Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540060.[MT7]-EFYILWTK[MT7].3y3_1.heavy 463.267 / 578.342 16106.0 44.32780075073242 41 11 10 10 10 0.9169259569462282 65.049128722084 0.0 3 0.8612865597610401 3.274538567050283 16106.0 187.01595041322315 0.0 - - - - - - - 206.0 32 15 CAPN2 calpain 2, (m/II) large subunit 3 1 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540060.[MT7]-EFYILWTK[MT7].3b4_1.heavy 463.267 / 697.368 16228.0 44.32780075073242 41 11 10 10 10 0.9169259569462282 65.049128722084 0.0 3 0.8612865597610401 3.274538567050283 16228.0 192.59014876033058 0.0 - - - - - - - 125.33333333333333 32 15 CAPN2 calpain 2, (m/II) large subunit 5 1 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540060.[MT7]-EFYILWTK[MT7].3b5_1.heavy 463.267 / 810.452 2180.0 44.32780075073242 41 11 10 10 10 0.9169259569462282 65.049128722084 0.0 3 0.8612865597610401 3.274538567050283 2180.0 50.171602763853144 0.0 - - - - - - - 147.28571428571428 4 7 CAPN2 calpain 2, (m/II) large subunit 7 1 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540060.[MT7]-EFYILWTK[MT7].3b3_1.heavy 463.267 / 584.284 11686.0 44.32780075073242 41 11 10 10 10 0.9169259569462282 65.049128722084 0.0 3 0.8612865597610401 3.274538567050283 11686.0 248.40381372725636 0.0 - - - - - - - 212.125 23 8 CAPN2 calpain 2, (m/II) large subunit 9 2 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21366.[MT7]-YLMGDLLGEGSYGK[MT7].3y7_1.heavy 597.646 / 841.417 2448.0 42.82972431182861 46 20 10 6 10 9.016545233080464 11.090722379244964 0.030696868896484375 3 0.9943376252427432 16.392980561538064 2448.0 37.97332976104757 1.0 - - - - - - - 138.53333333333333 4 15 STK11 serine/threonine kinase 11 11 2 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21366.[MT7]-YLMGDLLGEGSYGK[MT7].3y3_1.heavy 597.646 / 511.3 3488.0 42.82972431182861 46 20 10 6 10 9.016545233080464 11.090722379244964 0.030696868896484375 3 0.9943376252427432 16.392980561538064 3488.0 31.478572085184616 0.0 - - - - - - - 235.45 6 20 STK11 serine/threonine kinase 11 13 2 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21366.[MT7]-YLMGDLLGEGSYGK[MT7].3b6_1.heavy 597.646 / 837.43 4529.0 42.82972431182861 46 20 10 6 10 9.016545233080464 11.090722379244964 0.030696868896484375 3 0.9943376252427432 16.392980561538064 4529.0 13.764607843137254 0.0 - - - - - - - 167.2 9 15 STK11 serine/threonine kinase 11 15 2 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21366.[MT7]-YLMGDLLGEGSYGK[MT7].3y5_1.heavy 597.646 / 655.353 4651.0 42.82972431182861 46 20 10 6 10 9.016545233080464 11.090722379244964 0.030696868896484375 3 0.9943376252427432 16.392980561538064 4651.0 41.137903139397835 0.0 - - - - - - - 189.94736842105263 9 19 STK11 serine/threonine kinase 11 17 3 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21363.[MT7]-AHQITDESLESTRR.3b6_1.heavy 596.31 / 810.423 1151.0 21.921424865722656 41 14 10 7 10 1.0781486560507294 58.49260746560873 0.027099609375 3 0.9314203607275103 4.6854464909957905 1151.0 4.1436 0.0 - - - - - - - 175.0 2 18 SNAP23 synaptosomal-associated protein, 23kDa 19 3 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21363.[MT7]-AHQITDESLESTRR.3b4_1.heavy 596.31 / 594.348 1051.0 21.921424865722656 41 14 10 7 10 1.0781486560507294 58.49260746560873 0.027099609375 3 0.9314203607275103 4.6854464909957905 1051.0 -0.19999999999999996 1.0 - - - - - - - 123.52941176470588 2 17 SNAP23 synaptosomal-associated protein, 23kDa 21 3 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21363.[MT7]-AHQITDESLESTRR.3y12_2.heavy 596.31 / 717.863 2952.0 21.921424865722656 41 14 10 7 10 1.0781486560507294 58.49260746560873 0.027099609375 3 0.9314203607275103 4.6854464909957905 2952.0 25.584 0.0 - - - - - - - 143.75 5 16 SNAP23 synaptosomal-associated protein, 23kDa 23 3 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21363.[MT7]-AHQITDESLESTRR.3y13_2.heavy 596.31 / 786.392 2652.0 21.921424865722656 41 14 10 7 10 1.0781486560507294 58.49260746560873 0.027099609375 3 0.9314203607275103 4.6854464909957905 2652.0 4.880019184652278 0.0 - - - - - - - 113.88888888888889 5 18 SNAP23 synaptosomal-associated protein, 23kDa 25 4 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21360.[MT7]-K[MT7]IEDASNPLLLK[MT7].4y4_1.heavy 444.027 / 630.467 N/A 32.795799255371094 33 5 10 10 8 0.36700001782265235 127.5698610731831 0.0 4 0.6825418158381218 2.129589355235412 7404.0 4.757004762286616 1.0 - - - - - - - 1262.0 20 8 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 27 4 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21360.[MT7]-K[MT7]IEDASNPLLLK[MT7].4b7_2.heavy 444.027 / 523.79 70679.0 32.795799255371094 33 5 10 10 8 0.36700001782265235 127.5698610731831 0.0 4 0.6825418158381218 2.129589355235412 70679.0 95.13975337020142 0.0 - - - - - - - 772.8888888888889 141 9 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 29 4 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21360.[MT7]-K[MT7]IEDASNPLLLK[MT7].4b4_1.heavy 444.027 / 774.46 2019.0 32.795799255371094 33 5 10 10 8 0.36700001782265235 127.5698610731831 0.0 4 0.6825418158381218 2.129589355235412 2019.0 19.28416205118411 3.0 - - - - - - - 174.33333333333334 4 9 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 31 4 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21360.[MT7]-K[MT7]IEDASNPLLLK[MT7].4y3_1.heavy 444.027 / 517.383 45773.0 32.795799255371094 33 5 10 10 8 0.36700001782265235 127.5698610731831 0.0 4 0.6825418158381218 2.129589355235412 45773.0 44.38773129574236 0.0 - - - - - - - 645.0 91 4 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 33 5 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539928.[MT7]-EIQLLR.2y4_1.heavy 458.291 / 529.346 9555.0 33.26625061035156 39 17 8 6 8 2.3907940370345053 36.47314537803577 0.03900146484375 4 0.9716439014076261 7.311517307233706 9555.0 7.453039014373717 1.0 - - - - - - - 337.3333333333333 19 3 STK11 serine/threonine kinase 11 35 5 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539928.[MT7]-EIQLLR.2b3_1.heavy 458.291 / 515.295 19897.0 33.26625061035156 39 17 8 6 8 2.3907940370345053 36.47314537803577 0.03900146484375 4 0.9716439014076261 7.311517307233706 19897.0 32.75314986204522 0.0 - - - - - - - 761.7777777777778 39 9 STK11 serine/threonine kinase 11 37 5 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539928.[MT7]-EIQLLR.2y5_1.heavy 458.291 / 642.43 26867.0 33.26625061035156 39 17 8 6 8 2.3907940370345053 36.47314537803577 0.03900146484375 4 0.9716439014076261 7.311517307233706 26867.0 50.41171209358289 0.0 - - - - - - - 295.25 53 8 STK11 serine/threonine kinase 11 39 5 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539928.[MT7]-EIQLLR.2b4_1.heavy 458.291 / 628.379 18436.0 33.26625061035156 39 17 8 6 8 2.3907940370345053 36.47314537803577 0.03900146484375 4 0.9716439014076261 7.311517307233706 18436.0 45.211537484116896 2.0 - - - - - - - 348.5 72 10 STK11 serine/threonine kinase 11 41 6 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585330.[MT7]-VK[MT7]EEIIEAFVQELR.3y7_1.heavy 664.385 / 862.478 3994.0 48.59109878540039 40 14 10 6 10 2.831436081929851 28.246418879829335 0.03079986572265625 3 0.9368971324990824 4.886829238403516 3994.0 50.9258275058275 0.0 - - - - - - - 151.42105263157896 7 19 VASP vasodilator-stimulated phosphoprotein 43 6 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585330.[MT7]-VK[MT7]EEIIEAFVQELR.3y6_1.heavy 664.385 / 791.441 4053.0 48.59109878540039 40 14 10 6 10 2.831436081929851 28.246418879829335 0.03079986572265625 3 0.9368971324990824 4.886829238403516 4053.0 74.23256658595642 0.0 - - - - - - - 176.14285714285714 8 14 VASP vasodilator-stimulated phosphoprotein 45 6 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585330.[MT7]-VK[MT7]EEIIEAFVQELR.3b4_1.heavy 664.385 / 774.46 2761.0 48.59109878540039 40 14 10 6 10 2.831436081929851 28.246418879829335 0.03079986572265625 3 0.9368971324990824 4.886829238403516 2761.0 21.37522435897436 0.0 - - - - - - - 129.13333333333333 5 15 VASP vasodilator-stimulated phosphoprotein 47 6 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585330.[MT7]-VK[MT7]EEIIEAFVQELR.3b3_1.heavy 664.385 / 645.417 1703.0 48.59109878540039 40 14 10 6 10 2.831436081929851 28.246418879829335 0.03079986572265625 3 0.9368971324990824 4.886829238403516 1703.0 4.972262773722628 0.0 - - - - - - - 193.7 3 20 VASP vasodilator-stimulated phosphoprotein 49 7 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542452.[MT7]-DNSLDAPVK[MT7].3y3_1.heavy 416.234 / 487.336 19390.0 24.48544931411743 38 12 10 6 10 0.8481524903088207 67.71104462065307 0.03619956970214844 3 0.8826581359827389 3.5669309558685085 19390.0 8.332828909411425 0.0 - - - - - - - 1469.0 38 1 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 51 7 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542452.[MT7]-DNSLDAPVK[MT7].3b5_1.heavy 416.234 / 689.322 11576.0 24.48544931411743 38 12 10 6 10 0.8481524903088207 67.71104462065307 0.03619956970214844 3 0.8826581359827389 3.5669309558685085 11576.0 23.225965614913378 1.0 - - - - - - - 747.8181818181819 23 11 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 53 7 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542452.[MT7]-DNSLDAPVK[MT7].3y4_1.heavy 416.234 / 558.373 3643.0 24.48544931411743 38 12 10 6 10 0.8481524903088207 67.71104462065307 0.03619956970214844 3 0.8826581359827389 3.5669309558685085 3643.0 4.495990094597371 1.0 - - - - - - - 1287.3636363636363 8 11 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 55 7 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542452.[MT7]-DNSLDAPVK[MT7].3b3_1.heavy 416.234 / 461.211 7639.0 24.48544931411743 38 12 10 6 10 0.8481524903088207 67.71104462065307 0.03619956970214844 3 0.8826581359827389 3.5669309558685085 7639.0 9.810170060245557 0.0 - - - - - - - 1217.142857142857 15 7 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 57 8 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21497.[MT7]-TSQQLQLIDEQDSYIQSR.3b6_1.heavy 766.056 / 830.449 53471.0 35.35139846801758 50 20 10 10 10 4.126030618279633 19.143963385707337 0.0 3 0.9908360173755566 12.882140366867606 53471.0 128.57450216450218 0.0 - - - - - - - 760.5714285714286 106 7 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 59 8 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21497.[MT7]-TSQQLQLIDEQDSYIQSR.3y6_1.heavy 766.056 / 753.389 36172.0 35.35139846801758 50 20 10 10 10 4.126030618279633 19.143963385707337 0.0 3 0.9908360173755566 12.882140366867606 36172.0 87.29110743801652 0.0 - - - - - - - 387.2 72 10 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 61 8 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21497.[MT7]-TSQQLQLIDEQDSYIQSR.3b4_1.heavy 766.056 / 589.306 77787.0 35.35139846801758 50 20 10 10 10 4.126030618279633 19.143963385707337 0.0 3 0.9908360173755566 12.882140366867606 77787.0 92.73367561983471 0.0 - - - - - - - 332.75 155 8 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 63 8 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21497.[MT7]-TSQQLQLIDEQDSYIQSR.3b5_1.heavy 766.056 / 702.39 37381.0 35.35139846801758 50 20 10 10 10 4.126030618279633 19.143963385707337 0.0 3 0.9908360173755566 12.882140366867606 37381.0 57.19567607897154 0.0 - - - - - - - 295.77777777777777 74 9 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 65 9 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21217.[MT7]-SSLAEVQSEIER.2y8_1.heavy 746.392 / 989.49 15327.0 34.099398612976074 40 14 10 6 10 1.054760755674796 59.11619935017484 0.039600372314453125 3 0.9339080730080498 4.77382718686317 15327.0 60.93977146298821 0.0 - - - - - - - 292.53846153846155 30 13 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 67 9 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21217.[MT7]-SSLAEVQSEIER.2y5_1.heavy 746.392 / 633.32 8182.0 34.099398612976074 40 14 10 6 10 1.054760755674796 59.11619935017484 0.039600372314453125 3 0.9339080730080498 4.77382718686317 8182.0 9.16201793101103 0.0 - - - - - - - 1168.7142857142858 16 7 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 69 9 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21217.[MT7]-SSLAEVQSEIER.2b4_1.heavy 746.392 / 503.295 11985.0 34.099398612976074 40 14 10 6 10 1.054760755674796 59.11619935017484 0.039600372314453125 3 0.9339080730080498 4.77382718686317 11985.0 41.574193762913765 0.0 - - - - - - - 215.8125 23 16 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 71 9 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21217.[MT7]-SSLAEVQSEIER.2b5_1.heavy 746.392 / 632.337 18439.0 34.099398612976074 40 14 10 6 10 1.054760755674796 59.11619935017484 0.039600372314453125 3 0.9339080730080498 4.77382718686317 18439.0 37.77334796058069 0.0 - - - - - - - 691.1428571428571 36 7 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 73 10 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544424.[MT7]-ADTNRDRIDIANAR.4y5_1.heavy 436.985 / 544.32 43320.0 22.663474559783936 43 17 10 6 10 4.9146760083361825 20.347221226868637 0.03709983825683594 3 0.9758976441347966 7.933346971662846 43320.0 46.18630574935743 0.0 - - - - - - - 759.5454545454545 86 11 SNAP23 synaptosomal-associated protein, 23kDa 75 10 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544424.[MT7]-ADTNRDRIDIANAR.4y8_2.heavy 436.985 / 464.77 6972.0 22.663474559783936 43 17 10 6 10 4.9146760083361825 20.347221226868637 0.03709983825683594 3 0.9758976441347966 7.933346971662846 6972.0 22.55980487804878 0.0 - - - - - - - 169.875 13 16 SNAP23 synaptosomal-associated protein, 23kDa 77 10 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544424.[MT7]-ADTNRDRIDIANAR.4y6_1.heavy 436.985 / 659.347 5486.0 22.663474559783936 43 17 10 6 10 4.9146760083361825 20.347221226868637 0.03709983825683594 3 0.9758976441347966 7.933346971662846 5486.0 28.17219893292683 0.0 - - - - - - - 199.1764705882353 10 17 SNAP23 synaptosomal-associated protein, 23kDa 79 10 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544424.[MT7]-ADTNRDRIDIANAR.4b9_2.heavy 436.985 / 601.306 2871.0 22.663474559783936 43 17 10 6 10 4.9146760083361825 20.347221226868637 0.03709983825683594 3 0.9758976441347966 7.933346971662846 2871.0 3.2004896663756455 3.0 - - - - - - - 685.0 30 11 SNAP23 synaptosomal-associated protein, 23kDa 81 11 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21216.[MT7]-SSLAEVQSEIER.3y6_1.heavy 497.931 / 761.379 23357.0 34.10929870605469 50 20 10 10 10 8.289995757713283 12.06273234904333 0.0 3 0.991840368375809 13.653102285116784 23357.0 53.61954782608695 0.0 - - - - - - - 238.84615384615384 46 13 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 83 11 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21216.[MT7]-SSLAEVQSEIER.3b4_1.heavy 497.931 / 503.295 57989.0 34.10929870605469 50 20 10 10 10 8.289995757713283 12.06273234904333 0.0 3 0.991840368375809 13.653102285116784 57989.0 165.10315802893513 0.0 - - - - - - - 345.0 115 7 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 85 11 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21216.[MT7]-SSLAEVQSEIER.3b5_1.heavy 497.931 / 632.337 86753.0 34.10929870605469 50 20 10 10 10 8.289995757713283 12.06273234904333 0.0 3 0.991840368375809 13.653102285116784 86753.0 109.04622290969502 0.0 - - - - - - - 690.0 173 7 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 87 11 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21216.[MT7]-SSLAEVQSEIER.3y5_1.heavy 497.931 / 633.32 69379.0 34.10929870605469 50 20 10 10 10 8.289995757713283 12.06273234904333 0.0 3 0.991840368375809 13.653102285116784 69379.0 348.40323913043477 0.0 - - - - - - - 249.16666666666666 138 6 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 89 12 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585755.[MT7]-LNLSGC[CAM]SGFSEFALQTLLSSC[CAM]SR.3y6_1.heavy 893.439 / 709.33 3473.0 49.761199951171875 48 18 10 10 10 6.683682572941347 14.961811682207422 0.0 3 0.9895511526612786 12.062832428809777 3473.0 21.716067390321125 0.0 - - - - - - - 166.1 6 20 SKP2 S-phase kinase-associated protein 2 (p45) 91 12 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585755.[MT7]-LNLSGC[CAM]SGFSEFALQTLLSSC[CAM]SR.3y8_1.heavy 893.439 / 923.461 3070.0 49.761199951171875 48 18 10 10 10 6.683682572941347 14.961811682207422 0.0 3 0.9895511526612786 12.062832428809777 3070.0 38.04041672823999 0.0 - - - - - - - 129.38095238095238 6 21 SKP2 S-phase kinase-associated protein 2 (p45) 93 12 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585755.[MT7]-LNLSGC[CAM]SGFSEFALQTLLSSC[CAM]SR.3y5_1.heavy 893.439 / 596.246 4580.0 49.761199951171875 48 18 10 10 10 6.683682572941347 14.961811682207422 0.0 3 0.9895511526612786 12.062832428809777 4580.0 21.58764031667257 0.0 - - - - - - - 171.95833333333334 9 24 SKP2 S-phase kinase-associated protein 2 (p45) 95 12 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585755.[MT7]-LNLSGC[CAM]SGFSEFALQTLLSSC[CAM]SR.3y9_1.heavy 893.439 / 1051.52 3120.0 49.761199951171875 48 18 10 10 10 6.683682572941347 14.961811682207422 0.0 3 0.9895511526612786 12.062832428809777 3120.0 23.932196162046907 0.0 - - - - - - - 161.91304347826087 6 23 SKP2 S-phase kinase-associated protein 2 (p45) 97 13 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 718355.0 30.976499557495117 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 718355.0 2178.588270734852 0.0 - - - - - - - 162.0 1436 2 99 13 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 317854.0 30.976499557495117 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 317854.0 362.59727597307574 0.0 - - - - - - - 325.0 635 1 101 13 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 244045.0 30.976499557495117 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 244045.0 124.47326359327262 1.0 - - - - - - - 866.0 541 2 103 14 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545102.[MT7]-QYLDQQQYQSALFWADK[MT7].3b4_1.heavy 807.409 / 664.342 10451.0 40.78267574310303 43 17 10 6 10 4.093774701889276 24.42733352029608 0.033901214599609375 3 0.9723108259989228 7.399461906310196 10451.0 73.59544092465754 0.0 - - - - - - - 574.5714285714286 20 7 CDC16 cell division cycle 16 homolog (S. cerevisiae) 105 14 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545102.[MT7]-QYLDQQQYQSALFWADK[MT7].3b5_1.heavy 807.409 / 792.401 4750.0 40.78267574310303 43 17 10 6 10 4.093774701889276 24.42733352029608 0.033901214599609375 3 0.9723108259989228 7.399461906310196 4750.0 14.124685362841944 0.0 - - - - - - - 251.44444444444446 9 18 CDC16 cell division cycle 16 homolog (S. cerevisiae) 107 14 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545102.[MT7]-QYLDQQQYQSALFWADK[MT7].3b3_1.heavy 807.409 / 549.315 8697.0 40.78267574310303 43 17 10 6 10 4.093774701889276 24.42733352029608 0.033901214599609375 3 0.9723108259989228 7.399461906310196 8697.0 37.80206392694064 0.0 - - - - - - - 594.125 17 8 CDC16 cell division cycle 16 homolog (S. cerevisiae) 109 14 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545102.[MT7]-QYLDQQQYQSALFWADK[MT7].3y5_1.heavy 807.409 / 810.427 7893.0 40.78267574310303 43 17 10 6 10 4.093774701889276 24.42733352029608 0.033901214599609375 3 0.9723108259989228 7.399461906310196 7893.0 44.55621559728526 0.0 - - - - - - - 214.13333333333333 15 15 CDC16 cell division cycle 16 homolog (S. cerevisiae) 111 15 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21346.[MT7]-IRNPWGEVEWTGR.3y6_1.heavy 581.973 / 747.378 3205.0 37.27320098876953 50 20 10 10 10 6.897534217580451 14.497934601776933 0.0 3 0.9936350406348298 15.460869954727114 3205.0 32.72400022983222 0.0 - - - - - - - 270.45454545454544 6 11 CAPN2 calpain 2, (m/II) large subunit 113 15 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21346.[MT7]-IRNPWGEVEWTGR.3y4_1.heavy 581.973 / 519.267 5609.0 37.27320098876953 50 20 10 10 10 6.897534217580451 14.497934601776933 0.0 3 0.9936350406348298 15.460869954727114 5609.0 5.639017703067866 1.0 - - - - - - - 297.5 12 10 CAPN2 calpain 2, (m/II) large subunit 115 15 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21346.[MT7]-IRNPWGEVEWTGR.3y8_1.heavy 581.973 / 933.443 6181.0 37.27320098876953 50 20 10 10 10 6.897534217580451 14.497934601776933 0.0 3 0.9936350406348298 15.460869954727114 6181.0 37.51786026200873 0.0 - - - - - - - 320.4 12 10 CAPN2 calpain 2, (m/II) large subunit 117 15 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21346.[MT7]-IRNPWGEVEWTGR.3y5_1.heavy 581.973 / 648.31 6982.0 37.27320098876953 50 20 10 10 10 6.897534217580451 14.497934601776933 0.0 3 0.9936350406348298 15.460869954727114 6982.0 26.782614931187698 0.0 - - - - - - - 257.4166666666667 13 12 CAPN2 calpain 2, (m/II) large subunit 119 16 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584349.[MT7]-SDTFINLR.2b4_1.heavy 555.307 / 595.284 3535.0 33.992000579833984 47 17 10 10 10 4.421364354540971 22.617452890371904 0.0 3 0.9781394121573923 8.33176669859261 3535.0 5.22719298245614 0.0 - - - - - - - 635.1428571428571 7 7 CAPN2 calpain 2, (m/II) large subunit 121 16 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584349.[MT7]-SDTFINLR.2y6_1.heavy 555.307 / 763.446 4219.0 33.992000579833984 47 17 10 10 10 4.421364354540971 22.617452890371904 0.0 3 0.9781394121573923 8.33176669859261 4219.0 18.01093567251462 0.0 - - - - - - - 201.69230769230768 8 13 CAPN2 calpain 2, (m/II) large subunit 123 16 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584349.[MT7]-SDTFINLR.2b5_1.heavy 555.307 / 708.369 2623.0 33.992000579833984 47 17 10 10 10 4.421364354540971 22.617452890371904 0.0 3 0.9781394121573923 8.33176669859261 2623.0 8.053070175438597 1.0 - - - - - - - 671.3333333333334 5 9 CAPN2 calpain 2, (m/II) large subunit 125 16 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584349.[MT7]-SDTFINLR.2y7_1.heavy 555.307 / 878.473 2052.0 33.992000579833984 47 17 10 10 10 4.421364354540971 22.617452890371904 0.0 3 0.9781394121573923 8.33176669859261 2052.0 18.72 0.0 - - - - - - - 218.5 4 12 CAPN2 calpain 2, (m/II) large subunit 127 17 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21242.[MT7]-TIEYLQPNPASR.2y8_1.heavy 766.913 / 882.479 16753.0 31.232500076293945 48 18 10 10 10 11.602244923182823 8.619021634355153 0.0 3 0.9867495436989594 10.709426965554547 16753.0 124.25514826261278 0.0 - - - - - - - 185.8 33 10 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 129 17 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21242.[MT7]-TIEYLQPNPASR.2y9_1.heavy 766.913 / 1045.54 22885.0 31.232500076293945 48 18 10 10 10 11.602244923182823 8.619021634355153 0.0 3 0.9867495436989594 10.709426965554547 22885.0 74.16153934982289 0.0 - - - - - - - 314.5 45 8 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 131 17 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21242.[MT7]-TIEYLQPNPASR.2y6_1.heavy 766.913 / 641.336 37119.0 31.232500076293945 48 18 10 10 10 11.602244923182823 8.619021634355153 0.0 3 0.9867495436989594 10.709426965554547 37119.0 123.1133795797751 0.0 - - - - - - - 196.8 74 5 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 133 17 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21242.[MT7]-TIEYLQPNPASR.2y10_1.heavy 766.913 / 1174.59 14782.0 31.232500076293945 48 18 10 10 10 11.602244923182823 8.619021634355153 0.0 3 0.9867495436989594 10.709426965554547 14782.0 58.338194398039874 0.0 - - - - - - - 145.55555555555554 29 9 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 135 18 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545103.[MT7]-GQVC[CAM]LPVISAENWK[MT7]PATK[MT7].4y4_1.heavy 608.344 / 560.352 7900.0 37.42460060119629 45 20 10 5 10 5.959409867459263 16.780184988792193 0.041797637939453125 3 0.9910511488796828 13.036299391970624 7900.0 13.527362298195632 0.0 - - - - - - - 304.1111111111111 15 9 UBE2L3 ubiquitin-conjugating enzyme E2L 3 137 18 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545103.[MT7]-GQVC[CAM]LPVISAENWK[MT7]PATK[MT7].4y10_2.heavy 608.344 / 710.395 2949.0 37.42460060119629 45 20 10 5 10 5.959409867459263 16.780184988792193 0.041797637939453125 3 0.9910511488796828 13.036299391970624 2949.0 13.650779290899274 1.0 - - - - - - - 210.75 9 8 UBE2L3 ubiquitin-conjugating enzyme E2L 3 139 18 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545103.[MT7]-GQVC[CAM]LPVISAENWK[MT7]PATK[MT7].4b4_1.heavy 608.344 / 589.288 4951.0 37.42460060119629 45 20 10 5 10 5.959409867459263 16.780184988792193 0.041797637939453125 3 0.9910511488796828 13.036299391970624 4951.0 13.48561358078752 0.0 - - - - - - - 263.25 9 8 UBE2L3 ubiquitin-conjugating enzyme E2L 3 141 18 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545103.[MT7]-GQVC[CAM]LPVISAENWK[MT7]PATK[MT7].4b5_1.heavy 608.344 / 702.372 5477.0 37.42460060119629 45 20 10 5 10 5.959409867459263 16.780184988792193 0.041797637939453125 3 0.9910511488796828 13.036299391970624 5477.0 1.1652806049407838 2.0 - - - - - - - 175.66666666666666 10 6 UBE2L3 ubiquitin-conjugating enzyme E2L 3 143 19 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 755378.0 16.86440086364746 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 755378.0 3048.359458247067 0.0 - - - - - - - 134.33333333333334 1510 9 145 19 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 1170440.0 16.86440086364746 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1170440.0 5460.125050630428 0.0 - - - - - - - 134.44444444444446 2340 9 147 19 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 618793.0 16.86440086364746 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 618793.0 3105.6585300799115 0.0 - - - - - - - 165.4 1237 10 149 20 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20902.[MT7]-ATPTSTAK[MT7].2y4_1.heavy 532.813 / 550.332 2378.0 16.33209991455078 50 20 10 10 10 4.768950411423746 15.635204221472453 0.0 3 0.994561390079355 16.727128301640118 2378.0 36.93980582524272 0.0 - - - - - - - 80.22222222222223 4 18 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 151 20 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20902.[MT7]-ATPTSTAK[MT7].2y5_1.heavy 532.813 / 651.379 1447.0 16.33209991455078 50 20 10 10 10 4.768950411423746 15.635204221472453 0.0 3 0.994561390079355 16.727128301640118 1447.0 20.658887765419614 0.0 - - - - - - - 112.33333333333333 2 15 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 153 20 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20902.[MT7]-ATPTSTAK[MT7].2y6_1.heavy 532.813 / 748.432 11613.0 16.33209991455078 50 20 10 10 10 4.768950411423746 15.635204221472453 0.0 3 0.994561390079355 16.727128301640118 11613.0 106.14053745554664 0.0 - - - - - - - 175.65 23 20 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 155 20 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20902.[MT7]-ATPTSTAK[MT7].2y7_1.heavy 532.813 / 849.48 3067.0 16.33209991455078 50 20 10 10 10 4.768950411423746 15.635204221472453 0.0 3 0.994561390079355 16.727128301640118 3067.0 32.71121429576474 0.0 - - - - - - - 79.1 6 20 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 157 21 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541023.[MT7]-IQQEQK[MT7].2y4_1.heavy 531.313 / 676.375 1940.0 17.604474544525146 45 20 10 5 10 6.1449912073116755 16.27341628756345 0.04129981994628906 3 0.9917940497178788 13.614462437325487 1940.0 55.94418604651163 0.0 - - - - - - - 69.46153846153847 3 13 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 159 21 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541023.[MT7]-IQQEQK[MT7].2y5_1.heavy 531.313 / 804.433 2500.0 17.604474544525146 45 20 10 5 10 6.1449912073116755 16.27341628756345 0.04129981994628906 3 0.9917940497178788 13.614462437325487 2500.0 17.24186046511628 1.0 - - - - - - - 82.0909090909091 5 11 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 161 21 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541023.[MT7]-IQQEQK[MT7].2b4_1.heavy 531.313 / 643.353 1853.0 17.604474544525146 45 20 10 5 10 6.1449912073116755 16.27341628756345 0.04129981994628906 3 0.9917940497178788 13.614462437325487 1853.0 43.954883720930226 0.0 - - - - - - - 77.4 3 15 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 163 21 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541023.[MT7]-IQQEQK[MT7].2y3_1.heavy 531.313 / 548.316 1724.0 17.604474544525146 45 20 10 5 10 6.1449912073116755 16.27341628756345 0.04129981994628906 3 0.9917940497178788 13.614462437325487 1724.0 20.313798449612406 0.0 - - - - - - - 126.77777777777777 3 18 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 165 22 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540311.[MT7]-DDTTTK[MT7].2y4_1.heavy 484.761 / 594.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 167 22 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540311.[MT7]-DDTTTK[MT7].2y5_1.heavy 484.761 / 709.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 169 22 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540311.[MT7]-DDTTTK[MT7].2b4_1.heavy 484.761 / 577.259 N/A N/A - - - - - - - - - 0.0 - - - - - - - RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 171 22 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540311.[MT7]-DDTTTK[MT7].2y3_1.heavy 484.761 / 493.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 173 23 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543582.[MT7]-IEDASNPLLLK[MT7].3y3_1.heavy 500.967 / 517.383 18519.0 36.54410171508789 35 5 10 10 10 0.39485804338484465 118.64707284600368 0.0 3 0.6673290578134752 2.0773287020970383 18519.0 5.548491532136589 1.0 - - - - - - - 484.0 39 2 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 175 23 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543582.[MT7]-IEDASNPLLLK[MT7].3b6_1.heavy 500.967 / 774.375 9199.0 36.54410171508789 35 5 10 10 10 0.39485804338484465 118.64707284600368 0.0 3 0.6673290578134752 2.0773287020970383 9199.0 40.2585837716003 0.0 - - - - - - - 287.375 18 8 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 177 23 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543582.[MT7]-IEDASNPLLLK[MT7].3b4_1.heavy 500.967 / 573.3 3389.0 36.54410171508789 35 5 10 10 10 0.39485804338484465 118.64707284600368 0.0 3 0.6673290578134752 2.0773287020970383 3389.0 6.535181362996259 2.0 - - - - - - - 338.8 6 10 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 179 23 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543582.[MT7]-IEDASNPLLLK[MT7].3b5_1.heavy 500.967 / 660.332 3026.0 36.54410171508789 35 5 10 10 10 0.39485804338484465 118.64707284600368 0.0 3 0.6673290578134752 2.0773287020970383 3026.0 10.717827626918536 0.0 - - - - - - - 295.77777777777777 6 9 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 181 24 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20909.[MT7]-EIQLLRR.2b3_1.heavy 536.341 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - STK11 serine/threonine kinase 11 183 24 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20909.[MT7]-EIQLLRR.2b5_2.heavy 536.341 / 371.235 N/A N/A - - - - - - - - - 0.0 - - - - - - - STK11 serine/threonine kinase 11 185 24 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20909.[MT7]-EIQLLRR.2b4_1.heavy 536.341 / 628.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - STK11 serine/threonine kinase 11 187 24 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20909.[MT7]-EIQLLRR.2b5_1.heavy 536.341 / 741.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - STK11 serine/threonine kinase 11 189 25 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20904.[MT7]-GDQAFTER.2y5_1.heavy 534.266 / 623.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3;MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 3;mitogen-activated protein kinase-activated protein kinase 2 191 25 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20904.[MT7]-GDQAFTER.2b4_1.heavy 534.266 / 516.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3;MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 3;mitogen-activated protein kinase-activated protein kinase 2 193 25 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20904.[MT7]-GDQAFTER.2y6_1.heavy 534.266 / 751.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3;MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 3;mitogen-activated protein kinase-activated protein kinase 2 195 25 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20904.[MT7]-GDQAFTER.2b5_1.heavy 534.266 / 663.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK3;MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 3;mitogen-activated protein kinase-activated protein kinase 2 197 26 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544811.[MT7]-GAEAANVTGPDGVPVEGSR.3b6_1.heavy 642.993 / 658.328 26240.0 27.01165008544922 41 17 10 6 8 4.544580979379161 22.00422887252877 0.03070068359375 4 0.9765277988138125 8.039560238328436 26240.0 84.36151686263466 0.0 - - - - - - - 273.6363636363636 52 11 CSDA cold shock domain protein A 199 26 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544811.[MT7]-GAEAANVTGPDGVPVEGSR.3y6_1.heavy 642.993 / 644.336 44713.0 27.01165008544922 41 17 10 6 8 4.544580979379161 22.00422887252877 0.03070068359375 4 0.9765277988138125 8.039560238328436 44713.0 59.45520934164752 0.0 - - - - - - - 760.0 89 7 CSDA cold shock domain protein A 201 26 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544811.[MT7]-GAEAANVTGPDGVPVEGSR.3b5_1.heavy 642.993 / 544.285 13855.0 27.01165008544922 41 17 10 6 8 4.544580979379161 22.00422887252877 0.03070068359375 4 0.9765277988138125 8.039560238328436 13855.0 18.29449200873055 1.0 - - - - - - - 1268.5 67 8 CSDA cold shock domain protein A 203 26 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544811.[MT7]-GAEAANVTGPDGVPVEGSR.3y8_1.heavy 642.993 / 800.426 9516.0 27.01165008544922 41 17 10 6 8 4.544580979379161 22.00422887252877 0.03070068359375 4 0.9765277988138125 8.039560238328436 9516.0 25.557257142857143 0.0 - - - - - - - 280.0 19 16 CSDA cold shock domain protein A 205 27 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21232.[MT7]-DESANQEEPEAR.2y5_1.heavy 759.843 / 601.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - VASP vasodilator-stimulated phosphoprotein 207 27 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21232.[MT7]-DESANQEEPEAR.2b4_1.heavy 759.843 / 547.248 N/A N/A - - - - - - - - - 0.0 - - - - - - - VASP vasodilator-stimulated phosphoprotein 209 27 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21232.[MT7]-DESANQEEPEAR.2y10_1.heavy 759.843 / 1130.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - VASP vasodilator-stimulated phosphoprotein 211 27 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21232.[MT7]-DESANQEEPEAR.2b5_1.heavy 759.843 / 661.291 N/A N/A - - - - - - - - - 0.0 - - - - - - - VASP vasodilator-stimulated phosphoprotein 213 28 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21235.[MT7]-EVLDSETLC[CAM]RR.3b6_1.heavy 507.932 / 817.406 3009.0 27.065624237060547 37 11 10 6 10 0.9630940026260657 62.40008024543366 0.03170013427734375 3 0.8796111230440046 3.52056755540374 3009.0 32.955714285714286 0.0 - - - - - - - 152.35294117647058 6 17 STK11 serine/threonine kinase 11 215 28 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21235.[MT7]-EVLDSETLC[CAM]RR.3b4_1.heavy 507.932 / 601.331 16094.0 27.065624237060547 37 11 10 6 10 0.9630940026260657 62.40008024543366 0.03170013427734375 3 0.8796111230440046 3.52056755540374 16094.0 147.14514285714287 0.0 - - - - - - - 325.29411764705884 32 17 STK11 serine/threonine kinase 11 217 28 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21235.[MT7]-EVLDSETLC[CAM]RR.3y7_2.heavy 507.932 / 461.232 29529.0 27.065624237060547 37 11 10 6 10 0.9630940026260657 62.40008024543366 0.03170013427734375 3 0.8796111230440046 3.52056755540374 29529.0 52.45282894736842 0.0 - - - - - - - 738.8888888888889 59 9 STK11 serine/threonine kinase 11 219 28 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21235.[MT7]-EVLDSETLC[CAM]RR.3b5_1.heavy 507.932 / 688.363 10356.0 27.065624237060547 37 11 10 6 10 0.9630940026260657 62.40008024543366 0.03170013427734375 3 0.8796111230440046 3.52056755540374 10356.0 40.536342857142856 0.0 - - - - - - - 720.0 20 7 STK11 serine/threonine kinase 11 221 29 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584493.[MT7]-AVESC[CAM]SDVTR.2y8_1.heavy 634.307 / 953.399 2264.0 19.403600692749023 42 12 10 10 10 1.5418116701347169 44.259871970640745 0.0 3 0.8914274823612004 3.711012388343576 2264.0 24.034132612856016 0.0 - - - - - - - 90.53846153846153 4 13 ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) 223 29 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584493.[MT7]-AVESC[CAM]SDVTR.2b4_1.heavy 634.307 / 531.289 330.0 19.403600692749023 42 12 10 10 10 1.5418116701347169 44.259871970640745 0.0 3 0.8914274823612004 3.711012388343576 330.0 0.9316282461158787 18.0 - - - - - - - 0.0 0 0 ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) 225 29 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584493.[MT7]-AVESC[CAM]SDVTR.2y9_1.heavy 634.307 / 1052.47 2170.0 19.403600692749023 42 12 10 10 10 1.5418116701347169 44.259871970640745 0.0 3 0.8914274823612004 3.711012388343576 2170.0 14.494648613797551 0.0 - - - - - - - 104.14285714285714 4 14 ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) 227 29 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584493.