4 13 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1711 219 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542329.[MT7]-AVQFTEEK[MT7].3y3_1.heavy 413.899 / 549.3 97858.0 26.427099227905273 50 20 10 10 10 14.778243724816273 6.766703937361354 0.0 3 0.99879579362015 35.56053748644769 97858.0 246.53083815449256 0.0 - - - - - - - 341.3 195 10 SH3GLB1;SH3GLB2 SH3-domain GRB2-like endophilin B1;SH3-domain GRB2-like endophilin B2 1713 219 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542329.[MT7]-AVQFTEEK[MT7].3b4_1.heavy 413.899 / 590.342 37063.0 26.427099227905273 50 20 10 10 10 14.778243724816273 6.766703937361354 0.0 3 0.99879579362015 35.56053748644769 37063.0 176.55339024390244 0.0 - - - - - - - 314.1111111111111 74 18 SH3GLB1;SH3GLB2 SH3-domain GRB2-like endophilin B1;SH3-domain GRB2-like endophilin B2 1715 219 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542329.[MT7]-AVQFTEEK[MT7].3y4_1.heavy 413.899 / 650.348 26291.0 26.427099227905273 50 20 10 10 10 14.778243724816273 6.766703937361354 0.0 3 0.99879579362015 35.56053748644769 26291.0 151.76340889084506 0.0 - - - - - - - 231.95 52 20 SH3GLB1;SH3GLB2 SH3-domain GRB2-like endophilin B1;SH3-domain GRB2-like endophilin B2 1717 219 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542329.[MT7]-AVQFTEEK[MT7].3b3_1.heavy 413.899 / 443.273 194490.0 26.427099227905273 50 20 10 10 10 14.778243724816273 6.766703937361354 0.0 3 0.99879579362015 35.56053748644769 194490.0 284.8155661970711 0.0 - - - - - - - 699.875 388 8 SH3GLB1;SH3GLB2 SH3-domain GRB2-like endophilin B1;SH3-domain GRB2-like endophilin B2 1719 220 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543484.[MT7]-GSWRGELVAVK[MT7].3b9_2.heavy 497.296 / 550.802 1765.0 31.064032872517902 38 14 8 6 10 2.3179274661001856 43.14198846275623 0.030500411987304688 3 0.9374385808905004 4.908157318404787 1765.0 6.972209369577791 0.0 - - - - - - - 294.25 3 24 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1721 220 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543484.[MT7]-GSWRGELVAVK[MT7].3b6_1.heavy 497.296 / 817.407 911.0 31.064032872517902 38 14 8 6 10 2.3179274661001856 43.14198846275623 0.030500411987304688 3 0.9374385808905004 4.908157318404787 911.0 5.977438596491228 0.0 - - - - - - - 0.0 1 0 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1723 220 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543484.[MT7]-GSWRGELVAVK[MT7].3b7_1.heavy 497.296 / 930.491 740.0 31.064032872517902 38 14 8 6 10 2.3179274661001856 43.14198846275623 0.030500411987304688 3 0.9374385808905004 4.908157318404787 740.0 4.3274853801169595 0.0 - - - - - - - 0.0 1 0 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1725 220 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543484.[MT7]-GSWRGELVAVK[MT7].3y5_1.heavy 497.296 / 673.473 N/A 31.064032872517902 38 14 8 6 10 2.3179274661001856 43.14198846275623 0.030500411987304688 3 0.9374385808905004 4.908157318404787 8711.0 16.86278116846436 1.0 - - - - - - - 748.7692307692307 22 13 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1727 221 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544974.[MT7]-LTDFGFC[CAM]AQITPEQSK[MT7].3b6_1.heavy 710.698 / 825.426 7382.0 39.600101470947266 46 16 10 10 10 1.4488746400365236 45.542173157282974 0.0 3 0.9616264437077492 6.2798270719171665 7382.0 40.25991749174917 0.0 - - - - - - - 217.53846153846155 14 13 PAK1;PAK2;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3 1729 221 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544974.[MT7]-LTDFGFC[CAM]AQITPEQSK[MT7].3y6_1.heavy 710.698 / 833.448 11224.0 39.600101470947266 46 16 10 10 10 1.4488746400365236 45.542173157282974 0.0 3 0.9616264437077492 6.2798270719171665 11224.0 47.763987364140036 0.0 - - - - - - - 218.83333333333334 22 12 PAK1;PAK2;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3 1731 221 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544974.[MT7]-LTDFGFC[CAM]AQITPEQSK[MT7].3b5_1.heavy 710.698 / 678.358 10213.0 39.600101470947266 46 16 10 10 10 1.4488746400365236 45.542173157282974 0.0 3 0.9616264437077492 6.2798270719171665 10213.0 35.25979211569893 0.0 - - - - - - - 247.9090909090909 20 11 PAK1;PAK2;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3 1733 221 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544974.[MT7]-LTDFGFC[CAM]AQITPEQSK[MT7].3y5_1.heavy 710.698 / 732.401 19617.0 39.600101470947266 46 16 10 10 10 1.4488746400365236 45.542173157282974 0.0 3 0.9616264437077492 6.2798270719171665 19617.0 29.534559041034708 1.0 - - - - - - - 271.9230769230769 39 13 PAK1;PAK2;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3 1735 222 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21460.[MT7]-RAGLGSGLSLSGLVHPELSR.4y5_1.heavy 538.31 / 601.33 13370.0 37.52320098876953 41 13 10 10 8 2.436365718246231 41.04474104650553 0.0 4 0.9291755145200431 4.609708729771832 13370.0 33.68290895061728 0.0 - - - - - - - 297.3333333333333 26 9 ACADVL acyl-CoA dehydrogenase, very long chain 1737 222 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21460.[MT7]-RAGLGSGLSLSGLVHPELSR.4b7_1.heavy 538.31 / 743.428 3039.0 37.52320098876953 41 13 10 10 8 2.436365718246231 41.04474104650553 0.0 4 0.9291755145200431 4.609708729771832 3039.0 34.42170309653916 1.0 - - - - - - - 254.27272727272728 17 11 ACADVL acyl-CoA dehydrogenase, very long chain 1739 222 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21460.[MT7]-RAGLGSGLSLSGLVHPELSR.4y6_1.heavy 538.31 / 738.389 2552.0 37.52320098876953 41 13 10 10 8 2.436365718246231 41.04474104650553 0.0 4 0.9291755145200431 4.609708729771832 2552.0 18.9037037037037 0.0 - - - - - - - 188.0909090909091 5 11 ACADVL acyl-CoA dehydrogenase, very long chain 1741 222 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21460.[MT7]-RAGLGSGLSLSGLVHPELSR.4y19_2.heavy 538.31 / 925.51 486.0 37.52320098876953 41 13 10 10 8 2.436365718246231 41.04474104650553 0.0 4 0.9291755145200431 4.609708729771832 486.0 -0.3999999999999999 3.0 - - - - - - - 0.0 0 0 ACADVL acyl-CoA dehydrogenase, very long chain 1743 223 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20782.[MT7]-LSPEGK[MT7].2y4_1.heavy 459.779 / 574.332 12816.0 20.849599838256836 36 20 0 10 6 33.50112299315799 2.9849745639996375 0.0 6 0.9996092777075802 62.432989782840046 12816.0 27.486341459645324 1.0 - - - - - - - 619.5 436 2 MAP3K4 mitogen-activated protein kinase kinase kinase 4 1745 223 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20782.[MT7]-LSPEGK[MT7].2y5_1.heavy 459.779 / 661.364 9576.0 20.849599838256836 36 20 0 10 6 33.50112299315799 2.9849745639996375 0.0 6 0.9996092777075802 62.432989782840046 9576.0 21.788424525750493 1.0 - - - - - - - 254.33333333333334 57 3 MAP3K4 mitogen-activated protein kinase kinase kinase 4 1747 223 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20782.[MT7]-LSPEGK[MT7].2y3_1.heavy 459.779 / 477.279 2382.0 20.849599838256836 36 20 0 10 6 33.50112299315799 2.9849745639996375 0.0 6 0.9996092777075802 62.432989782840046 2382.0 1.9988811188811189 3.0 - - - - - - - 673.7142857142857 4 7 MAP3K4 mitogen-activated protein kinase kinase kinase 4 1749 224 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543072.[MT7]-TTC[CAM]FIC[CAM]GLER.2y8_1.heavy 700.843 / 1054.48 11435.0 35.44499969482422 44 14 10 10 10 1.7247185647810874 46.20995931594298 0.0 3 0.935902578872504 4.848356840454282 11435.0 58.45523368513838 0.0 - - - - - - - 216.0 22 12 ITPR1;ITPR2;ITPR3 inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-triphosphate receptor, type 2;inositol 1,4,5-triphosphate receptor, type 3 1751 224 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543072.[MT7]-TTC[CAM]FIC[CAM]GLER.2y9_1.heavy 700.843 / 1155.53 9062.0 35.44499969482422 44 14 10 10 10 1.7247185647810874 46.20995931594298 0.0 3 0.935902578872504 4.848356840454282 9062.0 30.941273240127543 0.0 - - - - - - - 302.4 18 10 ITPR1;ITPR2;ITPR3 inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-triphosphate receptor, type 2;inositol 1,4,5-triphosphate receptor, type 3 1753 224 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543072.[MT7]-TTC[CAM]FIC[CAM]GLER.2y6_1.heavy 700.843 / 747.382 5610.0 35.44499969482422 44 14 10 10 10 1.7247185647810874 46.20995931594298 0.0 3 0.935902578872504 4.848356840454282 5610.0 36.490972222222226 0.0 - - - - - - - 186.54545454545453 11 11 ITPR1;ITPR2;ITPR3 inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-triphosphate receptor, type 2;inositol 1,4,5-triphosphate receptor, type 3 1755 224 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543072.[MT7]-TTC[CAM]FIC[CAM]GLER.2y7_1.heavy 700.843 / 894.45 7659.0 35.44499969482422 44 14 10 10 10 1.7247185647810874 46.20995931594298 0.0 3 0.935902578872504 4.848356840454282 7659.0 47.51416666666667 0.0 - - - - - - - 216.0 15 13 ITPR1;ITPR2;ITPR3 inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-triphosphate receptor, type 2;inositol 1,4,5-triphosphate receptor, type 3 1757 225 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21469.[MT7]-LC[CAM]EAIC[CAM]PAQAITIEAEPR.2b3_1.heavy 1093.56 / 547.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1759 225 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21469.[MT7]-LC[CAM]EAIC[CAM]PAQAITIEAEPR.2b4_1.heavy 1093.56 / 618.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1761 225 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21469.[MT7]-LC[CAM]EAIC[CAM]PAQAITIEAEPR.2b6_1.heavy 1093.56 / 891.419 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1763 225 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21469.[MT7]-LC[CAM]EAIC[CAM]PAQAITIEAEPR.2b5_1.heavy 1093.56 / 731.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) 1765 226 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21070.[MT7]-EVLGILVSYR.2y8_1.heavy 646.888 / 920.556 12559.0 43.14440155029297 50 20 10 10 10 6.261274627858834 15.971188926143137 0.0 3 0.9913470215555549 13.257630145414252 12559.0 77.8658 0.0 - - - - - - - 213.33333333333334 25 15 ARRB2 arrestin, beta 2 1767 226 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21070.[MT7]-EVLGILVSYR.2b4_1.heavy 646.888 / 543.326 8000.0 43.14440155029297 50 20 10 10 10 6.261274627858834 15.971188926143137 0.0 3 0.9913470215555549 13.257630145414252 8000.0 30.416666666666664 0.0 - - - - - - - 670.0 16 8 ARRB2 arrestin, beta 2 1769 226 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21070.[MT7]-EVLGILVSYR.2y9_1.heavy 646.888 / 1019.62 16559.0 43.14440155029297 50 20 10 10 10 6.261274627858834 15.971188926143137 0.0 3 0.9913470215555549 13.257630145414252 16559.0 112.34821527777778 0.0 - - - - - - - 200.0 33 12 ARRB2 arrestin, beta 2 1771 226 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21070.[MT7]-EVLGILVSYR.2y7_1.heavy 646.888 / 807.472 17439.0 43.14440155029297 50 20 10 10 10 6.261274627858834 15.971188926143137 0.0 3 0.9913470215555549 13.257630145414252 17439.0 57.50025833333333 0.0 - - - - - - - 275.0 34 16 ARRB2 arrestin, beta 2 1773 227 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585374.[MT7]-EAELGLPFSPLC[CAM]DRK[MT7].3y7_1.heavy 674.031 / 1019.54 2040.0 38.7098503112793 31 18 0 5 8 6.239090832809948 16.027976299707472 0.04010009765625 4 0.989741750797031 12.174574414784704 2040.0 6.00248474929326 0.0 - - - - - - - 181.1875 4 16 PDE1A;PDE1C phosphodiesterase 1A, calmodulin-dependent;phosphodiesterase 1C, calmodulin-dependent 70kDa 1775 227 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585374.[MT7]-EAELGLPFSPLC[CAM]DRK[MT7].3b6_1.heavy 674.031 / 757.421 4832.0 38.7098503112793 31 18 0 5 8 6.239090832809948 16.027976299707472 0.04010009765625 4 0.989741750797031 12.174574414784704 4832.0 17.48630747749049 0.0 - - - - - - - 233.52941176470588 9 17 PDE1A;PDE1C phosphodiesterase 1A, calmodulin-dependent;phosphodiesterase 1C, calmodulin-dependent 70kDa 1777 227 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585374.[MT7]-EAELGLPFSPLC[CAM]DRK[MT7].3y6_1.heavy 674.031 / 932.51 5368.0 38.7098503112793 31 18 0 5 8 6.239090832809948 16.027976299707472 0.04010009765625 4 0.989741750797031 12.174574414784704 5368.0 25.68081541646759 1.0 - - - - - - - 222.84615384615384 71 13 PDE1A;PDE1C phosphodiesterase 1A, calmodulin-dependent;phosphodiesterase 1C, calmodulin-dependent 70kDa 1779 227 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB585374.[MT7]-EAELGLPFSPLC[CAM]DRK[MT7].3b5_1.heavy 674.031 / 644.337 8482.0 38.7098503112793 31 18 0 5 8 6.239090832809948 16.027976299707472 0.04010009765625 4 0.989741750797031 12.174574414784704 8482.0 21.2826717881037 0.0 - - - - - - - 724.75 16 8 PDE1A;PDE1C phosphodiesterase 1A, calmodulin-dependent;phosphodiesterase 1C, calmodulin-dependent 70kDa 1781 228 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20788.[MT7]-VIFAGK[MT7].2b3_1.heavy 461.802 / 504.33 17461.0 30.220449447631836 44 18 10 6 10 6.150423595244292 16.2590427230611 0.032100677490234375 3 0.9879061700604278 11.210933515708726 17461.0 15.856059232885581 0.0 - - - - - - - 1214.4545454545455 34 11 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1783 228 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20788.[MT7]-VIFAGK[MT7].2y4_1.heavy 461.802 / 566.342 66209.0 30.220449447631836 44 18 10 6 10 6.150423595244292 16.2590427230611 0.032100677490234375 3 0.9879061700604278 11.210933515708726 66209.0 116.82071867959644 0.0 - - - - - - - 720.8 132 10 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1785 228 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20788.[MT7]-VIFAGK[MT7].2y5_1.heavy 461.802 / 679.426 61288.0 30.220449447631836 44 18 10 6 10 6.150423595244292 16.2590427230611 0.032100677490234375 3 0.9879061700604278 11.210933515708726 61288.0 214.12621482283078 0.0 - - - - - - - 247.0 122 14 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1787 228 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB20788.[MT7]-VIFAGK[MT7].2b4_1.heavy 461.802 / 575.367 11250.0 30.220449447631836 44 18 10 6 10 6.150423595244292 16.2590427230611 0.032100677490234375 3 0.9879061700604278 11.210933515708726 11250.0 19.90478761406813 0.0 - - - - - - - 736.6428571428571 22 14 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1789 229 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21268.[MT7]-NNLVDIIQQNK[MT7].3b6_1.heavy 529.642 / 813.459 10071.0 36.95240020751953 45 20 10 5 10 7.075729959071139 14.132817473029654 0.04579925537109375 3 0.998480711073569 31.65827033780428 10071.0 103.97065888656797 0.0 - - - - - - - 181.75 20 8 PDE1A phosphodiesterase 1A, calmodulin-dependent 1791 229 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21268.[MT7]-NNLVDIIQQNK[MT7].3b4_1.heavy 529.642 / 585.348 8373.0 36.95240020751953 45 20 10 5 10 7.075729959071139 14.132817473029654 0.04579925537109375 3 0.998480711073569 31.65827033780428 8373.0 11.49636725763931 0.0 - - - - - - - 667.5 16 8 PDE1A phosphodiesterase 1A, calmodulin-dependent 1793 229 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21268.[MT7]-NNLVDIIQQNK[MT7].3b5_1.heavy 529.642 / 700.375 45503.0 36.95240020751953 45 20 10 5 10 7.075729959071139 14.132817473029654 0.04579925537109375 3 0.998480711073569 31.65827033780428 45503.0 89.43021884181778 0.0 - - - - - - - 343.5 91 6 PDE1A phosphodiesterase 1A, calmodulin-dependent 1795 229 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21268.[MT7]-NNLVDIIQQNK[MT7].3y4_1.heavy 529.642 / 661.375 9343.0 36.95240020751953 45 20 10 5 10 7.075729959071139 14.132817473029654 0.04579925537109375 3 0.998480711073569 31.65827033780428 9343.0 38.49333929250321 0.0 - - - - - - - 252.07692307692307 18 13 PDE1A phosphodiesterase 1A, calmodulin-dependent 1797 230 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21263.[MT7]-DHVFDNVGHLIR.3y7_1.heavy 522.615 / 808.479 1833.0 32.87329864501953 48 18 10 10 10 4.922103081372172 20.316518843023143 0.0 3 0.9832095880041652 9.510911681826638 1833.0 12.630831643002029 0.0 - - - - - - - 165.2608695652174 3 23 SHC4 SHC (Src homology 2 domain containing) family, member 4 1799 230 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21263.[MT7]-DHVFDNVGHLIR.3b6_1.heavy 522.615 / 872.402 2961.0 32.87329864501953 48 18 10 10 10 4.922103081372172 20.316518843023143 0.0 3 0.9832095880041652 9.510911681826638 2961.0 35.7 0.0 - - - - - - - 203.78947368421052 5 19 SHC4 SHC (Src homology 2 domain containing) family, member 4 1801 230 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21263.