[MT7]-AVESC[CAM]SDVTR.2y7_1.heavy 634.307 / 824.357 1132.0 19.403600692749023 42 12 10 10 10 1.5418116701347169 44.259871970640745 0.0 3 0.8914274823612004 3.711012388343576 1132.0 19.41259574468085 0.0 - - - - - - - 125.58333333333333 2 12 ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) 229 30 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21239.[MT7]-EFETLC[CAM]SELTR.2b3_1.heavy 764.875 / 550.263 7570.0 38.03010177612305 38 8 10 10 10 0.5701529662171239 93.53817040066812 0.0 3 0.7841171854771251 2.606821162673415 7570.0 16.6 0.0 - - - - - - - 243.125 15 8 ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) 231 30 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21239.[MT7]-EFETLC[CAM]SELTR.2y8_1.heavy 764.875 / 979.488 4758.0 38.03010177612305 38 8 10 10 10 0.5701529662171239 93.53817040066812 0.0 3 0.7841171854771251 2.606821162673415 4758.0 18.0210623556582 0.0 - - - - - - - 261.1666666666667 9 12 ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) 233 30 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21239.[MT7]-EFETLC[CAM]SELTR.2b4_1.heavy 764.875 / 651.311 1514.0 38.03010177612305 38 8 10 10 10 0.5701529662171239 93.53817040066812 0.0 3 0.7841171854771251 2.606821162673415 1514.0 6.608647872320189 7.0 - - - - - - - 635.5 4 8 ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) 235 30 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21239.[MT7]-EFETLC[CAM]SELTR.2y9_1.heavy 764.875 / 1108.53 2487.0 38.03010177612305 38 8 10 10 10 0.5701529662171239 93.53817040066812 0.0 3 0.7841171854771251 2.606821162673415 2487.0 5.056746765249537 0.0 - - - - - - - 239.28571428571428 4 14 ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) 237 31 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 594131.0 19.5403995513916 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 594131.0 6593.874763186814 0.0 - - - - - - - 646.4 1188 10 239 31 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 331562.0 19.5403995513916 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 331562.0 2067.1875714285716 0.0 - - - - - - - 715.2857142857143 663 7 241 31 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 355862.0 19.5403995513916 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 355862.0 3973.140571428571 0.0 - - - - - - - 682.7 711 10 243 32 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21333.[MT7]-AVEIEELTYIIK[MT7].2y8_1.heavy 855.002 / 1152.66 5524.0 45.35465049743652 37 11 10 6 10 0.7986245288079853 68.12966165994177 0.035701751708984375 3 0.8608209445665377 3.268922893690417 5524.0 19.43331981926077 0.0 - - - - - - - 182.76470588235293 11 17 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 245 32 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21333.[MT7]-AVEIEELTYIIK[MT7].2b6_1.heavy 855.002 / 815.427 5270.0 45.35465049743652 37 11 10 6 10 0.7986245288079853 68.12966165994177 0.035701751708984375 3 0.8608209445665377 3.268922893690417 5270.0 29.323884514435697 0.0 - - - - - - - 172.55555555555554 10 18 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 247 32 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21333.[MT7]-AVEIEELTYIIK[MT7].2b7_1.heavy 855.002 / 928.511 5397.0 45.35465049743652 37 11 10 6 10 0.7986245288079853 68.12966165994177 0.035701751708984375 3 0.8608209445665377 3.268922893690417 5397.0 33.69431320859066 0.0 - - - - - - - 185.23076923076923 10 13 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 249 32 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21333.[MT7]-AVEIEELTYIIK[MT7].2b5_1.heavy 855.002 / 686.384 5333.0 45.35465049743652 37 11 10 6 10 0.7986245288079853 68.12966165994177 0.035701751708984375 3 0.8608209445665377 3.268922893690417 5333.0 36.18616203895566 0.0 - - - - - - - 210.1578947368421 10 19 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 251 33 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544952.[MT7]-IVSVGDDQEIHIYDC[CAM]PI.3b9_1.heavy 706.35 / 1087.54 8478.0 40.72469902038574 46 20 10 6 10 27.52074545286207 3.6336225038410186 0.031200408935546875 3 0.9951083687901643 17.63836490568161 8478.0 29.98381646333847 0.0 - - - - - - - 685.375 16 8 WDR61 WD repeat domain 61 253 33 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544952.[MT7]-IVSVGDDQEIHIYDC[CAM]PI.3b6_1.heavy 706.35 / 715.411 3727.0 40.72469902038574 46 20 10 6 10 27.52074545286207 3.6336225038410186 0.031200408935546875 3 0.9951083687901643 17.63836490568161 3727.0 10.373931290064103 0.0 - - - - - - - 643.4 7 10 WDR61 WD repeat domain 61 255 33 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544952.[MT7]-IVSVGDDQEIHIYDC[CAM]PI.3b10_1.heavy 706.35 / 1200.62 5774.0 40.72469902038574 46 20 10 6 10 27.52074545286207 3.6336225038410186 0.031200408935546875 3 0.9951083687901643 17.63836490568161 5774.0 42.514041095890406 0.0 - - - - - - - 226.3 11 20 WDR61 WD repeat domain 61 257 33 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544952.[MT7]-IVSVGDDQEIHIYDC[CAM]PI.3b7_1.heavy 706.35 / 830.438 4239.0 40.72469902038574 46 20 10 6 10 27.52074545286207 3.6336225038410186 0.031200408935546875 3 0.9951083687901643 17.63836490568161 4239.0 14.62631190727081 0.0 - - - - - - - 210.41176470588235 8 17 WDR61 WD repeat domain 61 259 34 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20915.[MT7]-TNRQAAK[MT7].2y4_1.heavy 538.824 / 561.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP9 caspase 9, apoptosis-related cysteine peptidase 261 34 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20915.[MT7]-TNRQAAK[MT7].2b3_1.heavy 538.824 / 516.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP9 caspase 9, apoptosis-related cysteine peptidase 263 34 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20915.[MT7]-TNRQAAK[MT7].2b6_1.heavy 538.824 / 786.434 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP9 caspase 9, apoptosis-related cysteine peptidase 265 34 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20915.[MT7]-TNRQAAK[MT7].2y6_1.heavy 538.824 / 831.492 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP9 caspase 9, apoptosis-related cysteine peptidase 267 35 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20914.[MT7]-VANAVSVK[MT7].2y4_1.heavy 538.339 / 576.384 5247.0 23.837600708007812 46 16 10 10 10 2.372870348641175 28.719811309580933 0.0 3 0.9697112214955979 7.073252541020356 5247.0 13.501052631578947 0.0 - - - - - - - 271.5882352941176 10 17 CASP9 caspase 9, apoptosis-related cysteine peptidase 269 35 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20914.[MT7]-VANAVSVK[MT7].2b4_1.heavy 538.339 / 500.295 4334.0 23.837600708007812 46 16 10 10 10 2.372870348641175 28.719811309580933 0.0 3 0.9697112214955979 7.073252541020356 4334.0 6.207199799088724 0.0 - - - - - - - 666.9 8 10 CASP9 caspase 9, apoptosis-related cysteine peptidase 271 35 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20914.[MT7]-VANAVSVK[MT7].2b5_1.heavy 538.339 / 599.363 2737.0 23.837600708007812 46 16 10 10 10 2.372870348641175 28.719811309580933 0.0 3 0.9697112214955979 7.073252541020356 2737.0 25.52932748538012 0.0 - - - - - - - 197.8235294117647 5 17 CASP9 caspase 9, apoptosis-related cysteine peptidase 273 35 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20914.[MT7]-VANAVSVK[MT7].2y7_1.heavy 538.339 / 832.501 5190.0 23.837600708007812 46 16 10 10 10 2.372870348641175 28.719811309580933 0.0 3 0.9697112214955979 7.073252541020356 5190.0 34.16641604010025 0.0 - - - - - - - 199.5 10 14 CASP9 caspase 9, apoptosis-related cysteine peptidase 275 36 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544546.[MT7]-AILSTK[MT7]PPGTFLLR.3y7_1.heavy 601.376 / 803.477 2485.0 37.82939910888672 36 20 2 10 4 108.29863221928558 0.9233726959498222 0.0 8 0.9999279334679994 145.37607857527337 2485.0 4.002572706935123 3.0 - - - - - - - 282.9230769230769 28 13 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 277 36 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544546.[MT7]-AILSTK[MT7]PPGTFLLR.3y6_1.heavy 601.376 / 706.425 795.0 37.82939910888672 36 20 2 10 4 108.29863221928558 0.9233726959498222 0.0 8 0.9999279334679994 145.37607857527337 795.0 0.37378648427157524 6.0 - - - - - - - 235.0909090909091 2 11 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 279 36 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544546.[MT7]-AILSTK[MT7]PPGTFLLR.3y11_2.heavy 601.376 / 680.907 N/A 37.82939910888672 36 20 2 10 4 108.29863221928558 0.9233726959498222 0.0 8 0.9999279334679994 145.37607857527337 0.0 0.0 30.0 - - - - - - - 218.5 4 10 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 281 36 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544546.[MT7]-AILSTK[MT7]PPGTFLLR.3y8_1.heavy 601.376 / 900.53 6064.0 37.82939910888672 36 20 2 10 4 108.29863221928558 0.9233726959498222 0.0 8 0.9999279334679994 145.37607857527337 6064.0 12.272840388972828 1.0 - - - - - - - 265.0 12 12 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 283 37 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544549.[MT7]-AILSTK[MT7]PPGTFLLR.4y4_1.heavy 451.284 / 548.356 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 285 37 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544549.[MT7]-AILSTK[MT7]PPGTFLLR.4y7_1.heavy 451.284 / 803.477 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 287 37 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544549.[MT7]-AILSTK[MT7]PPGTFLLR.4y3_1.heavy 451.284 / 401.287 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 289 37 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544549.[MT7]-AILSTK[MT7]PPGTFLLR.4y6_1.heavy 451.284 / 706.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 291 38 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544073.[MT7]-RQGK[MT7]IPDEELR.4y5_1.heavy 407.989 / 661.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 293 38 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544073.[MT7]-RQGK[MT7]IPDEELR.4y4_1.heavy 407.989 / 546.288 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 295 38 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544073.[MT7]-RQGK[MT7]IPDEELR.4b7_2.heavy 407.989 / 542.329 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 297 38 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544073.[MT7]-RQGK[MT7]IPDEELR.4b9_2.heavy 407.989 / 671.372 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 299 39 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21518.[MT7]-QFLAPWIESQDWAYAASK[MT7].4y5_1.heavy 600.562 / 683.385 6947.0 47.427398681640625 47 17 10 10 10 2.058445101944692 37.8019933633073 0.0 3 0.9748265856495932 7.762042517610323 6947.0 109.82649856821632 0.0 - - - - - - - 187.35714285714286 13 14 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 301 39 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21518.[MT7]-QFLAPWIESQDWAYAASK[MT7].4y4_1.heavy 600.562 / 520.321 12492.0 47.427398681640625 47 17 10 10 10 2.058445101944692 37.8019933633073 0.0 3 0.9748265856495932 7.762042517610323 12492.0 51.22866672050391 0.0 - - - - - - - 223.66666666666666 24 15 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 303 39 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21518.[MT7]-QFLAPWIESQDWAYAASK[MT7].4b4_1.heavy 600.562 / 604.357 21572.0 47.427398681640625 47 17 10 10 10 2.058445101944692 37.8019933633073 0.0 3 0.9748265856495932 7.762042517610323 21572.0 126.94623977701983 0.0 - - - - - - - 173.6153846153846 43 13 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 305 39 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21518.[MT7]-QFLAPWIESQDWAYAASK[MT7].4b3_1.heavy 600.562 / 533.32 9262.0 47.427398681640625 47 17 10 10 10 2.058445101944692 37.8019933633073 0.0 3 0.9748265856495932 7.762042517610323 9262.0 20.145365527153846 0.0 - - - - - - - 187.06666666666666 18 15 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 307 40 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20983.[MT7]-MSFQEVQR.2b3_1.heavy 584.799 / 510.25 449.0 29.021799087524414 50 20 10 10 10 10.979182742998766 9.108146056114082 0.0 3 0.9975682227444462 25.02144722751639 449.0 1.2878272980501393 26.0 - - - - - - - 0.0 1 0 PLCD4 phospholipase C, delta 4 309 40 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20983.[MT7]-MSFQEVQR.2y6_1.heavy 584.799 / 806.416 898.0 29.021799087524414 50 20 10 10 10 10.979182742998766 9.108146056114082 0.0 3 0.9975682227444462 25.02144722751639 898.0 8.630777777777778 0.0 - - - - - - - 0.0 1 0 PLCD4 phospholipase C, delta 4 311 40 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20983.[MT7]-MSFQEVQR.2b5_1.heavy 584.799 / 767.351 988.0 29.021799087524414 50 20 10 10 10 10.979182742998766 9.108146056114082 0.0 3 0.9975682227444462 25.02144722751639 988.0 7.3551111111111105 1.0 - - - - - - - 0.0 1 0 PLCD4 phospholipase C, delta 4 313 40 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20983.[MT7]-MSFQEVQR.2y7_1.heavy 584.799 / 893.448 2244.0 29.021799087524414 50 20 10 10 10 10.979182742998766 9.108146056114082 0.0 3 0.9975682227444462 25.02144722751639 2244.0 8.575198560018 1.0 - - - - - - - 187.9090909090909 5 11 PLCD4 phospholipase C, delta 4 315 41 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21320.[MT7]-RWLPAGTGPQAFSR.3b6_1.heavy 563.31 / 825.485 8888.0 33.03379821777344 47 17 10 10 10 3.3893499851678537 23.549421924403678 0.0 3 0.9708838858050907 7.2149984977203605 8888.0 9.195894686697573 1.0 - - - - - - - 739.4285714285714 19 7 VASP vasodilator-stimulated phosphoprotein 317 41 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21320.[MT7]-RWLPAGTGPQAFSR.3y6_1.heavy 563.31 / 705.368 25200.0 33.03379821777344 47 17 10 10 10 3.3893499851678537 23.549421924403678 0.0 3 0.9708838858050907 7.2149984977203605 25200.0 62.346666666666664 0.0 - - - - - - - 225.3 50 10 VASP vasodilator-stimulated phosphoprotein 319 41 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21320.[MT7]-RWLPAGTGPQAFSR.3b3_1.heavy 563.31 / 600.374 23850.0 33.03379821777344 47 17 10 10 10 3.3893499851678537 23.549421924403678 0.0 3 0.9708838858050907 7.2149984977203605 23850.0 52.952776030887804 0.0 - - - - - - - 707.4285714285714 47 7 VASP vasodilator-stimulated phosphoprotein 321 41 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21320.[MT7]-RWLPAGTGPQAFSR.3y5_1.heavy 563.31 / 608.315 21263.0 33.03379821777344 47 17 10 10 10 3.3893499851678537 23.549421924403678 0.0 3 0.9708838858050907 7.2149984977203605 21263.0 55.189870107781786 0.0 - - - - - - - 362.6666666666667 42 9 VASP vasodilator-stimulated phosphoprotein 323 42 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21515.[MT7]-RSIVSELAGLLSAMEYVQK[MT7].4y3_1.heavy 596.338 / 518.342 563.0 54.86347484588623 32 5 10 7 10 0.4109199961343644 115.09889964107484 0.023097991943359375 3 0.6583439391473833 2.048076303376538 563.0 16.68148148148148 1.0 - - - - - - - 0.0 1 0 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 325 42 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21515.[MT7]-RSIVSELAGLLSAMEYVQK[MT7].4b9_1.heavy 596.338 / 1057.61 214.0 54.86347484588623 32 5 10 7 10 0.4109199961343644 115.09889964107484 0.023097991943359375 3 0.6583439391473833 2.048076303376538 214.0 0.04628099173553718 0.0 - - - - - - - 0.0 0 0 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 327 42 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21515.[MT7]-RSIVSELAGLLSAMEYVQK[MT7].4b9_2.heavy 596.338 / 529.31 1018.0 54.86347484588623 32 5 10 7 10 0.4109199961343644 115.09889964107484 0.023097991943359375 3 0.6583439391473833 2.048076303376538 1018.0 98.04123076923076 1.0 - - - - - - - 85.76470588235294 2 17 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 329 42 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21515.[MT7]-RSIVSELAGLLSAMEYVQK[MT7].4b6_1.heavy 596.338 / 816.47 188.0 54.86347484588623 32 5 10 7 10 0.4109199961343644 115.09889964107484 0.023097991943359375 3 0.6583439391473833 2.048076303376538 188.0 27.47692307692308 1.0 - - - - - - - 0.0 0 0 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 331 43 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21516.[MT7]-TRQVC[CAM]PLDNREWEFQK[MT7].4y8_2.heavy 599.311 / 640.829 9120.0 31.807100296020508 46 16 10 10 10 2.568229181466473 30.935783722467182 0.0 3 0.9645176375226293 6.532260865895818 9120.0 64.11636363636364 0.0 - - - - - - - 245.3846153846154 18 13 RBX1 ring-box 1, E3 ubiquitin protein ligase 333 43 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21516.[MT7]-TRQVC[CAM]PLDNREWEFQK[MT7].4y9_2.heavy 599.311 / 698.342 3736.0 31.807100296020508 46 16 10 10 10 2.568229181466473 30.935783722467182 0.0 3 0.9645176375226293 6.532260865895818 3736.0 7.936874051593323 0.0 - - - - - - - 200.0 7 11 RBX1 ring-box 1, E3 ubiquitin protein ligase 335 43 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21516.[MT7]-TRQVC[CAM]PLDNREWEFQK[MT7].4y11_2.heavy 599.311 / 803.411 6483.0 31.807100296020508 46 16 10 10 10 2.568229181466473 30.935783722467182 0.0 3 0.9645176375226293 6.532260865895818 6483.0 72.88463636363636 0.0 - - - - - - - 220.0 12 13 RBX1 ring-box 1, E3 ubiquitin protein ligase 337 43 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21516.[MT7]-TRQVC[CAM]PLDNREWEFQK[MT7].4y3_1.heavy 599.311 / 566.342 3956.0 31.807100296020508 46 16 10 10 10 2.568229181466473 30.935783722467182 0.0 3 0.9645176375226293 6.532260865895818 3956.0 7.469661119419607 1.0 - - - - - - - 270.7692307692308 7 13 RBX1 ring-box 1, E3 ubiquitin protein ligase 339 44 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 351710.0 38.53179931640625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 351710.0 140.6167813429866 0.0 - - - - - - - 172.6 703 10 341 44 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 272999.0 38.53179931640625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 272999.0 422.662541319015 0.0 - - - - - - - 229.9 545 10 343 44 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 420749.0 38.53179931640625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 420749.0 798.9498901834717 0.0 - - - - - - - 821.0 841 7 345 45 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20924.[MT7]-IIDFGFAR.2y5_1.heavy 541.809 / 597.314 21844.0 41.4472017288208 43 17 10 6 10 4.79319266610704 20.862921014443284 0.035999298095703125 3 0.9758389452630737 7.923665039844001 21844.0 96.29642135642135 0.0 - - - - - - - 252.35294117647058 43 17 RPS6KA4;RPS6KA5 ribosomal protein S6 kinase, 90kDa, polypeptide 4;ribosomal protein S6 kinase, 90kDa, polypeptide 5 347 45 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20924.[MT7]-IIDFGFAR.2y6_1.heavy 541.809 / 712.341 5411.0 41.4472017288208 43 17 10 6 10 4.79319266610704 20.862921014443284 0.035999298095703125 3 0.9758389452630737 7.923665039844001 5411.0 37.7130303030303 0.0 - - - - - - - 183.33333333333334 10 18 RPS6KA4;RPS6KA5 ribosomal protein S6 kinase, 90kDa, polypeptide 4;ribosomal protein S6 kinase, 90kDa, polypeptide 5 349 45 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20924.[MT7]-IIDFGFAR.2b5_1.heavy 541.809 / 690.394 3366.0 41.4472017288208 43 17 10 6 10 4.79319266610704 20.862921014443284 0.035999298095703125 3 0.9758389452630737 7.923665039844001 3366.0 21.759999999999998 0.0 - - - - - - - 198.0 6 15 RPS6KA4;RPS6KA5 ribosomal protein S6 kinase, 90kDa, polypeptide 4;ribosomal protein S6 kinase, 90kDa, polypeptide 5 351 45 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20924.[MT7]-IIDFGFAR.2y7_1.heavy 541.809 / 825.425 12803.0 41.4472017288208 43 17 10 6 10 4.79319266610704 20.862921014443284 0.035999298095703125 3 0.9758389452630737 7.923665039844001 12803.0 100.22550505050506 0.0 - - - - - - - 184.10526315789474 25 19 RPS6KA4;RPS6KA5 ribosomal protein S6 kinase, 90kDa, polypeptide 4;ribosomal protein S6 kinase, 90kDa, polypeptide 5 353 46 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20988.[MT7]-DLSNTFAK[MT7].2y5_1.heavy 592.332 / 724.411 988.0 27.992024898529053 37 14 9 6 8 1.1140613601740526 57.29377323951672 0.03669929504394531 4 0.9337416467581324 4.767760247683375 988.0 6.825 0.0 - - - - - - - 0.0 1 0 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 355 46 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20988.[MT7]-DLSNTFAK[MT7].2y3_1.heavy 592.332 / 509.32 2051.0 27.992024898529053 37 14 9 6 8 1.1140613601740526 57.29377323951672 0.03669929504394531 4 0.9337416467581324 4.767760247683375 2051.0 3.6432236842105263 1.0 - - - - - - - 709.3333333333334 4 9 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 357 46 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20988.[MT7]-DLSNTFAK[MT7].2y6_1.heavy 592.332 / 811.443 1595.0 27.992024898529053 37 14 9 6 8 1.1140613601740526 57.29377323951672 0.03669929504394531 4 0.9337416467581324 4.767760247683375 1595.0 2.0986842105263155 1.0 - - - - - - - 141.86666666666667 4 15 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 359 46 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20988.[MT7]-DLSNTFAK[MT7].2b5_1.heavy 592.332 / 675.343 1899.0 27.992024898529053 37 14 9 6 8 1.1140613601740526 57.29377323951672 0.03669929504394531 4 0.9337416467581324 4.767760247683375 1899.0 10.577763157894736 0.0 - - - - - - - 220.0 3 19 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 361 47 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20987.[MT7]-VDYEQIK[MT7].2y5_1.heavy 591.834 / 824.463 1395.0 27.60997486114502 38 17 10 3 8 18.79463367473671 5.320667682627812 0.061100006103515625 4 0.9704611711634515 7.162932371219913 1395.0 1.2681818181818179 1.0 - - - - - - - 188.64285714285714 2 14 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 363 47 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20987.[MT7]-VDYEQIK[MT7].2b4_1.heavy 591.834 / 651.311 881.0 27.60997486114502 38 17 10 3 8 18.79463367473671 5.320667682627812 0.061100006103515625 4 0.9704611711634515 7.162932371219913 881.0 4.800006184291899 0.0 - - - - - - - 0.0 1 0 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 365 47 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20987.[MT7]-VDYEQIK[MT7].2y6_1.heavy 591.834 / 939.49 2349.0 27.60997486114502 38 17 10 3 8 18.79463367473671 5.320667682627812 0.061100006103515625 4 0.9704611711634515 7.162932371219913 2349.0 15.298749305169537 0.0 - - - - - - - 146.64705882352942 4 17 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 367 47 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20987.[MT7]-VDYEQIK[MT7].2b5_1.heavy 591.834 / 779.369 954.0 27.60997486114502 38 17 10 3 8 18.79463367473671 5.320667682627812 0.061100006103515625 4 0.9704611711634515 7.162932371219913 954.0 1.5177272727272726 1.0 - - - - - - - 250.1818181818182 2 22 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 369 48 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542788.[MT7]-DTTFAQVLK[MT7].2y5_1.heavy 655.882 / 702.463 6084.0 34.38290023803711 37 13 6 10 8 2.1201572129024995 33.2336261097916 0.0 4 0.9220389992304884 4.390974831503281 6084.0 17.16 1.0 - - - - - - - 292.5 19 12 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 371 48 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542788.[MT7]-DTTFAQVLK[MT7].2b4_1.heavy 655.882 / 609.3 1989.0 34.38290023803711 37 13 6 10 8 2.1201572129024995 33.2336261097916 0.0 4 0.9220389992304884 4.390974831503281 1989.0 2.1209523809523807 1.0 - - - - - - - 263.25 4 12 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 373 48 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542788.[MT7]-DTTFAQVLK[MT7].2b6_1.heavy 655.882 / 808.396 3744.0 34.38290023803711 37 13 6 10 8 2.1201572129024995 33.2336261097916 0.0 4 0.9220389992304884 4.390974831503281 3744.0 36.480000000000004 0.0 - - - - - - - 214.5 7 12 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 375 48 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542788.[MT7]-DTTFAQVLK[MT7].2b5_1.heavy 655.882 / 680.337 4212.0 34.38290023803711 37 13 6 10 8 2.1201572129024995 33.2336261097916 0.0 4 0.9220389992304884 4.390974831503281 4212.0 20.835 0.0 - - - - - - - 179.4 8 15 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 377 49 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540023.[MT7]-EEELTR.2y4_1.heavy 460.744 / 518.293 516.0 18.68607473373413 22 5 10 6 1 0.8467678304819095 78.80535101864648 0.03769874572753906 18 0.6913993814402204 2.1617407683250263 516.0 1.2808510638297872 27.0 - - - - - - - 657.0 3 9 MAP3K11;KIAA1804 mitogen-activated protein kinase kinase kinase 11;mixed lineage kinase 4 379 49 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540023.[MT7]-EEELTR.2b3_1.heavy 460.744 / 532.237 2629.0 18.68607473373413 22 5 10 6 1 0.8467678304819095 78.80535101864648 0.03769874572753906 18 0.6913993814402204 2.1617407683250263 2629.0 10.237653231360325 3.0 - - - - - - - 619.4 8 10 MAP3K11;KIAA1804 mitogen-activated protein kinase kinase kinase 11;mixed lineage kinase 4 381 49 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540023.[MT7]-EEELTR.2y5_1.heavy 460.744 / 647.336 9951.0 18.68607473373413 22 5 10 6 1 0.8467678304819095 78.80535101864648 0.03769874572753906 18 0.6913993814402204 2.1617407683250263 9951.0 43.604939209726446 0.0 - - - - - - - 677.1428571428571 19 7 MAP3K11;KIAA1804 mitogen-activated protein kinase kinase kinase 11;mixed lineage kinase 4 383 49 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540023.[MT7]-EEELTR.2b4_1.heavy 460.744 / 645.321 329.0 18.68607473373413 22 5 10 6 1 0.8467678304819095 78.80535101864648 0.03769874572753906 18 0.6913993814402204 2.1617407683250263 329.0 1.5516666666666667 28.0 - - - - - - - 209.22727272727272 3 22 MAP3K11;KIAA1804 mitogen-activated protein kinase kinase kinase 11;mixed lineage kinase 4 385 50 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20921.[MT7]-GDIIYVTR.2y5_1.heavy 540.812 / 651.382 7029.0 30.316999435424805 46 18 10 10 8 5.332803345632602 18.751863423183764 0.0 4 0.9881573507462938 11.32943893524659 7029.0 19.332543720190777 0.0 - - - - - - - 642.5 14 8 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 387 50 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20921.[MT7]-GDIIYVTR.2b4_1.heavy 540.812 / 543.326 9862.0 30.316999435424805 46 18 10 10 8 5.332803345632602 18.751863423183764 0.0 4 0.9881573507462938 11.32943893524659 9862.0 22.730810072507275 0.0 - - - - - - - 692.2 19 10 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 389 50 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20921.[MT7]-GDIIYVTR.2y6_1.heavy 540.812 / 764.466 7239.0 30.316999435424805 46 18 10 10 8 5.332803345632602 18.751863423183764 0.0 4 0.9881573507462938 11.32943893524659 7239.0 72.89533047878552 1.0 - - - - - - - 192.5 17 12 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 391 50 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20921.[MT7]-GDIIYVTR.2b5_1.heavy 540.812 / 706.389 5141.0 30.316999435424805 46 18 10 10 8 5.332803345632602 18.751863423183764 0.0 4 0.9881573507462938 11.32943893524659 5141.0 38.027079365079366 0.0 - - - - - - - 236.25 10 16 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 393 51 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542999.[MT7]-AFLLQTVDGK[MT7].3y3_1.heavy 460.609 / 463.263 85257.0 37.786598205566406 50 20 10 10 10 40.29424706830798 2.4817438536691623 0.0 3 0.9990834567384008 40.76173947999864 85257.0 357.42444098510185 0.0 - - - - - - - 236.36363636363637 170 11 CDC25B cell division cycle 25 homolog B (S. pombe) 395 51 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542999.[MT7]-AFLLQTVDGK[MT7].3b4_1.heavy 460.609 / 589.383 41869.0 37.786598205566406 50 20 10 10 10 40.29424706830798 2.4817438536691623 0.0 3 0.9990834567384008 40.76173947999864 41869.0 90.1337990589121 0.0 - - - - - - - 260.2 83 10 CDC25B cell division cycle 25 homolog B (S. pombe) 397 51 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542999.[MT7]-AFLLQTVDGK[MT7].3b5_1.heavy 460.609 / 717.442 11172.0 37.786598205566406 50 20 10 10 10 40.29424706830798 2.4817438536691623 0.0 3 0.9990834567384008 40.76173947999864 11172.0 79.67802282878412 0.0 - - - - - - - 189.5 22 12 CDC25B cell division cycle 25 homolog B (S. pombe) 399 51 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542999.[MT7]-AFLLQTVDGK[MT7].3b3_1.heavy 460.609 / 476.299 107711.0 37.786598205566406 50 20 10 10 10 40.29424706830798 2.4817438536691623 0.0 3 0.9990834567384008 40.76173947999864 107711.0 323.60691185235964 0.0 - - - - - - - 270.875 215 8 CDC25B cell division cycle 25 homolog B (S. pombe) 401 52 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539382.[MT7]-SVLEVR.2y4_1.heavy 423.762 / 516.314 16875.0 27.418949604034424 41 15 10 6 10 3.274334767602162 30.54055467676914 0.030599594116210938 3 0.9526861189335714 5.651200114819659 16875.0 14.763001974983542 0.0 - - - - - - - 723.2857142857143 33 7 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 403 52 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539382.[MT7]-SVLEVR.2b3_1.heavy 423.762 / 444.294 30106.0 27.418949604034424 41 15 10 6 10 3.274334767602162 30.54055467676914 0.030599594116210938 3 0.9526861189335714 5.651200114819659 30106.0 43.80856625514403 0.0 - - - - - - - 1220.4615384615386 60 13 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 405 52 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539382.[MT7]-SVLEVR.2y5_1.heavy 423.762 / 615.382 26258.0 27.418949604034424 41 15 10 6 10 3.274334767602162 30.54055467676914 0.030599594116210938 3 0.9526861189335714 5.651200114819659 26258.0 46.846210774844394 0.0 - - - - - - - 684.7142857142857 52 7 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 407 52 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539382.[MT7]-SVLEVR.2b4_1.heavy 423.762 / 573.336 88967.0 27.418949604034424 41 15 10 6 10 3.274334767602162 30.54055467676914 0.030599594116210938 3 0.9526861189335714 5.651200114819659 88967.0 72.55769531266301 1.0 - - - - - - - 1736.0 177 7 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 409 53 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545097.[MT7]-QFLAPWIESQDWAYAASK[MT7].3b6_1.heavy 800.414 / 887.49 10527.0 47.41757392883301 40 14 10 6 10 1.9999451603041767 41.31250431594522 0.03929901123046875 3 0.9497943837046811 5.4846921611551025 10527.0 66.49368351063829 0.0 - - - - - - - 156.75 21 16 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 411 53 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545097.[MT7]-QFLAPWIESQDWAYAASK[MT7].3b4_1.heavy 800.414 / 604.357 59966.0 47.41757392883301 40 14 10 6 10 1.9999451603041767 41.31250431594522 0.03929901123046875 3 0.9497943837046811 5.4846921611551025 59966.0 120.78258156028369 0.0 - - - - - - - 682.3333333333334 119 9 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 413 53 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545097.[MT7]-QFLAPWIESQDWAYAASK[MT7].3b3_1.heavy 800.414 / 533.32 20114.0 47.41757392883301 40 14 10 6 10 1.9999451603041767 41.31250431594522 0.03929901123046875 3 0.9497943837046811 5.4846921611551025 20114.0 55.29825837634144 0.0 - - - - - - - 250.625 40 16 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 415 53 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545097.[MT7]-QFLAPWIESQDWAYAASK[MT7].3y5_1.heavy 800.414 / 683.385 21931.0 47.41757392883301 40 14 10 6 10 1.9999451603041767 41.31250431594522 0.03929901123046875 3 0.9497943837046811 5.4846921611551025 21931.0 37.03772606382979 0.0 - - - - - - - 323.0769230769231 43 13 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 417 54 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20980.[MT7]-SQVGTLLFR.2y8_1.heavy 582.846 / 933.552 19856.0 37.65729904174805 44 14 10 10 10 1.7191344017671684 46.13652555292401 0.0 3 0.9452998242113756 5.252525697217462 19856.0 156.01142857142855 0.0 - - - - - - - 224.22222222222223 39 9 CDC25B cell division cycle 25 homolog B (S. pombe) 419 54 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20980.[MT7]-SQVGTLLFR.2y6_1.heavy 582.846 / 706.425 26698.0 37.65729904174805 44 14 10 10 10 1.7191344017671684 46.13652555292401 0.0 3 0.9452998242113756 5.252525697217462 26698.0 103.46218262806237 0.0 - - - - - - - 276.6666666666667 53 15 CDC25B cell division cycle 25 homolog B (S. pombe) 421 54 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20980.[MT7]-SQVGTLLFR.2b5_1.heavy 582.846 / 617.338 3141.0 37.65729904174805 44 14 10 10 10 1.7191344017671684 46.13652555292401 0.0 3 0.9452998242113756 5.252525697217462 3141.0 4.995443977401848 1.0 - - - - - - - 306.0 8 11 CDC25B cell division cycle 25 homolog B (S. pombe) 423 54 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20980.[MT7]-SQVGTLLFR.2y7_1.heavy 582.846 / 805.493 12452.0 37.65729904174805 44 14 10 10 10 1.7191344017671684 46.13652555292401 0.0 3 0.9452998242113756 5.252525697217462 12452.0 42.53617078732002 0.0 - - - - - - - 285.54545454545456 24 11 CDC25B cell division cycle 25 homolog B (S. pombe) 425 55 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585727.[MT7]-SLTFSPDSQLLVTASDDGYIK[MT7].3b9_1.heavy 849.114 / 1107.54 11103.0 42.54779815673828 48 18 10 10 10 4.446365650266483 22.490278098025236 0.0 3 0.9838548710532756 9.699638793788564 11103.0 38.85055107526882 0.0 - - - - - - - 294.5 22 20 WDR61 WD repeat domain 61 427 55 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585727.[MT7]-SLTFSPDSQLLVTASDDGYIK[MT7].3b4_1.heavy 849.114 / 593.341 9118.0 42.54779815673828 48 18 10 10 10 4.446365650266483 22.490278098025236 0.0 3 0.9838548710532756 9.699638793788564 9118.0 46.22505131964809 0.0 - - - - - - - 253.9047619047619 18 21 WDR61 WD repeat domain 61 429 55 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585727.[MT7]-SLTFSPDSQLLVTASDDGYIK[MT7].3b5_1.heavy 849.114 / 680.374 20344.0 42.54779815673828 48 18 10 10 10 4.446365650266483 22.490278098025236 0.0 3 0.9838548710532756 9.699638793788564 20344.0 67.43051612903226 0.0 - - - - - - - 310.0 40 21 WDR61 WD repeat domain 61 431 55 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585727.[MT7]-SLTFSPDSQLLVTASDDGYIK[MT7].3y4_1.heavy 849.114 / 624.384 12963.0 42.54779815673828 48 18 10 10 10 4.446365650266483 22.490278098025236 0.0 3 0.9838548710532756 9.699638793788564 12963.0 41.81612903225806 0.0 - - - - - - - 265.22222222222223 25 18 WDR61 WD repeat domain 61 433 56 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584362.[MT7]-SVVILVPVR.2y5_1.heavy 563.377 / 583.393 9289.0 37.850399017333984 39 14 10 5 10 3.613334733298079 22.10667993811407 0.04199981689453125 3 0.9461633119420957 5.294869565620042 9289.0 19.113139471855014 0.0 - - - - - - - 685.8571428571429 18 7 ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) 435 56 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584362.[MT7]-SVVILVPVR.2b4_1.heavy 563.377 / 543.362 13881.0 37.850399017333984 39 14 10 5 10 3.613334733298079 22.10667993811407 0.04199981689453125 3 0.9461633119420957 5.294869565620042 13881.0 44.31569294637561 0.0 - - - - - - - 325.875 27 8 ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) 437 56 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584362.[MT7]-SVVILVPVR.2y6_1.heavy 563.377 / 696.477 12838.0 37.850399017333984 39 14 10 5 10 3.613334733298079 22.10667993811407 0.04199981689453125 3 0.9461633119420957 5.294869565620042 12838.0 59.37062300319488 0.0 - - - - - - - 323.3 25 10 ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) 439 56 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584362.[MT7]-SVVILVPVR.2y7_1.heavy 563.377 / 795.545 6575.0 37.850399017333984 39 14 10 5 10 3.613334733298079 22.10667993811407 0.04199981689453125 3 0.9461633119420957 5.294869565620042 6575.0 41.5564926049591 0.0 - - - - - - - 256.0 13 11 ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) 441 57 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21128.[MT7]-TITMLDEQK[MT7].3y3_1.heavy 456.255 / 548.316 11482.0 30.89150047302246 45 17 10 10 8 4.544098607448282 22.00656469824156 0.0 4 0.976467021218006 8.029130796201839 11482.0 18.78031819714311 1.0 - - - - - - - 727.4285714285714 42 7 SNAP23 synaptosomal-associated protein, 23kDa 443 57 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21128.[MT7]-TITMLDEQK[MT7].3b4_1.heavy 456.255 / 591.329 16465.0 30.89150047302246 45 17 10 10 8 4.544098607448282 22.00656469824156 0.0 4 0.976467021218006 8.029130796201839 16465.0 22.0310016032366 0.0 - - - - - - - 1205.25 32 8 SNAP23 synaptosomal-associated protein, 23kDa 445 57 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21128.[MT7]-TITMLDEQK[MT7].3y4_1.heavy 456.255 / 663.343 8233.0 30.89150047302246 45 17 10 10 8 4.544098607448282 22.00656469824156 0.0 4 0.976467021218006 8.029130796201839 8233.0 30.175324054745516 1.0 - - - - - - - 223.4375 18 16 SNAP23 synaptosomal-associated protein, 23kDa 447 57 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21128.[MT7]-TITMLDEQK[MT7].3b3_1.heavy 456.255 / 460.289 22748.0 30.89150047302246 45 17 10 10 8 4.544098607448282 22.00656469824156 0.0 4 0.976467021218006 8.029130796201839 22748.0 25.37911095508518 0.0 - - - - - - - 785.5 45 8 SNAP23 synaptosomal-associated protein, 23kDa 449 58 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20829.