[MT7]-DHVFDNVGHLIR.3y4_1.heavy 522.615 / 538.346 5921.0 32.87329864501953 48 18 10 10 10 4.922103081372172 20.316518843023143 0.0 3 0.9832095880041652 9.510911681826638 5921.0 13.647695035460993 0.0 - - - - - - - 690.8 11 10 SHC4 SHC (Src homology 2 domain containing) family, member 4 1803 230 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21263.[MT7]-DHVFDNVGHLIR.3y5_1.heavy 522.615 / 595.367 12900.0 32.87329864501953 48 18 10 10 10 4.922103081372172 20.316518843023143 0.0 3 0.9832095880041652 9.510911681826638 12900.0 26.846499765084904 0.0 - - - - - - - 684.5714285714286 25 7 SHC4 SHC (Src homology 2 domain containing) family, member 4 1805 231 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542912.[MT7]-EIQGLFDELR.2y8_1.heavy 682.371 / 977.505 9085.0 43.20715141296387 43 18 10 5 10 8.498641991340092 11.766585779457184 0.040500640869140625 3 0.9870170795504558 10.81944993863908 9085.0 66.10630081300813 0.0 - - - - - - - 231.1764705882353 18 17 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1807 231 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542912.[MT7]-EIQGLFDELR.2b4_1.heavy 682.371 / 572.316 4420.0 43.20715141296387 43 18 10 5 10 8.498641991340092 11.766585779457184 0.040500640869140625 3 0.9870170795504558 10.81944993863908 4420.0 7.478132122229484 0.0 - - - - - - - 298.14285714285717 8 14 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1809 231 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542912.[MT7]-EIQGLFDELR.2y9_1.heavy 682.371 / 1090.59 10394.0 43.20715141296387 43 18 10 5 10 8.498641991340092 11.766585779457184 0.040500640869140625 3 0.9870170795504558 10.81944993863908 10394.0 70.9717856343701 0.0 - - - - - - - 245.6875 20 16 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1811 231 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542912.[MT7]-EIQGLFDELR.2y7_1.heavy 682.371 / 849.446 12276.0 43.20715141296387 43 18 10 5 10 8.498641991340092 11.766585779457184 0.040500640869140625 3 0.9870170795504558 10.81944993863908 12276.0 73.72627825153558 0.0 - - - - - - - 234.8 24 15 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1813 232 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21075.[MT7]-IFGSEAAWK[MT7].3b6_1.heavy 432.911 / 749.395 7591.0 36.60810089111328 39 9 10 10 10 0.6898686598405481 78.16069416914893 0.0 3 0.8140006310210899 2.816002355647776 7591.0 41.00401662049862 0.0 - - - - - - - 220.5 15 6 ACADVL acyl-CoA dehydrogenase, very long chain 1815 232 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21075.[MT7]-IFGSEAAWK[MT7].3y3_1.heavy 432.911 / 548.331 20243.0 36.60810089111328 39 9 10 10 10 0.6898686598405481 78.16069416914893 0.0 3 0.8140006310210899 2.816002355647776 20243.0 212.9580422437673 0.0 - - - - - - - 240.63636363636363 40 11 ACADVL acyl-CoA dehydrogenase, very long chain 1817 232 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21075.[MT7]-IFGSEAAWK[MT7].3b4_1.heavy 432.911 / 549.315 9760.0 36.60810089111328 39 9 10 10 10 0.6898686598405481 78.16069416914893 0.0 3 0.8140006310210899 2.816002355647776 9760.0 14.411354748894318 1.0 - - - - - - - 259.3076923076923 21 13 ACADVL acyl-CoA dehydrogenase, very long chain 1819 232 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21075.[MT7]-IFGSEAAWK[MT7].3b5_1.heavy 432.911 / 678.358 9037.0 36.60810089111328 39 9 10 10 10 0.6898686598405481 78.16069416914893 0.0 3 0.8140006310210899 2.816002355647776 9037.0 107.15969605809128 0.0 - - - - - - - 200.55555555555554 18 9 ACADVL acyl-CoA dehydrogenase, very long chain 1821 233 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543595.[MT7]-DNNPALLHSNK[MT7].3b6_1.heavy 504.279 / 769.396 3739.0 22.11182451248169 44 18 10 6 10 8.418240338526383 11.878967097475986 0.03709983825683594 3 0.9887758797906802 11.63802168749607 3739.0 72.35756346030999 0.0 - - - - - - - 222.8235294117647 7 17 SHC4 SHC (Src homology 2 domain containing) family, member 4 1823 233 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543595.[MT7]-DNNPALLHSNK[MT7].3b4_1.heavy 504.279 / 585.275 1651.0 22.11182451248169 44 18 10 6 10 8.418240338526383 11.878967097475986 0.03709983825683594 3 0.9887758797906802 11.63802168749607 1651.0 7.300654617962751 2.0 - - - - - - - 235.55 3 20 SHC4 SHC (Src homology 2 domain containing) family, member 4 1825 233 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543595.[MT7]-DNNPALLHSNK[MT7].3b5_1.heavy 504.279 / 656.312 6798.0 22.11182451248169 44 18 10 6 10 8.418240338526383 11.878967097475986 0.03709983825683594 3 0.9887758797906802 11.63802168749607 6798.0 49.65107945205479 0.0 - - - - - - - 191.3125 13 16 SHC4 SHC (Src homology 2 domain containing) family, member 4 1827 233 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB543595.[MT7]-DNNPALLHSNK[MT7].3y4_1.heavy 504.279 / 629.349 4855.0 22.11182451248169 44 18 10 6 10 8.418240338526383 11.878967097475986 0.03709983825683594 3 0.9887758797906802 11.63802168749607 4855.0 21.351201333031234 0.0 - - - - - - - 735.2857142857143 9 7 SHC4 SHC (Src homology 2 domain containing) family, member 4 1829 234 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544841.[MT7]-EHLLAQWELEVFER.3y7_1.heavy 648.343 / 921.468 4127.0 45.08279991149902 43 17 10 6 10 3.089140309250389 25.941214367683962 0.037197113037109375 3 0.9762854449184382 7.9982111439620445 4127.0 14.916218160233775 0.0 - - - - - - - 171.75 8 12 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1831 234 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544841.[MT7]-EHLLAQWELEVFER.3y6_1.heavy 648.343 / 792.425 3898.0 45.08279991149902 43 17 10 6 10 3.089140309250389 25.941214367683962 0.037197113037109375 3 0.9762854449184382 7.9982111439620445 3898.0 11.892565983136256 0.0 - - - - - - - 180.07142857142858 7 14 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1833 234 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544841.[MT7]-EHLLAQWELEVFER.3b3_1.heavy 648.343 / 524.295 3975.0 45.08279991149902 43 17 10 6 10 3.089140309250389 25.941214367683962 0.037197113037109375 3 0.9762854449184382 7.9982111439620445 3975.0 19.078759596997457 0.0 - - - - - - - 216.44444444444446 7 18 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1835 234 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544841.[MT7]-EHLLAQWELEVFER.3y5_1.heavy 648.343 / 679.341 3822.0 45.08279991149902 43 17 10 6 10 3.089140309250389 25.941214367683962 0.037197113037109375 3 0.9762854449184382 7.9982111439620445 3822.0 15.747050479766376 0.0 - - - - - - - 178.11111111111111 7 18 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1837 235 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21380.[MT7]-ITQSEFDRQAEITR.3b11_2.heavy 613.322 / 725.358 5450.0 28.861000061035156 43 13 10 10 10 1.1446318110327531 53.18468877712324 0.0 3 0.9156215515666515 4.218368105275612 5450.0 41.344827586206904 0.0 - - - - - - - 194.71428571428572 10 14 SH3GLB1 SH3-domain GRB2-like endophilin B1 1839 235 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21380.[MT7]-ITQSEFDRQAEITR.3y6_1.heavy 613.322 / 717.389 3595.0 28.861000061035156 43 13 10 10 10 1.1446318110327531 53.18468877712324 0.0 3 0.9156215515666515 4.218368105275612 3595.0 25.97077586206897 0.0 - - - - - - - 183.66666666666666 7 18 SH3GLB1 SH3-domain GRB2-like endophilin B1 1841 235 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21380.[MT7]-ITQSEFDRQAEITR.3y5_1.heavy 613.322 / 589.33 2899.0 28.861000061035156 43 13 10 10 10 1.1446318110327531 53.18468877712324 0.0 3 0.9156215515666515 4.218368105275612 2899.0 16.155141625615762 0.0 - - - - - - - 238.44444444444446 5 18 SH3GLB1 SH3-domain GRB2-like endophilin B1 1843 235 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21380.[MT7]-ITQSEFDRQAEITR.3y13_2.heavy 613.322 / 790.887 24873.0 28.861000061035156 43 13 10 10 10 1.1446318110327531 53.18468877712324 0.0 3 0.9156215515666515 4.218368105275612 24873.0 201.8633866995074 0.0 - - - - - - - 207.57894736842104 49 19 SH3GLB1 SH3-domain GRB2-like endophilin B1 1845 236 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21177.[MT7]-TPVTDPATGAVK[MT7].2y4_1.heavy 722.916 / 518.342 N/A 24.971800486246746 41 17 10 6 8 2.829056390810619 35.34747498311501 0.03240013122558594 4 0.9761761969254804 7.979778223680327 564.0 3.0306006735381157 2.0 - - - - - - - 0.0 1 0 ACADVL acyl-CoA dehydrogenase, very long chain 1847 236 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21177.