[MT7]-LWLTYR.2b3_1.heavy 498.293 / 557.357 1800.0 38.88635063171387 35 12 10 5 8 2.121240795482783 47.142219880435846 0.040302276611328125 4 0.8982013478281936 3.8347440748723614 1800.0 12.15 2.0 - - - - - - - 220.0 3 9 ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) 451 58 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20829.[MT7]-LWLTYR.2y4_1.heavy 498.293 / 552.314 1800.0 38.88635063171387 35 12 10 5 8 2.121240795482783 47.142219880435846 0.040302276611328125 4 0.8982013478281936 3.8347440748723614 1800.0 2.5142857142857142 3.0 - - - - - - - 295.7142857142857 3 14 ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) 453 58 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20829.[MT7]-LWLTYR.2y5_1.heavy 498.293 / 738.393 3600.0 38.88635063171387 35 12 10 5 8 2.121240795482783 47.142219880435846 0.040302276611328125 4 0.8982013478281936 3.8347440748723614 3600.0 56.599999999999994 0.0 - - - - - - - 193.84615384615384 7 13 ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) 455 58 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20829.[MT7]-LWLTYR.2y3_1.heavy 498.293 / 439.23 2250.0 38.88635063171387 35 12 10 5 8 2.121240795482783 47.142219880435846 0.040302276611328125 4 0.8982013478281936 3.8347440748723614 2250.0 1.666666666666667 0.0 - - - - - - - 303.75 4 16 ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) 457 59 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21127.[MT7]-EVLDSETLC[CAM]R.2y8_1.heavy 683.344 / 993.467 7486.0 29.505199432373047 45 15 10 10 10 2.0816759159859175 33.60985822252712 0.0 3 0.9536266696415684 5.708676933015755 7486.0 36.167939096313354 0.0 - - - - - - - 238.54545454545453 14 11 STK11 serine/threonine kinase 11 459 59 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21127.[MT7]-EVLDSETLC[CAM]R.2y9_1.heavy 683.344 / 1092.54 7875.0 29.505199432373047 45 15 10 10 10 2.0816759159859175 33.60985822252712 0.0 3 0.9536266696415684 5.708676933015755 7875.0 34.40130119378807 0.0 - - - - - - - 252.73333333333332 15 15 STK11 serine/threonine kinase 11 461 59 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21127.[MT7]-EVLDSETLC[CAM]R.2y6_1.heavy 683.344 / 765.356 7000.0 29.505199432373047 45 15 10 10 10 2.0816759159859175 33.60985822252712 0.0 3 0.9536266696415684 5.708676933015755 7000.0 28.261805129923673 0.0 - - - - - - - 316.125 14 8 STK11 serine/threonine kinase 11 463 59 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21127.[MT7]-EVLDSETLC[CAM]R.2y7_1.heavy 683.344 / 880.383 6708.0 29.505199432373047 45 15 10 10 10 2.0816759159859175 33.60985822252712 0.0 3 0.9536266696415684 5.708676933015755 6708.0 42.511717211013064 0.0 - - - - - - - 186.0 13 12 STK11 serine/threonine kinase 11 465 60 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585525.[MT7]-TLQVFGIVPDGTLQLLK[MT7].4b7_1.heavy 533.325 / 903.542 3179.0 49.28635025024414 36 9 10 7 10 1.7711998097267396 44.00806026405103 0.02970123291015625 3 0.8192932722483409 2.858295162093579 3179.0 16.292829775588398 1.0 - - - - - - - 205.0 6 7 SKP2 S-phase kinase-associated protein 2 (p45) 467 60 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585525.[MT7]-TLQVFGIVPDGTLQLLK[MT7].4b4_1.heavy 533.325 / 586.368 2974.0 49.28635025024414 36 9 10 7 10 1.7711998097267396 44.00806026405103 0.02970123291015625 3 0.8192932722483409 2.858295162093579 2974.0 71.9985179526356 0.0 - - - - - - - 153.71428571428572 5 14 SKP2 S-phase kinase-associated protein 2 (p45) 469 60 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585525.[MT7]-TLQVFGIVPDGTLQLLK[MT7].4y3_1.heavy 533.325 / 517.383 10972.0 49.28635025024414 36 9 10 7 10 1.7711998097267396 44.00806026405103 0.02970123291015625 3 0.8192932722483409 2.858295162093579 10972.0 122.02921466630161 0.0 - - - - - - - 183.88235294117646 21 17 SKP2 S-phase kinase-associated protein 2 (p45) 471 60 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585525.[MT7]-TLQVFGIVPDGTLQLLK[MT7].4b6_1.heavy 533.325 / 790.458 6819.0 49.28635025024414 36 9 10 7 10 1.7711998097267396 44.00806026405103 0.02970123291015625 3 0.8192932722483409 2.858295162093579 6819.0 171.3171734148205 0.0 - - - - - - - 146.0 13 13 SKP2 S-phase kinase-associated protein 2 (p45) 473 61 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545223.[MT7]-LLQTAATAAQQGGQANHPTAAVVTEK[MT7].4y9_1.heavy 716.892 / 1059.62 16843.0 31.934600830078125 50 20 10 10 10 6.392818703292465 15.642552157547883 0.0 3 0.9941913774698606 16.185098506129602 16843.0 84.58297491430442 0.0 - - - - - - - 251.125 33 8 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 475 61 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545223.[MT7]-LLQTAATAAQQGGQANHPTAAVVTEK[MT7].4b4_1.heavy 716.892 / 600.384 10150.0 31.934600830078125 50 20 10 10 10 6.392818703292465 15.642552157547883 0.0 3 0.9941913774698606 16.185098506129602 10150.0 19.401453844203253 0.0 - - - - - - - 223.25 20 12 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 477 61 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545223.[MT7]-LLQTAATAAQQGGQANHPTAAVVTEK[MT7].4b5_1.heavy 716.892 / 671.421 12158.0 31.934600830078125 50 20 10 10 10 6.392818703292465 15.642552157547883 0.0 3 0.9941913774698606 16.185098506129602 12158.0 29.89523168908819 0.0 - - - - - - - 290.2 24 10 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 479 61 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545223.[MT7]-LLQTAATAAQQGGQANHPTAAVVTEK[MT7].4y3_1.heavy 716.892 / 521.305 11377.0 31.934600830078125 50 20 10 10 10 6.392818703292465 15.642552157547883 0.0 3 0.9941913774698606 16.185098506129602 11377.0 112.41559523809525 0.0 - - - - - - - 266.2307692307692 22 13 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 481 62 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542784.[MT7]-WFLDALEK[MT7].3y3_1.heavy 437.251 / 533.341 8864.0 44.77309989929199 36 10 10 6 10 0.8357281825050176 74.93983555425176 0.03440093994140625 3 0.8397365079038994 3.0406510068723125 8864.0 33.33057220708447 0.0 - - - - - - - 192.07142857142858 17 14 CDC16 cell division cycle 16 homolog (S. cerevisiae) 483 62 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542784.[MT7]-WFLDALEK[MT7].3b4_1.heavy 437.251 / 706.368 8314.0 44.77309989929199 36 10 10 6 10 0.8357281825050176 74.93983555425176 0.03440093994140625 3 0.8397365079038994 3.0406510068723125 8314.0 201.03524590163937 0.0 - - - - - - - 175.625 16 8 CDC16 cell division cycle 16 homolog (S. cerevisiae) 485 62 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542784.[MT7]-WFLDALEK[MT7].3b5_1.heavy 437.251 / 777.405 6725.0 44.77309989929199 36 10 10 6 10 0.8357281825050176 74.93983555425176 0.03440093994140625 3 0.8397365079038994 3.0406510068723125 6725.0 139.6448087431694 0.0 - - - - - - - 129.75 13 8 CDC16 cell division cycle 16 homolog (S. cerevisiae) 487 62 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542784.[MT7]-WFLDALEK[MT7].3b3_1.heavy 437.251 / 591.341 5196.0 44.77309989929199 36 10 10 6 10 0.8357281825050176 74.93983555425176 0.03440093994140625 3 0.8397365079038994 3.0406510068723125 5196.0 38.33114754098361 1.0 - - - - - - - 94.27272727272727 10 11 CDC16 cell division cycle 16 homolog (S. cerevisiae) 489 63 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540334.[MT7]-LSDPIVNTLAK[MT7].3b4_1.heavy 486.964 / 557.305 30810.0 36.33555030822754 38 13 10 5 10 1.086737317601827 56.615105562924676 0.046298980712890625 3 0.9252446870544399 4.485367073438524 30810.0 41.78806313402188 0.0 - - - - - - - 325.0 61 3 SKP2 S-phase kinase-associated protein 2 (p45) 491 63 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540334.[MT7]-LSDPIVNTLAK[MT7].3b5_1.heavy 486.964 / 670.389 19607.0 36.33555030822754 38 13 10 5 10 1.086737317601827 56.615105562924676 0.046298980712890625 3 0.9252446870544399 4.485367073438524 19607.0 112.29439645750895 0.0 - - - - - - - 243.75 39 12 SKP2 S-phase kinase-associated protein 2 (p45) 493 63 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540334.[MT7]-LSDPIVNTLAK[MT7].3y4_1.heavy 486.964 / 576.384 17171.0 36.33555030822754 38 13 10 5 10 1.086737317601827 56.615105562924676 0.046298980712890625 3 0.9252446870544399 4.485367073438524 17171.0 25.49003359235875 0.0 - - - - - - - 213.25 34 8 SKP2 S-phase kinase-associated protein 2 (p45) 495 63 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540334.[MT7]-LSDPIVNTLAK[MT7].3y5_1.heavy 486.964 / 690.427 20946.0 36.33555030822754 38 13 10 5 10 1.086737317601827 56.615105562924676 0.046298980712890625 3 0.9252446870544399 4.485367073438524 20946.0 210.31456464806274 0.0 - - - - - - - 255.8 41 10 SKP2 S-phase kinase-associated protein 2 (p45) 497 64 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20929.[MT7]-FLFENK[MT7].2y5_1.heavy 543.315 / 794.453 3662.0 35.679901123046875 50 20 10 10 10 2369.4883515583456 0.04220320388333322 0.0 3 0.9999997287150183 2369.4605587161413 3662.0 34.5188524590164 0.0 - - - - - - - 221.8181818181818 7 11 CDC16 cell division cycle 16 homolog (S. cerevisiae) 499 64 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20929.[MT7]-FLFENK[MT7].2y3_1.heavy 543.315 / 534.3 N/A 35.679901123046875 50 20 10 10 10 2369.4883515583456 0.04220320388333322 0.0 3 0.9999997287150183 2369.4605587161413 5248.0 4.189024512963936 1.0 - - - - - - - 1255.4285714285713 10 7 CDC16 cell division cycle 16 homolog (S. cerevisiae) 501 64 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20929.[MT7]-FLFENK[MT7].2b5_1.heavy 543.315 / 795.416 854.0 35.679901123046875 50 20 10 10 10 2369.4883515583456 0.04220320388333322 0.0 3 0.9999997287150183 2369.4605587161413 854.0 1.221111111111111 2.0 - - - - - - - 183.0 2 14 CDC16 cell division cycle 16 homolog (S. cerevisiae) 503 65 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542781.[MT7]-TVATFILQK[MT7].3b6_1.heavy 436.943 / 777.463 7989.0 38.1088981628418 41 11 10 10 10 1.0670875256611687 79.52057366185369 0.0 3 0.8622171496455546 3.285846634552045 7989.0 144.8985294117647 0.0 - - - - - - - 175.28571428571428 15 7 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 505 65 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542781.[MT7]-TVATFILQK[MT7].3b4_1.heavy 436.943 / 517.31 9218.0 38.1088981628418 41 11 10 10 10 1.0670875256611687 79.52057366185369 0.0 3 0.8622171496455546 3.285846634552045 9218.0 111.06992335696494 0.0 - - - - - - - 190.0 18 7 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 507 65 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542781.[MT7]-TVATFILQK[MT7].3b5_1.heavy 436.943 / 664.379 22226.0 38.1088981628418 41 11 10 10 10 1.0670875256611687 79.52057366185369 0.0 3 0.8622171496455546 3.285846634552045 22226.0 113.564645180171 0.0 - - - - - - - 204.66666666666666 44 9 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 509 65 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542781.[MT7]-TVATFILQK[MT7].3y4_1.heavy 436.943 / 645.442 9013.0 38.1088981628418 41 11 10 10 10 1.0670875256611687 79.52057366185369 0.0 3 0.8622171496455546 3.285846634552045 9013.0 32.21443359375 0.0 - - - - - - - 526.7142857142857 18 7 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 511 66 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543849.[MT7]-TQIQSVEPYTK[MT7].3y3_1.heavy 527.962 / 555.326 8006.0 27.57939910888672 50 20 10 10 10 6.542369768065663 15.284981366861247 0.0 3 0.9901214911213996 12.406763625273399 8006.0 16.809638781773824 0.0 - - - - - - - 691.3 16 10 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 513 66 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543849.[MT7]-TQIQSVEPYTK[MT7].3b4_1.heavy 527.962 / 615.358 6696.0 27.57939910888672 50 20 10 10 10 6.542369768065663 15.284981366861247 0.0 3 0.9901214911213996 12.406763625273399 6696.0 3.4426889106967615 1.0 - - - - - - - 260.04761904761904 13 21 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 515 66 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543849.[MT7]-TQIQSVEPYTK[MT7].3b5_1.heavy 527.962 / 702.39 7060.0 27.57939910888672 50 20 10 10 10 6.542369768065663 15.284981366861247 0.0 3 0.9901214911213996 12.406763625273399 7060.0 45.466915793672456 0.0 - - - - - - - 218.47368421052633 14 19 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 517 66 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543849.[MT7]-TQIQSVEPYTK[MT7].3y4_1.heavy 527.962 / 652.379 18269.0 27.57939910888672 50 20 10 10 10 6.542369768065663 15.284981366861247 0.0 3 0.9901214911213996 12.406763625273399 18269.0 80.4147194995574 0.0 - - - - - - - 223.0 36 16 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 519 67 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20995.[MT7]-EIQHHLK[MT7].2y4_1.heavy 596.856 / 678.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 521 67 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20995.[MT7]-EIQHHLK[MT7].2b3_1.heavy 596.856 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 523 67 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20995.[MT7]-EIQHHLK[MT7].2y3_1.heavy 596.856 / 541.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 525 67 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20995.[MT7]-EIQHHLK[MT7].2b5_1.heavy 596.856 / 789.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 527 68 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542886.[MT7]-C[CAM]VVVGDGAVGK[MT7].3b6_1.heavy 450.255 / 774.394 4513.0 26.131799697875977 49 20 9 10 10 7.9864705598412495 12.521175561935303 0.0 3 0.9915117718307753 13.385856618189429 4513.0 38.8871565816829 0.0 - - - - - - - 143.1578947368421 9 19 LOC100510206;RHOQ;RHOG;RHOJ;RAC1;RAC2;RAC3;CDC42 rho-related GTP-binding protein RhoQ-like;ras homolog gene family, member Q;ras homolog gene family, member G (rho G);ras homolog gene family, member J;ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3);cell division cycle 42 (GTP binding protein, 25kDa) 529 68 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542886.[MT7]-C[CAM]VVVGDGAVGK[MT7].3b4_1.heavy 450.255 / 602.345 N/A 26.131799697875977 49 20 9 10 10 7.9864705598412495 12.521175561935303 0.0 3 0.9915117718307753 13.385856618189429 16074.0 14.744833654773384 1.0 - - - - - - - 1290.5 39 8 LOC100510206;RHOQ;RHOG;RHOJ;RAC1;RAC2;RAC3;CDC42 rho-related GTP-binding protein RhoQ-like;ras homolog gene family, member Q;ras homolog gene family, member G (rho G);ras homolog gene family, member J;ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3);cell division cycle 42 (GTP binding protein, 25kDa) 531 68 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542886.[MT7]-C[CAM]VVVGDGAVGK[MT7].3b5_1.heavy 450.255 / 659.367 4018.0 26.131799697875977 49 20 9 10 10 7.9864705598412495 12.521175561935303 0.0 3 0.9915117718307753 13.385856618189429 4018.0 12.541607194147167 0.0 - - - - - - - 317.54545454545456 8 22 LOC100510206;RHOQ;RHOG;RHOJ;RAC1;RAC2;RAC3;CDC42 rho-related GTP-binding protein RhoQ-like;ras homolog gene family, member Q;ras homolog gene family, member G (rho G);ras homolog gene family, member J;ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3);cell division cycle 42 (GTP binding protein, 25kDa) 533 68 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542886.[MT7]-C[CAM]VVVGDGAVGK[MT7].3b7_1.heavy 450.255 / 831.415 9521.0 26.131799697875977 49 20 9 10 10 7.9864705598412495 12.521175561935303 0.0 3 0.9915117718307753 13.385856618189429 9521.0 73.52955867997377 0.0 - - - - - - - 212.94444444444446 19 18 LOC100510206;RHOQ;RHOG;RHOJ;RAC1;RAC2;RAC3;CDC42 rho-related GTP-binding protein RhoQ-like;ras homolog gene family, member Q;ras homolog gene family, member G (rho G);ras homolog gene family, member J;ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3);cell division cycle 42 (GTP binding protein, 25kDa) 535 69 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21524.[MT7]-YLEQLHQLYSDSFPMELR.3y7_1.heavy 805.071 / 879.439 3130.0 46.49437618255615 46 20 10 6 10 7.328023338224184 13.64624474902849 0.037899017333984375 3 0.9904214696781463 12.599858318236505 3130.0 15.42693230799373 0.0 - - - - - - - 195.58823529411765 6 17 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 537 69 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21524.[MT7]-YLEQLHQLYSDSFPMELR.3b4_1.heavy 805.071 / 678.358 5174.0 46.49437618255615 46 20 10 6 10 7.328023338224184 13.64624474902849 0.037899017333984375 3 0.9904214696781463 12.599858318236505 5174.0 23.26037640655577 0.0 - - - - - - - 218.68421052631578 10 19 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 539 69 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21524.[MT7]-YLEQLHQLYSDSFPMELR.3b5_1.heavy 805.071 / 791.442 3386.0 46.49437618255615 46 20 10 6 10 7.328023338224184 13.64624474902849 0.037899017333984375 3 0.9904214696781463 12.599858318236505 3386.0 19.130004408307208 0.0 - - - - - - - 200.33333333333334 6 15 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 541 69 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21524.[MT7]-YLEQLHQLYSDSFPMELR.3y10_1.heavy 805.071 / 1244.56 2300.0 46.49437618255615 46 20 10 6 10 7.328023338224184 13.64624474902849 0.037899017333984375 3 0.9904214696781463 12.599858318236505 2300.0 18.8671875 0.0 - - - - - - - 161.57894736842104 4 19 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 543 70 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21525.[MT7]-YLEQLHQLYSDSFPMELR.4y4_1.heavy 604.055 / 548.286 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 545 70 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21525.[MT7]-YLEQLHQLYSDSFPMELR.4b4_1.heavy 604.055 / 678.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 547 70 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21525.[MT7]-YLEQLHQLYSDSFPMELR.4b5_1.heavy 604.055 / 791.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 549 70 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21525.[MT7]-YLEQLHQLYSDSFPMELR.4b3_1.heavy 604.055 / 550.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 551 71 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584978.[MT7]-VQIYHNPTANSFR.3y7_1.heavy 564.298 / 792.4 18886.0 28.6919002532959 50 20 10 10 10 14.279765048060032 7.0029163409509625 0.0 3 0.9983374001093527 30.262744143133176 18886.0 112.74753712423035 0.0 - - - - - - - 209.16666666666666 37 12 VASP vasodilator-stimulated phosphoprotein 553 71 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584978.[MT7]-VQIYHNPTANSFR.3y6_1.heavy 564.298 / 695.347 4596.0 28.6919002532959 50 20 10 10 10 14.279765048060032 7.0029163409509625 0.0 3 0.9983374001093527 30.262744143133176 4596.0 20.34114832535885 0.0 - - - - - - - 186.6153846153846 9 13 VASP vasodilator-stimulated phosphoprotein 555 71 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584978.[MT7]-VQIYHNPTANSFR.3b4_1.heavy 564.298 / 648.384 9527.0 28.6919002532959 50 20 10 10 10 14.279765048060032 7.0029163409509625 0.0 3 0.9983374001093527 30.262744143133176 9527.0 22.181924448974392 0.0 - - - - - - - 300.9 19 10 VASP vasodilator-stimulated phosphoprotein 557 71 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584978.[MT7]-VQIYHNPTANSFR.3y5_1.heavy 564.298 / 594.299 6268.0 28.6919002532959 50 20 10 10 10 14.279765048060032 7.0029163409509625 0.0 3 0.9983374001093527 30.262744143133176 6268.0 28.640861244019135 0.0 - - - - - - - 225.75 12 20 VASP vasodilator-stimulated phosphoprotein 559 72 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20998.[MT7]-GLLTVDPAK[MT7].2y4_1.heavy 601.373 / 574.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 561 72 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20998.[MT7]-GLLTVDPAK[MT7].2y3_1.heavy 601.373 / 459.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 563 72 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20998.[MT7]-GLLTVDPAK[MT7].2b6_1.heavy 601.373 / 743.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 565 72 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20998.[MT7]-GLLTVDPAK[MT7].2y6_1.heavy 601.373 / 774.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 567 73 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21318.[MT7]-LFFIQAC[CAM]GGEQK[MT7].2b3_1.heavy 843.45 / 552.33 7301.0 39.778799057006836 42 17 10 5 10 3.4838579921809707 28.703810610086844 0.040401458740234375 3 0.9749630631540478 7.7832587356670855 7301.0 56.045020746887964 0.0 - - - - - - - 219.52631578947367 14 19 CASP9 caspase 9, apoptosis-related cysteine peptidase 569 73 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21318.[MT7]-LFFIQAC[CAM]GGEQK[MT7].2y9_1.heavy 843.45 / 1134.57 2968.0 39.778799057006836 42 17 10 5 10 3.4838579921809707 28.703810610086844 0.040401458740234375 3 0.9749630631540478 7.7832587356670855 2968.0 3.883422112069928 1.0 - - - - - - - 235.94117647058823 6 17 CASP9 caspase 9, apoptosis-related cysteine peptidase 571 73 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21318.[MT7]-LFFIQAC[CAM]GGEQK[MT7].2y6_1.heavy 843.45 / 822.39 4092.0 39.778799057006836 42 17 10 5 10 3.4838579921809707 28.703810610086844 0.040401458740234375 3 0.9749630631540478 7.7832587356670855 4092.0 10.41677579808421 0.0 - - - - - - - 303.64285714285717 8 14 CASP9 caspase 9, apoptosis-related cysteine peptidase 573 73 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21318.[MT7]-LFFIQAC[CAM]GGEQK[MT7].2y7_1.heavy 843.45 / 893.427 4252.0 39.778799057006836 42 17 10 5 10 3.4838579921809707 28.703810610086844 0.040401458740234375 3 0.9749630631540478 7.7832587356670855 4252.0 25.8653765926795 0.0 - - - - - - - 233.83333333333334 8 12 CASP9 caspase 9, apoptosis-related cysteine peptidase 575 74 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584574.[MT7]-EQQAAIQLER.2y9_1.heavy 665.366 / 1056.58 8066.0 26.98094940185547 43 17 10 6 10 3.8149034886538766 26.212982922743848 0.03070068359375 3 0.974325300259515 7.6855699519982705 8066.0 41.220600618663 1.0 - - - - - - - 171.66666666666666 16 15 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 577 74 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584574.[MT7]-EQQAAIQLER.2y6_1.heavy 665.366 / 729.425 3173.0 26.98094940185547 43 17 10 6 10 3.8149034886538766 26.212982922743848 0.03070068359375 3 0.974325300259515 7.6855699519982705 3173.0 7.996856090168247 0.0 - - - - - - - 214.8 6 20 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 579 74 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584574.[MT7]-EQQAAIQLER.2b5_1.heavy 665.366 / 672.343 3967.0 26.98094940185547 43 17 10 6 10 3.8149034886538766 26.212982922743848 0.03070068359375 3 0.974325300259515 7.6855699519982705 3967.0 40.571590909090915 0.0 - - - - - - - 148.5 7 16 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 581 74 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584574.[MT7]-EQQAAIQLER.2y7_1.heavy 665.366 / 800.463 4826.0 26.98094940185547 43 17 10 6 10 3.8149034886538766 26.212982922743848 0.03070068359375 3 0.974325300259515 7.6855699519982705 4826.0 18.71536219531684 0.0 - - - - - - - 185.0 9 15 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 583 75 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20833.[MT7]-AC[CAM]SASSK[MT7].2y4_1.heavy 499.763 / 536.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - STK11 serine/threonine kinase 11 585 75 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20833.[MT7]-AC[CAM]SASSK[MT7].2y5_1.heavy 499.763 / 623.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - STK11 serine/threonine kinase 11 587 75 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20833.[MT7]-AC[CAM]SASSK[MT7].2b4_1.heavy 499.763 / 534.246 N/A N/A - - - - - - - - - 0.0 - - - - - - - STK11 serine/threonine kinase 11 589 75 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20833.[MT7]-AC[CAM]SASSK[MT7].2y6_1.heavy 499.763 / 783.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - STK11 serine/threonine kinase 11 591 76 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21520.[MT7]-EDEMEENLTQVGSILGNLK[MT7].3b6_1.heavy 803.08 / 907.347 1053.0 47.98910140991211 35 11 6 10 8 0.7954324980523265 72.17425282491618 0.0 4 0.8748876763132653 3.452047514990069 1053.0 10.514195121951218 1.0 - - - - - - - 146.57142857142858 2 14 SNAP23 synaptosomal-associated protein, 23kDa 593 76 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21520.[MT7]-EDEMEENLTQVGSILGNLK[MT7].3b5_1.heavy 803.08 / 778.305 1170.0 47.98910140991211 35 11 6 10 8 0.7954324980523265 72.17425282491618 0.0 4 0.8748876763132653 3.452047514990069 1170.0 7.653409090909091 0.0 - - - - - - - 149.27272727272728 2 11 SNAP23 synaptosomal-associated protein, 23kDa 595 76 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21520.[MT7]-EDEMEENLTQVGSILGNLK[MT7].3y4_1.heavy 803.08 / 575.363 2925.0 47.98910140991211 35 11 6 10 8 0.7954324980523265 72.17425282491618 0.0 4 0.8748876763132653 3.452047514990069 2925.0 10.828589500316255 0.0 - - - - - - - 222.6 5 10 SNAP23 synaptosomal-associated protein, 23kDa 597 76 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21520.[MT7]-EDEMEENLTQVGSILGNLK[MT7].3y5_1.heavy 803.08 / 688.447 1697.0 47.98910140991211 35 11 6 10 8 0.7954324980523265 72.17425282491618 0.0 4 0.8748876763132653 3.452047514990069 1697.0 5.151396769565418 2.0 - - - - - - - 283.1666666666667 9 6 SNAP23 synaptosomal-associated protein, 23kDa 599 77 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540704.[MT7]-SLFDDK[MT7].2y4_1.heavy 506.781 / 668.337 7412.0 30.316999435424805 42 12 10 10 10 1.6603560605951941 47.562478278826404 0.0 3 0.8921440133504298 3.7235504275258333 7412.0 16.657481888835363 0.0 - - - - - - - 591.0 14 10 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 601 77 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540704.[MT7]-SLFDDK[MT7].2y5_1.heavy 506.781 / 781.421 5108.0 30.316999435424805 42 12 10 10 10 1.6603560605951941 47.562478278826404 0.0 3 0.8921440133504298 3.7235504275258333 5108.0 19.535942242703534 0.0 - - - - - - - 772.4285714285714 10 7 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 603 77 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540704.[MT7]-SLFDDK[MT7].2b4_1.heavy 506.781 / 607.321 14824.0 30.316999435424805 42 12 10 10 10 1.6603560605951941 47.562478278826404 0.0 3 0.8921440133504298 3.7235504275258333 14824.0 59.21906906187625 0.0 - - - - - - - 225.125 29 8 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 605 77 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540704.[MT7]-SLFDDK[MT7].2y3_1.heavy 506.781 / 521.269 4608.0 30.316999435424805 42 12 10 10 10 1.6603560605951941 47.562478278826404 0.0 3 0.8921440133504298 3.7235504275258333 4608.0 6.89241427188702 1.0 - - - - - - - 651.0 11 10 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 607 78 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543745.[MT7]-IQDRGDQAFTER.3y6_1.heavy 527.27 / 751.373 7129.0 24.19707489013672 41 15 10 6 10 2.053173466032899 38.871332852326574 0.0364990234375 3 0.9534363759644745 5.696908125380254 7129.0 113.94213675213675 0.0 - - - - - - - 157.0 14 16 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 609 78 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543745.[MT7]-IQDRGDQAFTER.3y11_2.heavy 527.27 / 661.808 8765.0 24.19707489013672 41 15 10 6 10 2.053173466032899 38.871332852326574 0.0364990234375 3 0.9534363759644745 5.696908125380254 8765.0 49.69330484330484 0.0 - - - - - - - 183.0 17 15 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 611 78 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543745.[MT7]-IQDRGDQAFTER.3b3_1.heavy 527.27 / 501.279 5201.0 24.19707489013672 41 15 10 6 10 2.053173466032899 38.871332852326574 0.0364990234375 3 0.9534363759644745 5.696908125380254 5201.0 9.498043926355813 1.0 - - - - - - - 672.0 10 10 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 613 78 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543745.[MT7]-IQDRGDQAFTER.3y5_1.heavy 527.27 / 623.315 4441.0 24.19707489013672 41 15 10 6 10 2.053173466032899 38.871332852326574 0.0364990234375 3 0.9534363759644745 5.696908125380254 4441.0 15.70685730838051 0.0 - - - - - - - 213.0 8 17 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 615 79 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539378.[MT7]-NSNLVR.2b3_1.heavy 423.749 / 460.227 6237.0 18.89240074157715 41 13 10 10 8 1.162879620649104 59.961861928736695 0.0 4 0.9034331893917651 3.9390362991550005 6237.0 5.532292531120332 1.0 - - - - - - - 722.4285714285714 19 7 SKP2 S-phase kinase-associated protein 2 (p45) 617 79 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539378.[MT7]-NSNLVR.2y5_1.heavy 423.749 / 588.346 9073.0 18.89240074157715 41 13 10 10 8 1.162879620649104 59.961861928736695 0.0 4 0.9034331893917651 3.9390362991550005 9073.0 5.786781247858078 1.0 - - - - - - - 305.46153846153845 18 13 SKP2 S-phase kinase-associated protein 2 (p45) 619 79 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539378.[MT7]-NSNLVR.2b4_1.heavy 423.749 / 573.311 11246.0 18.89240074157715 41 13 10 10 8 1.162879620649104 59.961861928736695 0.0 4 0.9034331893917651 3.9390362991550005 11246.0 22.61669819906121 0.0 - - - - - - - 720.625 22 8 SKP2 S-phase kinase-associated protein 2 (p45) 621 79 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539378.[MT7]-NSNLVR.2b5_1.heavy 423.749 / 672.38 4064.0 18.89240074157715 41 13 10 10 8 1.162879620649104 59.961861928736695 0.0 4 0.9034331893917651 3.9390362991550005 4064.0 13.310344322344323 0.0 - - - - - - - 223.8 8 15 SKP2 S-phase kinase-associated protein 2 (p45) 623 80 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21314.[MT7]-STAALEEDAQILK[MT7].3y3_1.heavy 559.648 / 517.383 33554.0 35.13859939575195 44 14 10 10 10 1.2815955281532867 46.40953534189097 0.0 3 0.9356824917975779 4.839963558180782 33554.0 75.71567695961994 0.0 - - - - - - - 721.6666666666666 67 9 ARHGEF7;ARHGEF6 Rho guanine nucleotide exchange factor (GEF) 7;Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 625 80 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21314.[MT7]-STAALEEDAQILK[MT7].3b6_1.heavy 559.648 / 717.39 15153.0 35.13859939575195 44 14 10 10 10 1.2815955281532867 46.40953534189097 0.0 3 0.9356824917975779 4.839963558180782 15153.0 75.50290974025415 0.0 - - - - - - - 260.6666666666667 30 12 ARHGEF7;ARHGEF6 Rho guanine nucleotide exchange factor (GEF) 7;Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 627 80 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21314.[MT7]-STAALEEDAQILK[MT7].3b5_1.heavy 559.648 / 588.347 18641.0 35.13859939575195 44 14 10 10 10 1.2815955281532867 46.40953534189097 0.0 3 0.9356824917975779 4.839963558180782 18641.0 35.86970958168108 0.0 - - - - - - - 360.8333333333333 37 12 ARHGEF7;ARHGEF6 Rho guanine nucleotide exchange factor (GEF) 7;Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 629 80 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21314.[MT7]-STAALEEDAQILK[MT7].3b8_1.heavy 559.648 / 961.459 10944.0 35.13859939575195 44 14 10 10 10 1.2815955281532867 46.40953534189097 0.0 3 0.9356824917975779 4.839963558180782 10944.0 103.930079002079 0.0 - - - - - - - 180.33333333333334 21 12 ARHGEF7;ARHGEF6 Rho guanine nucleotide exchange factor (GEF) 7;Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 631 81 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584377.[MT7]-ALFDFLK[MT7].2y4_1.heavy 571.347 / 666.394 5568.0 45.47085094451904 46 20 10 6 10 18.826404060605338 5.311688821619004 0.035800933837890625 3 0.9974977545806396 24.66645949697523 5568.0 82.85184 0.0 - - - - - - - 167.0 11 12 CACNB1;CACNB2;CACNB3;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 3 subunit;calcium channel, voltage-dependent, beta 4 subunit 633 81 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584377.[MT7]-ALFDFLK[MT7].2y5_1.heavy 571.347 / 813.463 7508.0 45.47085094451904 46 20 10 6 10 18.826404060605338 5.311688821619004 0.035800933837890625 3 0.9974977545806396 24.66645949697523 7508.0 216.89777777777778 0.0 - - - - - - - 119.1 15 10 CACNB1;CACNB2;CACNB3;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 3 subunit;calcium channel, voltage-dependent, beta 4 subunit 635 81 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584377.[MT7]-ALFDFLK[MT7].2b4_1.heavy 571.347 / 591.326 15078.0 45.47085094451904 46 20 10 6 10 18.826404060605338 5.311688821619004 0.035800933837890625 3 0.9974977545806396 24.66645949697523 15078.0 83.88185252396165 0.0 - - - - - - - 172.25 30 12 CACNB1;CACNB2;CACNB3;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 3 subunit;calcium channel, voltage-dependent, beta 4 subunit 637 81 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584377.[MT7]-ALFDFLK[MT7].2y3_1.heavy 571.347 / 551.367 15891.0 45.47085094451904 46 20 10 6 10 18.826404060605338 5.311688821619004 0.035800933837890625 3 0.9974977545806396 24.66645949697523 15891.0 140.0571880851064 0.0 - - - - - - - 192.6153846153846 31 13 CACNB1;CACNB2;CACNB3;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 3 subunit;calcium channel, voltage-dependent, beta 4 subunit 639 82 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539376.[MT7]-LSDNPR.2y4_1.heavy 423.234 / 501.242 2870.0 18.63895034790039 44 18 10 6 10 4.13158368828811 24.203793882590872 0.037700653076171875 3 0.9889152455264585 11.711090642318966 2870.0 6.731838235294118 0.0 - - - - - - - 693.1818181818181 5 11 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 641 82 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539376.[MT7]-LSDNPR.2b3_1.heavy 423.234 / 460.252 33358.0 18.63895034790039 44 18 10 6 10 4.13158368828811 24.203793882590872 0.037700653076171875 3 0.9889152455264585 11.711090642318966 33358.0 46.11607536727892 0.0 - - - - - - - 712.7142857142857 66 7 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 643 82 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539376.[MT7]-LSDNPR.2y5_1.heavy 423.234 / 588.274 36558.0 18.63895034790039 44 18 10 6 10 4.13158368828811 24.203793882590872 0.037700653076171875 3 0.9889152455264585 11.711090642318966 36558.0 76.92659685400635 0.0 - - - - - - - 701.3 73 10 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 645 82 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539376.[MT7]-LSDNPR.2b4_1.heavy 423.234 / 574.295 11480.0 18.63895034790039 44 18 10 6 10 4.13158368828811 24.203793882590872 0.037700653076171875 3 0.9889152455264585 11.711090642318966 11480.0 34.77516959190266 0.0 - - - - - - - 694.25 22 8 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 647 83 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20990.[MT7]-DRIDIANAR.2y5_1.heavy 594.334 / 544.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNAP23 synaptosomal-associated protein, 23kDa 649 83 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20990.[MT7]-DRIDIANAR.2b4_1.heavy 594.334 / 644.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNAP23 synaptosomal-associated protein, 23kDa 651 83 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20990.[MT7]-DRIDIANAR.2b6_1.heavy 594.334 / 828.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNAP23 synaptosomal-associated protein, 23kDa 653 83 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20990.[MT7]-DRIDIANAR.2y6_1.heavy 594.334 / 659.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNAP23 synaptosomal-associated protein, 23kDa 655 84 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540426.[MT7]-SSIC[CAM]LLR.2y4_1.heavy 496.788 / 561.318 4942.0 32.09080123901367 45 17 10 10 8 3.5635421848539823 28.061966103566007 0.0 4 0.9727490666787972 7.458997651855192 4942.0 6.524823730970679 2.0 - - - - - - - 706.0 10 7 CDC16 cell division cycle 16 homolog (S. cerevisiae) 657 84 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540426.[MT7]-SSIC[CAM]LLR.2b4_1.heavy 496.788 / 592.288 4283.0 32.09080123901367 45 17 10 10 8 3.5635421848539823 28.061966103566007 0.0 4 0.9727490666787972 7.458997651855192 4283.0 10.922829694033318 0.0 - - - - - - - 700.125 8 8 CDC16 cell division cycle 16 homolog (S. cerevisiae) 659 84 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540426.[MT7]-SSIC[CAM]LLR.2y6_1.heavy 496.788 / 761.434 8017.0 32.09080123901367 45 17 10 10 8 3.5635421848539823 28.061966103566007 0.0 4 0.9727490666787972 7.458997651855192 8017.0 25.5395969791591 0.0 - - - - - - - 304.8888888888889 16 9 CDC16 cell division cycle 16 homolog (S. cerevisiae) 661 84 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540426.[MT7]-SSIC[CAM]LLR.2b5_1.heavy 496.788 / 705.372 5271.0 32.09080123901367 45 17 10 10 8 3.5635421848539823 28.061966103566007 0.0 4 0.9727490666787972 7.458997651855192 5271.0 7.200819672131148 0.0 - - - - - - - 252.6 10 10 CDC16 cell division cycle 16 homolog (S. cerevisiae) 663 85 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21119.[MT7]-IGPVAQDLLQR.2y4_1.heavy 677.402 / 529.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 665 85 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21119.[MT7]-IGPVAQDLLQR.2y5_1.heavy 677.402 / 644.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 667 85 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21119.[MT7]-IGPVAQDLLQR.2y10_1.heavy 677.402 / 1096.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 669 85 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21119.[MT7]-IGPVAQDLLQR.2y7_1.heavy 677.402 / 843.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 671 86 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541983.