[MT7]-TPVTDPATGAVK[MT7].2y11_1.heavy 722.916 / 1199.68 2972.0 24.971800486246746 41 17 10 6 8 2.829056390810619 35.34747498311501 0.03240013122558594 4 0.9761761969254804 7.979778223680327 2972.0 7.212536585365854 2.0 - - - - - - - 194.21052631578948 5 19 ACADVL acyl-CoA dehydrogenase, very long chain 1849 236 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21177.[MT7]-TPVTDPATGAVK[MT7].2y5_1.heavy 722.916 / 619.39 769.0 24.971800486246746 41 17 10 6 8 2.829056390810619 35.34747498311501 0.03240013122558594 4 0.9761761969254804 7.979778223680327 769.0 3.451121951219512 1.0 - - - - - - - 156.0 2 22 ACADVL acyl-CoA dehydrogenase, very long chain 1851 236 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21177.[MT7]-TPVTDPATGAVK[MT7].2y7_1.heavy 722.916 / 787.479 4765.0 24.971800486246746 41 17 10 6 8 2.829056390810619 35.34747498311501 0.03240013122558594 4 0.9761761969254804 7.979778223680327 4765.0 138.6521568627451 0.0 - - - - - - - 135.21428571428572 9 14 ACADVL acyl-CoA dehydrogenase, very long chain 1853 237 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544329.[MT7]-LFIGGLNTETNEK[MT7].3y3_1.heavy 575.32 / 534.3 13762.0 37.290199279785156 46 16 10 10 10 2.686787238324112 28.977782308847793 0.0 3 0.9617446444902762 6.2895840807123475 13762.0 9.79212256350056 1.0 - - - - - - - 261.0 32 7 RBMX;RBMXL1 RNA binding motif protein, X-linked;RNA binding motif protein, X-linked-like 1 1855 237 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544329.[MT7]-LFIGGLNTETNEK[MT7].3b5_1.heavy 575.32 / 632.389 24357.0 37.290199279785156 46 16 10 10 10 2.686787238324112 28.977782308847793 0.0 3 0.9617446444902762 6.2895840807123475 24357.0 52.12042819489091 0.0 - - - - - - - 401.8 48 10 RBMX;RBMXL1 RNA binding motif protein, X-linked;RNA binding motif protein, X-linked-like 1 1857 237 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544329.[MT7]-LFIGGLNTETNEK[MT7].3b3_1.heavy 575.32 / 518.346 10352.0 37.290199279785156 46 16 10 10 10 2.686787238324112 28.977782308847793 0.0 3 0.9617446444902762 6.2895840807123475 10352.0 17.53503843801875 0.0 - - - - - - - 818.0 20 7 RBMX;RBMXL1 RNA binding motif protein, X-linked;RNA binding motif protein, X-linked-like 1 1859 237 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544329.[MT7]-LFIGGLNTETNEK[MT7].3y4_1.heavy 575.32 / 635.348 28133.0 37.290199279785156 46 16 10 10 10 2.686787238324112 28.977782308847793 0.0 3 0.9617446444902762 6.2895840807123475 28133.0 60.022864799271915 0.0 - - - - - - - 284.3333333333333 56 6 RBMX;RBMXL1 RNA binding motif protein, X-linked;RNA binding motif protein, X-linked-like 1 1861 238 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21377.[MT7]-WTASQLLDHSFVK[MT7].3b4_1.heavy 607.336 / 590.305 1331.0 39.27090072631836 44 20 10 10 4 21.631190441861662 4.622954074985881 0.0 8 0.999484274921547 54.34186984966706 1331.0 2.270181821897303 18.0 - - - - - - - 763.4545454545455 6 11 MAP3K4 mitogen-activated protein kinase kinase kinase 4 1863 238 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21377.[MT7]-WTASQLLDHSFVK[MT7].3b5_1.heavy 607.336 / 718.364 2663.0 39.27090072631836 44 20 10 10 4 21.631190441861662 4.622954074985881 0.0 8 0.999484274921547 54.34186984966706 2663.0 12.620647004796409 0.0 - - - - - - - 244.30769230769232 5 13 MAP3K4 mitogen-activated protein kinase kinase kinase 4 1865 238 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21377.[MT7]-WTASQLLDHSFVK[MT7].3b3_1.heavy 607.336 / 503.273 N/A 39.27090072631836 44 20 10 10 4 21.631190441861662 4.622954074985881 0.0 8 0.999484274921547 54.34186984966706 512.0 0.1334959349593496 28.0 - - - - - - - 307.3333333333333 2 9 MAP3K4 mitogen-activated protein kinase kinase kinase 4 1867 238 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21377.[MT7]-WTASQLLDHSFVK[MT7].3y4_1.heavy 607.336 / 624.384 3482.0 39.27090072631836 44 20 10 10 4 21.631190441861662 4.622954074985881 0.0 8 0.999484274921547 54.34186984966706 3482.0 15.875282980456028 0.0 - - - - - - - 219.42857142857142 6 14 MAP3K4 mitogen-activated protein kinase kinase kinase 4 1869 239 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542722.[MT7]-TSAVPSPC[CAM]GK[MT7].3y3_1.heavy 431.235 / 508.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADVL acyl-CoA dehydrogenase, very long chain 1871 239 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542722.[MT7]-TSAVPSPC[CAM]GK[MT7].3y4_2.heavy 431.235 / 303.164 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADVL acyl-CoA dehydrogenase, very long chain 1873 239 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542722.[MT7]-TSAVPSPC[CAM]GK[MT7].3y4_1.heavy 431.235 / 605.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADVL acyl-CoA dehydrogenase, very long chain 1875 239 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542722.[MT7]-TSAVPSPC[CAM]GK[MT7].3y5_1.heavy 431.235 / 692.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACADVL acyl-CoA dehydrogenase, very long chain 1877 240 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21579.[MT7]-GQLTTDQVFPYPSVLNEEQTQFLK[MT7].3b9_1.heavy 1024.2 / 1134.59 5152.0 44.41957473754883 39 13 10 6 10 1.5076491689238836 58.00381209622978 0.0384979248046875 3 0.9171725662239291 4.258249017386473 5152.0 28.186904887020496 0.0 - - - - - - - 230.92857142857142 10 14 ACADVL acyl-CoA dehydrogenase, very long chain 1879 240 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21579.[MT7]-GQLTTDQVFPYPSVLNEEQTQFLK[MT7].3b6_1.heavy 1024.2 / 760.396 2999.0 44.41957473754883 39 13 10 6 10 1.5076491689238836 58.00381209622978 0.0384979248046875 3 0.9171725662239291 4.258249017386473 2999.0 20.739837662337663 0.0 - - - - - - - 154.0 5 16 ACADVL acyl-CoA dehydrogenase, very long chain 1881 240 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21579.[MT7]-GQLTTDQVFPYPSVLNEEQTQFLK[MT7].3b8_1.heavy 1024.2 / 987.523 7152.0 44.41957473754883 39 13 10 6 10 1.5076491689238836 58.00381209622978 0.0384979248046875 3 0.9171725662239291 4.258249017386473 7152.0 30.522359020904744 0.0 - - - - - - - 692.0 14 7 ACADVL acyl-CoA dehydrogenase, very long chain 1883 240 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21579.[MT7]-GQLTTDQVFPYPSVLNEEQTQFLK[MT7].3b7_1.heavy 1024.2 / 888.454 5383.0 44.41957473754883 39 13 10 6 10 1.5076491689238836 58.00381209622978 0.0384979248046875 3 0.9171725662239291 4.258249017386473 5383.0 23.31602455784612 0.0 - - - - - - - 130.30769230769232 10 13 ACADVL acyl-CoA dehydrogenase, very long chain 1885 241 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544323.[MT7]-SSNVLLDQNLTPK[MT7].3b6_1.heavy 572.996 / 758.453 3167.0 33.33664894104004 47 20 10 7 10 10.982159529383342 9.105677233375165 0.02899932861328125 3 0.9913874911674895 13.288786963965292 3167.0 3.3125574508410325 0.0 - - - - - - - 255.69565217391303 6 23 IRAK2 interleukin-1 receptor-associated kinase 2 1887 241 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544323.[MT7]-SSNVLLDQNLTPK[MT7].3b4_1.heavy 572.996 / 532.285 16213.0 33.33664894104004 47 20 10 7 10 10.982159529383342 9.105677233375165 0.02899932861328125 3 0.9913874911674895 13.288786963965292 16213.0 33.247406513872136 0.0 - - - - - - - 728.9166666666666 32 12 IRAK2 interleukin-1 receptor-associated kinase 2 1889 241 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544323.[MT7]-SSNVLLDQNLTPK[MT7].3b5_1.heavy 572.996 / 645.369 11839.0 33.33664894104004 47 20 10 7 10 10.982159529383342 9.105677233375165 0.02899932861328125 3 0.9913874911674895 13.288786963965292 11839.0 32.72608027652886 0.0 - - - - - - - 663.5 23 10 IRAK2 interleukin-1 receptor-associated kinase 2 1891 241 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544323.[MT7]-SSNVLLDQNLTPK[MT7].3b7_1.heavy 572.996 / 873.48 2036.0 33.33664894104004 47 20 10 7 10 10.982159529383342 9.105677233375165 0.02899932861328125 3 0.9913874911674895 13.288786963965292 2036.0 5.967551349328201 1.0 - - - - - - - 240.57142857142858 4 21 IRAK2 interleukin-1 receptor-associated kinase 2 1893 242 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21181.[MT7]-EWSGLLEELAR.2y8_1.heavy 723.889 / 900.515 2605.0 47.15817356109619 43 17 10 6 10 3.970748853660103 25.184166434455644 0.030498504638671875 3 0.9704768355118939 7.164841822461671 2605.0 3.0 0.0 - - - - - - - 198.38095238095238 5 21 PFKP phosphofructokinase, platelet 1895 242 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21181.