[MT7]-VTADISLAK[MT7].3y3_1.heavy 402.583 / 475.336 26717.0 31.232500076293945 39 13 8 10 8 2.2594119363330036 44.259304110032595 0.0 4 0.9048242972115381 3.9681955848573778 26717.0 67.61129836022977 2.0 - - - - - - - 438.0 94 1 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 673 86 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541983.[MT7]-VTADISLAK[MT7].3b4_1.heavy 402.583 / 531.289 36572.0 31.232500076293945 39 13 8 10 8 2.2594119363330036 44.259304110032595 0.0 4 0.9048242972115381 3.9681955848573778 36572.0 30.623519315090697 0.0 - - - - - - - 1216.4444444444443 73 9 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 675 86 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541983.[MT7]-VTADISLAK[MT7].3b5_1.heavy 402.583 / 644.374 8650.0 31.232500076293945 39 13 8 10 8 2.2594119363330036 44.259304110032595 0.0 4 0.9048242972115381 3.9681955848573778 8650.0 21.731962063493537 0.0 - - - - - - - 642.875 17 8 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 677 86 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541983.[MT7]-VTADISLAK[MT7].3y4_1.heavy 402.583 / 562.368 13906.0 31.232500076293945 39 13 8 10 8 2.2594119363330036 44.259304110032595 0.0 4 0.9048242972115381 3.9681955848573778 13906.0 70.12045133088317 0.0 - - - - - - - 686.4545454545455 27 11 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 679 87 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543651.[MT7]-TIEYLQPNPASR.3y6_1.heavy 511.611 / 641.336 146109.0 31.232500076293945 50 20 10 10 10 79.5191268249674 1.257559080346969 0.0 3 0.9996836130864507 69.38117695253183 146109.0 236.91860027761354 0.0 - - - - - - - 352.75 292 4 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 681 87 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543651.[MT7]-TIEYLQPNPASR.3b4_1.heavy 511.611 / 651.347 118428.0 31.232500076293945 50 20 10 10 10 79.5191268249674 1.257559080346969 0.0 3 0.9996836130864507 69.38117695253183 118428.0 135.92377043042612 0.0 - - - - - - - 271.5 236 2 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 683 87 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543651.[MT7]-TIEYLQPNPASR.3b5_1.heavy 511.611 / 764.431 25509.0 31.232500076293945 50 20 10 10 10 79.5191268249674 1.257559080346969 0.0 3 0.9996836130864507 69.38117695253183 25509.0 70.62176652316275 0.0 - - - - - - - 289.55555555555554 51 9 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 685 87 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543651.[MT7]-TIEYLQPNPASR.3y5_1.heavy 511.611 / 544.284 22036.0 31.232500076293945 50 20 10 10 10 79.5191268249674 1.257559080346969 0.0 3 0.9996836130864507 69.38117695253183 22036.0 77.6885246179966 0.0 - - - - - - - 744.1428571428571 44 7 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 687 88 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21111.[MT7]-VNIFGVESGK[MT7].3b4_1.heavy 446.594 / 618.373 3398.0 36.171199798583984 33 5 10 10 8 1.655038832965449 37.697930043142975 0.0 4 0.6798147149841903 2.11995403389342 3398.0 5.404116967981123 1.0 - - - - - - - 303.3 8 10 WDR61 WD repeat domain 61 689 88 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21111.[MT7]-VNIFGVESGK[MT7].3b5_1.heavy 446.594 / 675.395 13836.0 36.171199798583984 33 5 10 10 8 1.655038832965449 37.697930043142975 0.0 4 0.6798147149841903 2.11995403389342 13836.0 151.59787666878577 0.0 - - - - - - - 263.0 27 12 WDR61 WD repeat domain 61 691 88 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21111.[MT7]-VNIFGVESGK[MT7].3y4_1.heavy 446.594 / 564.311 14078.0 36.171199798583984 33 5 10 10 8 1.655038832965449 37.697930043142975 0.0 4 0.6798147149841903 2.11995403389342 14078.0 48.58177419902445 0.0 - - - - - - - 254.9 28 10 WDR61 WD repeat domain 61 693 88 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21111.[MT7]-VNIFGVESGK[MT7].3b3_1.heavy 446.594 / 471.305 3277.0 36.171199798583984 33 5 10 10 8 1.655038832965449 37.697930043142975 0.0 4 0.6798147149841903 2.11995403389342 3277.0 7.9974441166140995 0.0 - - - - - - - 291.2 6 10 WDR61 WD repeat domain 61 695 89 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540327.[MT7]-NFESGK[MT7].2b3_1.heavy 485.266 / 535.263 3208.0 19.680700302124023 47 17 10 10 10 3.2511562587599174 24.003503356539706 0.0 3 0.9731134341955718 7.50960014715174 3208.0 14.157932112645895 0.0 - - - - - - - 229.1904761904762 6 21 SNAP23 synaptosomal-associated protein, 23kDa 697 89 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540327.[MT7]-NFESGK[MT7].2y4_1.heavy 485.266 / 564.311 3727.0 19.680700302124023 47 17 10 10 10 3.2511562587599174 24.003503356539706 0.0 3 0.9731134341955718 7.50960014715174 3727.0 16.212944297082228 0.0 - - - - - - - 231.63636363636363 7 22 SNAP23 synaptosomal-associated protein, 23kDa 699 89 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540327.[MT7]-NFESGK[MT7].2y5_1.heavy 485.266 / 711.379 9484.0 19.680700302124023 47 17 10 10 10 3.2511562587599174 24.003503356539706 0.0 3 0.9731134341955718 7.50960014715174 9484.0 107.15513604126372 0.0 - - - - - - - 177.57142857142858 18 21 SNAP23 synaptosomal-associated protein, 23kDa 701 89 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540327.[MT7]-NFESGK[MT7].2y3_1.heavy 485.266 / 435.268 9106.0 19.680700302124023 47 17 10 10 10 3.2511562587599174 24.003503356539706 0.0 3 0.9731134341955718 7.50960014715174 9106.0 15.340700187969926 0.0 - - - - - - - 684.1 18 10 SNAP23 synaptosomal-associated protein, 23kDa 703 90 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 437803.0 35.679901123046875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 437803.0 153.45560093792122 0.0 - - - - - - - 748.4285714285714 875 7 705 90 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 99157.0 35.679901123046875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 99157.0 123.54240142877885 0.0 - - - - - - - 234.3846153846154 198 13 707 90 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 137773.0 35.679901123046875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 137773.0 274.1053392576787 0.0 - - - - - - - 292.4 275 10 709 91 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20944.[MT7]-LFENIGK[MT7].2y4_1.heavy 554.834 / 575.363 6661.0 34.38290023803711 47 17 10 10 10 4.978438952386994 20.086617704140647 0.0 3 0.9759656274651581 7.944604541876991 6661.0 12.922910128388015 0.0 - - - - - - - 613.25 13 8 STK11 serine/threonine kinase 11 711 91 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20944.[MT7]-LFENIGK[MT7].2y5_1.heavy 554.834 / 704.406 2922.0 34.38290023803711 47 17 10 10 10 4.978438952386994 20.086617704140647 0.0 3 0.9759656274651581 7.944604541876991 2922.0 2.555361216730038 0.0 - - - - - - - 272.8333333333333 5 6 STK11 serine/threonine kinase 11 713 91 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20944.[MT7]-LFENIGK[MT7].2b4_1.heavy 554.834 / 648.347 2571.0 34.38290023803711 47 17 10 10 10 4.978438952386994 20.086617704140647 0.0 3 0.9759656274651581 7.944604541876991 2571.0 0.14721753620803157 1.0 - - - - - - - 250.57142857142858 5 7 STK11 serine/threonine kinase 11 715 91 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20944.[MT7]-LFENIGK[MT7].2y6_1.heavy 554.834 / 851.474 8999.0 34.38290023803711 47 17 10 10 10 4.978438952386994 20.086617704140647 0.0 3 0.9759656274651581 7.944604541876991 8999.0 27.46395124683906 0.0 - - - - - - - 233.84615384615384 17 13 STK11 serine/threonine kinase 11 717 92 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20967.[MT7]-VLQIFNK[MT7].2y4_1.heavy 575.365 / 665.41 7867.0 37.96157455444336 43 17 10 6 10 4.085543017502184 24.476550502982565 0.038299560546875 3 0.97718255218756 8.154541917370512 7867.0 29.74597891048692 0.0 - - - - - - - 262.4 15 15 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 719 92 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20967.[MT7]-VLQIFNK[MT7].2y5_1.heavy 575.365 / 793.469 6228.0 37.96157455444336 43 17 10 6 10 4.085543017502184 24.476550502982565 0.038299560546875 3 0.97718255218756 8.154541917370512 6228.0 30.529615770130302 0.0 - - - - - - - 182.16666666666666 12 6 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 721 92 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20967.[MT7]-VLQIFNK[MT7].2y3_1.heavy 575.365 / 552.326 12892.0 37.96157455444336 43 17 10 6 10 4.085543017502184 24.476550502982565 0.038299560546875 3 0.97718255218756 8.154541917370512 12892.0 33.752871353419415 0.0 - - - - - - - 238.54545454545453 25 11 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 723 92 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20967.[MT7]-VLQIFNK[MT7].2y6_1.heavy 575.365 / 906.553 12128.0 37.96157455444336 43 17 10 6 10 4.085543017502184 24.476550502982565 0.038299560546875 3 0.97718255218756 8.154541917370512 12128.0 119.92818527634817 0.0 - - - - - - - 218.54545454545453 24 11 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 725 93 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20942.[MT7]-TLTELNK[MT7].2y5_1.heavy 553.837 / 748.432 7100.0 27.15290069580078 46 20 8 10 8 10.558087072479083 9.471412701327495 0.0 4 0.9966229421727931 21.231018342841658 7100.0 15.152439024390244 0.0 - - - - - - - 258.94736842105266 14 19 SNAP23 synaptosomal-associated protein, 23kDa 727 93 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20942.[MT7]-TLTELNK[MT7].2b4_1.heavy 553.837 / 589.331 5342.0 27.15290069580078 46 20 8 10 8 10.558087072479083 9.471412701327495 0.0 4 0.9966229421727931 21.231018342841658 5342.0 40.612506486766996 0.0 - - - - - - - 256.69565217391306 10 23 SNAP23 synaptosomal-associated protein, 23kDa 729 93 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20942.[MT7]-TLTELNK[MT7].2y3_1.heavy 553.837 / 518.342 7170.0 27.15290069580078 46 20 8 10 8 10.558087072479083 9.471412701327495 0.0 4 0.9966229421727931 21.231018342841658 7170.0 8.759743954480795 1.0 - - - - - - - 1182.090909090909 19 11 SNAP23 synaptosomal-associated protein, 23kDa 731 93 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20942.[MT7]-TLTELNK[MT7].2y6_1.heavy 553.837 / 861.516 6116.0 27.15290069580078 46 20 8 10 8 10.558087072479083 9.471412701327495 0.0 4 0.9966229421727931 21.231018342841658 6116.0 26.42339206666088 0.0 - - - - - - - 199.56 12 25 SNAP23 synaptosomal-associated protein, 23kDa 733 94 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585701.[MT7]-SLQLVVLDADTINHPAQLIK[MT7].3y6_1.heavy 826.151 / 813.531 13168.0 42.463998794555664 46 20 10 6 10 4.938003630524631 16.058678060185457 0.034000396728515625 3 0.9904519175569495 12.619964304452555 13168.0 85.7722383252818 0.0 - - - - - - - 212.9047619047619 26 21 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 735 94 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585701.[MT7]-SLQLVVLDADTINHPAQLIK[MT7].3b4_1.heavy 826.151 / 586.368 10000.0 42.463998794555664 46 20 10 6 10 4.938003630524631 16.058678060185457 0.034000396728515625 3 0.9904519175569495 12.619964304452555 10000.0 31.079140315956558 0.0 - - - - - - - 621.0 20 7 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 737 94 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585701.[MT7]-SLQLVVLDADTINHPAQLIK[MT7].3b5_1.heavy 826.151 / 685.437 7267.0 42.463998794555664 46 20 10 6 10 4.938003630524631 16.058678060185457 0.034000396728515625 3 0.9904519175569495 12.619964304452555 7267.0 19.599290149946988 0.0 - - - - - - - 674.4285714285714 14 7 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 739 94 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585701.[MT7]-SLQLVVLDADTINHPAQLIK[MT7].3y8_1.heavy 826.151 / 1064.63 2174.0 42.463998794555664 46 20 10 6 10 4.938003630524631 16.058678060185457 0.034000396728515625 3 0.9904519175569495 12.619964304452555 2174.0 2.9986206896551724 0.0 - - - - - - - 235.5 4 24 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 741 95 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21202.[MT7]-ETVNVITLYK[MT7].2y4_1.heavy 734.437 / 668.41 4267.0 36.681800842285156 40 10 10 10 10 0.845309159413186 70.76227685989451 0.0 3 0.8467043889658613 3.1109046375743743 4267.0 8.40196905766526 0.0 - - - - - - - 711.1428571428571 8 7 TSG101 tumor susceptibility gene 101 743 95 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21202.[MT7]-ETVNVITLYK[MT7].2y5_1.heavy 734.437 / 781.494 5927.0 36.681800842285156 40 10 10 10 10 0.845309159413186 70.76227685989451 0.0 3 0.8467043889658613 3.1109046375743743 5927.0 21.42396620914893 0.0 - - - - - - - 219.15384615384616 11 13 TSG101 tumor susceptibility gene 101 745 95 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21202.[MT7]-ETVNVITLYK[MT7].2b4_1.heavy 734.437 / 588.311 4978.0 36.681800842285156 40 10 10 10 10 0.845309159413186 70.76227685989451 0.0 3 0.8467043889658613 3.1109046375743743 4978.0 4.05151004653852 1.0 - - - - - - - 344.90909090909093 13 11 TSG101 tumor susceptibility gene 101 747 95 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21202.[MT7]-ETVNVITLYK[MT7].2b5_1.heavy 734.437 / 687.379 8297.0 36.681800842285156 40 10 10 10 10 0.845309159413186 70.76227685989451 0.0 3 0.8467043889658613 3.1109046375743743 8297.0 12.512923239243154 0.0 - - - - - - - 217.66666666666666 16 6 TSG101 tumor susceptibility gene 101 749 96 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21302.[MT7]-DRTQEFLSAC[CAM]K[MT7].3y3_1.heavy 548.287 / 522.283 6272.0 27.019325256347656 41 15 10 6 10 2.8655010222202666 26.467756931394817 0.03070068359375 3 0.9565852124174387 5.901462314073643 6272.0 17.569126990352185 0.0 - - - - - - - 705.75 12 8 STX5 syntaxin 5 751 96 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21302.[MT7]-DRTQEFLSAC[CAM]K[MT7].3b6_1.heavy 548.287 / 921.455 3554.0 27.019325256347656 41 15 10 6 10 2.8655010222202666 26.467756931394817 0.03070068359375 3 0.9565852124174387 5.901462314073643 3554.0 18.516730935607463 0.0 - - - - - - - 187.7826086956522 7 23 STX5 syntaxin 5 753 96 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21302.[MT7]-DRTQEFLSAC[CAM]K[MT7].3b5_1.heavy 548.287 / 774.386 2857.0 27.019325256347656 41 15 10 6 10 2.8655010222202666 26.467756931394817 0.03070068359375 3 0.9565852124174387 5.901462314073643 2857.0 66.11914285714286 0.0 - - - - - - - 176.6 5 15 STX5 syntaxin 5 755 96 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21302.[MT7]-DRTQEFLSAC[CAM]K[MT7].3y4_1.heavy 548.287 / 609.315 16238.0 27.019325256347656 41 15 10 6 10 2.8655010222202666 26.467756931394817 0.03070068359375 3 0.9565852124174387 5.901462314073643 16238.0 125.41279827133818 0.0 - - - - - - - 194.3684210526316 32 19 STX5 syntaxin 5 757 97 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542462.[MT7]-LLSQGVIAFR.2y8_1.heavy 624.383 / 877.489 19172.0 40.31230068206787 44 18 10 6 10 6.380826692129072 15.671950489323397 0.034801483154296875 3 0.9884901323954554 11.492374449902359 19172.0 85.58307508517322 0.0 - - - - - - - 172.0 38 14 SKP2 S-phase kinase-associated protein 2 (p45) 759 97 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542462.[MT7]-LLSQGVIAFR.2y9_1.heavy 624.383 / 990.573 30815.0 40.31230068206787 44 18 10 6 10 6.380826692129072 15.671950489323397 0.034801483154296875 3 0.9884901323954554 11.492374449902359 30815.0 109.65354985888179 0.0 - - - - - - - 215.55555555555554 61 9 SKP2 S-phase kinase-associated protein 2 (p45) 761 97 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542462.[MT7]-LLSQGVIAFR.2y6_1.heavy 624.383 / 662.398 9547.0 40.31230068206787 44 18 10 6 10 6.380826692129072 15.671950489323397 0.034801483154296875 3 0.9884901323954554 11.492374449902359 9547.0 43.32857041234914 0.0 - - - - - - - 223.64705882352942 19 17 SKP2 S-phase kinase-associated protein 2 (p45) 763 97 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542462.[MT7]-LLSQGVIAFR.2y7_1.heavy 624.383 / 790.457 6986.0 40.31230068206787 44 18 10 6 10 6.380826692129072 15.671950489323397 0.034801483154296875 3 0.9884901323954554 11.492374449902359 6986.0 89.59180280200898 0.0 - - - - - - - 181.26666666666668 13 15 SKP2 S-phase kinase-associated protein 2 (p45) 765 98 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21004.[MT7]-DSLDIEVK[MT7].3y3_1.heavy 402.899 / 519.326 34706.0 31.41189956665039 41 11 10 10 10 1.411819151488059 60.78686186407296 0.0 3 0.8788045299269086 3.508585930445401 34706.0 63.054265893496876 0.0 - - - - - - - 703.5714285714286 69 7 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 767 98 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21004.[MT7]-DSLDIEVK[MT7].3b4_1.heavy 402.899 / 575.279 53099.0 31.41189956665039 41 11 10 10 10 1.411819151488059 60.78686186407296 0.0 3 0.8788045299269086 3.508585930445401 53099.0 110.60848445314198 0.0 - - - - - - - 672.4285714285714 106 7 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 769 98 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21004.[MT7]-DSLDIEVK[MT7].3b3_1.heavy 402.899 / 460.252 19926.0 31.41189956665039 41 11 10 10 10 1.411819151488059 60.78686186407296 0.0 3 0.8788045299269086 3.508585930445401 19926.0 34.67004851542518 0.0 - - - - - - - 736.3636363636364 39 11 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 771 99 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21002.[MT7]-VTADISLAK[MT7].2y4_1.heavy 603.371 / 562.368 7973.0 31.18829917907715 48 18 10 10 10 3.897063330804327 20.427964913322285 0.0 3 0.9821959407319711 9.235414458987801 7973.0 36.81894074421513 0.0 - - - - - - - 229.2 15 10 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 773 99 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21002.[MT7]-VTADISLAK[MT7].2y8_1.heavy 603.371 / 962.564 10485.0 31.18829917907715 48 18 10 10 10 3.897063330804327 20.427964913322285 0.0 3 0.9821959407319711 9.235414458987801 10485.0 41.268192219679634 0.0 - - - - - - - 297.72727272727275 20 11 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 775 99 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21002.[MT7]-VTADISLAK[MT7].2y5_1.heavy 603.371 / 675.452 4478.0 31.18829917907715 48 18 10 10 10 3.897063330804327 20.427964913322285 0.0 3 0.9821959407319711 9.235414458987801 4478.0 10.772858494358209 1.0 - - - - - - - 257.35714285714283 12 14 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 777 99 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21002.[MT7]-VTADISLAK[MT7].2b4_1.heavy 603.371 / 531.289 13215.0 31.18829917907715 48 18 10 10 10 3.897063330804327 20.427964913322285 0.0 3 0.9821959407319711 9.235414458987801 13215.0 75.74354156453533 0.0 - - - - - - - 297.8181818181818 26 11 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 779 100 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21001.[MT7]-ELEEIRK[MT7].2b3_1.heavy 602.861 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2L3 ubiquitin-conjugating enzyme E2L 3 781 100 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21001.[MT7]-ELEEIRK[MT7].2b4_1.heavy 602.861 / 645.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2L3 ubiquitin-conjugating enzyme E2L 3 783 100 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21001.[MT7]-ELEEIRK[MT7].2y3_1.heavy 602.861 / 560.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2L3 ubiquitin-conjugating enzyme E2L 3 785 100 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21001.[MT7]-ELEEIRK[MT7].2y6_1.heavy 602.861 / 931.569 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBE2L3 ubiquitin-conjugating enzyme E2L 3 787 101 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 444472.0 23.656400680541992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 444472.0 675.9021807832075 0.0 - - - - - - - 448.0 888 1 789 101 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 694781.0 23.656400680541992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 694781.0 1197.3975436777303 0.0 - - - - - - - 448.0 1389 1 791 101 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 1768690.0 23.656400680541992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1768690.0 4507.195316676948 0.0 - - - - - - - 1373.0 3537 2 793 102 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21008.[MT7]-DAESFLLK[MT7].2y5_1.heavy 605.85 / 751.483 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25B cell division cycle 25 homolog B (S. pombe) 795 102 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21008.[MT7]-DAESFLLK[MT7].2b4_1.heavy 605.85 / 547.248 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25B cell division cycle 25 homolog B (S. pombe) 797 102 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21008.[MT7]-DAESFLLK[MT7].2b6_1.heavy 605.85 / 807.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25B cell division cycle 25 homolog B (S. pombe) 799 102 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21008.[MT7]-DAESFLLK[MT7].2y3_1.heavy 605.85 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25B cell division cycle 25 homolog B (S. pombe) 801 103 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20969.[MT7]-NLHPDVTGR.2b3_1.heavy 576.816 / 509.295 2589.0 20.491525650024414 40 15 10 7 8 1.2721765631859694 59.43119567242197 0.0251007080078125 4 0.9532720875627857 5.6868053510340335 2589.0 20.13010574331329 0.0 - - - - - - - 167.65384615384616 5 26 SKP2 S-phase kinase-associated protein 2 (p45) 803 103 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20969.[MT7]-NLHPDVTGR.2y8_1.heavy 576.816 / 894.479 999.0 20.491525650024414 40 15 10 7 8 1.2721765631859694 59.43119567242197 0.0251007080078125 4 0.9532720875627857 5.6868053510340335 999.0 0.0 0.0 - - - - - - - 0.0 1 0 SKP2 S-phase kinase-associated protein 2 (p45) 805 103 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20969.[MT7]-NLHPDVTGR.2y6_1.heavy 576.816 / 644.336 5315.0 20.491525650024414 40 15 10 7 8 1.2721765631859694 59.43119567242197 0.0251007080078125 4 0.9532720875627857 5.6868053510340335 5315.0 36.72225641357864 0.0 - - - - - - - 145.26666666666668 10 15 SKP2 S-phase kinase-associated protein 2 (p45) 807 103 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20969.[MT7]-NLHPDVTGR.2y7_1.heavy 576.816 / 781.395 1090.0 20.491525650024414 40 15 10 7 8 1.2721765631859694 59.43119567242197 0.0251007080078125 4 0.9532720875627857 5.6868053510340335 1090.0 39.724444444444444 1.0 - - - - - - - 106.92857142857143 5 14 SKP2 S-phase kinase-associated protein 2 (p45) 809 104 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585424.[MT7]-NYYTVVLQNILDTEK[MT7].3b6_1.heavy 701.052 / 884.463 42221.0 48.48637580871582 39 13 10 6 10 2.708120619716656 36.925977104543726 0.03350067138671875 3 0.9276911592773798 4.561569814838093 42221.0 220.70068181818183 0.0 - - - - - - - 231.65 84 20 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 811 104 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585424.[MT7]-NYYTVVLQNILDTEK[MT7].3b4_1.heavy 701.052 / 686.327 20993.0 48.48637580871582 39 13 10 6 10 2.708120619716656 36.925977104543726 0.03350067138671875 3 0.9276911592773798 4.561569814838093 20993.0 97.60949810606061 0.0 - - - - - - - 250.63636363636363 41 22 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 813 104 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585424.[MT7]-NYYTVVLQNILDTEK[MT7].3b5_1.heavy 701.052 / 785.395 18941.0 48.48637580871582 39 13 10 6 10 2.708120619716656 36.925977104543726 0.03350067138671875 3 0.9276911592773798 4.561569814838093 18941.0 115.89344709897611 0.0 - - - - - - - 166.16666666666666 37 18 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 815 104 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585424.[MT7]-NYYTVVLQNILDTEK[MT7].3y5_1.heavy 701.052 / 749.416 48964.0 48.48637580871582 39 13 10 6 10 2.708120619716656 36.925977104543726 0.03350067138671875 3 0.9276911592773798 4.561569814838093 48964.0 142.5873421753062 0.0 - - - - - - - 246.5 97 10 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 817 105 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20947.[MT7]-EVELHWR.2y5_1.heavy 556.802 / 740.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 819 105 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20947.[MT7]-EVELHWR.2y6_1.heavy 556.802 / 839.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 821 105 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20947.[MT7]-EVELHWR.2b5_1.heavy 556.802 / 752.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 823 106 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21500.[MT7]-ISDLGVAEALHPFAADDTC[CAM]R.3b9_1.heavy 768.047 / 1000.54 15166.0 40.684425354003906 41 15 10 6 10 1.810897935287006 42.263945002272834 0.03289794921875 3 0.9515841384337795 5.585995029462411 15166.0 99.49326241134753 0.0 - - - - - - - 231.33333333333334 30 18 STK11 serine/threonine kinase 11 825 106 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21500.[MT7]-ISDLGVAEALHPFAADDTC[CAM]R.3b6_1.heavy 768.047 / 729.426 11075.0 40.684425354003906 41 15 10 6 10 1.810897935287006 42.263945002272834 0.03289794921875 3 0.9515841384337795 5.585995029462411 11075.0 60.48049645390071 0.0 - - - - - - - 274.3888888888889 22 18 STK11 serine/threonine kinase 11 827 106 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21500.[MT7]-ISDLGVAEALHPFAADDTC[CAM]R.3b5_1.heavy 768.047 / 630.358 10510.0 40.684425354003906 41 15 10 6 10 1.810897935287006 42.263945002272834 0.03289794921875 3 0.9515841384337795 5.585995029462411 10510.0 26.709810874704495 0.0 - - - - - - - 755.7142857142857 21 7 STK11 serine/threonine kinase 11 829 106 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21500.[MT7]-ISDLGVAEALHPFAADDTC[CAM]R.3y9_1.heavy 768.047 / 1052.45 36187.0 40.684425354003906 41 15 10 6 10 1.810897935287006 42.263945002272834 0.03289794921875 3 0.9515841384337795 5.585995029462411 36187.0 223.39418068028849 0.0 - - - - - - - 257.14285714285717 72 14 STK11 serine/threonine kinase 11 831 107 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20954.[MT7]-NAEEFTK[MT7].2y4_1.heavy 563.803 / 668.374 1760.0 23.320499420166016 43 15 10 10 8 1.5926690052447483 44.859868738796976 0.0 4 0.9546947642314201 5.776100349199596 1760.0 13.617091311916443 0.0 - - - - - - - 142.04761904761904 3 21 UBE2L3 ubiquitin-conjugating enzyme E2L 3 833 107 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20954.[MT7]-NAEEFTK[MT7].2b4_1.heavy 563.803 / 588.275 2986.0 23.320499420166016 43 15 10 10 8 1.5926690052447483 44.859868738796976 0.0 4 0.9546947642314201 5.776100349199596 2986.0 37.26395443925234 0.0 - - - - - - - 168.42105263157896 5 19 UBE2L3 ubiquitin-conjugating enzyme E2L 3 835 107 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20954.[MT7]-NAEEFTK[MT7].2y3_1.heavy 563.803 / 539.331 1920.0 23.320499420166016 43 15 10 10 8 1.5926690052447483 44.859868738796976 0.0 4 0.9546947642314201 5.776100349199596 1920.0 10.423661971830986 1.0 - - - - - - - 266.6666666666667 4 12 UBE2L3 ubiquitin-conjugating enzyme E2L 3 837 107 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20954.[MT7]-NAEEFTK[MT7].2y6_1.heavy 563.803 / 868.453 2506.0 23.320499420166016 43 15 10 10 8 1.5926690052447483 44.859868738796976 0.0 4 0.9546947642314201 5.776100349199596 2506.0 10.46213682224972 0.0 - - - - - - - 217.14285714285714 5 14 UBE2L3 ubiquitin-conjugating enzyme E2L 3 839 108 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20957.[MT7]-RLEANTQR.2b3_1.heavy 566.321 / 543.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 841 108 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20957.[MT7]-RLEANTQR.2y5_1.heavy 566.321 / 589.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 843 108 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20957.[MT7]-RLEANTQR.2b7_1.heavy 566.321 / 957.523 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 845 108 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20957.[MT7]-RLEANTQR.2y7_1.heavy 566.321 / 831.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 847 109 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542177.[MT7]-QDINSLNK[MT7].3y3_1.heavy 407.234 / 518.342 13009.0 22.874000549316406 44 14 10 10 10 1.2839995780634632 46.32935547147052 0.0 3 0.9498881289414446 5.489863616143512 13009.0 14.024686632220766 0.0 - - - - - - - 881.7142857142857 26 7 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 849 109 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542177.[MT7]-QDINSLNK[MT7].3b4_1.heavy 407.234 / 615.322 12340.0 22.874000549316406 44 14 10 10 10 1.2839995780634632 46.32935547147052 0.0 3 0.9498881289414446 5.489863616143512 12340.0 51.044957899180204 0.0 - - - - - - - 727.2857142857143 24 7 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 851 109 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542177.[MT7]-QDINSLNK[MT7].3b5_1.heavy 407.234 / 702.354 8021.0 22.874000549316406 44 14 10 10 10 1.2839995780634632 46.32935547147052 0.0 3 0.9498881289414446 5.489863616143512 8021.0 40.144246254572565 0.0 - - - - - - - 237.11111111111111 16 18 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 853 109 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542177.[MT7]-QDINSLNK[MT7].3b3_1.heavy 407.234 / 501.279 21750.0 22.874000549316406 44 14 10 10 10 1.2839995780634632 46.32935547147052 0.0 3 0.9498881289414446 5.489863616143512 21750.0 25.379548306148052 0.0 - - - - - - - 815.4285714285714 43 7 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 855 110 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543866.[MT7]-FILSIAYSPDGK[MT7].2b3_1.heavy 799.955 / 518.346 22944.0 41.85580062866211 44 14 10 10 10 1.5230850903668312 44.14384332561646 0.0 3 0.935073188012934 4.816949233663296 22944.0 33.48030553838177 0.0 - - - - - - - 712.7142857142857 45 7 WDR61 WD repeat domain 61 857 110 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543866.[MT7]-FILSIAYSPDGK[MT7].2y4_1.heavy 799.955 / 560.316 19220.0 41.85580062866211 44 14 10 10 10 1.5230850903668312 44.14384332561646 0.0 3 0.935073188012934 4.816949233663296 19220.0 50.0895203941718 0.0 - - - - - - - 275.7857142857143 38 14 WDR61 WD repeat domain 61 859 110 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543866.[MT7]-FILSIAYSPDGK[MT7].2y5_1.heavy 799.955 / 647.348 18156.0 41.85580062866211 44 14 10 10 10 1.5230850903668312 44.14384332561646 0.0 3 0.935073188012934 4.816949233663296 18156.0 53.02575355379692 0.0 - - - - - - - 698.5 36 8 WDR61 WD repeat domain 61 861 110 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543866.[MT7]-FILSIAYSPDGK[MT7].2y7_1.heavy 799.955 / 881.448 25206.0 41.85580062866211 44 14 10 10 10 1.5230850903668312 44.14384332561646 0.0 3 0.935073188012934 4.816949233663296 25206.0 59.95685577580315 0.0 - - - - - - - 680.0 50 9 WDR61 WD repeat domain 61 863 111 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20973.[MT7]-TAVNLPLER.2y4_1.heavy 578.844 / 514.298 5529.0 32.1473503112793 46 20 10 6 10 11.566648254904951 8.64554690314837 0.03769683837890625 3 0.9929182731560842 14.656698512717227 5529.0 9.30532097457627 0.0 - - - - - - - 773.9090909090909 11 11 CDC25B cell division cycle 25 homolog B (S. pombe) 865 111 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20973.[MT7]-TAVNLPLER.2y8_1.heavy 578.844 / 911.531 7409.0 32.1473503112793 46 20 10 6 10 11.566648254904951 8.64554690314837 0.03769683837890625 3 0.9929182731560842 14.656698512717227 7409.0 54.83641511748351 0.0 - - - - - - - 195.92307692307693 14 13 CDC25B cell division cycle 25 homolog B (S. pombe) 867 111 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20973.[MT7]-TAVNLPLER.2b4_1.heavy 578.844 / 530.305 4423.0 32.1473503112793 46 20 10 6 10 11.566648254904951 8.64554690314837 0.03769683837890625 3 0.9929182731560842 14.656698512717227 4423.0 5.1430232558139535 0.0 - - - - - - - 233.55555555555554 8 9 CDC25B cell division cycle 25 homolog B (S. pombe) 869 111 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20973.[MT7]-TAVNLPLER.2y6_1.heavy 578.844 / 741.425 5197.0 32.1473503112793 46 20 10 6 10 11.566648254904951 8.64554690314837 0.03769683837890625 3 0.9929182731560842 14.656698512717227 5197.0 16.970524903242698 0.0 - - - - - - - 258.0833333333333 10 12 CDC25B cell division cycle 25 homolog B (S. pombe) 871 112 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20953.[MT7]-IYDALDNR.2b3_1.heavy 562.297 / 536.284 10511.0 30.89150047302246 48 18 10 10 10 4.646099017913003 21.523432801249108 0.0 3 0.9846231753380149 9.93964691501225 10511.0 17.89087762323777 0.0 - - - - - - - 812.5 21 8 CDC16 cell division cycle 16 homolog (S. cerevisiae) 873 112 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20953.[MT7]-IYDALDNR.2y5_1.heavy 562.297 / 588.31 11594.0 30.89150047302246 48 18 10 10 10 4.646099017913003 21.523432801249108 0.0 3 0.9846231753380149 9.93964691501225 11594.0 41.0438722330787 0.0 - - - - - - - 623.1666666666666 23 12 CDC16 cell division cycle 16 homolog (S. cerevisiae) 875 112 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20953.[MT7]-IYDALDNR.2b4_1.heavy 562.297 / 607.321 7693.0 30.89150047302246 48 18 10 10 10 4.646099017913003 21.523432801249108 0.0 3 0.9846231753380149 9.93964691501225 7693.0 27.233958003197728 0.0 - - - - - - - 180.44444444444446 15 9 CDC16 cell division cycle 16 homolog (S. cerevisiae) 877 112 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20953.[MT7]-IYDALDNR.2y7_1.heavy 562.297 / 866.4 14195.0 30.89150047302246 48 18 10 10 10 4.646099017913003 21.523432801249108 0.0 3 0.9846231753380149 9.93964691501225 14195.0 94.2616433888692 0.0 - - - - - - - 187.73333333333332 28 15 CDC16 cell division cycle 16 homolog (S. cerevisiae) 879 113 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21506.[MT7]-YLASGAIDGIINIFDIATGK[MT7].3y7_1.heavy 780.773 / 895.5 2111.0 52.55363337198893 39 14 10 5 10 1.7950072954569736 44.81879402746502 0.04509735107421875 3 0.9468499003238117 5.329270185375399 2111.0 39.378269230769234 0.0 - - - - - - - 174.30769230769232 4 13 WDR61 WD repeat domain 61 881 113 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21506.[MT7]-YLASGAIDGIINIFDIATGK[MT7].3b6_1.heavy 780.773 / 707.385 4573.0 52.55363337198893 39 14 10 5 10 1.7950072954569736 44.81879402746502 0.04509735107421875 3 0.9468499003238117 5.329270185375399 4573.0 26.152843094405593 0.0 - - - - - - - 144.0625 9 16 WDR61 WD repeat domain 61 883 113 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21506.[MT7]-YLASGAIDGIINIFDIATGK[MT7].3b5_1.heavy 780.773 / 636.347 N/A 52.55363337198893 39 14 10 5 10 1.7950072954569736 44.81879402746502 0.04509735107421875 3 0.9468499003238117 5.329270185375399 1759.0 14.513318527491755 1.0 - - - - - - - 128.28571428571428 3 14 WDR61 WD repeat domain 61 885 113 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21506.[MT7]-YLASGAIDGIINIFDIATGK[MT7].3y4_1.heavy 780.773 / 520.321 3362.0 52.55363337198893 39 14 10 5 10 1.7950072954569736 44.81879402746502 0.04509735107421875 3 0.9468499003238117 5.329270185375399 3362.0 20.710158345187846 0.0 - - - - - - - 145.93333333333334 6 15 WDR61 WD repeat domain 61 887 114 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543726.[MT7]-DREAAEGLGSHER.3y7_1.heavy 524.261 / 755.38 2263.0 18.068599700927734 47 17 10 10 10 5.3084334334785215 18.83794932217353 0.0 3 0.9756391000334995 7.890964524588273 2263.0 30.60748201438849 0.0 - - - - - - - 128.71428571428572 4 14 CAPN2 calpain 2, (m/II) large subunit 889 114 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543726.[MT7]-DREAAEGLGSHER.3y4_1.heavy 524.261 / 528.253 2540.0 18.068599700927734 47 17 10 10 10 5.3084334334785215 18.83794932217353 0.0 3 0.9756391000334995 7.890964524588273 2540.0 22.162209972281914 0.0 - - - - - - - 125.33333333333333 5 21 CAPN2 calpain 2, (m/II) large subunit 891 114 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543726.[MT7]-DREAAEGLGSHER.3b7_1.heavy 524.261 / 873.418 2678.0 18.068599700927734 47 17 10 10 10 5.3084334334785215 18.83794932217353 0.0 3 0.9756391000334995 7.890964524588273 2678.0 25.105856639247946 0.0 - - - - - - - 120.5 5 18 CAPN2 calpain 2, (m/II) large subunit 893 114 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543726.[MT7]-DREAAEGLGSHER.3y5_1.heavy 524.261 / 585.274 8773.0 18.068599700927734 47 17 10 10 10 5.3084334334785215 18.83794932217353 0.0 3 0.9756391000334995 7.890964524588273 8773.0 62.60793996881497 0.0 - - - - - - - 158.0 17 19 CAPN2 calpain 2, (m/II) large subunit 895 115 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541400.[MT7]-FSNIVDK[MT7].2b4_1.heavy 555.823 / 606.337 4145.0 29.827999114990234 45 15 10 10 10 2.3332456598405766 42.85875324711102 0.0 3 0.9540085863111675 5.7325161939745755 4145.0 9.667806543738747 0.0 - - - - - - - 266.27272727272725 8 11 CDC25B cell division cycle 25 homolog B (S. pombe) 897 115 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541400.[MT7]-FSNIVDK[MT7].2b6_1.heavy 555.823 / 820.432 4650.0 29.827999114990234 45 15 10 10 10 2.3332456598405766 42.85875324711102 0.0 3 0.9540085863111675 5.7325161939745755 4650.0 16.715334301140164 0.0 - - - - - - - 202.0 9 13 CDC25B cell division cycle 25 homolog B (S. pombe) 899 115 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541400.[MT7]-FSNIVDK[MT7].2y3_1.heavy 555.823 / 505.31 5155.0 29.827999114990234 45 15 10 10 10 2.3332456598405766 42.85875324711102 0.0 3 0.9540085863111675 5.7325161939745755 5155.0 11.577152853094496 0.0 - - - - - - - 707.8 10 10 CDC25B cell division cycle 25 homolog B (S. pombe) 901 115 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541400.[MT7]-FSNIVDK[MT7].2y6_1.heavy 555.823 / 819.469 5560.0 29.827999114990234 45 15 10 10 10 2.3332456598405766 42.85875324711102 0.0 3 0.9540085863111675 5.7325161939745755 5560.0 19.817821782178218 0.0 - - - - - - - 225.30769230769232 11 13 CDC25B cell division cycle 25 homolog B (S. pombe) 903 116 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544917.[MT7]-DIK[MT7]PGNLLLTTGGTLK[MT7].4y5_1.heavy 519.072 / 619.39 13990.0 36.404998779296875 41 13 10 10 8 1.4996310924165193 53.839311015118454 0.0 4 0.9006171759333006 3.8818837816545333 13990.0 67.72501912088902 1.0 - - - - - - - 209.375 46 8 STK11 serine/threonine kinase 11 905 116 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544917.[MT7]-DIK[MT7]PGNLLLTTGGTLK[MT7].4b7_2.heavy 519.072 / 513.813 44958.0 36.404998779296875 41 13 10 10 8 1.4996310924165193 53.839311015118454 0.0 4 0.9006171759333006 3.8818837816545333 44958.0 68.79025083612039 0.0 - - - - - - - 269.0 89 4 STK11 serine/threonine kinase 11 907 116 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544917.[MT7]-DIK[MT7]PGNLLLTTGGTLK[MT7].4b6_1.heavy 519.072 / 913.534 3587.0 36.404998779296875 41 13 10 10 8 1.4996310924165193 53.839311015118454 0.0 4 0.9006171759333006 3.8818837816545333 3587.0 55.5985 0.0 - - - - - - - 137.0 7 7 STK11 serine/threonine kinase 11 909 116 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544917.[MT7]-DIK[MT7]PGNLLLTTGGTLK[MT7].4b3_1.heavy 519.072 / 645.417 5859.0 36.404998779296875 41 13 10 10 8 1.4996310924165193 53.839311015118454 0.0 4 0.9006171759333006 3.8818837816545333 5859.0 30.32435146443515 0.0 - - - - - - - 299.0 11 12 STK11 serine/threonine kinase 11 911 117 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540156.[MT7]-SVLELVR.2y5_1.heavy 480.304 / 629.398 12266.0 36.77470016479492 47 17 10 10 10 3.1044477367720904 25.679892055994276 0.0 3 0.978701743523313 8.441439385224191 12266.0 30.00825370675453 0.0 - - - - - - - 262.9166666666667 24 12 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 913 117 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540156.[MT7]-SVLELVR.2b4_1.heavy 480.304 / 573.336 17123.0 36.77470016479492 47 17 10 10 10 3.1044477367720904 25.679892055994276 0.0 3 0.978701743523313 8.441439385224191 17123.0 56.224103441468706 0.0 - - - - - - - 308.15384615384613 34 13 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 915 117 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540156.[MT7]-SVLELVR.2y6_1.heavy 480.304 / 728.466 11780.0 36.77470016479492 47 17 10 10 10 3.1044477367720904 25.679892055994276 0.0 3 0.978701743523313 8.441439385224191 11780.0 17.030540957624293 0.0 - - - - - - - 279.1 23 10 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 917 117 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540156.[MT7]-SVLELVR.2b5_1.heavy 480.304 / 686.42 10808.0 36.77470016479492 47 17 10 10 10 3.1044477367720904 25.679892055994276 0.0 3 0.978701743523313 8.441439385224191 10808.0 55.22769230769231 0.0 - - - - - - - 313.6666666666667 21 12 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 919 118 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585310.[MT7]-FADDQLIIDFDNFVR.3y7_1.heavy 658.003 / 912.421 1356.0 52.4031982421875 43 13 10 10 10 4.746586453277964 16.777392403385697 0.0 3 0.9180218861969174 4.2805630319565955 1356.0 46.62436974789915 0.0 - - - - - - - 102.71428571428571 2 7 CAPN2 calpain 2, (m/II) large subunit 921 118 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585310.[MT7]-FADDQLIIDFDNFVR.3b4_1.heavy 658.003 / 593.269 3561.0 52.4031982421875 43 13 10 10 10 4.746586453277964 16.777392403385697 0.0 3 0.9180218861969174 4.2805630319565955 3561.0 16.384102808186576 0.0 - - - - - - - 140.5 7 16 CAPN2 calpain 2, (m/II) large subunit 923 118 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585310.[MT7]-FADDQLIIDFDNFVR.3y4_1.heavy 658.003 / 535.299 2967.0 52.4031982421875 43 13 10 10 10 4.746586453277964 16.777392403385697 0.0 3 0.9180218861969174 4.2805630319565955 2967.0 21.701586452762925 0.0 - - - - - - - 149.73333333333332 5 15 CAPN2 calpain 2, (m/II) large subunit 925 118 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585310.[MT7]-FADDQLIIDFDNFVR.3y8_1.heavy 658.003 / 1025.51 4493.0 52.4031982421875 43 13 10 10 10 4.746586453277964 16.777392403385697 0.0 3 0.9180218861969174 4.2805630319565955 4493.0 58.10308476146364 0.0 - - - - - - - 104.76470588235294 8 17 CAPN2 calpain 2, (m/II) large subunit 927 119 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540400.[MT7]-EISLLK[MT7].2y4_1.heavy 495.826 / 604.415 26446.0 33.2760009765625 46 18 10 10 8 12.960308526421631 7.715865698423324 0.0 4 0.9891519862313439 11.838423443981574 26446.0 54.04649543147208 0.0 - - - - - - - 327.3636363636364 52 11 CDK2;CDK3;CDK1 cyclin-dependent kinase 2;cyclin-dependent kinase 3;cyclin-dependent kinase 1 929 119 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540400.[MT7]-EISLLK[MT7].2y5_1.heavy 495.826 / 717.499 17106.0 33.2760009765625 46 18 10 10 8 12.960308526421631 7.715865698423324 0.0 4 0.9891519862313439 11.838423443981574 17106.0 26.381253333333333 0.0 - - - - - - - 611.0 34 7 CDK2;CDK3;CDK1 cyclin-dependent kinase 2;cyclin-dependent kinase 3;cyclin-dependent kinase 1 931 119 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540400.[MT7]-EISLLK[MT7].2b4_1.heavy 495.826 / 587.352 9341.0 33.2760009765625 46 18 10 10 8 12.960308526421631 7.715865698423324 0.0 4 0.9891519862313439 11.838423443981574 9341.0 17.847590610946583 0.0 - - - - - - - 675.3636363636364 18 11 CDK2;CDK3;CDK1 cyclin-dependent kinase 2;cyclin-dependent kinase 3;cyclin-dependent kinase 1 933 119 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540400.[MT7]-EISLLK[MT7].2y3_1.heavy 495.826 / 517.383 9566.0 33.2760009765625 46 18 10 10 8 12.960308526421631 7.715865698423324 0.0 4 0.9891519862313439 11.838423443981574 9566.0 5.861235365510632 1.0 - - - - - - - 703.375 44 8 CDK2;CDK3;CDK1 cyclin-dependent kinase 2;cyclin-dependent kinase 3;cyclin-dependent kinase 1 935 120 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20813.[MT7]-VWDVGTR.2b3_1.heavy 488.77 / 545.284 52796.0 30.23590087890625 43 13 10 10 10 1.5124334635764551 42.46750263685871 0.0 3 0.9185126793575867 4.293615514780826 52796.0 97.40483523107602 0.0 - - - - - - - 340.5 105 4 WDR61 WD repeat domain 61 937 120 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20813.[MT7]-VWDVGTR.2y5_1.heavy 488.77 / 547.284 14037.0 30.23590087890625 43 13 10 10 10 1.5124334635764551 42.46750263685871 0.0 3 0.9185126793575867 4.293615514780826 14037.0 28.93392609969228 0.0 - - - - - - - 702.0 28 10 WDR61 WD repeat domain 61 939 120 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20813.[MT7]-VWDVGTR.2b4_1.heavy 488.77 / 644.352 5447.0 30.23590087890625 43 13 10 10 10 1.5124334635764551 42.46750263685871 0.0 3 0.9185126793575867 4.293615514780826 5447.0 6.817509722559173 1.0 - - - - - - - 602.5 12 8 WDR61 WD repeat domain 61 941 120 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20813.[MT7]-VWDVGTR.2y6_1.heavy 488.77 / 733.363 51853.0 30.23590087890625 43 13 10 10 10 1.5124334635764551 42.46750263685871 0.0 3 0.9185126793575867 4.293615514780826 51853.0 123.18007288554762 0.0 - - - - - - - 707.25 103 8 WDR61 WD repeat domain 61 943 121 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21601.[MT7]-YLNQDYEALRNEC[CAM]LEAGTLFQDPSFPAIPSALGFK[MT7].4y4_1.heavy 1066.54 / 608.389 1267.0 49.619850158691406 39 16 10 3 10 2.841962958440255 35.18694700189994 0.0670013427734375 3 0.961717558362786 6.287344245829147 1267.0 25.142235552115583 0.0 - - - - - - - 158.375 2 16 CAPN2 calpain 2, (m/II) large subunit 945 121 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21601.[MT7]-YLNQDYEALRNEC[CAM]LEAGTLFQDPSFPAIPSALGFK[MT7].4y10_1.heavy 1066.54 / 1144.68 2635.0 49.619850158691406 39 16 10 3 10 2.841962958440255 35.18694700189994 0.0670013427734375 3 0.961717558362786 6.287344245829147 2635.0 23.933989494487207 0.0 - - - - - - - 145.66666666666666 5 24 CAPN2 calpain 2, (m/II) large subunit 947 121 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21601.[MT7]-YLNQDYEALRNEC[CAM]LEAGTLFQDPSFPAIPSALGFK[MT7].4b5_1.heavy 1066.54 / 778.385 912.0 49.619850158691406 39 16 10 3 10 2.841962958440255 35.18694700189994 0.0670013427734375 3 0.961717558362786 6.287344245829147 912.0 27.181176470588234 0.0 - - - - - - - 0.0 1 0 CAPN2 calpain 2, (m/II) large subunit 949 121 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21601.[MT7]-YLNQDYEALRNEC[CAM]LEAGTLFQDPSFPAIPSALGFK[MT7].4y7_1.heavy 1066.54 / 863.511 4662.0 49.619850158691406 39 16 10 3 10 2.841962958440255 35.18694700189994 0.0670013427734375 3 0.961717558362786 6.287344245829147 4662.0 70.98982152162584 0.0 - - - - - - - 181.21052631578948 9 19 CAPN2 calpain 2, (m/II) large subunit 951 122 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 259688.0 33.03379821777344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 259688.0 1307.2760704253214 0.0 - - - - - - - 745.125 519 8 953 122 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 326157.0 33.03379821777344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 326157.0 779.2827432367842 0.0 - - - - - - - 267.9230769230769 652 13 955 122 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 557219.0 33.03379821777344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 557219.0 376.9403217545939 0.0 - - - - - - - 274.77777777777777 1114 9 957 123 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543118.[MT7]-QVWGLNFGSK[MT7].3b6_1.heavy 475.269 / 842.464 11491.0 38.90650177001953 42 12 10 10 10 2.1315444389180227 46.91433975017675 0.0 3 0.8928981864088449 3.7368819250072898 11491.0 99.94776041666665 0.0 - - - - - - - 191.75 22 4 VASP vasodilator-stimulated phosphoprotein 959 123 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543118.[MT7]-QVWGLNFGSK[MT7].3b4_1.heavy 475.269 / 615.337 19247.0 38.90650177001953 42 12 10 10 10 2.1315444389180227 46.91433975017675 0.0 3 0.8928981864088449 3.7368819250072898 19247.0 122.72477351916376 0.0 - - - - - - - 191.66666666666666 38 15 VASP vasodilator-stimulated phosphoprotein 961 123 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543118.[MT7]-QVWGLNFGSK[MT7].3b5_1.heavy 475.269 / 728.421 11491.0 38.90650177001953 42 12 10 10 10 2.1315444389180227 46.91433975017675 0.0 3 0.8928981864088449 3.7368819250072898 11491.0 153.3509650842044 0.0 - - - - - - - 252.63636363636363 22 11 VASP vasodilator-stimulated phosphoprotein 963 123 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543118.[MT7]-QVWGLNFGSK[MT7].3y4_1.heavy 475.269 / 582.337 16566.0 38.90650177001953 42 12 10 10 10 2.1315444389180227 46.91433975017675 0.0 3 0.8928981864088449 3.7368819250072898 16566.0 55.17111929362582 0.0 - - - - - - - 245.625 33 16 VASP vasodilator-stimulated phosphoprotein 965 124 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542860.[MT7]-EQQAAIQLER.3b4_1.heavy 443.913 / 601.306 44331.0 26.996299743652344 47 17 10 10 10 2.3807595449462915 29.074449322804497 0.0 3 0.9781169852524589 8.327480490811674 44331.0 59.765666386132935 0.0 - - - - - - - 780.1538461538462 88 13 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 967 124 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542860.[MT7]-EQQAAIQLER.3y4_1.heavy 443.913 / 545.304 59152.0 26.996299743652344 47 17 10 10 10 2.3807595449462915 29.074449322804497 0.0 3 0.9781169852524589 8.327480490811674 59152.0 70.00791844110428 0.0 - - - - - - - 1214.142857142857 118 7 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 969 124 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542860.[MT7]-EQQAAIQLER.3b3_1.heavy 443.913 / 530.269 43541.0 26.996299743652344 47 17 10 10 10 2.3807595449462915 29.074449322804497 0.0 3 0.9781169852524589 8.327480490811674 43541.0 59.22086455936942 0.0 - - - - - - - 1185.9 87 10 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 971 124 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542860.[MT7]-EQQAAIQLER.3y5_1.heavy 443.913 / 658.388 32079.0 26.996299743652344 47 17 10 10 10 2.3807595449462915 29.074449322804497 0.0 3 0.9781169852524589 8.327480490811674 32079.0 91.36051446182474 0.0 - - - - - - - 629.5555555555555 64 9 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 973 125 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585415.[MT7]-EQLNRIEEGLDQINK[MT7].3b11_2.heavy 696.383 / 721.374 12578.0 35.03325080871582 41 16 10 5 10 5.186642026576107 19.280297249666503 0.042499542236328125 3 0.9623411617815854 6.339521563423846 12578.0 76.26215413184772 0.0 - - - - - - - 256.7857142857143 25 14 SNAP23 synaptosomal-associated protein, 23kDa 975 125 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585415.[MT7]-EQLNRIEEGLDQINK[MT7].3y3_1.heavy 696.383 / 518.342 11260.0 35.03325080871582 41 16 10 5 10 5.186642026576107 19.280297249666503 0.042499542236328125 3 0.9623411617815854 6.339521563423846 11260.0 51.42272492018539 0.0 - - - - - - - 239.66666666666666 22 12 SNAP23 synaptosomal-associated protein, 23kDa 977 125 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585415.[MT7]-EQLNRIEEGLDQINK[MT7].3b4_1.heavy 696.383 / 629.338 7427.0 35.03325080871582 41 16 10 5 10 5.186642026576107 19.280297249666503 0.042499542236328125 3 0.9623411617815854 6.339521563423846 7427.0 25.509214267626525 0.0 - - - - - - - 299.6 14 10 SNAP23 synaptosomal-associated protein, 23kDa 979 125 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585415.[MT7]-EQLNRIEEGLDQINK[MT7].3y4_1.heavy 696.383 / 646.4 8146.0 35.03325080871582 41 16 10 5 10 5.186642026576107 19.280297249666503 0.042499542236328125 3 0.9623411617815854 6.339521563423846 8146.0 16.475353565158866 0.0 - - - - - - - 749.0 16 8 SNAP23 synaptosomal-associated protein, 23kDa 981 126 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540963.[MT7]-DSGDVAALR.2y8_1.heavy 524.281 / 788.426 1688.0 24.306575298309326 43 17 10 6 10 4.776955202949121 20.933836670325814 0.03650093078613281 3 0.9743759535831191 7.693195357685305 1688.0 10.148716750494977 0.0 - - - - - - - 133.41176470588235 3 17 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 983 126 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540963.[MT7]-DSGDVAALR.2y5_1.heavy 524.281 / 529.346 2328.0 24.306575298309326 43 17 10 6 10 4.776955202949121 20.933836670325814 0.03650093078613281 3 0.9743759535831191 7.693195357685305 2328.0 6.988995708154506 0.0 - - - - - - - 207.8095238095238 4 21 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 985 126 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540963.[MT7]-DSGDVAALR.2b4_1.heavy 524.281 / 519.217 3259.0 24.306575298309326 43 17 10 6 10 4.776955202949121 20.933836670325814 0.03650093078613281 3 0.9743759535831191 7.693195357685305 3259.0 6.581776065934905 0.0 - - - - - - - 669.3 6 10 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 987 126 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540963.[MT7]-DSGDVAALR.2b6_1.heavy 524.281 / 689.322 757.0 24.306575298309326 43 17 10 6 10 4.776955202949121 20.933836670325814 0.03650093078613281 3 0.9743759535831191 7.693195357685305 757.0 1.5810996563573885 3.0 - - - - - - - 0.0 1 0 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 989 127 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545267.[MT7]-LEEEDEDEEDGESGC[CAM]TFLVGLIQK[MT7].4y5_1.heavy 758.106 / 702.463 5802.0 44.588600158691406 37 17 2 10 8 5.205409158226954 19.21078573467251 0.0 4 0.9775339594897242 8.218312629430114 5802.0 16.616507902619134 0.0 - - - - - - - 767.8571428571429 11 7 CAPN2 calpain 2, (m/II) large subunit 991 127 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545267.[MT7]-LEEEDEDEEDGESGC[CAM]TFLVGLIQK[MT7].4b7_1.heavy 758.106 / 1004.42 3176.0 44.588600158691406 37 17 2 10 8 5.205409158226954 19.21078573467251 0.0 4 0.9775339594897242 8.218312629430114 3176.0 7.286586435392712 0.0 - - - - - - - 283.8 6 20 CAPN2 calpain 2, (m/II) large subunit 993 127 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545267.[MT7]-LEEEDEDEEDGESGC[CAM]TFLVGLIQK[MT7].4y3_1.heavy 758.106 / 532.357 3725.0 44.588600158691406 37 17 2 10 8 5.205409158226954 19.21078573467251 0.0 4 0.9775339594897242 8.218312629430114 3725.0 6.6517857142857135 1.0 - - - - - - - 780.4444444444445 9 9 CAPN2 calpain 2, (m/II) large subunit 995 127 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545267.[MT7]-LEEEDEDEEDGESGC[CAM]TFLVGLIQK[MT7].4b3_1.heavy 758.106 / 516.279 1893.0 44.588600158691406 37 17 2 10 8 5.205409158226954 19.21078573467251 0.0 4 0.9775339594897242 8.218312629430114 1893.0 1.5498245614035089 2.0 - - - - - - - 728.9333333333333 23 15 CAPN2 calpain 2, (m/II) large subunit 997 128 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21155.[MT7]-IIRNEQFAIR.2b8_1.heavy 702.416 / 1116.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25B cell division cycle 25 homolog B (S. pombe) 999 128 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21155.[MT7]-IIRNEQFAIR.2b8_2.heavy 702.416 / 558.818 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25B cell division cycle 25 homolog B (S. pombe) 1001 128 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21155.[MT7]-IIRNEQFAIR.2b6_1.heavy 702.416 / 898.523 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25B cell division cycle 25 homolog B (S. pombe) 1003 128 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21155.[MT7]-IIRNEQFAIR.2b5_1.heavy 702.416 / 770.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25B cell division cycle 25 homolog B (S. pombe) 1005 129 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21017.[MT7]-QDINSLNK[MT7].2y4_1.heavy 610.348 / 605.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510546;STX5 syntaxin-5-like;syntaxin 5 1007 129 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21017.[MT7]-QDINSLNK[MT7].2y5_1.heavy 610.348 / 719.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510546;STX5 syntaxin-5-like;syntaxin 5 1009 129 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21017.[MT7]-QDINSLNK[MT7].2b4_1.heavy 610.348 / 615.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510546;STX5 syntaxin-5-like;syntaxin 5 1011 129 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21017.[MT7]-QDINSLNK[MT7].2y7_1.heavy 610.348 / 947.528 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510546;STX5 syntaxin-5-like;syntaxin 5 1013 130 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541943.[MT7]-EQEETIQR.2b3_1.heavy 588.802 / 531.253 1227.0 18.695499420166016 48 18 10 10 10 9.405820812607612 10.631714338631614 0.0 3 0.9892422655821264 11.888083723584224 1227.0 4.937819478073715 0.0 - - - - - - - 158.11764705882354 2 17 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 1015 130 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541943.[MT7]-EQEETIQR.2y5_1.heavy 588.802 / 646.352 802.0 18.695499420166016 48 18 10 10 10 9.405820812607612 10.631714338631614 0.0 3 0.9892422655821264 11.888083723584224 802.0 13.651063829787233 0.0 - - - - - - - 0.0 1 0 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 1017 130 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541943.[MT7]-EQEETIQR.2y6_1.heavy 588.802 / 775.394 1039.0 18.695499420166016 48 18 10 10 10 9.405820812607612 10.631714338631614 0.0 3 0.9892422655821264 11.888083723584224 1039.0 23.31012630629276 0.0 - - - - - - - 108.76923076923077 2 13 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 1019 130 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541943.[MT7]-EQEETIQR.2y7_1.heavy 588.802 / 903.453 2313.0 18.695499420166016 48 18 10 10 10 9.405820812607612 10.631714338631614 0.0 3 0.9892422655821264 11.888083723584224 2313.0 51.656721961774245 0.0 - - - - - - - 138.14285714285714 4 14 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 1021 131 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 307794.0 27.45709991455078 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 307794.0 554.1383745695719 0.0 - - - - - - - 937.0 615 1 1023 131 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 353794.0 27.45709991455078 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 353794.0 311.2504047803727 0.0 - - - - - - - 2091.0 707 1 1025 131 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 446587.0 27.45709991455078 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 446587.0 780.1456471396665 0.0 - - - - - - - 3148.3333333333335 893 3 1027 132 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21159.[MT7]-GVIDLDVFLK[MT7].2b4_1.heavy 703.928 / 529.31 2028.0 46.66186650594076 44 20 10 6 8 8.065286629486865 12.398815391680913 0.037899017333984375 4 0.9957757816612292 18.98174753654921 2028.0 5.52 0.0 - - - - - - - 204.05555555555554 4 18 TSG101 tumor susceptibility gene 101 1029 132 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21159.[MT7]-GVIDLDVFLK[MT7].2y3_1.heavy 703.928 / 551.367 887.0 46.66186650594076 44 20 10 6 8 8.065286629486865 12.398815391680913 0.037899017333984375 4 0.9957757816612292 18.98174753654921 887.0 1.3011198738170346 12.0 - - - - - - - 0.0 1 0 TSG101 tumor susceptibility gene 101 1031 132 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21159.[MT7]-GVIDLDVFLK[MT7].2b6_1.heavy 703.928 / 757.421 1267.0 46.66186650594076 44 20 10 6 8 8.065286629486865 12.398815391680913 0.037899017333984375 4 0.9957757816612292 18.98174753654921 1267.0 2.2977917981072555 2.0 - - - - - - - 211.05555555555554 2 18 TSG101 tumor susceptibility gene 101 1033 132 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21159.[MT7]-GVIDLDVFLK[MT7].2y7_1.heavy 703.928 / 993.574 N/A 46.66186650594076 44 20 10 6 8 8.065286629486865 12.398815391680913 0.037899017333984375 4 0.9957757816612292 18.98174753654921 7034.0 21.673888809099786 0.0 - - - - - - - 248.16666666666666 14 12 TSG101 tumor susceptibility gene 101 1035 133 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21554.[MT7]-SAFLAAHIPLFLYPFLHTVSK[MT7].4b7_1.heavy 665.886 / 842.464 726.0 51.583224296569824 34 11 10 3 10 0.7697749577427018 74.57618695348857 0.06709671020507812 3 0.8628273105089334 3.2933228509030057 726.0 5.082796052631578 0.0 - - - - - - - 0.0 1 0 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1037 133 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21554.[MT7]-SAFLAAHIPLFLYPFLHTVSK[MT7].4b4_1.heavy 665.886 / 563.331 1195.0 51.583224296569824 34 11 10 3 10 0.7697749577427018 74.57618695348857 0.06709671020507812 3 0.8628273105089334 3.2933228509030057 1195.0 7.46875 1.0 - - - - - - - 151.83333333333334 2 18 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1039 133 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21554.[MT7]-SAFLAAHIPLFLYPFLHTVSK[MT7].4b5_1.heavy 665.886 / 634.368 2518.0 51.583224296569824 34 11 10 3 10 0.7697749577427018 74.57618695348857 0.06709671020507812 3 0.8628273105089334 3.2933228509030057 2518.0 19.129242313323573 0.0 - - - - - - - 166.0 5 9 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1041 133 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21554.[MT7]-SAFLAAHIPLFLYPFLHTVSK[MT7].4b6_1.heavy 665.886 / 705.405 3329.0 51.583224296569824 34 11 10 3 10 0.7697749577427018 74.57618695348857 0.06709671020507812 3 0.8628273105089334 3.2933228509030057 3329.0 14.035070422535211 1.0 - - - - - - - 153.66666666666666 6 15 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1043 134 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21415.[MT7]-VYGGEIVLALEHLHK[MT7].4b4_1.heavy 492.29 / 521.284 4595.0 42.82205009460449 43 17 10 6 10 2.799140969252587 29.251011595230867 0.030696868896484375 3 0.9787503820613436 8.451129249451569 4595.0 21.242191659272404 0.0 - - - - - - - 187.27777777777777 9 18 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1045 134 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21415.[MT7]-VYGGEIVLALEHLHK[MT7].4b5_1.heavy 492.29 / 650.327 11823.0 42.82205009460449 43 17 10 6 10 2.799140969252587 29.251011595230867 0.030696868896484375 3 0.9787503820613436 8.451129249451569 11823.0 101.26131987577641 0.0 - - - - - - - 148.16666666666666 23 12 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1047 134 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21415.[MT7]-VYGGEIVLALEHLHK[MT7].4y3_1.heavy 492.29 / 541.358 6249.0 42.82205009460449 43 17 10 6 10 2.799140969252587 29.251011595230867 0.030696868896484375 3 0.9787503820613436 8.451129249451569 6249.0 21.666342058562556 1.0 - - - - - - - 254.6153846153846 12 13 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1049 134 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21415.[MT7]-VYGGEIVLALEHLHK[MT7].4b6_1.heavy 492.29 / 763.411 5268.0 42.82205009460449 43 17 10 6 10 2.799140969252587 29.251011595230867 0.030696868896484375 3 0.9787503820613436 8.451129249451569 5268.0 89.30044295751088 0.0 - - - - - - - 131.92307692307693 10 13 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1051 135 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584824.[MT7]-FILSIAYSPDGK[MT7].3b6_1.heavy 533.639 / 789.499 19666.0 41.85580062866211 48 18 10 10 10 7.7687357273054065 12.872107317091746 0.0 3 0.985262398921054 10.153462117767047 19666.0 101.92992609608821 0.0 - - - - - - - 201.1818181818182 39 11 WDR61 WD repeat domain 61 1053 135 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584824.[MT7]-FILSIAYSPDGK[MT7].3b4_1.heavy 533.639 / 605.378 23118.0 41.85580062866211 48 18 10 10 10 7.7687357273054065 12.872107317091746 0.0 3 0.985262398921054 10.153462117767047 23118.0 72.5425296125276 0.0 - - - - - - - 260.375 46 16 WDR61 WD repeat domain 61 1055 135 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584824.[MT7]-FILSIAYSPDGK[MT7].3b3_1.heavy 533.639 / 518.346 19732.0 41.85580062866211 48 18 10 10 10 7.7687357273054065 12.872107317091746 0.0 3 0.985262398921054 10.153462117767047 19732.0 27.303646198536562 0.0 - - - - - - - 774.9 39 10 WDR61 WD repeat domain 61 1057 135 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584824.[MT7]-FILSIAYSPDGK[MT7].3y4_1.heavy 533.639 / 560.316 23639.0 41.85580062866211 48 18 10 10 10 7.7687357273054065 12.872107317091746 0.0 3 0.985262398921054 10.153462117767047 23639.0 187.78234503806772 0.0 - - - - - - - 207.0909090909091 47 11 WDR61 WD repeat domain 61 1059 136 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21299.[MT7]-LDQWLSDWFQR.2b3_1.heavy 819.413 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD4 phospholipase C, delta 4 1061 136 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21299.[MT7]-LDQWLSDWFQR.2y4_1.heavy 819.413 / 636.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD4 phospholipase C, delta 4 1063 136 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21299.[MT7]-LDQWLSDWFQR.2y8_1.heavy 819.413 / 1137.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD4 phospholipase C, delta 4 1065 136 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21299.[MT7]-LDQWLSDWFQR.2y7_1.heavy 819.413 / 951.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD4 phospholipase C, delta 4 1067 137 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584929.[MT7]-RSDGSTTSTSFILR.3y7_1.heavy 557.964 / 823.467 10556.0 30.376399993896484 43 17 10 6 10 11.622176220247583 8.604240557442669 0.038799285888671875 3 0.9744131640912487 7.698811467648403 10556.0 23.75853657885606 0.0 - - - - - - - 694.5714285714286 21 7 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1069 137 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584929.[MT7]-RSDGSTTSTSFILR.3y6_1.heavy 557.964 / 736.435 7451.0 30.376399993896484 43 17 10 6 10 11.622176220247583 8.604240557442669 0.038799285888671875 3 0.9744131640912487 7.698811467648403 7451.0 17.037713365539453 0.0 - - - - - - - 216.0909090909091 14 11 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1071 137 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584929.[MT7]-RSDGSTTSTSFILR.3b3_1.heavy 557.964 / 503.269 2794.0 30.376399993896484 43 17 10 6 10 11.622176220247583 8.604240557442669 0.038799285888671875 3 0.9744131640912487 7.698811467648403 2794.0 4.097148892706254 1.0 - - - - - - - 698.25 5 8 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1073 137 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584929.[MT7]-RSDGSTTSTSFILR.3y5_1.heavy 557.964 / 635.388 12522.0 30.376399993896484 43 17 10 6 10 11.622176220247583 8.604240557442669 0.038799285888671875 3 0.9744131640912487 7.698811467648403 12522.0 25.906993268573217 0.0 - - - - - - - 241.22222222222223 25 9 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1075 138 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21417.[MT7]-FADDQLIIDFDNFVR.2y6_1.heavy 986.5 / 797.394 406.0 52.4031982421875 43 13 10 10 10 1.5433182804052474 51.345979750426274 0.0 3 0.9265879726572629 4.526738336123817 406.0 8.156565472576402 0.0 - - - - - - - 0.0 0 0 CAPN2 calpain 2, (m/II) large subunit 1077 138 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21417.[MT7]-FADDQLIIDFDNFVR.2y4_1.heavy 986.5 / 535.299 568.0 52.4031982421875 43 13 10 10 10 1.5433182804052474 51.345979750426274 0.0 3 0.9265879726572629 4.526738336123817 568.0 27.014634146341464 0.0 - - - - - - - 0.0 1 0 CAPN2 calpain 2, (m/II) large subunit 1079 138 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21417.[MT7]-FADDQLIIDFDNFVR.2y8_1.heavy 986.5 / 1025.51 893.0 52.4031982421875 43 13 10 10 10 1.5433182804052474 51.345979750426274 0.0 3 0.9265879726572629 4.526738336123817 893.0 25.482097801273582 0.0 - - - - - - - 0.0 1 0 CAPN2 calpain 2, (m/II) large subunit 1081 138 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21417.[MT7]-FADDQLIIDFDNFVR.2b4_1.heavy 986.5 / 593.269 974.0 52.4031982421875 43 13 10 10 10 1.5433182804052474 51.345979750426274 0.0 3 0.9265879726572629 4.526738336123817 974.0 27.35845661735306 0.0 - - - - - - - 0.0 1 0 CAPN2 calpain 2, (m/II) large subunit 1083 139 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544207.[MT7]-LFFIQAC[CAM]GGEQK[MT7].3y6_1.heavy 562.636 / 822.39 8509.0 39.75859832763672 47 17 10 10 10 4.145630590352829 24.121782638498217 0.0 3 0.9725889175359028 7.43707588959053 8509.0 23.732899414065304 0.0 - - - - - - - 198.33333333333334 17 12 CASP9 caspase 9, apoptosis-related cysteine peptidase 1085 139 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544207.[MT7]-LFFIQAC[CAM]GGEQK[MT7].3b4_1.heavy 562.636 / 665.414 17018.0 39.75859832763672 47 17 10 10 10 4.145630590352829 24.121782638498217 0.0 3 0.9725889175359028 7.43707588959053 17018.0 67.21238236445262 0.0 - - - - - - - 196.15384615384616 34 13 CASP9 caspase 9, apoptosis-related cysteine peptidase 1087 139 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544207.[MT7]-LFFIQAC[CAM]GGEQK[MT7].3b3_1.heavy 562.636 / 552.33 29186.0 39.75859832763672 47 17 10 10 10 4.145630590352829 24.121782638498217 0.0 3 0.9725889175359028 7.43707588959053 29186.0 166.42773063197882 0.0 - - - - - - - 620.2857142857143 58 7 CASP9 caspase 9, apoptosis-related cysteine peptidase 1089 139 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544207.[MT7]-LFFIQAC[CAM]GGEQK[MT7].3y5_1.heavy 562.636 / 662.359 22464.0 39.75859832763672 47 17 10 10 10 4.145630590352829 24.121782638498217 0.0 3 0.9725889175359028 7.43707588959053 22464.0 210.1044705882353 0.0 - - - - - - - 198.33333333333334 44 12 CASP9 caspase 9, apoptosis-related cysteine peptidase 1091 140 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21296.[MT7]-AHQITDESLESTR.3y7_1.heavy 544.277 / 821.4 8120.0 23.911100387573242 47 17 10 10 10 3.534344660317042 24.36523100005996 0.0 3 0.9751016494268013 7.8049807792546835 8120.0 87.73349444384507 0.0 - - - - - - - 168.78571428571428 16 14 SNAP23 synaptosomal-associated protein, 23kDa 1093 140 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21296.[MT7]-AHQITDESLESTR.3y6_1.heavy 544.277 / 692.357 11747.0 23.911100387573242 47 17 10 10 10 3.534344660317042 24.36523100005996 0.0 3 0.9751016494268013 7.8049807792546835 11747.0 63.0395707122742 0.0 - - - - - - - 183.625 23 16 SNAP23 synaptosomal-associated protein, 23kDa 1095 140 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21296.[MT7]-AHQITDESLESTR.3y8_1.heavy 544.277 / 936.427 8407.0 23.911100387573242 47 17 10 10 10 3.534344660317042 24.36523100005996 0.0 3 0.9751016494268013 7.8049807792546835 8407.0 77.75260115606936 0.0 - - - - - - - 155.23076923076923 16 13 SNAP23 synaptosomal-associated protein, 23kDa 1097 140 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21296.[MT7]-AHQITDESLESTR.3y9_1.heavy 544.277 / 1037.47 5355.0 23.911100387573242 47 17 10 10 10 3.534344660317042 24.36523100005996 0.0 3 0.9751016494268013 7.8049807792546835 5355.0 110.30211281642416 0.0 - - - - - - - 115.46153846153847 10 13 SNAP23 synaptosomal-associated protein, 23kDa 1099 141 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21550.[MT7]-TDQVIQSLIALVNDPQPEHPLR.3y6_1.heavy 876.481 / 748.41 1961.0 49.874698638916016 46 20 10 6 10 5.705473940277765 17.527027736302585 0.03079986572265625 3 0.9935126305504 15.314153244253589 1961.0 23.21183673469388 0.0 - - - - - - - 153.6818181818182 3 22 UBE2L3 ubiquitin-conjugating enzyme E2L 3 1101 141 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21550.[MT7]-TDQVIQSLIALVNDPQPEHPLR.3b4_1.heavy 876.481 / 588.311 2451.0 49.874698638916016 46 20 10 6 10 5.705473940277765 17.527027736302585 0.03079986572265625 3 0.9935126305504 15.314153244253589 2451.0 24.71008163265306 0.0 - - - - - - - 174.69565217391303 4 23 UBE2L3 ubiquitin-conjugating enzyme E2L 3 1103 141 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21550.[MT7]-TDQVIQSLIALVNDPQPEHPLR.3b5_1.heavy 876.481 / 701.395 1716.0 49.874698638916016 46 20 10 6 10 5.705473940277765 17.527027736302585 0.03079986572265625 3 0.9935126305504 15.314153244253589 1716.0 4.071122448979592 1.0 - - - - - - - 199.92 3 25 UBE2L3 ubiquitin-conjugating enzyme E2L 3 1105 141 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21550.[MT7]-TDQVIQSLIALVNDPQPEHPLR.3y8_1.heavy 876.481 / 973.521 4756.0 49.874698638916016 46 20 10 6 10 5.705473940277765 17.527027736302585 0.03079986572265625 3 0.9935126305504 15.314153244253589 4756.0 95.9827664399093 0.0 - - - - - - - 164.15 9 20 UBE2L3 ubiquitin-conjugating enzyme E2L 3 1107 142 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20858.[MT7]-IPDEELR.2y6_1.heavy 508.281 / 758.368 76935.0 28.506675243377686 43 20 10 3 10 8.539123192227173 11.710804229997063 0.07530021667480469 3 0.997940506882514 27.18990145612289 76935.0 154.62426470588235 0.0 - - - - - - - 336.0 153 2 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 1109 142 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20858.[MT7]-IPDEELR.2y4_1.heavy 508.281 / 546.288 18310.0 28.506675243377686 43 20 10 3 10 8.539123192227173 11.710804229997063 0.07530021667480469 3 0.997940506882514 27.18990145612289 18310.0 34.83869477711439 0.0 - - - - - - - 336.0 36 5 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 1111 142 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20858.[MT7]-IPDEELR.2b5_1.heavy 508.281 / 728.358 4535.0 28.506675243377686 43 20 10 3 10 8.539123192227173 11.710804229997063 0.07530021667480469 3 0.997940506882514 27.18990145612289 4535.0 3.2813793139838032 1.0 - - - - - - - 193.2 9 10 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 1113 142 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20858.[MT7]-IPDEELR.2y5_1.heavy 508.281 / 661.315 4283.0 28.506675243377686 43 20 10 3 10 8.539123192227173 11.710804229997063 0.07530021667480469 3 0.997940506882514 27.18990145612289 4283.0 6.4245 0.0 - - - - - - - 210.0 8 6 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 1115 143 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20855.[MT7]-ALEAAALAH.2b4_1.heavy 505.791 / 529.31 10956.0 29.572499752044678 38 12 10 6 10 0.9786128740116727 61.91649458836755 0.03840065002441406 3 0.8906456875096379 3.69747224938636 10956.0 21.01097056155686 0.0 - - - - - - - 743.9 21 10 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1117 143 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20855.[MT7]-ALEAAALAH.2b6_1.heavy 505.791 / 671.385 35581.0 29.572499752044678 38 12 10 6 10 0.9786128740116727 61.91649458836755 0.03840065002441406 3 0.8906456875096379 3.69747224938636 35581.0 34.087652471016156 0.0 - - - - - - - 1177.7142857142858 71 7 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1119 143 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20855.[MT7]-ALEAAALAH.2b7_1.heavy 505.791 / 784.469 7036.0 29.572499752044678 38 12 10 6 10 0.9786128740116727 61.91649458836755 0.03840065002441406 3 0.8906456875096379 3.69747224938636 7036.0 59.732581974615364 0.0 - - - - - - - 190.11111111111111 14 9 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1121 143 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20855.[MT7]-ALEAAALAH.2b5_1.heavy 505.791 / 600.347 21007.0 29.572499752044678 38 12 10 6 10 0.9786128740116727 61.91649458836755 0.03840065002441406 3 0.8906456875096379 3.69747224938636 21007.0 34.68689624557139 0.0 - - - - - - - 261.4 42 5 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1123 144 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584430.