[MT7]-EWSGLLEELAR.2y9_1.heavy 723.889 / 987.547 4168.0 47.15817356109619 43 17 10 6 10 3.970748853660103 25.184166434455644 0.030498504638671875 3 0.9704768355118939 7.164841822461671 4168.0 13.86013819715529 0.0 - - - - - - - 209.05263157894737 8 19 PFKP phosphofructokinase, platelet 1897 242 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21181.[MT7]-EWSGLLEELAR.2y6_1.heavy 723.889 / 730.409 1303.0 47.15817356109619 43 17 10 6 10 3.970748853660103 25.184166434455644 0.030498504638671875 3 0.9704768355118939 7.164841822461671 1303.0 2.797852760736196 1.0 - - - - - - - 240.0 2 19 PFKP phosphofructokinase, platelet 1899 242 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21181.[MT7]-EWSGLLEELAR.2y10_1.heavy 723.889 / 1173.63 5275.0 47.15817356109619 43 17 10 6 10 3.970748853660103 25.184166434455644 0.030498504638671875 3 0.9704768355118939 7.164841822461671 5275.0 17.401543162629675 0.0 - - - - - - - 651.2857142857143 10 7 PFKP phosphofructokinase, platelet 1901 243 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542728.[MT7]-EVLGILVSYR.3b4_1.heavy 431.595 / 543.326 7200.0 43.12320137023926 34 9 10 5 10 3.141912587281445 31.827747342431792 0.042400360107421875 3 0.8190601031669861 2.8563934093092542 7200.0 108.50212575520251 0.0 - - - - - - - 204.66666666666666 14 6 ARRB2 arrestin, beta 2 1903 243 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542728.[MT7]-EVLGILVSYR.3b5_1.heavy 431.595 / 656.41 12599.0 43.12320137023926 34 9 10 5 10 3.141912587281445 31.827747342431792 0.042400360107421875 3 0.8190601031669861 2.8563934093092542 12599.0 198.39191886510704 0.0 - - - - - - - 224.875 25 8 ARRB2 arrestin, beta 2 1905 243 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542728.[MT7]-EVLGILVSYR.3y4_1.heavy 431.595 / 524.283 16853.0 43.12320137023926 34 9 10 5 10 3.141912587281445 31.827747342431792 0.042400360107421875 3 0.8190601031669861 2.8563934093092542 16853.0 259.2207829766053 0.0 - - - - - - - 190.88888888888889 33 9 ARRB2 arrestin, beta 2 1907 243 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB542728.[MT7]-EVLGILVSYR.3y5_1.heavy 431.595 / 637.367 14317.0 43.12320137023926 34 9 10 5 10 3.141912587281445 31.827747342431792 0.042400360107421875 3 0.8190601031669861 2.8563934093092542 14317.0 130.6438263593645 0.0 - - - - - - - 181.88888888888889 28 9 ARRB2 arrestin, beta 2 1909 244 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21574.[MT7]-AAGYANPVWTALFDYEPSGQDELALR.4y9_1.heavy 750.373 / 988.506 993.0 51.53200149536133 46 20 10 6 10 4.855181016091595 15.58522037173464 0.03459930419921875 3 0.996588211159684 21.122617931386472 993.0 5.106857142857143 0.0 - - - - - - - 0.0 1 0 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1911 244 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21574.[MT7]-AAGYANPVWTALFDYEPSGQDELALR.4b4_1.heavy 750.373 / 507.268 1226.0 51.53200149536133 46 20 10 6 10 4.855181016091595 15.58522037173464 0.03459930419921875 3 0.996588211159684 21.122617931386472 1226.0 8.557328173374612 0.0 - - - - - - - 184.48 2 25 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1913 244 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21574.[MT7]-AAGYANPVWTALFDYEPSGQDELALR.4b5_1.heavy 750.373 / 578.305 1255.0 51.53200149536133 46 20 10 6 10 4.855181016091595 15.58522037173464 0.03459930419921875 3 0.996588211159684 21.122617931386472 1255.0 5.1586557098788965 0.0 - - - - - - - 189.83333333333334 2 24 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1915 244 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21574.[MT7]-AAGYANPVWTALFDYEPSGQDELALR.4b6_1.heavy 750.373 / 692.348 3883.0 51.53200149536133 46 20 10 6 10 4.855181016091595 15.58522037173464 0.03459930419921875 3 0.996588211159684 21.122617931386472 3883.0 33.22434618395303 0.0 - - - - - - - 204.38888888888889 7 18 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1917 245 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21575.[MT7]-AAGYANPVWTALFDYEPSGQDELALR.3b6_1.heavy 1000.16 / 692.348 4731.0 51.54930114746094 44 14 10 10 10 2.2032474348765687 36.374867264954425 0.0 3 0.939453189030225 4.990002154616882 4731.0 68.59949999999999 0.0 - - - - - - - 121.93333333333334 9 15 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1919 245 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21575.[MT7]-AAGYANPVWTALFDYEPSGQDELALR.3b4_1.heavy 1000.16 / 507.268 988.0 51.54930114746094 44 14 10 10 10 2.2032474348765687 36.374867264954425 0.0 3 0.939453189030225 4.990002154616882 988.0 14.144866666666665 0.0 - - - - - - - 0.0 1 0 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1921 245 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21575.[MT7]-AAGYANPVWTALFDYEPSGQDELALR.3b8_1.heavy 1000.16 / 888.47 3204.0 51.54930114746094 44 14 10 10 10 2.2032474348765687 36.374867264954425 0.0 3 0.939453189030225 4.990002154616882 3204.0 72.06863999999999 0.0 - - - - - - - 119.875 6 16 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1923 245 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21575.[MT7]-AAGYANPVWTALFDYEPSGQDELALR.3y10_1.heavy 1000.16 / 1085.56 6198.0 51.54930114746094 44 14 10 10 10 2.2032474348765687 36.374867264954425 0.0 3 0.939453189030225 4.990002154616882 6198.0 50.144143465045595 0.0 - - - - - - - 124.88888888888889 12 18 MAP3K11 mitogen-activated protein kinase kinase kinase 11 1925 246 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21085.[MT7]-LLQTSNITK[MT7].2y8_1.heavy 653.403 / 1048.61 9196.0 30.180325031280518 43 17 10 6 10 4.440894310889085 22.517986918715838 0.03209877014160156 3 0.9734888029861216 7.562815945620235 9196.0 33.70567796610169 0.0 - - - - - - - 226.16666666666666 18 18 PAK1;PAK2;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3 1927 246 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21085.[MT7]-LLQTSNITK[MT7].2y5_1.heavy 653.403 / 706.422 5659.0 30.180325031280518 43 17 10 6 10 4.440894310889085 22.517986918715838 0.03209877014160156 3 0.9734888029861216 7.562815945620235 5659.0 30.69613824062617 0.0 - - - - - - - 193.85714285714286 11 21 PAK1;PAK2;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3 1929 246 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21085.[MT7]-LLQTSNITK[MT7].2y6_1.heavy 653.403 / 807.469 8429.0 30.180325031280518 43 17 10 6 10 4.440894310889085 22.517986918715838 0.03209877014160156 3 0.9734888029861216 7.562815945620235 8429.0 25.94519673123487 0.0 - - - - - - - 229.78947368421052 16 19 PAK1;PAK2;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3 1931 246 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21085.[MT7]-LLQTSNITK[MT7].2y7_1.heavy 653.403 / 935.528 7368.0 30.180325031280518 43 17 10 6 10 4.440894310889085 22.517986918715838 0.03209877014160156 3 0.9734888029861216 7.562815945620235 7368.0 34.237421656930735 0.0 - - - - - - - 183.21052631578948 14 19 PAK1;PAK2;PAK3 p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3 1933 247 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB541737.[MT7]-FLSTVLGK[MT7].2y4_1.heavy 576.865 / 560.389 7518.0 39.355098724365234 50 20 10 10 10 12.3871806079252 8.072862030930667 0.0 3 0.9945678287242659 16.737047530936433 7518.0 30.04221542118556 0.0 - - - - - - - 238.5 15 12 SHC4 SHC (Src homology 2 domain containing) family, member 4 1935 247 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB541737.[MT7]-FLSTVLGK[MT7].2y5_1.heavy 576.865 / 661.437 9213.0 39.355098724365234 50 20 10 10 10 12.3871806079252 8.072862030930667 0.0 3 0.9945678287242659 16.737047530936433 9213.0 14.16232010464611 0.0 - - - - - - - 270.8888888888889 18 9 SHC4 SHC (Src homology 2 domain containing) family, member 4 1937 247 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB541737.[MT7]-FLSTVLGK[MT7].2y6_1.heavy 576.865 / 748.469 16096.0 39.355098724365234 50 20 10 10 10 12.3871806079252 8.072862030930667 0.0 3 0.9945678287242659 16.737047530936433 16096.0 145.77509433962265 0.0 - - - - - - - 235.55555555555554 32 9 SHC4 SHC (Src homology 2 domain containing) family, member 4 1939 247 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB541737.[MT7]-FLSTVLGK[MT7].2y7_1.heavy 576.865 / 861.553 13872.0 39.355098724365234 50 20 10 10 10 12.3871806079252 8.072862030930667 0.0 3 0.9945678287242659 16.737047530936433 13872.0 72.41358490566037 0.0 - - - - - - - 269.0769230769231 27 13 SHC4 SHC (Src homology 2 domain containing) family, member 4 1941 248 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584717.[MT7]-DLIGFGLQVAK[MT7].3b6_1.heavy 483.629 / 747.416 29647.0 41.54159927368164 43 13 10 10 10 0.9070604931573021 66.44629824475088 0.0 3 0.9101699213610411 4.086443643115237 29647.0 215.08607843137256 0.0 - - - - - - - 207.77777777777777 59 9 MET met proto-oncogene (hepatocyte growth factor receptor) 1943 248 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584717.[MT7]-DLIGFGLQVAK[MT7].3b4_1.heavy 483.629 / 543.326 59040.0 41.54159927368164 43 13 10 10 10 0.9070604931573021 66.44629824475088 0.0 3 0.9101699213610411 4.086443643115237 59040.0 360.73022312373223 0.0 - - - - - - - 1116.142857142857 118 7 MET met proto-oncogene (hepatocyte growth factor receptor) 1945 248 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584717.[MT7]-DLIGFGLQVAK[MT7].3b5_1.heavy 483.629 / 690.394 17669.0 41.54159927368164 43 13 10 10 10 0.9070604931573021 66.44629824475088 0.0 3 0.9101699213610411 4.086443643115237 17669.0 101.7872980392157 0.0 - - - - - - - 154.54545454545453 35 11 MET met proto-oncogene (hepatocyte growth factor receptor) 1947 248 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584717.[MT7]-DLIGFGLQVAK[MT7].3b3_1.heavy 483.629 / 486.304 42474.0 41.54159927368164 43 13 10 10 10 0.9070604931573021 66.44629824475088 0.0 3 0.9101699213610411 4.086443643115237 42474.0 195.07687416551204 0.0 - - - - - - - 811.6666666666666 84 9 MET met proto-oncogene (hepatocyte growth factor receptor) 1949 249 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21089.[MT7]-AALLTGRLPVR.3y10_2.heavy 437.618 / 548.354 70642.0 33.13130187988281 48 18 10 10 10 4.202748845522008 23.79395097723937 0.0 3 0.982397150439153 9.288204028514171 70642.0 197.62925734894566 0.0 - - - - - - - 738.875 141 8 ARSA arylsulfatase A 1951 249 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21089.[MT7]-AALLTGRLPVR.3b4_1.heavy 437.618 / 513.352 38953.0 33.13130187988281 48 18 10 10 10 4.202748845522008 23.79395097723937 0.0 3 0.982397150439153 9.288204028514171 38953.0 31.41580992626418 0.0 - - - - - - - 736.0 77 12 ARSA arylsulfatase A 1953 249 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21089.[MT7]-AALLTGRLPVR.3b3_1.heavy 437.618 / 400.268 118354.0 33.13130187988281 48 18 10 10 10 4.202748845522008 23.79395097723937 0.0 3 0.982397150439153 9.288204028514171 118354.0 58.21718199608611 0.0 - - - - - - - 1257.888888888889 236 9 ARSA arylsulfatase A 1955 249 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21089.[MT7]-AALLTGRLPVR.3y4_1.heavy 437.618 / 484.324 43225.0 33.13130187988281 48 18 10 10 10 4.202748845522008 23.79395097723937 0.0 3 0.982397150439153 9.288204028514171 43225.0 143.24108916163874 0.0 - - - - - - - 717.6153846153846 86 13 ARSA arylsulfatase A 1957 250 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21189.[MT7]-SVIEPLPVTPTR.3y3_1.heavy 484.956 / 373.219 14915.0 34.03669993082682 39 13 10 6 10 1.4413300183354283 59.774638322026256 0.037197113037109375 3 0.9129755054055201 4.152796059488072 14915.0 33.947975655541825 0.0 - - - - - - - 753.1818181818181 29 11 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1959 250 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21189.[MT7]-SVIEPLPVTPTR.3y4_1.heavy 484.956 / 474.267 29747.0 34.03669993082682 39 13 10 6 10 1.4413300183354283 59.774638322026256 0.037197113037109375 3 0.9129755054055201 4.152796059488072 29747.0 43.83496167047534 0.0 - - - - - - - 414.0 59 6 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1961 250 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21189.[MT7]-SVIEPLPVTPTR.3b3_1.heavy 484.956 / 444.294 23118.0 34.03669993082682 39 13 10 6 10 1.4413300183354283 59.774638322026256 0.037197113037109375 3 0.9129755054055201 4.152796059488072 23118.0 60.63554257672733 0.0 - - - - - - - 673.25 46 8 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 1963 251 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21187.[MT7]-SPVLVFQC[CAM]NSR.2y8_1.heavy 725.883 / 1023.5 4261.0 34.61130142211914 46 16 10 10 10 2.469339120243543 35.03750791043634 0.0 3 0.9693703303216766 7.033579659923861 4261.0 15.216534563974207 0.0 - - - - - - - 271.8333333333333 8 12 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1965 251 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21187.[MT7]-SPVLVFQC[CAM]NSR.2y6_1.heavy 725.883 / 811.352 4624.0 34.61130142211914 46 16 10 10 10 2.469339120243543 35.03750791043634 0.0 3 0.9693703303216766 7.033579659923861 4624.0 18.52063360881543 0.0 - - - - - - - 249.33333333333334 9 12 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1967 251 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21187.[MT7]-SPVLVFQC[CAM]NSR.2y10_1.heavy 725.883 / 1219.63 6618.0 34.61130142211914 46 16 10 10 10 2.469339120243543 35.03750791043634 0.0 3 0.9693703303216766 7.033579659923861 6618.0 14.122439033891704 1.0 - - - - - - - 261.8888888888889 13 9 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1969 251 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21187.[MT7]-SPVLVFQC[CAM]NSR.2y7_1.heavy 725.883 / 910.42 4080.0 34.61130142211914 46 16 10 10 10 2.469339120243543 35.03750791043634 0.0 3 0.9693703303216766 7.033579659923861 4080.0 23.794271384350143 0.0 - - - - - - - 167.53846153846155 8 13 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 1971 252 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21186.[MT7]-DLIGFGLQVAK[MT7].2y8_1.heavy 724.939 / 963.574 40000.0 41.550599098205566 46 20 10 6 10 7.043683524867818 14.197117125854486 0.035999298095703125 3 0.9933373924734149 15.11119574585033 40000.0 113.6904761904762 0.0 - - - - - - - 317.3333333333333 80 9 MET met proto-oncogene (hepatocyte growth factor receptor) 1973 252 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21186.[MT7]-DLIGFGLQVAK[MT7].2b4_1.heavy 724.939 / 543.326 15546.0 41.550599098205566 46 20 10 6 10 7.043683524867818 14.197117125854486 0.035999298095703125 3 0.9933373924734149 15.11119574585033 15546.0 48.687417037636585 0.0 - - - - - - - 616.0 31 9 MET met proto-oncogene (hepatocyte growth factor receptor) 1975 252 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21186.[MT7]-DLIGFGLQVAK[MT7].2y6_1.heavy 724.939 / 759.484 15798.0 41.550599098205566 46 20 10 6 10 7.043683524867818 14.197117125854486 0.035999298095703125 3 0.9933373924734149 15.11119574585033 15798.0 95.28952380952383 0.0 - - - - - - - 246.0 31 14 MET met proto-oncogene (hepatocyte growth factor receptor) 1977 252 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21186.[MT7]-DLIGFGLQVAK[MT7].2y7_1.heavy 724.939 / 906.553 8908.0 41.550599098205566 46 20 10 6 10 7.043683524867818 14.197117125854486 0.035999298095703125 3 0.9933373924734149 15.11119574585033 8908.0 25.097936507936506 0.0 - - - - - - - 205.33333333333334 17 18 MET met proto-oncogene (hepatocyte growth factor receptor) 1979 253 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584911.[MT7]-EVLGILVSYRVK[MT7].3y7_1.heavy 555.35 / 1008.63 4046.0 40.868600845336914 39 13 10 6 10 2.4180739944554164 41.35522743691777 0.03600311279296875 3 0.9272240552241536 4.546725453442725 4046.0 51.02834354354355 0.0 - - - - - - - 150.0 8 6 ARRB2 arrestin, beta 2 1981 253 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584911.[MT7]-EVLGILVSYRVK[MT7].3y6_1.heavy 555.35 / 895.548 1978.0 40.868600845336914 39 13 10 6 10 2.4180739944554164 41.35522743691777 0.03600311279296875 3 0.9272240552241536 4.546725453442725 1978.0 20.878888888888888 0.0 - - - - - - - 115.71428571428571 3 7 ARRB2 arrestin, beta 2 1983 253 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584911.[MT7]-EVLGILVSYRVK[MT7].3b4_1.heavy 555.35 / 543.326 5395.0 40.868600845336914 39 13 10 6 10 2.4180739944554164 41.35522743691777 0.03600311279296875 3 0.9272240552241536 4.546725453442725 5395.0 28.22384259259259 0.0 - - - - - - - 198.0 10 15 ARRB2 arrestin, beta 2 1985 253 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB584911.