[MT7]-DSLDIEVK[MT7].2y4_1.heavy 603.845 / 632.41 14220.0 31.43375015258789 38 13 10 5 10 1.3282407739727096 48.53004925253035 0.043701171875 3 0.9016678151780348 3.9029214653282738 14220.0 21.391554933507184 0.0 - - - - - - - 246.08333333333334 28 12 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 1125 144 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584430.[MT7]-DSLDIEVK[MT7].2y5_1.heavy 603.845 / 747.437 3828.0 31.43375015258789 38 13 10 5 10 1.3282407739727096 48.53004925253035 0.043701171875 3 0.9016678151780348 3.9029214653282738 3828.0 8.417526749852973 0.0 - - - - - - - 179.0 7 11 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 1127 144 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584430.[MT7]-DSLDIEVK[MT7].2b4_1.heavy 603.845 / 575.279 13892.0 31.43375015258789 38 13 10 5 10 1.3282407739727096 48.53004925253035 0.043701171875 3 0.9016678151780348 3.9029214653282738 13892.0 24.85959768788863 1.0 - - - - - - - 697.25 27 8 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 1129 144 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584430.[MT7]-DSLDIEVK[MT7].2y3_1.heavy 603.845 / 519.326 5469.0 31.43375015258789 38 13 10 5 10 1.3282407739727096 48.53004925253035 0.043701171875 3 0.9016678151780348 3.9029214653282738 5469.0 2.401457225354049 0.0 - - - - - - - 259.75 10 8 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 1131 145 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20750.[MT7]-TEPTQR.2y4_1.heavy 438.239 / 501.278 7914.0 15.9822998046875 45 15 10 10 10 5.983767000030875 16.711880659705503 0.0 2 0.9577628845983331 5.9837667469797475 7914.0 35.31757048625299 0.0 - - - - - - - 262.4 15 20 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1133 145 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20750.[MT7]-TEPTQR.2b3_1.heavy 438.239 / 472.252 N/A 15.9822998046875 45 15 10 10 10 5.983767000030875 16.711880659705503 0.0 2 0.9577628845983331 5.9837667469797475 216.0 0.0 23.0 - - - - - - - 0.0 0 0 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1135 145 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20750.[MT7]-TEPTQR.2y5_1.heavy 438.239 / 630.321 N/A 15.9822998046875 45 15 10 10 10 5.983767000030875 16.711880659705503 0.0 2 0.9577628845983331 5.9837667469797475 401.0 2.6000775775775775 2.0 - - - - - - - 0.0 1 0 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1137 145 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20750.[MT7]-TEPTQR.2b4_1.heavy 438.239 / 573.3 2947.0 15.9822998046875 45 15 10 10 10 5.983767000030875 16.711880659705503 0.0 2 0.9577628845983331 5.9837667469797475 2947.0 13.786434094849875 0.0 - - - - - - - 250.7391304347826 5 23 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1139 146 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585550.[MT7]-RAEVQELFESFSADGQK[MT7].3y6_1.heavy 743.718 / 749.391 23839.0 40.321001052856445 37 11 10 6 10 0.9055076167549447 67.24607677492003 0.034801483154296875 3 0.8743700077448499 3.4447721388758934 23839.0 111.89734693877551 0.0 - - - - - - - 215.5 47 16 PLCD4 phospholipase C, delta 4 1141 146 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585550.[MT7]-RAEVQELFESFSADGQK[MT7].3b6_1.heavy 743.718 / 857.46 15840.0 40.321001052856445 37 11 10 6 10 0.9055076167549447 67.24607677492003 0.034801483154296875 3 0.8743700077448499 3.4447721388758934 15840.0 51.22723404255319 0.0 - - - - - - - 313.46153846153845 31 13 PLCD4 phospholipase C, delta 4 1143 146 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585550.[MT7]-RAEVQELFESFSADGQK[MT7].3y4_1.heavy 743.718 / 591.322 13096.0 40.321001052856445 37 11 10 6 10 0.9055076167549447 67.24607677492003 0.034801483154296875 3 0.8743700077448499 3.4447721388758934 13096.0 34.82043695559046 0.0 - - - - - - - 266.6 26 10 PLCD4 phospholipase C, delta 4 1145 146 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585550.[MT7]-RAEVQELFESFSADGQK[MT7].3b7_1.heavy 743.718 / 970.544 13644.0 40.321001052856445 37 11 10 6 10 0.9055076167549447 67.24607677492003 0.034801483154296875 3 0.8743700077448499 3.4447721388758934 13644.0 53.70510638297873 0.0 - - - - - - - 352.625 27 16 PLCD4 phospholipase C, delta 4 1147 147 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21555.[MT7]-IMDATNILVSPLVYLYPDIPK[MT7].3b6_1.heavy 888.504 / 790.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1149 147 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21555.[MT7]-IMDATNILVSPLVYLYPDIPK[MT7].3b3_1.heavy 888.504 / 504.261 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1151 147 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21555.[MT7]-IMDATNILVSPLVYLYPDIPK[MT7].3y5_1.heavy 888.504 / 713.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1153 147 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21555.[MT7]-IMDATNILVSPLVYLYPDIPK[MT7].3b7_1.heavy 888.504 / 903.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1155 148 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20852.[MT7]-FQSMPVR.2y5_1.heavy 504.774 / 589.313 2846.0 28.077374935150146 36 13 10 3 10 1.295770524787441 47.935096365926896 0.07710075378417969 3 0.9283212816190656 4.5818232868851165 2846.0 15.579077922077921 0.0 - - - - - - - 221.94117647058823 5 17 CDC25B cell division cycle 25 homolog B (S. pombe) 1157 148 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20852.[MT7]-FQSMPVR.2b4_1.heavy 504.774 / 638.309 2154.0 28.077374935150146 36 13 10 3 10 1.295770524787441 47.935096365926896 0.07710075378417969 3 0.9283212816190656 4.5818232868851165 2154.0 2.2379220779220783 0.0 - - - - - - - 634.25 4 8 CDC25B cell division cycle 25 homolog B (S. pombe) 1159 148 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20852.[MT7]-FQSMPVR.2y3_1.heavy 504.774 / 371.24 846.0 28.077374935150146 36 13 10 3 10 1.295770524787441 47.935096365926896 0.07710075378417969 3 0.9283212816190656 4.5818232868851165 846.0 1.0998 30.0 - - - - - - - 717.6666666666666 3 18 CDC25B cell division cycle 25 homolog B (S. pombe) 1161 148 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20852.[MT7]-FQSMPVR.2y6_1.heavy 504.774 / 717.371 2538.0 28.077374935150146 36 13 10 3 10 1.295770524787441 47.935096365926896 0.07710075378417969 3 0.9283212816190656 4.5818232868851165 2538.0 15.271948051948051 0.0 - - - - - - - 205.27777777777777 5 18 CDC25B cell division cycle 25 homolog B (S. pombe) 1163 149 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21164.[MT7]-IYHPNIDEK[MT7].3y3_1.heavy 472.929 / 535.284 36212.0 25.76460075378418 50 20 10 10 10 9.392213085946233 10.647117892760772 0.0 3 0.992813608340595 14.549447471794535 36212.0 106.14603571136047 0.0 - - - - - - - 733.8 72 10 UBE2L3 ubiquitin-conjugating enzyme E2L 3 1165 149 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21164.[MT7]-IYHPNIDEK[MT7].3y4_1.heavy 472.929 / 648.369 16662.0 25.76460075378418 50 20 10 10 10 9.392213085946233 10.647117892760772 0.0 3 0.992813608340595 14.549447471794535 16662.0 39.19552542518626 0.0 - - - - - - - 705.4545454545455 33 11 UBE2L3 ubiquitin-conjugating enzyme E2L 3 1167 149 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21164.[MT7]-IYHPNIDEK[MT7].3b3_1.heavy 472.929 / 558.316 25866.0 25.76460075378418 50 20 10 10 10 9.392213085946233 10.647117892760772 0.0 3 0.992813608340595 14.549447471794535 25866.0 54.29036108847971 0.0 - - - - - - - 721.75 51 12 UBE2L3 ubiquitin-conjugating enzyme E2L 3 1169 149 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21164.[MT7]-IYHPNIDEK[MT7].3y5_1.heavy 472.929 / 762.411 11850.0 25.76460075378418 50 20 10 10 10 9.392213085946233 10.647117892760772 0.0 3 0.992813608340595 14.549447471794535 11850.0 83.58921161825727 0.0 - - - - - - - 153.66666666666666 23 18 UBE2L3 ubiquitin-conjugating enzyme E2L 3 1171 150 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21165.[MT7]-ELLESLPLSK[MT7].3y3_1.heavy 472.957 / 491.331 22464.0 39.63990020751953 46 18 10 10 8 4.3309229916323995 23.089766360012852 0.0 4 0.9828763012154604 9.417635939858648 22464.0 41.92583994559057 0.0 - - - - - - - 664.8571428571429 44 7 CDC16 cell division cycle 16 homolog (S. cerevisiae) 1173 150 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21165.[MT7]-ELLESLPLSK[MT7].3b4_1.heavy 472.957 / 629.363 18693.0 39.63990020751953 46 18 10 10 8 4.3309229916323995 23.089766360012852 0.0 4 0.9828763012154604 9.417635939858648 18693.0 174.95600881742737 0.0 - - - - - - - 208.4 37 15 CDC16 cell division cycle 16 homolog (S. cerevisiae) 1175 150 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21165.[MT7]-ELLESLPLSK[MT7].3b3_1.heavy 472.957 / 500.32 19816.0 39.63990020751953 46 18 10 10 8 4.3309229916323995 23.089766360012852 0.0 4 0.9828763012154604 9.417635939858648 19816.0 36.56871533409199 1.0 - - - - - - - 247.16666666666666 46 12 CDC16 cell division cycle 16 homolog (S. cerevisiae) 1177 150 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21165.[MT7]-ELLESLPLSK[MT7].3y4_1.heavy 472.957 / 588.384 40434.0 39.63990020751953 46 18 10 10 8 4.3309229916323995 23.089766360012852 0.0 4 0.9828763012154604 9.417635939858648 40434.0 179.34842913506256 0.0 - - - - - - - 349.8181818181818 80 11 CDC16 cell division cycle 16 homolog (S. cerevisiae) 1179 151 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 208536.0 37.95199966430664 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 208536.0 84.20273108613287 0.0 - - - - - - - 284.44444444444446 417 9 1181 151 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 528851.0 37.95199966430664 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 528851.0 150.93943106301504 0.0 - - - - - - - 213.45454545454547 1057 11 1183 151 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 470300.0 37.95199966430664 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 470300.0 81.83040091225148 1.0 - - - - - - - 722.7777777777778 1026 9 1185 152 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21022.[MT7]-TRPFEYLR.3y6_1.heavy 409.232 / 824.43 2837.0 30.256450653076172 36 11 10 5 10 2.1378270184609556 40.37124619788398 0.04109954833984375 3 0.8690351415412513 3.3723070395329895 2837.0 19.926547619047618 0.0 - - - - - - - 180.0 5 7 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1187 152 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21022.[MT7]-TRPFEYLR.3y3_1.heavy 409.232 / 451.266 50127.0 30.256450653076172 36 11 10 5 10 2.1378270184609556 40.37124619788398 0.04109954833984375 3 0.8690351415412513 3.3723070395329895 50127.0 126.49458084251648 0.0 - - - - - - - 725.2 100 10 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1189 152 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21022.[MT7]-TRPFEYLR.3y4_1.heavy 409.232 / 580.309 38357.0 30.256450653076172 36 11 10 5 10 2.1378270184609556 40.37124619788398 0.04109954833984375 3 0.8690351415412513 3.3723070395329895 38357.0 191.66323174603176 0.0 - - - - - - - 236.25 76 8 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1191 152 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21022.[MT7]-TRPFEYLR.3y5_1.heavy 409.232 / 727.377 10299.0 30.256450653076172 36 11 10 5 10 2.1378270184609556 40.37124619788398 0.04109954833984375 3 0.8690351415412513 3.3723070395329895 10299.0 92.691 0.0 - - - - - - - 162.27272727272728 20 11 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1193 153 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543612.[MT7]-DESANQEEPEAR.3y6_1.heavy 506.898 / 730.337 2798.0 17.15215015411377 39 13 10 6 10 1.9157035392412345 52.20014368173464 0.037799835205078125 3 0.9222869364201498 4.398067326281884 2798.0 35.917981732144824 0.0 - - - - - - - 147.26315789473685 5 19 VASP vasodilator-stimulated phosphoprotein 1195 153 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543612.[MT7]-DESANQEEPEAR.3b4_1.heavy 506.898 / 547.248 9832.0 17.15215015411377 39 13 10 6 10 1.9157035392412345 52.20014368173464 0.037799835205078125 3 0.9222869364201498 4.398067326281884 9832.0 50.79212012673922 0.0 - - - - - - - 225.76190476190476 19 21 VASP vasodilator-stimulated phosphoprotein 1197 153 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543612.[MT7]-DESANQEEPEAR.3b5_1.heavy 506.898 / 661.291 3031.0 17.15215015411377 39 13 10 6 10 1.9157035392412345 52.20014368173464 0.037799835205078125 3 0.9222869364201498 4.398067326281884 3031.0 37.52189137027847 0.0 - - - - - - - 114.95454545454545 6 22 VASP vasodilator-stimulated phosphoprotein 1199 153 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543612.[MT7]-DESANQEEPEAR.3y5_1.heavy 506.898 / 601.294 5091.0 17.15215015411377 39 13 10 6 10 1.9157035392412345 52.20014368173464 0.037799835205078125 3 0.9222869364201498 4.398067326281884 5091.0 24.536660009348573 0.0 - - - - - - - 222.94736842105263 10 19 VASP vasodilator-stimulated phosphoprotein 1201 154 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21424.[MT7]-ENSETVVTGSLDDLVK[MT7].3b6_1.heavy 665.356 / 804.386 13028.0 38.51325035095215 43 17 10 6 10 2.692703739308856 31.633964119845018 0.037097930908203125 3 0.9737524817935599 7.60087714762675 13028.0 30.112473734479465 0.0 - - - - - - - 691.0 26 7 WDR61 WD repeat domain 61 1203 154 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21424.[MT7]-ENSETVVTGSLDDLVK[MT7].3b4_1.heavy 665.356 / 604.269 9585.0 38.51325035095215 43 17 10 6 10 2.692703739308856 31.633964119845018 0.037097930908203125 3 0.9737524817935599 7.60087714762675 9585.0 32.66126693461765 0.0 - - - - - - - 744.375 19 8 WDR61 WD repeat domain 61 1205 154 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21424.[MT7]-ENSETVVTGSLDDLVK[MT7].3b5_1.heavy 665.356 / 705.317 17774.0 38.51325035095215 43 17 10 6 10 2.692703739308856 31.633964119845018 0.037097930908203125 3 0.9737524817935599 7.60087714762675 17774.0 63.151135576256834 0.0 - - - - - - - 757.7142857142857 35 7 WDR61 WD repeat domain 61 1207 154 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21424.[MT7]-ENSETVVTGSLDDLVK[MT7].3y5_1.heavy 665.356 / 733.421 14796.0 38.51325035095215 43 17 10 6 10 2.692703739308856 31.633964119845018 0.037097930908203125 3 0.9737524817935599 7.60087714762675 14796.0 27.68886386898669 0.0 - - - - - - - 637.8571428571429 29 7 WDR61 WD repeat domain 61 1209 155 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21561.[MT7]-LFAQLAGEDAEISAFELQTILRR.3b4_1.heavy 912.5 / 604.357 4640.0 53.6776008605957 42 12 10 10 10 2.4445880280278653 32.21182461473031 0.0 3 0.8833836458031296 3.578235376637949 4640.0 70.50293431553101 0.0 - - - - - - - 107.1875 9 16 CAPN2 calpain 2, (m/II) large subunit 1211 155 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21561.[MT7]-LFAQLAGEDAEISAFELQTILRR.3b5_1.heavy 912.5 / 717.442 1778.0 53.6776008605957 42 12 10 10 10 2.4445880280278653 32.21182461473031 0.0 3 0.8833836458031296 3.578235376637949 1778.0 24.40991297684856 0.0 - - - - - - - 102.33333333333333 3 15 CAPN2 calpain 2, (m/II) large subunit 1213 155 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21561.[MT7]-LFAQLAGEDAEISAFELQTILRR.3y14_2.heavy 912.5 / 823.965 1778.0 53.6776008605957 42 12 10 10 10 2.4445880280278653 32.21182461473031 0.0 3 0.8833836458031296 3.578235376637949 1778.0 42.474444444444444 0.0 - - - - - - - 99.3 3 10 CAPN2 calpain 2, (m/II) large subunit 1215 155 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21561.[MT7]-LFAQLAGEDAEISAFELQTILRR.3y19_2.heavy 912.5 / 1066.57 3134.0 53.6776008605957 42 12 10 10 10 2.4445880280278653 32.21182461473031 0.0 3 0.8833836458031296 3.578235376637949 3134.0 64.76933333333334 0.0 - - - - - - - 98.55555555555556 6 18 CAPN2 calpain 2, (m/II) large subunit 1217 156 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545054.[MT7]-GSYAIPGDC[CAM]GPPLSDLLK[MT7].3b4_1.heavy 716.713 / 523.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - STK11 serine/threonine kinase 11 1219 156 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545054.[MT7]-GSYAIPGDC[CAM]GPPLSDLLK[MT7].3b5_1.heavy 716.713 / 636.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - STK11 serine/threonine kinase 11 1221 156 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545054.[MT7]-GSYAIPGDC[CAM]GPPLSDLLK[MT7].3y8_1.heavy 716.713 / 1026.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - STK11 serine/threonine kinase 11 1223 156 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545054.[MT7]-GSYAIPGDC[CAM]GPPLSDLLK[MT7].3y5_1.heavy 716.713 / 719.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - STK11 serine/threonine kinase 11 1225 157 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541514.[MT7]-C[CAM]LWEESR.2y5_1.heavy 562.27 / 706.315 3447.0 30.53619956970215 41 16 10 5 10 2.5961942789282126 38.51791863638303 0.040599822998046875 3 0.9672093967581228 6.796631684066467 3447.0 10.191317961769512 0.0 - - - - - - - 253.58333333333334 6 12 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1227 157 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541514.[MT7]-C[CAM]LWEESR.2b4_1.heavy 562.27 / 733.346 2231.0 30.53619956970215 41 16 10 5 10 2.5961942789282126 38.51791863638303 0.040599822998046875 3 0.9672093967581228 6.796631684066467 2231.0 11.213419030129906 0.0 - - - - - - - 182.3 4 10 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1229 157 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541514.[MT7]-C[CAM]LWEESR.2y6_1.heavy 562.27 / 819.399 4157.0 30.53619956970215 41 16 10 5 10 2.5961942789282126 38.51791863638303 0.040599822998046875 3 0.9672093967581228 6.796631684066467 4157.0 44.420676486367846 0.0 - - - - - - - 192.6 8 10 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1231 157 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541514.[MT7]-C[CAM]LWEESR.2b5_1.heavy 562.27 / 862.389 3346.0 30.53619956970215 41 16 10 5 10 2.5961942789282126 38.51791863638303 0.040599822998046875 3 0.9672093967581228 6.796631684066467 3346.0 21.42758620689655 0.0 - - - - - - - 179.3846153846154 6 13 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1233 158 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21569.[MT7]-K[MT7]WNAVALWAWDIVVDNC[CAM]AIC[CAM]R.4y8_1.heavy 712.871 / 1007.44 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBX1 ring-box 1, E3 ubiquitin protein ligase 1235 158 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21569.[MT7]-K[MT7]WNAVALWAWDIVVDNC[CAM]AIC[CAM]R.4b5_1.heavy 712.871 / 887.534 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBX1 ring-box 1, E3 ubiquitin protein ligase 1237 158 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21569.[MT7]-K[MT7]WNAVALWAWDIVVDNC[CAM]AIC[CAM]R.4b3_1.heavy 712.871 / 717.429 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBX1 ring-box 1, E3 ubiquitin protein ligase 1239 158 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21569.[MT7]-K[MT7]WNAVALWAWDIVVDNC[CAM]AIC[CAM]R.4b6_1.heavy 712.871 / 958.571 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBX1 ring-box 1, E3 ubiquitin protein ligase 1241 159 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545192.[MT7]-NDC[CAM]FQEFFQLNYLQHLSLSR.3y6_1.heavy 901.775 / 712.41 1473.0 47.358551025390625 42 16 10 6 10 10.577670939287193 9.453876999385914 0.039398193359375 3 0.9694158541971786 7.038839389585235 1473.0 3.708571428571428 1.0 - - - - - - - 218.5 2 16 SKP2 S-phase kinase-associated protein 2 (p45) 1243 159 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545192.[MT7]-NDC[CAM]FQEFFQLNYLQHLSLSR.3b6_1.heavy 901.775 / 938.379 2822.0 47.358551025390625 42 16 10 6 10 10.577670939287193 9.453876999385914 0.039398193359375 3 0.9694158541971786 7.038839389585235 2822.0 36.70894308943089 0.0 - - - - - - - 162.5 5 20 SKP2 S-phase kinase-associated protein 2 (p45) 1245 159 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545192.[MT7]-NDC[CAM]FQEFFQLNYLQHLSLSR.3b5_1.heavy 901.775 / 809.337 1043.0 47.358551025390625 42 16 10 6 10 10.577670939287193 9.453876999385914 0.039398193359375 3 0.9694158541971786 7.038839389585235 1043.0 7.263407095312279 0.0 - - - - - - - 177.16666666666666 2 18 SKP2 S-phase kinase-associated protein 2 (p45) 1247 159 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545192.[MT7]-NDC[CAM]FQEFFQLNYLQHLSLSR.3b3_1.heavy 901.775 / 534.21 1350.0 47.358551025390625 42 16 10 6 10 10.577670939287193 9.453876999385914 0.039398193359375 3 0.9694158541971786 7.038839389585235 1350.0 10.083673469387755 0.0 - - - - - - - 184.0 2 20 SKP2 S-phase kinase-associated protein 2 (p45) 1249 160 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21421.[MT7]-SVTPPEEQQEAEEPK[MT7].3y6_1.heavy 662.668 / 846.432 2890.0 23.15845012664795 44 18 10 6 10 5.794272777623973 17.258421175160223 0.037799835205078125 3 0.9889558768988653 11.73265332717942 2890.0 50.76600079507057 0.0 - - - - - - - 160.1 5 10 CDC25B cell division cycle 25 homolog B (S. pombe) 1251 160 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21421.[MT7]-SVTPPEEQQEAEEPK[MT7].3b6_1.heavy 662.668 / 755.406 3974.0 23.15845012664795 44 18 10 6 10 5.794272777623973 17.258421175160223 0.037799835205078125 3 0.9889558768988653 11.73265332717942 3974.0 22.544309177017247 0.0 - - - - - - - 193.5 7 12 CDC25B cell division cycle 25 homolog B (S. pombe) 1253 160 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21421.[MT7]-SVTPPEEQQEAEEPK[MT7].3b7_1.heavy 662.668 / 884.448 2477.0 23.15845012664795 44 18 10 6 10 5.794272777623973 17.258421175160223 0.037799835205078125 3 0.9889558768988653 11.73265332717942 2477.0 24.078022549326654 1.0 - - - - - - - 178.93333333333334 4 15 CDC25B cell division cycle 25 homolog B (S. pombe) 1255 160 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21421.[MT7]-SVTPPEEQQEAEEPK[MT7].3y5_1.heavy 662.668 / 717.39 5522.0 23.15845012664795 44 18 10 6 10 5.794272777623973 17.258421175160223 0.037799835205078125 3 0.9889558768988653 11.73265332717942 5522.0 13.766759002770083 0.0 - - - - - - - 182.9090909090909 11 11 CDC25B cell division cycle 25 homolog B (S. pombe) 1257 161 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21135.[MT7]-SK[MT7]PVAFAVK[MT7].3b4_1.heavy 460.298 / 700.46 5468.0 26.950249671936035 41 15 10 6 10 7.2571986738666805 13.779421577653927 0.030698776245117188 3 0.9562134175783573 5.876169015433319 5468.0 12.533478958954401 0.0 - - - - - - - 289.8636363636364 10 22 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1259 161 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21135.[MT7]-SK[MT7]PVAFAVK[MT7].3b5_1.heavy 460.298 / 771.497 4978.0 26.950249671936035 41 15 10 6 10 7.2571986738666805 13.779421577653927 0.030698776245117188 3 0.9562134175783573 5.876169015433319 4978.0 16.593333333333334 1.0 - - - - - - - 163.42857142857142 9 21 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1261 161 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21135.[MT7]-SK[MT7]PVAFAVK[MT7].3y4_1.heavy 460.298 / 608.389 13741.0 26.950249671936035 41 15 10 6 10 7.2571986738666805 13.779421577653927 0.030698776245117188 3 0.9562134175783573 5.876169015433319 13741.0 25.84314353583255 0.0 - - - - - - - 731.0 27 14 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1263 161 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21135.[MT7]-SK[MT7]PVAFAVK[MT7].3y5_1.heavy 460.298 / 679.426 8693.0 26.950249671936035 41 15 10 6 10 7.2571986738666805 13.779421577653927 0.030698776245117188 3 0.9562134175783573 5.876169015433319 8693.0 25.974598498198397 0.0 - - - - - - - 216.95238095238096 17 21 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1265 162 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21038.[MT7]-LC[CAM]DFGFAK[MT7].2y4_1.heavy 623.331 / 566.342 1514.0 36.91350173950195 34 8 10 10 6 2.4684409312261786 40.51140083401785 0.0 5 0.7819163534074078 2.593116972137295 1514.0 1.8193991416309014 4.0 - - - - - - - 286.53846153846155 4 13 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1267 162 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21038.[MT7]-LC[CAM]DFGFAK[MT7].2b3_1.heavy 623.331 / 533.251 6289.0 36.91350173950195 34 8 10 10 6 2.4684409312261786 40.51140083401785 0.0 5 0.7819163534074078 2.593116972137295 6289.0 10.577810827304447 1.0 - - - - - - - 349.375 12 8 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1269 162 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21038.[MT7]-LC[CAM]DFGFAK[MT7].2y5_1.heavy 623.331 / 713.41 1281.0 36.91350173950195 34 8 10 10 6 2.4684409312261786 40.51140083401785 0.0 5 0.7819163534074078 2.593116972137295 1281.0 3.455793991416309 1.0 - - - - - - - 213.25 3 12 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1271 162 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21038.[MT7]-LC[CAM]DFGFAK[MT7].2y7_1.heavy 623.331 / 988.468 1863.0 36.91350173950195 34 8 10 10 6 2.4684409312261786 40.51140083401785 0.0 5 0.7819163534074078 2.593116972137295 1863.0 8.162271157652203 1.0 - - - - - - - 271.5833333333333 8 12 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1273 163 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21131.[MT7]-K[MT7]PPPNLFK[MT7].3y6_1.heavy 458.294 / 859.516 1296.0 27.793500423431396 34 14 6 6 8 1.6788812990134223 42.227477569515145 0.03199958801269531 4 0.9477920618370956 5.377572580601259 1296.0 20.61059986210067 0.0 - - - - - - - 175.76923076923077 2 13 CAPN2 calpain 2, (m/II) large subunit 1275 163 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21131.[MT7]-K[MT7]PPPNLFK[MT7].3y3_1.heavy 458.294 / 551.367 4725.0 27.793500423431396 34 14 6 6 8 1.6788812990134223 42.227477569515145 0.03199958801269531 4 0.9477920618370956 5.377572580601259 4725.0 2.6800074929108018 1.0 - - - - - - - 830.8 14 10 CAPN2 calpain 2, (m/II) large subunit 1277 163 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21131.[MT7]-K[MT7]PPPNLFK[MT7].3y4_1.heavy 458.294 / 665.41 3125.0 27.793500423431396 34 14 6 6 8 1.6788812990134223 42.227477569515145 0.03199958801269531 4 0.9477920618370956 5.377572580601259 3125.0 2.0491803278688523 1.0 - - - - - - - 268.7368421052632 6 19 CAPN2 calpain 2, (m/II) large subunit 1279 163 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21131.[MT7]-K[MT7]PPPNLFK[MT7].3y5_1.heavy 458.294 / 762.463 3125.0 27.793500423431396 34 14 6 6 8 1.6788812990134223 42.227477569515145 0.03199958801269531 4 0.9477920618370956 5.377572580601259 3125.0 43.57204486626402 0.0 - - - - - - - 240.57894736842104 6 19 CAPN2 calpain 2, (m/II) large subunit 1281 164 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585163.[MT7]-IYQWINELSSPETR.3y7_1.heavy 627.327 / 789.41 16078.0 45.69850158691406 45 15 10 10 10 2.282695362107754 34.61442120518411 0.0 3 0.9554873809932164 5.827691054167073 16078.0 370.0492063492063 0.0 - - - - - - - 151.2 32 10 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1283 164 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585163.[MT7]-IYQWINELSSPETR.3y6_1.heavy 627.327 / 676.326 53531.0 45.69850158691406 45 15 10 10 10 2.282695362107754 34.61442120518411 0.0 3 0.9554873809932164 5.827691054167073 53531.0 303.34233333333333 0.0 - - - - - - - 237.46153846153845 107 13 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1285 164 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585163.[MT7]-IYQWINELSSPETR.3b4_1.heavy 627.327 / 735.395 26860.0 45.69850158691406 45 15 10 10 10 2.282695362107754 34.61442120518411 0.0 3 0.9554873809932164 5.827691054167073 26860.0 115.70643738977071 0.0 - - - - - - - 194.25 53 12 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1287 164 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585163.[MT7]-IYQWINELSSPETR.3b3_1.heavy 627.327 / 549.315 34237.0 45.69850158691406 45 15 10 10 10 2.282695362107754 34.61442120518411 0.0 3 0.9554873809932164 5.827691054167073 34237.0 104.82844512195122 0.0 - - - - - - - 194.72727272727272 68 11 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1289 165 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21030.[MT7]-NAIIDDYK[MT7].2y4_1.heavy 620.345 / 684.332 2523.0 29.721449851989746 43 18 10 5 10 2.384180609598929 33.397002835079725 0.04269981384277344 3 0.9801768856313159 8.75097377598685 2523.0 19.987253855497073 0.0 - - - - - - - 146.9090909090909 5 11 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1291 165 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21030.[MT7]-NAIIDDYK[MT7].2y5_1.heavy 620.345 / 797.416 4037.0 29.721449851989746 43 18 10 5 10 2.384180609598929 33.397002835079725 0.04269981384277344 3 0.9801768856313159 8.75097377598685 4037.0 49.16346534653465 0.0 - - - - - - - 222.2 8 10 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1293 165 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21030.[MT7]-NAIIDDYK[MT7].2b6_1.heavy 620.345 / 786.411 3431.0 29.721449851989746 43 18 10 5 10 2.384180609598929 33.397002835079725 0.04269981384277344 3 0.9801768856313159 8.75097377598685 3431.0 34.64970297029703 0.0 - - - - - - - 185.16666666666666 6 12 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1295 165 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21030.[MT7]-NAIIDDYK[MT7].2y3_1.heavy 620.345 / 569.305 2624.0 29.721449851989746 43 18 10 5 10 2.384180609598929 33.397002835079725 0.04269981384277344 3 0.9801768856313159 8.75097377598685 2624.0 7.811379537953796 0.0 - - - - - - - 231.7058823529412 5 17 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1297 166 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544885.[MT7]-LASDESLWQTLDLTGK[MT7].3b6_1.heavy 689.04 / 747.364 25662.0 45.07264995574951 40 14 10 6 10 1.9524608422813439 35.63322048351097 0.033000946044921875 3 0.9335485629525687 4.760749997599707 25662.0 44.60956989247312 0.0 - - - - - - - 227.33333333333334 51 18 SKP2 S-phase kinase-associated protein 2 (p45) 1299 166 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544885.[MT7]-LASDESLWQTLDLTGK[MT7].3b4_1.heavy 689.04 / 531.289 17542.0 45.07264995574951 40 14 10 6 10 1.9524608422813439 35.63322048351097 0.033000946044921875 3 0.9335485629525687 4.760749997599707 17542.0 26.504233074078797 0.0 - - - - - - - 668.2222222222222 35 9 SKP2 S-phase kinase-associated protein 2 (p45) 1301 166 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544885.[MT7]-LASDESLWQTLDLTGK[MT7].3b7_1.heavy 689.04 / 860.448 27646.0 45.07264995574951 40 14 10 6 10 1.9524608422813439 35.63322048351097 0.033000946044921875 3 0.9335485629525687 4.760749997599707 27646.0 53.904745519713266 0.0 - - - - - - - 237.05882352941177 55 17 SKP2 S-phase kinase-associated protein 2 (p45) 1303 166 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544885.[MT7]-LASDESLWQTLDLTGK[MT7].3y5_1.heavy 689.04 / 677.395 35208.0 45.07264995574951 40 14 10 6 10 1.9524608422813439 35.63322048351097 0.033000946044921875 3 0.9335485629525687 4.760749997599707 35208.0 69.15466989294205 0.0 - - - - - - - 289.3333333333333 70 12 SKP2 S-phase kinase-associated protein 2 (p45) 1305 167 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 530179.0 40.774200439453125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 530179.0 280.6645341877544 0.0 - - - - - - - 288.0 1060 1 1307 167 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 823576.0 40.774200439453125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 823576.0 285.8193226142825 0.0 - - - - - - - 936.0 1647 1 1309 167 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 1027230.0 40.774200439453125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1027230.0 1131.7294011096958 0.0 - - - - - - - 504.0 2054 1 1311 168 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21035.[MT7]-RLDFDYK[MT7].3y3_1.heavy 415.567 / 569.305 26850.0 29.341999053955078 31 11 2 10 8 0.955935125139688 69.73973956331487 0.0 4 0.876658935644607 3.477283874465814 26850.0 61.500440737104555 1.0 - - - - - - - 767.0 156 9 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 1313 168 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21035.[MT7]-RLDFDYK[MT7].3b5_1.heavy 415.567 / 791.417 13329.0 29.341999053955078 31 11 2 10 8 0.955935125139688 69.73973956331487 0.0 4 0.876658935644607 3.477283874465814 13329.0 149.9976278705637 0.0 - - - - - - - 211.1 26 10 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 1315 168 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21035.[MT7]-RLDFDYK[MT7].3y4_1.heavy 415.567 / 716.374 19466.0 29.341999053955078 31 11 2 10 8 0.955935125139688 69.73973956331487 0.0 4 0.876658935644607 3.477283874465814 19466.0 102.23029513888889 0.0 - - - - - - - 192.0 38 15 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 1317 168 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21035.[MT7]-RLDFDYK[MT7].3b3_1.heavy 415.567 / 529.321 15055.0 29.341999053955078 31 11 2 10 8 0.955935125139688 69.73973956331487 0.0 4 0.876658935644607 3.477283874465814 15055.0 53.69383038485414 0.0 - - - - - - - 767.0 30 7 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 1319 169 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544887.[MT7]-SIGEAIQYLHSINIAHR.4y8_1.heavy 517.287 / 947.517 4049.0 41.1864013671875 48 18 10 10 10 3.603986857829049 27.747049016776238 0.0 3 0.9831216063274215 9.486020638434159 4049.0 65.22439355564936 0.0 - - - - - - - 160.25 8 12 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1321 169 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544887.[MT7]-SIGEAIQYLHSINIAHR.4b4_1.heavy 517.287 / 531.289 15784.0 41.1864013671875 48 18 10 10 10 3.603986857829049 27.747049016776238 0.0 3 0.9831216063274215 9.486020638434159 15784.0 41.12012944983819 0.0 - - - - - - - 678.7777777777778 31 9 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1323 169 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544887.[MT7]-SIGEAIQYLHSINIAHR.4b5_1.heavy 517.287 / 602.327 18324.0 41.1864013671875 48 18 10 10 10 3.603986857829049 27.747049016776238 0.0 3 0.9831216063274215 9.486020638434159 18324.0 52.14941209771009 0.0 - - - - - - - 236.0 36 16 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1325 169 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544887.[MT7]-SIGEAIQYLHSINIAHR.4y7_1.heavy 517.287 / 810.458 6657.0 41.1864013671875 48 18 10 10 10 3.603986857829049 27.747049016776238 0.0 3 0.9831216063274215 9.486020638434159 6657.0 51.79920629296294 0.0 - - - - - - - 171.71428571428572 13 14 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1327 170 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545087.[MT7]-NLGSTALSPYPTAISGLQSQR.3y7_1.heavy 769.08 / 775.406 48874.0 37.445499420166016 50 20 10 10 10 18.11568801364741 5.520077400574863 0.0 3 0.9982922870023959 29.860226952594132 48874.0 86.0119758376518 0.0 - - - - - - - 252.25 97 8 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1329 170 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545087.[MT7]-NLGSTALSPYPTAISGLQSQR.3y11_1.heavy 769.08 / 1157.63 47386.0 37.445499420166016 50 20 10 10 10 18.11568801364741 5.520077400574863 0.0 3 0.9982922870023959 29.860226952594132 47386.0 196.94455198847902 0.0 - - - - - - - 286.7 94 10 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1331 170 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545087.[MT7]-NLGSTALSPYPTAISGLQSQR.3b5_1.heavy 769.08 / 617.338 19125.0 37.445499420166016 50 20 10 10 10 18.11568801364741 5.520077400574863 0.0 3 0.9982922870023959 29.860226952594132 19125.0 70.6429684294644 0.0 - - - - - - - 241.36363636363637 38 11 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1333 170 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545087.[MT7]-NLGSTALSPYPTAISGLQSQR.3y9_1.heavy 769.08 / 959.527 20506.0 37.445499420166016 50 20 10 10 10 18.11568801364741 5.520077400574863 0.0 3 0.9982922870023959 29.860226952594132 20506.0 82.13758147778884 0.0 - - - - - - - 233.6 41 10 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1335 171 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541960.[MT7]-LTDFGFAK[MT7].2y4_1.heavy 593.839 / 566.342 5024.0 37.48659896850586 48 18 10 10 10 4.767034024302446 20.977404291682785 0.0 3 0.9870670595689295 10.840381307594608 5024.0 14.005299268569074 0.0 - - - - - - - 672.3333333333334 10 9 PRKX;MAPKAPK3;TSSK3;MAPKAPK2 protein kinase, X-linked;mitogen-activated protein kinase-activated protein kinase 3;testis-specific serine kinase 3;mitogen-activated protein kinase-activated protein kinase 2 1337 171 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541960.[MT7]-LTDFGFAK[MT7].2y5_1.heavy 593.839 / 713.41 9363.0 37.48659896850586 48 18 10 10 10 4.767034024302446 20.977404291682785 0.0 3 0.9870670595689295 10.840381307594608 9363.0 38.927133479212245 0.0 - - - - - - - 285.5 18 12 PRKX;MAPKAPK3;TSSK3;MAPKAPK2 protein kinase, X-linked;mitogen-activated protein kinase-activated protein kinase 3;testis-specific serine kinase 3;mitogen-activated protein kinase-activated protein kinase 2 1339 171 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541960.[MT7]-LTDFGFAK[MT7].2y3_1.heavy 593.839 / 509.32 1941.0 37.48659896850586 48 18 10 10 10 4.767034024302446 20.977404291682785 0.0 3 0.9870670595689295 10.840381307594608 1941.0 5.743700368274017 0.0 - - - - - - - 668.7142857142857 3 7 PRKX;MAPKAPK3;TSSK3;MAPKAPK2 protein kinase, X-linked;mitogen-activated protein kinase-activated protein kinase 3;testis-specific serine kinase 3;mitogen-activated protein kinase-activated protein kinase 2 1341 171 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB541960.