[MT7]-EVLGILVSYRVK[MT7].3y5_1.heavy 555.35 / 796.48 4136.0 40.868600845336914 39 13 10 6 10 2.4180739944554164 41.35522743691777 0.03600311279296875 3 0.9272240552241536 4.546725453442725 4136.0 75.82666666666665 0.0 - - - - - - - 165.0 8 12 ARRB2 arrestin, beta 2 1987 254 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21488.[MT7]-ELTLLLQQVDRERPHVR.4y4_1.heavy 562.327 / 508.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 1989 254 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21488.[MT7]-ELTLLLQQVDRERPHVR.4b4_1.heavy 562.327 / 601.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 1991 254 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21488.[MT7]-ELTLLLQQVDRERPHVR.4b3_1.heavy 562.327 / 488.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP3K11 mitogen-activated protein kinase kinase kinase 11 1993 255 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21387.[MT7]-ELIQTSALNFLTPLR.3y7_1.heavy 620.695 / 860.499 8437.0 48.05065155029297 42 16 10 6 10 2.399149219915518 33.35549264025483 0.03350067138671875 3 0.9698154301461226 7.085514025607453 8437.0 149.68870967741935 0.0 - - - - - - - 186.0 16 9 SH3GLB1 SH3-domain GRB2-like endophilin B1 1995 255 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21387.[MT7]-ELIQTSALNFLTPLR.3b4_1.heavy 620.695 / 628.379 6638.0 48.05065155029297 42 16 10 6 10 2.399149219915518 33.35549264025483 0.03350067138671875 3 0.9698154301461226 7.085514025607453 6638.0 55.673548387096766 0.0 - - - - - - - 182.35294117647058 13 17 SH3GLB1 SH3-domain GRB2-like endophilin B1 1997 255 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21387.[MT7]-ELIQTSALNFLTPLR.3b3_1.heavy 620.695 / 500.32 8686.0 48.05065155029297 42 16 10 6 10 2.399149219915518 33.35549264025483 0.03350067138671875 3 0.9698154301461226 7.085514025607453 8686.0 76.81973118279569 0.0 - - - - - - - 170.5 17 16 SH3GLB1 SH3-domain GRB2-like endophilin B1 1999 255 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21387.[MT7]-ELIQTSALNFLTPLR.3y5_1.heavy 620.695 / 599.388 9554.0 48.05065155029297 42 16 10 6 10 2.399149219915518 33.35549264025483 0.03350067138671875 3 0.9698154301461226 7.085514025607453 9554.0 37.805075268817205 0.0 - - - - - - - 248.0 19 14 SH3GLB1 SH3-domain GRB2-like endophilin B1 2001 256 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544335.[MT7]-SIYNSFYVYC[CAM]K[MT7].3y3_1.heavy 577.96 / 614.309 11233.0 37.70690155029297 50 20 10 10 10 5.063293548863031 19.749990600970612 0.0 3 0.9911933768721664 13.141302905866835 11233.0 34.87546969372457 0.0 - - - - - - - 292.0 22 12 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 2003 256 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544335.[MT7]-SIYNSFYVYC[CAM]K[MT7].3b4_1.heavy 577.96 / 622.332 4469.0 37.70690155029297 50 20 10 10 10 5.063293548863031 19.749990600970612 0.0 3 0.9911933768721664 13.141302905866835 4469.0 8.095163288706548 0.0 - - - - - - - 310.7142857142857 8 7 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 2005 256 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544335.[MT7]-SIYNSFYVYC[CAM]K[MT7].3b5_1.heavy 577.96 / 709.364 6522.0 37.70690155029297 50 20 10 10 10 5.063293548863031 19.749990600970612 0.0 3 0.9911933768721664 13.141302905866835 6522.0 18.138428179949763 0.0 - - - - - - - 301.9 13 10 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 2007 256 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544335.[MT7]-SIYNSFYVYC[CAM]K[MT7].3b3_1.heavy 577.96 / 508.289 3744.0 37.70690155029297 50 20 10 10 10 5.063293548863031 19.749990600970612 0.0 3 0.9911933768721664 13.141302905866835 3744.0 6.437637108497423 0.0 - - - - - - - 375.55555555555554 7 9 PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) 2009 257 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21588.[MT7]-LLSLAGDSLFWSEADVVQATDDFNQNRK[MT7].4b8_1.heavy 857.69 / 901.511 2768.0 51.28524971008301 40 14 10 6 10 5.691296052083005 17.57069024082839 0.037700653076171875 3 0.9473802067495873 5.35629866050696 2768.0 16.938533400301356 0.0 - - - - - - - 182.04347826086956 5 23 IRAK2 interleukin-1 receptor-associated kinase 2 2011 257 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21588.[MT7]-LLSLAGDSLFWSEADVVQATDDFNQNRK[MT7].4b7_1.heavy 857.69 / 814.479 2406.0 51.28524971008301 40 14 10 6 10 5.691296052083005 17.57069024082839 0.037700653076171875 3 0.9473802067495873 5.35629866050696 2406.0 26.733333333333334 0.0 - - - - - - - 193.4090909090909 4 22 IRAK2 interleukin-1 receptor-associated kinase 2 2013 257 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21588.[MT7]-LLSLAGDSLFWSEADVVQATDDFNQNRK[MT7].4b5_1.heavy 857.69 / 642.431 2669.0 51.28524971008301 40 14 10 6 10 5.691296052083005 17.57069024082839 0.037700653076171875 3 0.9473802067495873 5.35629866050696 2669.0 11.510725719006558 1.0 - - - - - - - 270.57894736842104 5 19 IRAK2 interleukin-1 receptor-associated kinase 2 2015 257 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21588.[MT7]-LLSLAGDSLFWSEADVVQATDDFNQNRK[MT7].4y6_1.heavy 857.69 / 950.529 1186.0 51.28524971008301 40 14 10 6 10 5.691296052083005 17.57069024082839 0.037700653076171875 3 0.9473802067495873 5.35629866050696 1186.0 12.974121212121211 0.0 - - - - - - - 133.47619047619048 2 21 IRAK2 interleukin-1 receptor-associated kinase 2 2017 258 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21485.[MT7]-VQFAPEK[MT7]PGPQPSAETTR.3y7_1.heavy 743.402 / 761.379 6364.0 26.981700897216797 43 13 10 10 10 2.1851678111895128 45.76307571799909 0.0 3 0.9190136432271182 4.307060069618777 6364.0 64.01656804733727 0.0 - - - - - - - 108.38461538461539 12 13 ARRB2 arrestin, beta 2 2019 258 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21485.[MT7]-VQFAPEK[MT7]PGPQPSAETTR.3y11_1.heavy 743.402 / 1140.56 11996.0 26.981700897216797 43 13 10 10 10 2.1851678111895128 45.76307571799909 0.0 3 0.9190136432271182 4.307060069618777 11996.0 114.41707864525998 0.0 - - - - - - - 215.41176470588235 23 17 ARRB2 arrestin, beta 2 2021 258 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21485.[MT7]-VQFAPEK[MT7]PGPQPSAETTR.3b4_1.heavy 743.402 / 590.342 10306.0 26.981700897216797 43 13 10 10 10 2.1851678111895128 45.76307571799909 0.0 3 0.9190136432271182 4.307060069618777 10306.0 58.90885207100592 0.0 - - - - - - - 228.5 20 18 ARRB2 arrestin, beta 2 2023 258 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21485.[MT7]-VQFAPEK[MT7]PGPQPSAETTR.3y14_2.heavy 743.402 / 819.932 8053.0 26.981700897216797 43 13 10 10 10 2.1851678111895128 45.76307571799909 0.0 3 0.9190136432271182 4.307060069618777 8053.0 207.30875568900123 0.0 - - - - - - - 90.0 16 10 ARRB2 arrestin, beta 2 2025 259 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21388.[MT7]-GGLPLEEVTVAEVLAAR.3y7_1.heavy 623.359 / 729.425 28953.0 48.27542591094971 43 17 10 6 10 5.497856140095182 18.188908085592203 0.035900115966796875 3 0.9752381655764181 7.826556147363826 28953.0 72.14098962133447 0.0 - - - - - - - 152.0 57 8 ARSA arylsulfatase A 2027 259 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21388.[MT7]-GGLPLEEVTVAEVLAAR.3b6_1.heavy 623.359 / 711.416 13625.0 48.27542591094971 43 17 10 6 10 5.497856140095182 18.188908085592203 0.035900115966796875 3 0.9752381655764181 7.826556147363826 13625.0 333.8125 0.0 - - - - - - - 140.0 27 10 ARSA arylsulfatase A 2029 259 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21388.[MT7]-GGLPLEEVTVAEVLAAR.3b5_1.heavy 623.359 / 582.373 14537.0 48.27542591094971 43 17 10 6 10 5.497856140095182 18.188908085592203 0.035900115966796875 3 0.9752381655764181 7.826556147363826 14537.0 121.68793315367917 0.0 - - - - - - - 145.23076923076923 29 13 ARSA arylsulfatase A 2031 259 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21388.[MT7]-GGLPLEEVTVAEVLAAR.3b7_1.heavy 623.359 / 840.458 15754.0 48.27542591094971 43 17 10 6 10 5.497856140095182 18.188908085592203 0.035900115966796875 3 0.9752381655764181 7.826556147363826 15754.0 145.77572808435312 0.0 - - - - - - - 144.5 31 8 ARSA arylsulfatase A 2033 260 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21383.[MT7]-LFAMLAHPNIIALK[MT7].3y7_1.heavy 614.042 / 912.6 1395.0 45.68426767985026 40 14 10 6 10 2.8021597586625724 35.686759004678756 0.0355987548828125 3 0.9447028668799151 5.223831843386399 1395.0 4.461336515513127 0.0 - - - - - - - 302.46666666666664 2 15 MAP3K11 mitogen-activated protein kinase kinase kinase 11 2035 260 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21383.[MT7]-LFAMLAHPNIIALK[MT7].3b6_1.heavy 614.042 / 791.461 1395.0 45.68426767985026 40 14 10 6 10 2.8021597586625724 35.686759004678756 0.0355987548828125 3 0.9447028668799151 5.223831843386399 1395.0 0.0 1.0 - - - - - - - 147.44444444444446 2 18 MAP3K11 mitogen-activated protein kinase kinase kinase 11 2037 260 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21383.[MT7]-LFAMLAHPNIIALK[MT7].3b4_1.heavy 614.042 / 607.339 1535.0 45.68426767985026 40 14 10 6 10 2.8021597586625724 35.686759004678756 0.0355987548828125 3 0.9447028668799151 5.223831843386399 1535.0 4.3982808022922635 0.0 - - - - - - - 194.73684210526315 3 19 MAP3K11 mitogen-activated protein kinase kinase kinase 11 2039 260 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21383.[MT7]-LFAMLAHPNIIALK[MT7].3y4_1.heavy 614.042 / 588.42 N/A 45.68426767985026 40 14 10 6 10 2.8021597586625724 35.686759004678756 0.0355987548828125 3 0.9447028668799151 5.223831843386399 2651.0 5.887844019266517 1.0 - - - - - - - 224.88888888888889 5 9 MAP3K11 mitogen-activated protein kinase kinase kinase 11 2041 261 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21190.[MT7]-SVIEPLPVTPTR.2b3_1.heavy 726.931 / 444.294 10927.0 34.030500411987305 40 16 10 6 8 3.6341163294132506 22.89927477593916 0.037197113037109375 4 0.9690870136507801 7.001107002424027 10927.0 18.16896222113662 1.0 - - - - - - - 768.6428571428571 24 14 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 2043 261 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21190.[MT7]-SVIEPLPVTPTR.2y9_1.heavy 726.931 / 1009.57 10352.0 34.030500411987305 40 16 10 6 8 3.6341163294132506 22.89927477593916 0.037197113037109375 4 0.9690870136507801 7.001107002424027 10352.0 44.253608326794094 0.0 - - - - - - - 219.06666666666666 20 15 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 2045 261 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21190.[MT7]-SVIEPLPVTPTR.2y10_1.heavy 726.931 / 1122.65 6901.0 34.030500411987305 40 16 10 6 8 3.6341163294132506 22.89927477593916 0.037197113037109375 4 0.9690870136507801 7.001107002424027 6901.0 36.21342096894667 0.0 - - - - - - - 250.94444444444446 13 18 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 2047 261 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21190.[MT7]-SVIEPLPVTPTR.2y11_1.heavy 726.931 / 1221.72 2054.0 34.030500411987305 40 16 10 6 8 3.6341163294132506 22.89927477593916 0.037197113037109375 4 0.9690870136507801 7.001107002424027 2054.0 0.0 1.0 - - - - - - - 296.6111111111111 4 18 PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 2049 262 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21583.[MT7]-ASNTAEVFFDGVRVPSENVLGEVGSGFK[MT7].3y18_2.heavy 1067.55 / 988.04 2997.0 44.82365036010742 37 11 10 6 10 0.9793517767549189 63.42254838735041 0.0373992919921875 3 0.87491408967451 3.4524199327686937 2997.0 11.142281679389313 0.0 - - - - - - - 257.8125 5 16 ACADVL acyl-CoA dehydrogenase, very long chain 2051 262 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21583.[MT7]-ASNTAEVFFDGVRVPSENVLGEVGSGFK[MT7].3b6_1.heavy 1067.55 / 718.349 1498.0 44.82365036010742 37 11 10 6 10 0.9793517767549189 63.42254838735041 0.0373992919921875 3 0.87491408967451 3.4524199327686937 1498.0 11.984 0.0 - - - - - - - 168.75 2 8 ACADVL acyl-CoA dehydrogenase, very long chain 2053 262 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21583.[MT7]-ASNTAEVFFDGVRVPSENVLGEVGSGFK[MT7].3b10_1.heavy 1067.55 / 1226.58 450.0 44.82365036010742 37 11 10 6 10 0.9793517767549189 63.42254838735041 0.0373992919921875 3 0.87491408967451 3.4524199327686937 450.0 1.8499999999999999 8.0 - - - - - - - 0.0 0 0 ACADVL acyl-CoA dehydrogenase, very long chain 2055 262 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21583.[MT7]-ASNTAEVFFDGVRVPSENVLGEVGSGFK[MT7].3y5_1.heavy 1067.55 / 639.358 1423.0 44.82365036010742 37 11 10 6 10 0.9793517767549189 63.42254838735041 0.0373992919921875 3 0.87491408967451 3.4524199327686937 1423.0 7.905555555555555 0.0 - - - - - - - 195.0 2 15 ACADVL acyl-CoA dehydrogenase, very long chain 2057 263 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544655.[MT7]-QSLFFYPSYPDEVR.3b4_1.heavy 631.316 / 620.352 48739.0 42.09700012207031 50 20 10 10 10 8.884481648736859 11.255580680299722 0.0 3 0.994142272533328 16.117050342539066 48739.0 85.33953816355093 0.0 - - - - - - - 267.27272727272725 97 11 ARSA arylsulfatase A 2059 263 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544655.[MT7]-QSLFFYPSYPDEVR.3b5_1.heavy 631.316 / 767.421 32017.0 42.09700012207031 50 20 10 10 10 8.884481648736859 11.255580680299722 0.0 3 0.994142272533328 16.117050342539066 32017.0 95.9012606292517 0.0 - - - - - - - 310.15384615384613 64 13 ARSA arylsulfatase A 2061 263 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544655.[MT7]-QSLFFYPSYPDEVR.3y8_1.heavy 631.316 / 962.458 46638.0 42.09700012207031 50 20 10 10 10 8.884481648736859 11.255580680299722 0.0 3 0.994142272533328 16.117050342539066 46638.0 218.55253246753247 0.0 - - - - - - - 226.15384615384616 93 13 ARSA arylsulfatase A 2063 263 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB544655.[MT7]-QSLFFYPSYPDEVR.3y5_1.heavy 631.316 / 615.31 41008.0 42.09700012207031 50 20 10 10 10 8.884481648736859 11.255580680299722 0.0 3 0.994142272533328 16.117050342539066 41008.0 95.90230687830687 0.0 - - - - - - - 710.7692307692307 82 13 ARSA arylsulfatase A 2065 264 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21489.[MT7]-EAGLWSEWSQPIYVGFSR.2y8_1.heavy 1128.56 / 938.509 4033.0 48.05902671813965 46 20 10 6 10 9.611989594179587 10.40367335193056 0.03350067138671875 3 0.9960969374846408 19.7477789993367 4033.0 76.43185483870967 0.0 - - - - - - - 135.27272727272728 8 11 IL5RA interleukin 5 receptor, alpha 2067 264 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21489.[MT7]-EAGLWSEWSQPIYVGFSR.2b4_1.heavy 1128.56 / 515.295 3722.0 48.05902671813965 46 20 10 6 10 9.611989594179587 10.40367335193056 0.03350067138671875 3 0.9960969374846408 19.7477789993367 3722.0 34.41849462365592 0.0 - - - - - - - 147.25 7 8 IL5RA interleukin 5 receptor, alpha 2069 264 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21489.[MT7]-EAGLWSEWSQPIYVGFSR.2b6_1.heavy 1128.56 / 788.406 1489.0 48.05902671813965 46 20 10 6 10 9.611989594179587 10.40367335193056 0.03350067138671875 3 0.9960969374846408 19.7477789993367 1489.0 33.14225806451613 0.0 - - - - - - - 137.77777777777777 2 9 IL5RA interleukin 5 receptor, alpha 2071 264 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21489.[MT7]-EAGLWSEWSQPIYVGFSR.2y10_1.heavy 1128.56 / 1153.6 2295.0 48.05902671813965 46 20 10 6 10 9.611989594179587 10.40367335193056 0.03350067138671875 3 0.9960969374846408 19.7477789993367 2295.0 26.219758064516128 0.0 - - - - - - - 194.26666666666668 4 15 IL5RA interleukin 5 receptor, alpha 2073 265 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21289.[MT7]-QTEVLLQPNPNAR.2b3_1.heavy 812.45 / 503.258 4845.0 29.72410011291504 40 14 10 6 10 4.5326973716874415 22.061918500147254 0.035999298095703125 3 0.9422492579353208 5.110589852384978 4845.0 11.000724637681158 1.0 - - - - - - - 215.07142857142858 9 14 SH3GLB1 SH3-domain GRB2-like endophilin B1 2075 265 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21289.[MT7]-QTEVLLQPNPNAR.2y9_1.heavy 812.45 / 1022.57 6026.0 29.72410011291504 40 14 10 6 10 4.5326973716874415 22.061918500147254 0.035999298095703125 3 0.9422492579353208 5.110589852384978 6026.0 26.61810691003911 0.0 - - - - - - - 150.83333333333334 12 18 SH3GLB1 SH3-domain GRB2-like endophilin B1 2077 265 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21289.[MT7]-QTEVLLQPNPNAR.2b4_1.heavy 812.45 / 602.327 6617.0 29.72410011291504 40 14 10 6 10 4.5326973716874415 22.061918500147254 0.035999298095703125 3 0.9422492579353208 5.110589852384978 6617.0 24.3132071722647 0.0 - - - - - - - 243.5 13 16 SH3GLB1 SH3-domain GRB2-like endophilin B1 2079 265 C20140311_KEGG1700_set08_02 C20140311_KEGG1700_set08_02 TB21289.[MT7]-QTEVLLQPNPNAR.2y6_1.heavy 812.45 / 668.347 10635.0 29.72410011291504 40 14 10 6 10 4.5326973716874415 22.061918500147254 0.035999298095703125 3 0.9422492579353208 5.110589852384978 10635.0 43.89329335071708 0.0 - - - - - - - 227.0 21 13 SH3GLB1 SH3-domain GRB2-like endophilin B1