[MT7]-LTDFGFAK[MT7].2y7_1.heavy 593.839 / 929.485 7993.0 37.48659896850586 48 18 10 10 10 4.767034024302446 20.977404291682785 0.0 3 0.9870670595689295 10.840381307594608 7993.0 21.24715679604604 2.0 - - - - - - - 271.25 16 16 PRKX;MAPKAPK3;TSSK3;MAPKAPK2 protein kinase, X-linked;mitogen-activated protein kinase-activated protein kinase 3;testis-specific serine kinase 3;mitogen-activated protein kinase-activated protein kinase 2 1343 172 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21437.[MT7]-VVENLQDDFDFNYK[MT7].2b3_1.heavy 1017.51 / 472.289 3527.0 40.88724994659424 40 14 10 6 10 3.5894683672493746 27.85927880362697 0.034198760986328125 3 0.9365627878796782 4.873795224064918 3527.0 48.56014492753623 0.0 - - - - - - - 166.91666666666666 7 12 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1345 172 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21437.[MT7]-VVENLQDDFDFNYK[MT7].2y4_1.heavy 1017.51 / 715.39 1936.0 40.88724994659424 40 14 10 6 10 3.5894683672493746 27.85927880362697 0.034198760986328125 3 0.9365627878796782 4.873795224064918 1936.0 34.698357487922706 0.0 - - - - - - - 143.07142857142858 3 14 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1347 172 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21437.[MT7]-VVENLQDDFDFNYK[MT7].2b4_1.heavy 1017.51 / 586.332 4357.0 40.88724994659424 40 14 10 6 10 3.5894683672493746 27.85927880362697 0.034198760986328125 3 0.9365627878796782 4.873795224064918 4357.0 31.327305716120748 0.0 - - - - - - - 182.94117647058823 8 17 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1349 172 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21437.[MT7]-VVENLQDDFDFNYK[MT7].2y7_1.heavy 1017.51 / 1092.51 2144.0 40.88724994659424 40 14 10 6 10 3.5894683672493746 27.85927880362697 0.034198760986328125 3 0.9365627878796782 4.873795224064918 2144.0 16.842045753982514 0.0 - - - - - - - 154.07692307692307 4 13 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1351 173 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21436.[MT7]-LENWITSLAESQLQTR.3y7_1.heavy 678.364 / 861.443 1682.0 49.57835006713867 43 17 10 6 10 2.205449252863179 36.04506281684631 0.0337982177734375 3 0.9744701231214262 7.707431919988726 1682.0 26.384313725490195 1.0 - - - - - - - 150.16666666666666 3 18 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1353 173 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21436.[MT7]-LENWITSLAESQLQTR.3b4_1.heavy 678.364 / 687.358 3059.0 49.57835006713867 43 17 10 6 10 2.205449252863179 36.04506281684631 0.0337982177734375 3 0.9744701231214262 7.707431919988726 3059.0 31.88957516339869 0.0 - - - - - - - 126.15789473684211 6 19 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1355 173 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21436.[MT7]-LENWITSLAESQLQTR.3b3_1.heavy 678.364 / 501.279 1886.0 49.57835006713867 43 17 10 6 10 2.205449252863179 36.04506281684631 0.0337982177734375 3 0.9744701231214262 7.707431919988726 1886.0 2.8370598290598292 0.0 - - - - - - - 211.65 3 20 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1357 173 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21436.[MT7]-LENWITSLAESQLQTR.3y8_1.heavy 678.364 / 932.48 2651.0 49.57835006713867 43 17 10 6 10 2.205449252863179 36.04506281684631 0.0337982177734375 3 0.9744701231214262 7.707431919988726 2651.0 19.75254901960784 0.0 - - - - - - - 153.0 5 20 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1359 174 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543255.[MT7]-IDSTEVIYQPR.3b6_1.heavy 488.932 / 789.411 11607.0 31.41189956665039 50 20 10 10 10 8.251300275429495 12.119302008409193 0.0 3 0.9917341813055837 13.565000930921666 11607.0 66.5279268292683 0.0 - - - - - - - 247.86666666666667 23 15 STK11 serine/threonine kinase 11 1361 174 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543255.[MT7]-IDSTEVIYQPR.3b5_1.heavy 488.932 / 690.343 34711.0 31.41189956665039 50 20 10 10 10 8.251300275429495 12.119302008409193 0.0 3 0.9917341813055837 13.565000930921666 34711.0 66.04586349201053 0.0 - - - - - - - 697.75 69 8 STK11 serine/threonine kinase 11 1363 174 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543255.[MT7]-IDSTEVIYQPR.3y4_1.heavy 488.932 / 563.294 43251.0 31.41189956665039 50 20 10 10 10 8.251300275429495 12.119302008409193 0.0 3 0.9917341813055837 13.565000930921666 43251.0 97.95660273972601 0.0 - - - - - - - 310.1666666666667 86 6 STK11 serine/threonine kinase 11 1365 174 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543255.[MT7]-IDSTEVIYQPR.3y5_1.heavy 488.932 / 676.378 28141.0 31.41189956665039 50 20 10 10 10 8.251300275429495 12.119302008409193 0.0 3 0.9917341813055837 13.565000930921666 28141.0 40.06491146067195 0.0 - - - - - - - 828.7142857142857 56 7 STK11 serine/threonine kinase 11 1367 175 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 241019.0 35.891700744628906 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 241019.0 484.0135655737704 0.0 - - - - - - - 329.4 482 10 1369 175 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 40739.0 35.891700744628906 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 40739.0 -0.38042495256086184 3.0 - - - - - - - 325.3333333333333 100 15 1371 175 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 54888.0 35.891700744628906 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 54888.0 101.91732850755801 0.0 - - - - - - - 325.3333333333333 109 12 1373 176 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545180.[MT7]-LENVLLDSEGHIVLTDFGLSK[MT7].4y4_1.heavy 647.611 / 548.352 7441.0 47.907999992370605 35 9 10 6 10 0.7484889620683728 78.4052542451519 0.035999298095703125 3 0.80803116180845 2.770391162299787 7441.0 25.418292011019282 0.0 - - - - - - - 288.0 14 17 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1375 176 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545180.[MT7]-LENVLLDSEGHIVLTDFGLSK[MT7].4b4_1.heavy 647.611 / 600.347 3751.0 47.907999992370605 35 9 10 6 10 0.7484889620683728 78.4052542451519 0.035999298095703125 3 0.80803116180845 2.770391162299787 3751.0 36.58 0.0 - - - - - - - 145.0 7 15 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1377 176 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545180.[MT7]-LENVLLDSEGHIVLTDFGLSK[MT7].4b5_1.heavy 647.611 / 713.431 1875.0 47.907999992370605 35 9 10 6 10 0.7484889620683728 78.4052542451519 0.035999298095703125 3 0.80803116180845 2.770391162299787 1875.0 3.9893617021276597 1.0 - - - - - - - 200.21052631578948 3 19 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1379 176 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545180.[MT7]-LENVLLDSEGHIVLTDFGLSK[MT7].4b3_1.heavy 647.611 / 501.279 2238.0 47.907999992370605 35 9 10 6 10 0.7484889620683728 78.4052542451519 0.035999298095703125 3 0.80803116180845 2.770391162299787 2238.0 8.102951593860684 0.0 - - - - - - - 174.8421052631579 4 19 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1381 177 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20876.[MT7]-SDLSTLVR.2y5_1.heavy 517.802 / 575.351 11482.0 30.934600830078125 44 16 8 10 10 3.2151783191886643 31.102473975762113 0.0 3 0.969696404377583 7.071514245900926 11482.0 52.41632404200965 0.0 - - - - - - - 623.125 22 8 SKP2 S-phase kinase-associated protein 2 (p45) 1383 177 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20876.[MT7]-SDLSTLVR.2y6_1.heavy 517.802 / 688.435 13541.0 30.934600830078125 44 16 8 10 10 3.2151783191886643 31.102473975762113 0.0 3 0.969696404377583 7.071514245900926 13541.0 32.76386458510739 0.0 - - - - - - - 866.7142857142857 27 7 SKP2 S-phase kinase-associated protein 2 (p45) 1385 177 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20876.[MT7]-SDLSTLVR.2b5_1.heavy 517.802 / 648.332 4766.0 30.934600830078125 44 16 8 10 10 3.2151783191886643 31.102473975762113 0.0 3 0.969696404377583 7.071514245900926 4766.0 6.077449664429531 1.0 - - - - - - - 240.77777777777777 37 9 SKP2 S-phase kinase-associated protein 2 (p45) 1387 177 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20876.[MT7]-SDLSTLVR.2y7_1.heavy 517.802 / 803.462 7799.0 30.934600830078125 44 16 8 10 10 3.2151783191886643 31.102473975762113 0.0 3 0.969696404377583 7.071514245900926 7799.0 99.50081071855266 0.0 - - - - - - - 207.5 15 12 SKP2 S-phase kinase-associated protein 2 (p45) 1389 178 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21533.[MT7]-LSK[MT7]PTLENLTPVVLRPEIR.3b3_1.heavy 821.835 / 617.422 4541.0 39.180198669433594 44 16 10 10 8 2.475159419593801 32.24664335030364 0.0 4 0.9663559364239228 6.709388612093869 4541.0 26.334629441070582 0.0 - - - - - - - 250.78571428571428 9 14 CASP9 caspase 9, apoptosis-related cysteine peptidase 1391 178 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21533.[MT7]-LSK[MT7]PTLENLTPVVLRPEIR.3b8_2.heavy 821.835 / 586.35 4199.0 39.180198669433594 44 16 10 10 8 2.475159419593801 32.24664335030364 0.0 4 0.9663559364239228 6.709388612093869 4199.0 14.025551747336266 1.0 - - - - - - - 673.1428571428571 10 7 CASP9 caspase 9, apoptosis-related cysteine peptidase 1393 178 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21533.[MT7]-LSK[MT7]PTLENLTPVVLRPEIR.3y16_2.heavy 821.835 / 924.041 7540.0 39.180198669433594 44 16 10 10 8 2.475159419593801 32.24664335030364 0.0 4 0.9663559364239228 6.709388612093869 7540.0 61.89039946805789 0.0 - - - - - - - 171.42857142857142 15 14 CASP9 caspase 9, apoptosis-related cysteine peptidase 1395 178 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21533.[MT7]-LSK[MT7]PTLENLTPVVLRPEIR.3y9_1.heavy 821.835 / 1078.67 4113.0 39.180198669433594 44 16 10 10 8 2.475159419593801 32.24664335030364 0.0 4 0.9663559364239228 6.709388612093869 4113.0 15.312276168224297 0.0 - - - - - - - 184.6153846153846 8 13 CASP9 caspase 9, apoptosis-related cysteine peptidase 1397 179 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585531.[MT7]-C[CAM]LLIVMEC[CAM]LDGGELFSR.3b4_1.heavy 719.361 / 644.392 7287.0 52.448299407958984 44 14 10 10 10 1.2159993355020517 49.49371961005426 0.0 3 0.948904274666286 5.4362985440924945 7287.0 70.57070388349514 0.0 - - - - - - - 155.92857142857142 14 14 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1399 179 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585531.[MT7]-C[CAM]LLIVMEC[CAM]LDGGELFSR.3b5_1.heavy 719.361 / 743.461 3952.0 52.448299407958984 44 14 10 10 10 1.2159993355020517 49.49371961005426 0.0 3 0.948904274666286 5.4362985440924945 3952.0 52.02875824746089 0.0 - - - - - - - 170.0 7 15 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1401 179 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585531.[MT7]-C[CAM]LLIVMEC[CAM]LDGGELFSR.3b3_1.heavy 719.361 / 531.308 4323.0 52.448299407958984 44 14 10 10 10 1.2159993355020517 49.49371961005426 0.0 3 0.948904274666286 5.4362985440924945 4323.0 46.629133064516125 0.0 - - - - - - - 129.5 8 14 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1403 179 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585531.[MT7]-C[CAM]LLIVMEC[CAM]LDGGELFSR.3y8_1.heavy 719.361 / 880.416 5269.0 52.448299407958984 44 14 10 10 10 1.2159993355020517 49.49371961005426 0.0 3 0.948904274666286 5.4362985440924945 5269.0 94.2714837398374 0.0 - - - - - - - 132.92307692307693 10 13 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1405 180 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21535.[MT7]-SLQLVVLDADTINHPAQLIK[MT7].4b4_1.heavy 619.865 / 586.368 29436.0 42.47249889373779 44 18 10 6 10 5.552748370527676 18.009099877597556 0.034000396728515625 3 0.9850357693259032 10.07609160457894 29436.0 117.59014500797892 0.0 - - - - - - - 729.5 58 8 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1407 180 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21535.[MT7]-SLQLVVLDADTINHPAQLIK[MT7].4b5_1.heavy 619.865 / 685.437 17761.0 42.47249889373779 44 18 10 6 10 5.552748370527676 18.009099877597556 0.034000396728515625 3 0.9850357693259032 10.07609160457894 17761.0 66.29560853741287 0.0 - - - - - - - 674.1428571428571 35 7 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1409 180 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21535.[MT7]-SLQLVVLDADTINHPAQLIK[MT7].4y6_1.heavy 619.865 / 813.531 18009.0 42.47249889373779 44 18 10 6 10 5.552748370527676 18.009099877597556 0.034000396728515625 3 0.9850357693259032 10.07609160457894 18009.0 99.416529661842 0.0 - - - - - - - 221.2173913043478 36 23 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1411 180 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21535.[MT7]-SLQLVVLDADTINHPAQLIK[MT7].4b6_1.heavy 619.865 / 784.505 9688.0 42.47249889373779 44 18 10 6 10 5.552748370527676 18.009099877597556 0.034000396728515625 3 0.9850357693259032 10.07609160457894 9688.0 10.925963506757435 1.0 - - - - - - - 172.44444444444446 22 18 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1413 181 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21538.[MT7]-C[CAM]YDIIPETLLELGEIPTLK[MT7].4y4_1.heavy 627.1 / 602.399 4318.0 54.03179931640625 39 9 10 10 10 16.612303186284457 6.019634898221853 0.0 3 0.8048127762516121 2.7466625147290236 4318.0 -0.9488158774471279 2.0 - - - - - - - 102.0625 9 16 SKP2 S-phase kinase-associated protein 2 (p45) 1415 181 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21538.[MT7]-C[CAM]YDIIPETLLELGEIPTLK[MT7].4b4_1.heavy 627.1 / 696.314 3838.0 54.03179931640625 39 9 10 10 10 16.612303186284457 6.019634898221853 0.0 3 0.8048127762516121 2.7466625147290236 3838.0 85.51410081053697 0.0 - - - - - - - 89.8125 7 16 SKP2 S-phase kinase-associated protein 2 (p45) 1417 181 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21538.[MT7]-C[CAM]YDIIPETLLELGEIPTLK[MT7].4b5_1.heavy 627.1 / 809.398 3782.0 54.03179931640625 39 9 10 10 10 16.612303186284457 6.019634898221853 0.0 3 0.8048127762516121 2.7466625147290236 3782.0 90.86187943262411 0.0 - - - - - - - 110.5 7 12 SKP2 S-phase kinase-associated protein 2 (p45) 1419 181 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21538.[MT7]-C[CAM]YDIIPETLLELGEIPTLK[MT7].4b3_1.heavy 627.1 / 583.23 3133.0 54.03179931640625 39 9 10 10 10 16.612303186284457 6.019634898221853 0.0 3 0.8048127762516121 2.7466625147290236 3133.0 50.228325791855205 0.0 - - - - - - - 109.47058823529412 6 17 SKP2 S-phase kinase-associated protein 2 (p45) 1421 182 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543505.[MT7]-HLNVQLVAADK[MT7].3b4_1.heavy 499.299 / 608.364 7613.0 29.38479995727539 44 14 10 10 10 3.061047025210802 32.66856052076279 0.0 3 0.9363592238679619 4.865909700254384 7613.0 9.0770795750422 0.0 - - - - - - - 254.72727272727272 15 11 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1423 182 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543505.[MT7]-HLNVQLVAADK[MT7].3b5_1.heavy 499.299 / 736.422 5008.0 29.38479995727539 44 14 10 10 10 3.061047025210802 32.66856052076279 0.0 3 0.9363592238679619 4.865909700254384 5008.0 9.311034724782271 1.0 - - - - - - - 243.07142857142858 10 14 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1425 182 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543505.[MT7]-HLNVQLVAADK[MT7].3b3_1.heavy 499.299 / 509.295 8013.0 29.38479995727539 44 14 10 10 10 3.061047025210802 32.66856052076279 0.0 3 0.9363592238679619 4.865909700254384 8013.0 20.12429866220372 0.0 - - - - - - - 619.1818181818181 16 11 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1427 182 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543505.[MT7]-HLNVQLVAADK[MT7].3y4_1.heavy 499.299 / 548.316 17128.0 29.38479995727539 44 14 10 10 10 3.061047025210802 32.66856052076279 0.0 3 0.9363592238679619 4.865909700254384 17128.0 14.40384630375422 0.0 - - - - - - - 713.5 34 8 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1429 183 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21539.[MT7]-C[CAM]YDIIPETLLELGEIPTLK[MT7].3y7_1.heavy 835.797 / 901.547 4121.0 53.98287391662598 38 13 10 7 8 2.0499812929741927 42.946970696041944 0.02790069580078125 4 0.9214500423457679 4.374261333469951 4121.0 20.2765355912744 0.0 - - - - - - - 95.9 8 10 SKP2 S-phase kinase-associated protein 2 (p45) 1431 183 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21539.[MT7]-C[CAM]YDIIPETLLELGEIPTLK[MT7].3b4_1.heavy 835.797 / 696.314 5221.0 53.98287391662598 38 13 10 7 8 2.0499812929741927 42.946970696041944 0.02790069580078125 4 0.9214500423457679 4.374261333469951 5221.0 34.272789710415935 1.0 - - - - - - - 113.92 10 25 SKP2 S-phase kinase-associated protein 2 (p45) 1433 183 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21539.[MT7]-C[CAM]YDIIPETLLELGEIPTLK[MT7].3b5_1.heavy 835.797 / 809.398 9455.0 53.98287391662598 38 13 10 7 8 2.0499812929741927 42.946970696041944 0.02790069580078125 4 0.9214500423457679 4.374261333469951 9455.0 156.89576664592994 1.0 - - - - - - - 130.05555555555554 30 18 SKP2 S-phase kinase-associated protein 2 (p45) 1435 183 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21539.[MT7]-C[CAM]YDIIPETLLELGEIPTLK[MT7].3b3_1.heavy 835.797 / 583.23 4149.0 53.98287391662598 38 13 10 7 8 2.0499812929741927 42.946970696041944 0.02790069580078125 4 0.9214500423457679 4.374261333469951 4149.0 19.46521032064491 1.0 - - - - - - - 122.2 9 15 SKP2 S-phase kinase-associated protein 2 (p45) 1437 184 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21147.[MT7]-SLVDTVYALK[MT7].3y3_1.heavy 466.281 / 475.336 49996.0 41.118499755859375 43 13 10 10 10 5.302157792786607 18.860245942896373 0.0 3 0.9272027854204673 4.546052896950813 49996.0 146.97555303980386 0.0 - - - - - - - 199.46666666666667 99 15 ARHGEF7;ARHGEF6 Rho guanine nucleotide exchange factor (GEF) 7;Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1439 184 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21147.[MT7]-SLVDTVYALK[MT7].3b4_1.heavy 466.281 / 559.321 24658.0 41.118499755859375 43 13 10 10 10 5.302157792786607 18.860245942896373 0.0 3 0.9272027854204673 4.546052896950813 24658.0 128.1249019607843 0.0 - - - - - - - 209.66666666666666 49 12 ARHGEF7;ARHGEF6 Rho guanine nucleotide exchange factor (GEF) 7;Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1441 184 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21147.[MT7]-SLVDTVYALK[MT7].3b5_1.heavy 466.281 / 660.369 25134.0 41.118499755859375 43 13 10 10 10 5.302157792786607 18.860245942896373 0.0 3 0.9272027854204673 4.546052896950813 25134.0 168.7920588235294 0.0 - - - - - - - 161.5 50 16 ARHGEF7;ARHGEF6 Rho guanine nucleotide exchange factor (GEF) 7;Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1443 184 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21147.[MT7]-SLVDTVYALK[MT7].3y4_1.heavy 466.281 / 638.399 43339.0 41.118499755859375 43 13 10 10 10 5.302157792786607 18.860245942896373 0.0 3 0.9272027854204673 4.546052896950813 43339.0 343.1337742452231 0.0 - - - - - - - 197.8181818181818 86 11 ARHGEF7;ARHGEF6 Rho guanine nucleotide exchange factor (GEF) 7;Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1445 185 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21141.[MT7]-EFYILWTK[MT7].2y4_1.heavy 694.397 / 691.426 6534.0 44.319525718688965 40 14 10 6 10 1.4762302873397182 47.59991052208062 0.033100128173828125 3 0.9467494699443321 5.324196869617555 6534.0 11.302054054054054 0.0 - - - - - - - 695.5714285714286 13 7 CAPN2 calpain 2, (m/II) large subunit 1447 185 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21141.[MT7]-EFYILWTK[MT7].2b3_1.heavy 694.397 / 584.284 5301.0 44.319525718688965 40 14 10 6 10 1.4762302873397182 47.59991052208062 0.033100128173828125 3 0.9467494699443321 5.324196869617555 5301.0 17.16923076923077 1.0 - - - - - - - 239.83333333333334 10 18 CAPN2 calpain 2, (m/II) large subunit 1449 185 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21141.[MT7]-EFYILWTK[MT7].2b4_1.heavy 694.397 / 697.368 4130.0 44.319525718688965 40 14 10 6 10 1.4762302873397182 47.59991052208062 0.033100128173828125 3 0.9467494699443321 5.324196869617555 4130.0 18.393165998734442 0.0 - - - - - - - 304.94736842105266 8 19 CAPN2 calpain 2, (m/II) large subunit 1451 185 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21141.[MT7]-EFYILWTK[MT7].2y3_1.heavy 694.397 / 578.342 7027.0 44.319525718688965 40 14 10 6 10 1.4762302873397182 47.59991052208062 0.033100128173828125 3 0.9467494699443321 5.324196869617555 7027.0 11.510916580297113 0.0 - - - - - - - 255.85 14 20 CAPN2 calpain 2, (m/II) large subunit 1453 186 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584404.[MT7]-ELGPYSSK[MT7].2y5_1.heavy 584.826 / 725.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN2 calpain 2, (m/II) large subunit 1455 186 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584404.[MT7]-ELGPYSSK[MT7].2y3_1.heavy 584.826 / 465.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN2 calpain 2, (m/II) large subunit 1457 186 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584404.[MT7]-ELGPYSSK[MT7].2y6_1.heavy 584.826 / 782.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN2 calpain 2, (m/II) large subunit 1459 186 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584404.[MT7]-ELGPYSSK[MT7].2y7_1.heavy 584.826 / 895.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN2 calpain 2, (m/II) large subunit 1461 187 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21041.[MT7]-LLSQGVIAFR.3y6_1.heavy 416.591 / 662.398 10612.0 40.31230068206787 34 8 10 6 10 0.9407289338571583 69.00079394983828 0.034801483154296875 3 0.7880568267009898 2.6318759297262813 10612.0 142.88946356589148 0.0 - - - - - - - 105.3 21 10 SKP2 S-phase kinase-associated protein 2 (p45) 1463 187 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21041.[MT7]-LLSQGVIAFR.3b4_1.heavy 416.591 / 586.368 9860.0 40.31230068206787 34 8 10 6 10 0.9407289338571583 69.00079394983828 0.034801483154296875 3 0.7880568267009898 2.6318759297262813 9860.0 40.37793637726752 0.0 - - - - - - - 213.27777777777777 19 18 SKP2 S-phase kinase-associated protein 2 (p45) 1465 187 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21041.[MT7]-LLSQGVIAFR.3b5_1.heavy 416.591 / 643.39 23784.0 40.31230068206787 34 8 10 6 10 0.9407289338571583 69.00079394983828 0.034801483154296875 3 0.7880568267009898 2.6318759297262813 23784.0 84.62156028368796 0.0 - - - - - - - 217.44444444444446 47 9 SKP2 S-phase kinase-associated protein 2 (p45) 1467 187 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21041.[MT7]-LLSQGVIAFR.3y4_1.heavy 416.591 / 506.309 11741.0 40.31230068206787 34 8 10 6 10 0.9407289338571583 69.00079394983828 0.034801483154296875 3 0.7880568267009898 2.6318759297262813 11741.0 32.12449232610834 0.0 - - - - - - - 235.125 23 8 SKP2 S-phase kinase-associated protein 2 (p45) 1469 188 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545274.[MT7]-SIDAGPVDAWTLAFSPDSQYLATGTHVGK[MT7].4b8_1.heavy 823.924 / 899.459 7695.0 45.6070499420166 39 13 10 6 10 1.2986770334092248 55.76881053421327 0.037097930908203125 3 0.9135709702447583 4.167290742326504 7695.0 35.122799841667764 0.0 - - - - - - - 275.6 15 15 WDR61 WD repeat domain 61 1471 188 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545274.[MT7]-SIDAGPVDAWTLAFSPDSQYLATGTHVGK[MT7].4b4_1.heavy 823.924 / 531.289 5024.0 45.6070499420166 39 13 10 6 10 1.2986770334092248 55.76881053421327 0.037097930908203125 3 0.9135709702447583 4.167290742326504 5024.0 8.82255182703166 0.0 - - - - - - - 267.06666666666666 10 15 WDR61 WD repeat domain 61 1473 188 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545274.[MT7]-SIDAGPVDAWTLAFSPDSQYLATGTHVGK[MT7].4b5_1.heavy 823.924 / 588.311 8776.0 45.6070499420166 39 13 10 6 10 1.2986770334092248 55.76881053421327 0.037097930908203125 3 0.9135709702447583 4.167290742326504 8776.0 21.653934841941613 0.0 - - - - - - - 685.6666666666666 17 9 WDR61 WD repeat domain 61 1475 188 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545274.[MT7]-SIDAGPVDAWTLAFSPDSQYLATGTHVGK[MT7].4b9_1.heavy 823.924 / 970.496 12464.0 45.6070499420166 39 13 10 6 10 1.2986770334092248 55.76881053421327 0.037097930908203125 3 0.9135709702447583 4.167290742326504 12464.0 45.422124231503076 0.0 - - - - - - - 300.72727272727275 24 11 WDR61 WD repeat domain 61 1477 189 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585689.[MT7]-LSK[MT7]PTLENLTPVVLRPEIR.4y4_1.heavy 616.628 / 514.298 15453.0 39.18949890136719 42 16 10 6 10 14.222510279510615 7.031107591749332 0.037200927734375 3 0.9649671742642881 6.574287350351933 15453.0 30.090307755827986 0.0 - - - - - - - 678.625 30 8 CASP9 caspase 9, apoptosis-related cysteine peptidase 1479 189 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585689.[MT7]-LSK[MT7]PTLENLTPVVLRPEIR.4b8_2.heavy 616.628 / 586.35 41431.0 39.18949890136719 42 16 10 6 10 14.222510279510615 7.031107591749332 0.037200927734375 3 0.9649671742642881 6.574287350351933 41431.0 54.25315286979233 0.0 - - - - - - - 716.0 82 7 CASP9 caspase 9, apoptosis-related cysteine peptidase 1481 189 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585689.[MT7]-LSK[MT7]PTLENLTPVVLRPEIR.4y16_2.heavy 616.628 / 924.041 19964.0 39.18949890136719 42 16 10 6 10 14.222510279510615 7.031107591749332 0.037200927734375 3 0.9649671742642881 6.574287350351933 19964.0 299.75353253652054 0.0 - - - - - - - 193.07692307692307 39 13 CASP9 caspase 9, apoptosis-related cysteine peptidase 1483 189 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585689.[MT7]-LSK[MT7]PTLENLTPVVLRPEIR.4b7_2.heavy 616.628 / 529.328 22303.0 39.18949890136719 42 16 10 6 10 14.222510279510615 7.031107591749332 0.037200927734375 3 0.9649671742642881 6.574287350351933 22303.0 75.52910342950463 0.0 - - - - - - - 758.6666666666666 44 12 CASP9 caspase 9, apoptosis-related cysteine peptidase 1485 190 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21043.[MT7]-GFETAPLTK[MT7].2y4_1.heavy 626.363 / 602.399 6935.0 29.680450439453125 44 18 10 6 10 4.536921617188013 22.04137704763347 0.03929901123046875 3 0.9876541317313208 11.095674905397322 6935.0 10.503638647831831 0.0 - - - - - - - 226.5 13 8 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1487 190 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21043.[MT7]-GFETAPLTK[MT7].2y5_1.heavy 626.363 / 673.437 1608.0 29.680450439453125 44 18 10 6 10 4.536921617188013 22.04137704763347 0.03929901123046875 3 0.9876541317313208 11.095674905397322 1608.0 6.581579431152664 2.0 - - - - - - - 201.42857142857142 3 7 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1489 190 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21043.[MT7]-GFETAPLTK[MT7].2b4_1.heavy 626.363 / 579.289 2312.0 29.680450439453125 44 18 10 6 10 4.536921617188013 22.04137704763347 0.03929901123046875 3 0.9876541317313208 11.095674905397322 2312.0 8.730156807499375 0.0 - - - - - - - 224.6153846153846 4 13 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1491 190 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21043.[MT7]-GFETAPLTK[MT7].2b5_1.heavy 626.363 / 650.327 3618.0 29.680450439453125 44 18 10 6 10 4.536921617188013 22.04137704763347 0.03929901123046875 3 0.9876541317313208 11.095674905397322 3618.0 11.633200795228628 0.0 - - - - - - - 241.5 7 10 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1493 191 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21148.[MT7]-NLQEGQVTDPR.2b3_1.heavy 700.866 / 500.295 7752.0 22.808300495147705 39 13 10 6 10 2.5027477094015667 39.95608491593068 0.03679847717285156 3 0.9068972576175 4.01284695563998 7752.0 92.49199999999999 0.0 - - - - - - - 210.0 15 17 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1495 191 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21148.[MT7]-NLQEGQVTDPR.2b4_1.heavy 700.866 / 629.338 6936.0 22.808300495147705 39 13 10 6 10 2.5027477094015667 39.95608491593068 0.03679847717285156 3 0.9068972576175 4.01284695563998 6936.0 37.783272727272724 0.0 - - - - - - - 156.64285714285714 13 14 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1497 191 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21148.[MT7]-NLQEGQVTDPR.2b6_1.heavy 700.866 / 814.417 5763.0 22.808300495147705 39 13 10 6 10 2.5027477094015667 39.95608491593068 0.03679847717285156 3 0.9068972576175 4.01284695563998 5763.0 64.03333333333333 0.0 - - - - - - - 165.75 11 12 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1499 191 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21148.[MT7]-NLQEGQVTDPR.2b9_1.heavy 700.866 / 1129.56 20401.0 22.808300495147705 39 13 10 6 10 2.5027477094015667 39.95608491593068 0.03679847717285156 3 0.9068972576175 4.01284695563998 20401.0 470.4230588235294 0.0 - - - - - - - 160.84615384615384 40 13 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1501 192 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584545.[MT7]-DTTFAQVLK[MT7].3y3_1.heavy 437.59 / 503.367 71551.0 34.38290023803711 44 14 10 10 10 3.9516120473265466 25.306127930158212 0.0 3 0.943763580998037 5.179608822301525 71551.0 155.1402080723821 0.0 - - - - - - - 786.2727272727273 143 11 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1503 192 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584545.[MT7]-DTTFAQVLK[MT7].3b4_1.heavy 437.59 / 609.3 33788.0 34.38290023803711 44 14 10 10 10 3.9516120473265466 25.306127930158212 0.0 3 0.943763580998037 5.179608822301525 33788.0 341.48982905982905 0.0 - - - - - - - 263.25 67 8 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1505 192 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584545.[MT7]-DTTFAQVLK[MT7].3b5_1.heavy 437.59 / 680.337 37178.0 34.38290023803711 44 14 10 10 10 3.9516120473265466 25.306127930158212 0.0 3 0.943763580998037 5.179608822301525 37178.0 66.80315564470082 1.0 - - - - - - - 190.125 74 8 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1507 192 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584545.[MT7]-DTTFAQVLK[MT7].3b3_1.heavy 437.59 / 462.232 50506.0 34.38290023803711 44 14 10 10 10 3.9516120473265466 25.306127930158212 0.0 3 0.943763580998037 5.179608822301525 50506.0 45.04079966929481 0.0 - - - - - - - 312.0 101 6 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1509 193 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544235.[MT7]-AVEIEELTYIIK[MT7].3b6_1.heavy 570.337 / 815.427 54637.0 45.372501373291016 50 20 10 10 10 13.384521689830683 7.471316668415443 0.0 3 0.9901441506079881 12.421041111148396 54637.0 924.2802242194891 0.0 - - - - - - - 147.0 109 9 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 1511 193 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544235.[MT7]-AVEIEELTYIIK[MT7].3b4_1.heavy 570.337 / 557.341 40914.0 45.372501373291016 50 20 10 10 10 13.384521689830683 7.471316668415443 0.0 3 0.9901441506079881 12.421041111148396 40914.0 291.8408299319728 0.0 - - - - - - - 226.8 81 15 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 1513 193 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544235.[MT7]-AVEIEELTYIIK[MT7].3b5_1.heavy 570.337 / 686.384 44376.0 45.372501373291016 50 20 10 10 10 13.384521689830683 7.471316668415443 0.0 3 0.9901441506079881 12.421041111148396 44376.0 561.1568253968253 0.0 - - - - - - - 155.07692307692307 88 13 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 1515 193 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544235.[MT7]-AVEIEELTYIIK[MT7].3y4_1.heavy 570.337 / 680.446 37390.0 45.372501373291016 50 20 10 10 10 13.384521689830683 7.471316668415443 0.0 3 0.9901441506079881 12.421041111148396 37390.0 245.7057142857143 0.0 - - - - - - - 204.75 74 12 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 1517 194 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585157.[MT7]-RILGLAIESQDAGIK[MT7].4y4_1.heavy 468.784 / 532.357 22466.0 35.84809875488281 32 2 10 10 10 0.8651172028456253 69.1832827548799 0.0 3 0.43723443821490043 1.5607334473807535 22466.0 59.250808197941964 0.0 - - - - - - - 310.54545454545456 44 11 SNAP23 synaptosomal-associated protein, 23kDa 1519 194 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585157.[MT7]-RILGLAIESQDAGIK[MT7].4b7_1.heavy 468.784 / 881.605 5617.0 35.84809875488281 32 2 10 10 10 0.8651172028456253 69.1832827548799 0.0 3 0.43723443821490043 1.5607334473807535 5617.0 67.0817131147541 0.0 - - - - - - - 268.4 11 5 SNAP23 synaptosomal-associated protein, 23kDa 1521 194 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585157.[MT7]-RILGLAIESQDAGIK[MT7].4b5_1.heavy 468.784 / 697.484 9524.0 35.84809875488281 32 2 10 10 10 0.8651172028456253 69.1832827548799 0.0 3 0.43723443821490043 1.5607334473807535 9524.0 16.43114750369612 0.0 - - - - - - - 203.33333333333334 19 6 SNAP23 synaptosomal-associated protein, 23kDa 1523 194 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585157.[MT7]-RILGLAIESQDAGIK[MT7].4b6_1.heavy 468.784 / 768.521 1587.0 35.84809875488281 32 2 10 10 10 0.8651172028456253 69.1832827548799 0.0 3 0.43723443821490043 1.5607334473807535 1587.0 10.276475409836067 0.0 - - - - - - - 195.2 3 5 SNAP23 synaptosomal-associated protein, 23kDa 1525 195 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20725.[MT7]-AALVQR.2b3_1.heavy 401.257 / 400.268 20519.0 20.624600410461426 41 15 9 7 10 2.107834550680116 41.28294177458991 0.028400421142578125 3 0.9574868436989894 5.96416923403155 20519.0 10.638099140882803 0.0 - - - - - - - 1254.7777777777778 41 9 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1527 195 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20725.[MT7]-AALVQR.2y4_1.heavy 401.257 / 515.33 7941.0 20.624600410461426 41 15 9 7 10 2.107834550680116 41.28294177458991 0.028400421142578125 3 0.9574868436989894 5.96416923403155 7941.0 8.42423871063577 3.0 - - - - - - - 1667.888888888889 57 9 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1529 195 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20725.[MT7]-AALVQR.2y5_1.heavy 401.257 / 586.367 25752.0 20.624600410461426 41 15 9 7 10 2.107834550680116 41.28294177458991 0.028400421142578125 3 0.9574868436989894 5.96416923403155 25752.0 35.01086203819383 0.0 - - - - - - - 660.3076923076923 51 13 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1531 195 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20725.[MT7]-AALVQR.2b4_1.heavy 401.257 / 499.336 13083.0 20.624600410461426 41 15 9 7 10 2.107834550680116 41.28294177458991 0.028400421142578125 3 0.9574868436989894 5.96416923403155 13083.0 13.216723609577828 0.0 - - - - - - - 677.1 26 20 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1533 196 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545177.[MT7]-LRDVIAQC[CAM]ILPQAGENEDEK[MT7].4b8_2.heavy 647.341 / 550.804 5749.0 36.901851654052734 30 5 10 5 10 0.4909305433955056 91.8142283228297 0.046600341796875 3 0.6325727675825463 1.9700626428576076 5749.0 30.93211956521739 0.0 - - - - - - - 325.8333333333333 11 6 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1535 196 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545177.[MT7]-LRDVIAQC[CAM]ILPQAGENEDEK[MT7].4b7_1.heavy 647.341 / 940.57 920.0 36.901851654052734 30 5 10 5 10 0.4909305433955056 91.8142283228297 0.046600341796875 3 0.6325727675825463 1.9700626428576076 920.0 1.9333333333333333 1.0 - - - - - - - 0.0 1 0 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1537 196 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545177.[MT7]-LRDVIAQC[CAM]ILPQAGENEDEK[MT7].4b3_1.heavy 647.341 / 529.321 690.0 36.901851654052734 30 5 10 5 10 0.4909305433955056 91.8142283228297 0.046600341796875 3 0.6325727675825463 1.9700626428576076 690.0 -0.22564102564102562 21.0 - - - - - - - 219.54545454545453 2 11 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1539 196 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB545177.[MT7]-LRDVIAQC[CAM]ILPQAGENEDEK[MT7].4b6_1.heavy 647.341 / 812.511 920.0 36.901851654052734 30 5 10 5 10 0.4909305433955056 91.8142283228297 0.046600341796875 3 0.6325727675825463 1.9700626428576076 920.0 4.0 1.0 - - - - - - - 0.0 1 0 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1541 197 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542638.[MT7]-EEIIEAFVQELRK[MT7].3y7_1.heavy 631.363 / 1063.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - VASP vasodilator-stimulated phosphoprotein 1543 197 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542638.[MT7]-EEIIEAFVQELRK[MT7].3b5_1.heavy 631.363 / 758.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - VASP vasodilator-stimulated phosphoprotein 1545 197 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542638.[MT7]-EEIIEAFVQELRK[MT7].3b3_1.heavy 631.363 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - VASP vasodilator-stimulated phosphoprotein 1547 197 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542638.[MT7]-EEIIEAFVQELRK[MT7].3y8_1.heavy 631.363 / 1134.68 N/A N/A - - - - - - - - - 0.0 - - - - - - - VASP vasodilator-stimulated phosphoprotein 1549 198 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543100.[MT7]-YVTLLQELER.2b3_1.heavy 704.402 / 508.289 9343.0 45.318899154663086 46 20 10 6 10 10.765444468780819 9.288980152189197 0.035800933837890625 3 0.9964366465914947 20.668258028164086 9343.0 24.364113211254804 0.0 - - - - - - - 285.6470588235294 18 17 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1551 198 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543100.[MT7]-YVTLLQELER.2y8_1.heavy 704.402 / 1001.56 28090.0 45.318899154663086 46 20 10 6 10 10.765444468780819 9.288980152189197 0.035800933837890625 3 0.9964366465914947 20.668258028164086 28090.0 94.65538070046208 0.0 - - - - - - - 280.27777777777777 56 18 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1553 198 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543100.[MT7]-YVTLLQELER.2y6_1.heavy 704.402 / 787.431 12395.0 45.318899154663086 46 20 10 6 10 10.765444468780819 9.288980152189197 0.035800933837890625 3 0.9964366465914947 20.668258028164086 12395.0 63.21947791164659 0.0 - - - - - - - 221.05 24 20 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1555 198 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543100.[MT7]-YVTLLQELER.2y7_1.heavy 704.402 / 900.515 10464.0 45.318899154663086 46 20 10 6 10 10.765444468780819 9.288980152189197 0.035800933837890625 3 0.9964366465914947 20.668258028164086 10464.0 87.32219203426125 0.0 - - - - - - - 142.88235294117646 20 17 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1557 199 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21447.[MT7]-GLQLLVDLVTSMDHQER.3b7_1.heavy 700.041 / 883.537 1145.0 54.20650100708008 40 15 10 7 8 6.6023659175308875 15.146085698533561 0.0279998779296875 4 0.9530776481477323 5.674916908316301 1145.0 27.006324404761905 0.0 - - - - - - - 66.47619047619048 2 21 PLCD4 phospholipase C, delta 4 1559 199 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21447.[MT7]-GLQLLVDLVTSMDHQER.3b4_1.heavy 700.041 / 556.357 657.0 54.20650100708008 40 15 10 7 8 6.6023659175308875 15.146085698533561 0.0279998779296875 4 0.9530776481477323 5.674916908316301 657.0 5.327027027027027 0.0 - - - - - - - 0.0 1 0 PLCD4 phospholipase C, delta 4 1561 199 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21447.[MT7]-GLQLLVDLVTSMDHQER.3b5_1.heavy 700.041 / 669.442 911.0 54.20650100708008 40 15 10 7 8 6.6023659175308875 15.146085698533561 0.0279998779296875 4 0.9530776481477323 5.674916908316301 911.0 11.080528022232514 0.0 - - - - - - - 0.0 1 0 PLCD4 phospholipase C, delta 4 1563 199 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21447.[MT7]-GLQLLVDLVTSMDHQER.3y4_1.heavy 700.041 / 569.279 721.0 54.20650100708008 40 15 10 7 8 6.6023659175308875 15.146085698533561 0.0279998779296875 4 0.9530776481477323 5.674916908316301 721.0 7.83020353587877 1.0 - - - - - - - 109.87878787878788 2 33 PLCD4 phospholipase C, delta 4 1565 200 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21446.[MT7]-TTWGDGGENSPC[CAM]NVVSK[MT7].3b5_1.heavy 699.337 / 705.332 4734.0 28.856700897216797 41 11 10 10 10 1.103651369915447 63.958252957227245 0.0 3 0.8626312525579124 3.2909151956972345 4734.0 12.71934839590148 0.0 - - - - - - - 231.125 9 16 SNAP23 synaptosomal-associated protein, 23kDa 1567 200 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21446.[MT7]-TTWGDGGENSPC[CAM]NVVSK[MT7].3b8_1.heavy 699.337 / 948.418 8952.0 28.856700897216797 41 11 10 10 10 1.103651369915447 63.958252957227245 0.0 3 0.8626312525579124 3.2909151956972345 8952.0 27.512793398349583 0.0 - - - - - - - 231.53846153846155 17 13 SNAP23 synaptosomal-associated protein, 23kDa 1569 200 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21446.[MT7]-TTWGDGGENSPC[CAM]NVVSK[MT7].3y5_1.heavy 699.337 / 690.427 5423.0 28.856700897216797 41 11 10 10 10 1.103651369915447 63.958252957227245 0.0 3 0.8626312525579124 3.2909151956972345 5423.0 5.424074074074074 1.0 - - - - - - - 784.5555555555555 10 9 SNAP23 synaptosomal-associated protein, 23kDa 1571 200 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21446.[MT7]-TTWGDGGENSPC[CAM]NVVSK[MT7].3b7_1.heavy 699.337 / 819.375 2238.0 28.856700897216797 41 11 10 10 10 1.103651369915447 63.958252957227245 0.0 3 0.8626312525579124 3.2909151956972345 2238.0 6.753808742642092 1.0 - - - - - - - 207.83333333333334 4 12 SNAP23 synaptosomal-associated protein, 23kDa 1573 201 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21444.[MT7]-EQLNRIEEGLDQINK[MT7].4b11_2.heavy 522.539 / 721.374 34690.0 35.054500579833984 45 15 10 10 10 2.407870472273448 33.46391307172908 0.0 3 0.958837477771329 6.06192121777631 34690.0 76.53825396825398 0.0 - - - - - - - 270.0 69 8 SNAP23 synaptosomal-associated protein, 23kDa 1575 201 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21444.[MT7]-EQLNRIEEGLDQINK[MT7].4b9_1.heavy 522.539 / 1213.63 N/A 35.054500579833984 45 15 10 10 10 2.407870472273448 33.46391307172908 0.0 3 0.958837477771329 6.06192121777631 0.0 0.0 4.0 - - - - - - - 0.0 0 0 SNAP23 synaptosomal-associated protein, 23kDa 1577 201 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21444.[MT7]-EQLNRIEEGLDQINK[MT7].4y3_1.heavy 522.539 / 518.342 28449.0 35.054500579833984 45 15 10 10 10 2.407870472273448 33.46391307172908 0.0 3 0.958837477771329 6.06192121777631 28449.0 36.29147109282031 0.0 - - - - - - - 825.0 56 8 SNAP23 synaptosomal-associated protein, 23kDa 1579 201 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21444.[MT7]-EQLNRIEEGLDQINK[MT7].4b9_2.heavy 522.539 / 607.318 44893.0 35.054500579833984 45 15 10 10 10 2.407870472273448 33.46391307172908 0.0 3 0.958837477771329 6.06192121777631 44893.0 72.1905750915751 0.0 - - - - - - - 754.2857142857143 89 7 SNAP23 synaptosomal-associated protein, 23kDa 1581 202 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20862.[MT7]-LIIEETR.2y4_1.heavy 509.307 / 534.252 9328.0 31.69915008544922 38 13 10 5 10 2.430852350914588 41.13783379824606 0.043498992919921875 3 0.9260717837085346 4.510707689673068 9328.0 28.773905723416313 0.0 - - - - - - - 738.2727272727273 18 11 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1583 202 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20862.[MT7]-LIIEETR.2y5_1.heavy 509.307 / 647.336 17009.0 31.69915008544922 38 13 10 5 10 2.430852350914588 41.13783379824606 0.043498992919921875 3 0.9260717837085346 4.510707689673068 17009.0 22.013587522815385 0.0 - - - - - - - 674.2857142857143 34 7 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1585 202 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20862.[MT7]-LIIEETR.2y6_1.heavy 509.307 / 760.42 17558.0 31.69915008544922 38 13 10 5 10 2.430852350914588 41.13783379824606 0.043498992919921875 3 0.9260717837085346 4.510707689673068 17558.0 13.895530720182599 0.0 - - - - - - - 384.125 35 8 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1587 202 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20862.[MT7]-LIIEETR.2b5_1.heavy 509.307 / 742.447 8450.0 31.69915008544922 38 13 10 5 10 2.430852350914588 41.13783379824606 0.043498992919921875 3 0.9260717837085346 4.510707689673068 8450.0 33.40851288945318 0.0 - - - - - - - 329.125 16 8 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1589 203 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21443.[MT7]-DIK[MT7]PGNLLLTTGGTLK[MT7].3y6_1.heavy 691.76 / 720.437 5402.0 36.404998779296875 44 14 10 10 10 1.9497329536898773 43.97390780295288 0.0 3 0.9369138922249265 4.887485311525274 5402.0 16.24476435185185 0.0 - - - - - - - 280.0 10 12 STK11 serine/threonine kinase 11 1591 203 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21443.[MT7]-DIK[MT7]PGNLLLTTGGTLK[MT7].3b3_1.heavy 691.76 / 645.417 4201.0 36.404998779296875 44 14 10 10 10 1.9497329536898773 43.97390780295288 0.0 3 0.9369138922249265 4.887485311525274 4201.0 5.460133703498057 0.0 - - - - - - - 822.8571428571429 8 7 STK11 serine/threonine kinase 11 1593 203 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21443.[MT7]-DIK[MT7]PGNLLLTTGGTLK[MT7].3y5_1.heavy 691.76 / 619.39 16565.0 36.404998779296875 44 14 10 10 10 1.9497329536898773 43.97390780295288 0.0 3 0.9369138922249265 4.887485311525274 16565.0 25.21561111111111 0.0 - - - - - - - 260.0 33 6 STK11 serine/threonine kinase 11 1595 203 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21443.[MT7]-DIK[MT7]PGNLLLTTGGTLK[MT7].3b7_2.heavy 691.76 / 513.813 15965.0 36.404998779296875 44 14 10 10 10 1.9497329536898773 43.97390780295288 0.0 3 0.9369138922249265 4.887485311525274 15965.0 29.743473914949583 0.0 - - - - - - - 196.36363636363637 31 11 STK11 serine/threonine kinase 11 1597 204 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21546.[MT7]-LENVLLDSEGHIVLTDFGLSK[MT7].3b4_1.heavy 863.146 / 600.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1599 204 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21546.[MT7]-LENVLLDSEGHIVLTDFGLSK[MT7].3b5_1.heavy 863.146 / 713.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1601 204 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21546.[MT7]-LENVLLDSEGHIVLTDFGLSK[MT7].3b3_1.heavy 863.146 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1603 204 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21546.[MT7]-LENVLLDSEGHIVLTDFGLSK[MT7].3y8_1.heavy 863.146 / 1024.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1605 205 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20867.[MT7]-ATQVGEK[MT7].2y4_1.heavy 510.8 / 576.347 5346.0 17.274799346923828 40 14 10 6 10 2.1963668100410962 41.15635875889636 0.037799835205078125 3 0.943301413186281 5.158252445251172 5346.0 59.12460736343947 0.0 - - - - - - - 188.05882352941177 10 17 VASP vasodilator-stimulated phosphoprotein 1607 205 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20867.[MT7]-ATQVGEK[MT7].2b4_1.heavy 510.8 / 544.321 3701.0 17.274799346923828 40 14 10 6 10 2.1963668100410962 41.15635875889636 0.037799835205078125 3 0.943301413186281 5.158252445251172 3701.0 27.219799890350878 0.0 - - - - - - - 189.55 7 20 VASP vasodilator-stimulated phosphoprotein 1609 205 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20867.[MT7]-ATQVGEK[MT7].2b6_1.heavy 510.8 / 730.385 1142.0 17.274799346923828 40 14 10 6 10 2.1963668100410962 41.15635875889636 0.037799835205078125 3 0.943301413186281 5.158252445251172 1142.0 1.9171302431968786 3.0 - - - - - - - 223.33333333333334 8 18 VASP vasodilator-stimulated phosphoprotein 1611 205 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20867.[MT7]-ATQVGEK[MT7].2y6_1.heavy 510.8 / 805.454 3518.0 17.274799346923828 40 14 10 6 10 2.1963668100410962 41.15635875889636 0.037799835205078125 3 0.943301413186281 5.158252445251172 3518.0 34.40963503649635 0.0 - - - - - - - 127.52631578947368 7 19 VASP vasodilator-stimulated phosphoprotein 1613 206 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21549.[MT7]-QLELQILSEPIQAWEGEDIK[MT7].3y7_1.heavy 876.477 / 1020.51 2578.0 48.86484909057617 45 18 10 7 10 18.40138960950114 5.434372192650454 0.0281982421875 3 0.9889390386909139 11.723703042806598 2578.0 8.228019822670687 1.0 - - - - - - - 183.13636363636363 6 22 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1615 206 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21549.[MT7]-QLELQILSEPIQAWEGEDIK[MT7].3b4_1.heavy 876.477 / 628.379 3008.0 48.86484909057617 45 18 10 7 10 18.40138960950114 5.434372192650454 0.0281982421875 3 0.9889390386909139 11.723703042806598 3008.0 12.323455047522 0.0 - - - - - - - 188.04545454545453 6 22 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1617 206 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21549.[MT7]-QLELQILSEPIQAWEGEDIK[MT7].3b5_1.heavy 876.477 / 756.437 6124.0 48.86484909057617 45 18 10 7 10 18.40138960950114 5.434372192650454 0.0281982421875 3 0.9889390386909139 11.723703042806598 6124.0 21.805492171011405 0.0 - - - - - - - 198.55 12 20 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1619 206 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21549.[MT7]-QLELQILSEPIQAWEGEDIK[MT7].3b3_1.heavy 876.477 / 515.295 3707.0 48.86484909057617 45 18 10 7 10 18.40138960950114 5.434372192650454 0.0281982421875 3 0.9889390386909139 11.723703042806598 3707.0 8.21586879432624 0.0 - - - - - - - 196.95833333333334 7 24 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1621 207 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20869.[MT7]-EYSLDTR.2b3_1.heavy 514.262 / 524.247 10488.0 25.068750381469727 40 14 10 6 10 3.4422657253548694 29.05063350090174 0.03060150146484375 3 0.9380335646859986 4.9319146381583305 10488.0 57.62348824494259 0.0 - - - - - - - 269.0625 20 16 WDR61 WD repeat domain 61 1623 207 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20869.[MT7]-EYSLDTR.2y5_1.heavy 514.262 / 591.31 6776.0 25.068750381469727 40 14 10 6 10 3.4422657253548694 29.05063350090174 0.03060150146484375 3 0.9380335646859986 4.9319146381583305 6776.0 13.855246913580245 0.0 - - - - - - - 242.05263157894737 13 19 WDR61 WD repeat domain 61 1625 207 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20869.[MT7]-EYSLDTR.2y6_1.heavy 514.262 / 754.373 15909.0 25.068750381469727 40 14 10 6 10 3.4422657253548694 29.05063350090174 0.03060150146484375 3 0.9380335646859986 4.9319146381583305 15909.0 82.30727733995465 0.0 - - - - - - - 247.65 31 20 WDR61 WD repeat domain 61 1627 207 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20869.[MT7]-EYSLDTR.2b5_1.heavy 514.262 / 752.358 94395.0 25.068750381469727 40 14 10 6 10 3.4422657253548694 29.05063350090174 0.03060150146484375 3 0.9380335646859986 4.9319146381583305 94395.0 580.1369354511316 0.0 - - - - - - - 201.41666666666666 188 12 WDR61 WD repeat domain 61 1629 208 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544247.[MT7]-ILGLAIESQDAGIK[MT7].3b4_1.heavy 572.676 / 541.383 52063.0 40.186100006103516 46 20 10 6 10 5.716453625680956 17.493363289217235 0.03399658203125 3 0.9932693501154286 15.034534233099356 52063.0 51.66615968804136 0.0 - - - - - - - 281.4 104 10 SNAP23 synaptosomal-associated protein, 23kDa 1631 208 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544247.[MT7]-ILGLAIESQDAGIK[MT7].3b5_1.heavy 572.676 / 612.42 106236.0 40.186100006103516 46 20 10 6 10 5.716453625680956 17.493363289217235 0.03399658203125 3 0.9932693501154286 15.034534233099356 106236.0 76.97257943572046 0.0 - - - - - - - 286.55555555555554 212 9 SNAP23 synaptosomal-associated protein, 23kDa 1633 208 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544247.[MT7]-ILGLAIESQDAGIK[MT7].3y4_1.heavy 572.676 / 532.357 45809.0 40.186100006103516 46 20 10 6 10 5.716453625680956 17.493363289217235 0.03399658203125 3 0.9932693501154286 15.034534233099356 45809.0 36.11862759933419 0.0 - - - - - - - 748.2857142857143 91 7 SNAP23 synaptosomal-associated protein, 23kDa 1635 208 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544247.[MT7]-ILGLAIESQDAGIK[MT7].3y5_1.heavy 572.676 / 647.385 36741.0 40.186100006103516 46 20 10 6 10 5.716453625680956 17.493363289217235 0.03399658203125 3 0.9932693501154286 15.034534233099356 36741.0 45.986384618119125 0.0 - - - - - - - 227.45454545454547 73 11 SNAP23 synaptosomal-associated protein, 23kDa 1637 209 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21058.[MT7]-QELLEEVK[MT7].2y4_1.heavy 638.374 / 648.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - VASP vasodilator-stimulated phosphoprotein 1639 209 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21058.[MT7]-QELLEEVK[MT7].2b3_1.heavy 638.374 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - VASP vasodilator-stimulated phosphoprotein 1641 209 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21058.[MT7]-QELLEEVK[MT7].2y5_1.heavy 638.374 / 761.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - VASP vasodilator-stimulated phosphoprotein 1643 209 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21058.[MT7]-QELLEEVK[MT7].2b4_1.heavy 638.374 / 628.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - VASP vasodilator-stimulated phosphoprotein 1645 210 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21057.[MT7]-NQEIWGIK[MT7].3y3_1.heavy 425.915 / 461.32 55505.0 34.08949851989746 40 14 10 6 10 2.2188027467672176 34.7274142386048 0.039600372314453125 3 0.9407158685760616 5.043405255001002 55505.0 51.88758353554884 0.0 - - - - - - - 305.3333333333333 111 3 SKP2 S-phase kinase-associated protein 2 (p45) 1647 210 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21057.[MT7]-NQEIWGIK[MT7].3b4_1.heavy 425.915 / 629.338 20028.0 34.08949851989746 40 14 10 6 10 2.2188027467672176 34.7274142386048 0.039600372314453125 3 0.9407158685760616 5.043405255001002 20028.0 51.041269940958074 0.0 - - - - - - - 228.72727272727272 40 11 SKP2 S-phase kinase-associated protein 2 (p45) 1649 210 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21057.[MT7]-NQEIWGIK[MT7].3y4_1.heavy 425.915 / 647.4 13390.0 34.08949851989746 40 14 10 6 10 2.2188027467672176 34.7274142386048 0.039600372314453125 3 0.9407158685760616 5.043405255001002 13390.0 32.26713766882306 0.0 - - - - - - - 271.75 26 8 SKP2 S-phase kinase-associated protein 2 (p45) 1651 210 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21057.[MT7]-NQEIWGIK[MT7].3b3_1.heavy 425.915 / 516.253 41429.0 34.08949851989746 40 14 10 6 10 2.2188027467672176 34.7274142386048 0.039600372314453125 3 0.9407158685760616 5.043405255001002 41429.0 115.35634379665278 0.0 - - - - - - - 752.1428571428571 82 7 SKP2 S-phase kinase-associated protein 2 (p45) 1653 211 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542136.[MT7]-ASQC[CAM]PHIVR.3b4_1.heavy 404.553 / 591.268 16399.0 19.46940040588379 50 20 10 10 10 23.30921530961122 4.290148710358621 0.0 3 0.999377487711239 49.46133944676466 16399.0 46.93402029017126 0.0 - - - - - - - 716.1428571428571 32 7 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1655 211 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542136.[MT7]-ASQC[CAM]PHIVR.3y4_1.heavy 404.553 / 524.33 30315.0 19.46940040588379 50 20 10 10 10 23.30921530961122 4.290148710358621 0.0 3 0.999377487711239 49.46133944676466 30315.0 112.32679592837297 0.0 - - - - - - - 290.6 60 15 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1657 211 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542136.[MT7]-ASQC[CAM]PHIVR.3b3_1.heavy 404.553 / 431.237 33173.0 19.46940040588379 50 20 10 10 10 23.30921530961122 4.290148710358621 0.0 3 0.999377487711239 49.46133944676466 33173.0 78.08287974724732 0.0 - - - - - - - 762.3636363636364 66 11 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1659 211 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542136.[MT7]-ASQC[CAM]PHIVR.3y5_1.heavy 404.553 / 621.383 41560.0 19.46940040588379 50 20 10 10 10 23.30921530961122 4.290148710358621 0.0 3 0.999377487711239 49.46133944676466 41560.0 262.86990399805563 0.0 - - - - - - - 172.68421052631578 83 19 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1661 212 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21198.[MT7]-IDSTEVIYQPR.2y9_1.heavy 732.894 / 1092.57 10061.0 31.41189956665039 44 14 10 10 10 1.1692732775016956 52.44041368027436 0.0 3 0.9431750113833306 5.1524567990561625 10061.0 72.1702231595946 0.0 - - - - - - - 207.6 20 10 STK11 serine/threonine kinase 11 1663 212 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21198.[MT7]-IDSTEVIYQPR.2b6_1.heavy 732.894 / 789.411 7218.0 31.41189956665039 44 14 10 10 10 1.1692732775016956 52.44041368027436 0.0 3 0.9431750113833306 5.1524567990561625 7218.0 47.66144133412746 0.0 - - - - - - - 273.1666666666667 14 6 STK11 serine/threonine kinase 11 1665 212 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21198.[MT7]-IDSTEVIYQPR.2y10_1.heavy 732.894 / 1207.6 6780.0 31.41189956665039 44 14 10 10 10 1.1692732775016956 52.44041368027436 0.0 3 0.9431750113833306 5.1524567990561625 6780.0 87.88352394118385 0.0 - - - - - - - 238.36363636363637 13 11 STK11 serine/threonine kinase 11 1667 212 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21198.[MT7]-IDSTEVIYQPR.2b5_1.heavy 732.894 / 690.343 4484.0 31.41189956665039 44 14 10 10 10 1.1692732775016956 52.44041368027436 0.0 3 0.9431750113833306 5.1524567990561625 4484.0 5.2440208877284595 1.0 - - - - - - - 750.1428571428571 8 7 STK11 serine/threonine kinase 11 1669 213 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543478.[MT7]-RLGAGPQGAQEVR.3y7_1.heavy 494.947 / 787.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1671 213 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543478.[MT7]-RLGAGPQGAQEVR.3y6_1.heavy 494.947 / 659.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1673 213 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543478.[MT7]-RLGAGPQGAQEVR.3b5_1.heavy 494.947 / 599.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1675 213 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543478.[MT7]-RLGAGPQGAQEVR.3y5_1.heavy 494.947 / 602.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 1677 214 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21394.[MT7]-IYQWINELSSPETR.2b3_1.heavy 940.487 / 549.315 13333.0 45.698201179504395 39 16 10 3 10 11.495455774814783 8.699089619316222 0.07020187377929688 3 0.9678738303104205 6.866940765496569 13333.0 116.68599219792628 0.0 - - - - - - - 143.625 26 16 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1679 214 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21394.[MT7]-IYQWINELSSPETR.2b4_1.heavy 940.487 / 735.395 9569.0 45.698201179504395 39 16 10 3 10 11.495455774814783 8.699089619316222 0.07020187377929688 3 0.9678738303104205 6.866940765496569 9569.0 21.300123042505593 0.0 - - - - - - - 171.92307692307693 19 13 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1681 214 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21394.[MT7]-IYQWINELSSPETR.2y9_1.heavy 940.487 / 1032.5 13652.0 45.698201179504395 39 16 10 3 10 11.495455774814783 8.699089619316222 0.07020187377929688 3 0.9678738303104205 6.866940765496569 13652.0 101.18541176470588 0.0 - - - - - - - 191.35294117647058 27 17 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1683 214 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21394.[MT7]-IYQWINELSSPETR.2y10_1.heavy 940.487 / 1145.58 6188.0 45.698201179504395 39 16 10 3 10 11.495455774814783 8.699089619316222 0.07020187377929688 3 0.9678738303104205 6.866940765496569 6188.0 38.240591818973016 0.0 - - - - - - - 195.5 12 16 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1685 215 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21599.[MT7]-TFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPK[MT7].4b8_1.heavy 1028.03 / 1048.54 1006.0 52.71900177001953 45 15 10 10 10 1.9065012520872489 38.23160344259768 0.0 3 0.959058689874611 6.078389661180436 1006.0 0.06424010217113663 2.0 - - - - - - - 167.64285714285714 2 14 CASP9 caspase 9, apoptosis-related cysteine peptidase 1687 215 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21599.[MT7]-TFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPK[MT7].4b7_1.heavy 1028.03 / 935.459 2311.0 52.71900177001953 45 15 10 10 10 1.9065012520872489 38.23160344259768 0.0 3 0.959058689874611 6.078389661180436 2311.0 33.601403038427165 0.0 - - - - - - - 143.85714285714286 4 14 CASP9 caspase 9, apoptosis-related cysteine peptidase 1689 215 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21599.[MT7]-TFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPK[MT7].4b4_1.heavy 1028.03 / 636.311 2311.0 52.71900177001953 45 15 10 10 10 1.9065012520872489 38.23160344259768 0.0 3 0.959058689874611 6.078389661180436 2311.0 23.92175293784875 0.0 - - - - - - - 186.30769230769232 4 13 CASP9 caspase 9, apoptosis-related cysteine peptidase 1691 215 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21599.[MT7]-TFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPK[MT7].4b6_1.heavy 1028.03 / 864.422 2087.0 52.71900177001953 45 15 10 10 10 1.9065012520872489 38.23160344259768 0.0 3 0.959058689874611 6.078389661180436 2087.0 35.144760153256705 0.0 - - - - - - - 166.3846153846154 4 13 CASP9 caspase 9, apoptosis-related cysteine peptidase 1693 216 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20898.[MT7]-NFFLTNR.2y4_1.heavy 528.291 / 503.294 5408.0 35.13859939575195 45 15 10 10 10 1.8810918065208297 42.84080269978434 0.0 3 0.954493838825401 5.763236367439459 5408.0 8.416969208546126 0.0 - - - - - - - 1236.2857142857142 10 7 CAPN2 calpain 2, (m/II) large subunit 1695 216 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20898.[MT7]-NFFLTNR.2b3_1.heavy 528.291 / 553.289 6609.0 35.13859939575195 45 15 10 10 10 1.8810918065208297 42.84080269978434 0.0 3 0.954493838825401 5.763236367439459 6609.0 11.726107702402425 0.0 - - - - - - - 330.625 13 8 CAPN2 calpain 2, (m/II) large subunit 1697 216 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20898.[MT7]-NFFLTNR.2y5_1.heavy 528.291 / 650.362 9253.0 35.13859939575195 45 15 10 10 10 1.8810918065208297 42.84080269978434 0.0 3 0.954493838825401 5.763236367439459 9253.0 26.22787674726127 0.0 - - - - - - - 652.4285714285714 18 7 CAPN2 calpain 2, (m/II) large subunit 1699 216 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20898.[MT7]-NFFLTNR.2y6_1.heavy 528.291 / 797.43 11056.0 35.13859939575195 45 15 10 10 10 1.8810918065208297 42.84080269978434 0.0 3 0.954493838825401 5.763236367439459 11056.0 36.173546443061 0.0 - - - - - - - 266.14285714285717 22 14 CAPN2 calpain 2, (m/II) large subunit 1701 217 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20795.[MT7]-LTILAK[MT7].2y4_1.heavy 473.831 / 588.42 14596.0 33.92424964904785 44 18 10 6 10 4.689318431532872 21.325060658615033 0.03820037841796875 3 0.9811922541475928 8.984852702459367 14596.0 20.64565789473684 0.0 - - - - - - - 709.3333333333334 29 9 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 1703 217 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20795.[MT7]-LTILAK[MT7].2y5_1.heavy 473.831 / 689.468 35919.0 33.92424964904785 44 18 10 6 10 4.689318431532872 21.325060658615033 0.03820037841796875 3 0.9811922541475928 8.984852702459367 35919.0 39.46328173374613 0.0 - - - - - - - 700.2857142857143 71 7 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 1705 217 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20795.[MT7]-LTILAK[MT7].2b4_1.heavy 473.831 / 585.409 10947.0 33.92424964904785 44 18 10 6 10 4.689318431532872 21.325060658615033 0.03820037841796875 3 0.9811922541475928 8.984852702459367 10947.0 27.22346052631579 0.0 - - - - - - - 732.8571428571429 21 7 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 1707 217 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20795.[MT7]-LTILAK[MT7].2y3_1.heavy 473.831 / 475.336 36603.0 33.92424964904785 44 18 10 6 10 4.689318431532872 21.325060658615033 0.03820037841796875 3 0.9811922541475928 8.984852702459367 36603.0 59.96716905901116 0.0 - - - - - - - 798.0 73 8 LOC100510546;STX5 syntaxin-5-like;syntaxin 5 1709 218 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543277.[MT7]-ETVNVITLYK[MT7].3y3_1.heavy 489.96 / 567.362 11862.0 36.681800842285156 41 11 10 10 10 1.0286973870465468 64.80687858853297 0.0 3 0.8700057447793017 3.385160947122062 11862.0 27.617312868949234 0.0 - - - - - - - 282.3333333333333 23 9 TSG101 tumor susceptibility gene 101 1711 218 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543277.[MT7]-ETVNVITLYK[MT7].3b4_1.heavy 489.96 / 588.311 19245.0 36.681800842285156 41 11 10 10 10 1.0286973870465468 64.80687858853297 0.0 3 0.8700057447793017 3.385160947122062 19245.0 73.72327036599764 0.0 - - - - - - - 302.5 38 8 TSG101 tumor susceptibility gene 101 1713 218 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543277.[MT7]-ETVNVITLYK[MT7].3b5_1.heavy 489.96 / 687.379 20940.0 36.681800842285156 41 11 10 10 10 1.0286973870465468 64.80687858853297 0.0 3 0.8700057447793017 3.385160947122062 20940.0 81.33719008264464 0.0 - - - - - - - 352.0 41 11 TSG101 tumor susceptibility gene 101 1715 218 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543277.[MT7]-ETVNVITLYK[MT7].3y4_1.heavy 489.96 / 668.41 27112.0 36.681800842285156 41 11 10 10 10 1.0286973870465468 64.80687858853297 0.0 3 0.8700057447793017 3.385160947122062 27112.0 157.40644628099173 0.0 - - - - - - - 255.44444444444446 54 9 TSG101 tumor susceptibility gene 101 1717 219 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20794.[MT7]-AIVAFK[MT7].2b3_1.heavy 468.81 / 428.299 8653.0 31.677400588989258 46 18 10 10 8 3.584781407768035 27.895703705477047 0.0 4 0.9880543150554 11.280375660425072 8653.0 2.6146591701056017 2.0 - - - - - - - 718.0 42 9 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1719 219 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20794.[MT7]-AIVAFK[MT7].2y4_1.heavy 468.81 / 608.389 11720.0 31.677400588989258 46 18 10 10 8 3.584781407768035 27.895703705477047 0.0 4 0.9880543150554 11.280375660425072 11720.0 45.25289863560978 0.0 - - - - - - - 298.90909090909093 23 11 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1721 219 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20794.[MT7]-AIVAFK[MT7].2y5_1.heavy 468.81 / 721.473 7557.0 31.677400588989258 46 18 10 10 8 3.584781407768035 27.895703705477047 0.0 4 0.9880543150554 11.280375660425072 7557.0 43.82369863013698 0.0 - - - - - - - 249.1818181818182 15 11 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1723 219 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20794.[MT7]-AIVAFK[MT7].2y3_1.heavy 468.81 / 509.32 19934.0 31.677400588989258 46 18 10 10 8 3.584781407768035 27.895703705477047 0.0 4 0.9880543150554 11.280375660425072 19934.0 52.127481797669866 0.0 - - - - - - - 688.5714285714286 39 7 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1725 220 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20895.[MT7]-FVIVDC[CAM]R.2b3_1.heavy 526.788 / 504.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25B cell division cycle 25 homolog B (S. pombe) 1727 220 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20895.[MT7]-FVIVDC[CAM]R.2y5_1.heavy 526.788 / 662.329 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25B cell division cycle 25 homolog B (S. pombe) 1729 220 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20895.[MT7]-FVIVDC[CAM]R.2y6_1.heavy 526.788 / 761.397 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25B cell division cycle 25 homolog B (S. pombe) 1731 220 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20895.[MT7]-FVIVDC[CAM]R.2b5_1.heavy 526.788 / 718.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC25B cell division cycle 25 homolog B (S. pombe) 1733 221 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21061.[MT7]-ASLISAVSDK[MT7].3y3_1.heavy 426.922 / 493.274 37909.0 32.596900939941406 48 18 10 10 10 2.263129528159377 33.142458837205815 0.0 3 0.9884391329419917 11.466948838116918 37909.0 53.295649609905894 0.0 - - - - - - - 745.6666666666666 75 12 TSG101 tumor susceptibility gene 101 1735 221 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21061.[MT7]-ASLISAVSDK[MT7].3b4_1.heavy 426.922 / 529.347 7604.0 32.596900939941406 48 18 10 10 10 2.263129528159377 33.142458837205815 0.0 3 0.9884391329419917 11.466948838116918 7604.0 7.819789540152229 1.0 - - - - - - - 326.0 15 12 TSG101 tumor susceptibility gene 101 1737 221 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21061.[MT7]-ASLISAVSDK[MT7].3b5_1.heavy 426.922 / 616.379 9841.0 32.596900939941406 48 18 10 10 10 2.263129528159377 33.142458837205815 0.0 3 0.9884391329419917 11.466948838116918 9841.0 16.558617481232282 0.0 - - - - - - - 671.0 19 7 TSG101 tumor susceptibility gene 101 1739 221 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21061.[MT7]-ASLISAVSDK[MT7].3y4_1.heavy 426.922 / 592.342 7157.0 32.596900939941406 48 18 10 10 10 2.263129528159377 33.142458837205815 0.0 3 0.9884391329419917 11.466948838116918 7157.0 18.56276097139612 2.0 - - - - - - - 658.5555555555555 21 9 TSG101 tumor susceptibility gene 101 1741 222 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21457.[MT7]-TLQVFGIVPDGTLQLLK[MT7].3b6_1.heavy 710.764 / 790.458 41785.0 49.30120086669922 50 20 10 10 10 6.656730041557571 15.022390779813199 0.0 3 0.9944793235613016 16.602222126283763 41785.0 200.61885395537524 0.0 - - - - - - - 691.5555555555555 83 9 SKP2 S-phase kinase-associated protein 2 (p45) 1743 222 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21457.[MT7]-TLQVFGIVPDGTLQLLK[MT7].3b4_1.heavy 710.764 / 586.368 36189.0 49.30120086669922 50 20 10 10 10 6.656730041557571 15.022390779813199 0.0 3 0.9944793235613016 16.602222126283763 36189.0 123.32948758388034 0.0 - - - - - - - 620.1428571428571 72 7 SKP2 S-phase kinase-associated protein 2 (p45) 1745 222 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21457.[MT7]-TLQVFGIVPDGTLQLLK[MT7].3b7_1.heavy 710.764 / 903.542 20448.0 49.30120086669922 50 20 10 10 10 6.656730041557571 15.022390779813199 0.0 3 0.9944793235613016 16.602222126283763 20448.0 132.99643921616433 0.0 - - - - - - - 197.7826086956522 40 23 SKP2 S-phase kinase-associated protein 2 (p45) 1747 222 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21457.[MT7]-TLQVFGIVPDGTLQLLK[MT7].3y9_1.heavy 710.764 / 1128.67 30437.0 49.30120086669922 50 20 10 10 10 6.656730041557571 15.022390779813199 0.0 3 0.9944793235613016 16.602222126283763 30437.0 326.0248045160703 0.0 - - - - - - - 235.27272727272728 60 22 SKP2 S-phase kinase-associated protein 2 (p45) 1749 223 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20798.[MT7]-LYEAC[CAM]R.2y4_1.heavy 478.243 / 535.229 4843.0 23.612125396728516 46 20 10 6 10 26.632678035409747 3.7547857510628107 0.03549957275390625 3 0.9987836762835692 35.38292666138634 4843.0 12.077155388471176 0.0 - - - - - - - 616.3125 9 16 CDC16 cell division cycle 16 homolog (S. cerevisiae) 1751 223 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20798.[MT7]-LYEAC[CAM]R.2b3_1.heavy 478.243 / 550.299 6153.0 23.612125396728516 46 20 10 6 10 26.632678035409747 3.7547857510628107 0.03549957275390625 3 0.9987836762835692 35.38292666138634 6153.0 6.0561515030047115 0.0 - - - - - - - 627.0 12 12 CDC16 cell division cycle 16 homolog (S. cerevisiae) 1753 223 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20798.[MT7]-LYEAC[CAM]R.2y5_1.heavy 478.243 / 698.293 20225.0 23.612125396728516 46 20 10 6 10 26.632678035409747 3.7547857510628107 0.03549957275390625 3 0.9987836762835692 35.38292666138634 20225.0 50.313885466173794 0.0 - - - - - - - 267.9 40 10 CDC16 cell division cycle 16 homolog (S. cerevisiae) 1755 223 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20798.[MT7]-LYEAC[CAM]R.2b4_1.heavy 478.243 / 621.336 3703.0 23.612125396728516 46 20 10 6 10 26.632678035409747 3.7547857510628107 0.03549957275390625 3 0.9987836762835692 35.38292666138634 3703.0 15.30194608998352 0.0 - - - - - - - 278.29411764705884 7 17 CDC16 cell division cycle 16 homolog (S. cerevisiae) 1757 224 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21062.[MT7]-VPQTPLHTSR.3y6_1.heavy 427.246 / 710.394 9477.0 23.37079954147339 39 13 10 6 10 0.9048913904841852 57.265623521767935 0.03880119323730469 3 0.9042644377561436 3.9563842953668047 9477.0 38.6248732946178 1.0 - - - - - - - 286.5882352941176 18 17 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1759 224 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21062.[MT7]-VPQTPLHTSR.3b4_1.heavy 427.246 / 570.337 7943.0 23.37079954147339 39 13 10 6 10 0.9048913904841852 57.265623521767935 0.03880119323730469 3 0.9042644377561436 3.9563842953668047 7943.0 12.250398009950247 1.0 - - - - - - - 748.8888888888889 15 9 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1761 224 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21062.[MT7]-VPQTPLHTSR.3b3_1.heavy 427.246 / 469.289 10901.0 23.37079954147339 39 13 10 6 10 0.9048913904841852 57.265623521767935 0.03880119323730469 3 0.9042644377561436 3.9563842953668047 10901.0 46.043036529680364 0.0 - - - - - - - 332.26666666666665 21 15 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1763 224 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21062.[MT7]-VPQTPLHTSR.3y4_1.heavy 427.246 / 500.258 19994.0 23.37079954147339 39 13 10 6 10 0.9048913904841852 57.265623521767935 0.03880119323730469 3 0.9042644377561436 3.9563842953668047 19994.0 39.31682378640137 0.0 - - - - - - - 772.8888888888889 39 9 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1765 225 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542602.[MT7]-GFETAPLTK[MT7].3y3_1.heavy 417.911 / 505.347 45575.0 29.690275192260742 39 13 10 6 10 12.322886220003184 8.114982011087186 0.03929901123046875 3 0.92697735728887 4.538942796748185 45575.0 60.010937152745456 0.0 - - - - - - - 401.0 91 1 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1767 225 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542602.[MT7]-GFETAPLTK[MT7].3b5_1.heavy 417.911 / 650.327 33255.0 29.690275192260742 39 13 10 6 10 12.322886220003184 8.114982011087186 0.03929901123046875 3 0.92697735728887 4.538942796748185 33255.0 91.7301417113799 0.0 - - - - - - - 667.6666666666666 66 9 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1769 225 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542602.[MT7]-GFETAPLTK[MT7].3y4_1.heavy 417.911 / 602.399 41468.0 29.690275192260742 39 13 10 6 10 12.322886220003184 8.114982011087186 0.03929901123046875 3 0.92697735728887 4.538942796748185 41468.0 123.55029758463095 0.0 - - - - - - - 672.4285714285714 82 7 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1771 225 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542602.[MT7]-GFETAPLTK[MT7].3b3_1.heavy 417.911 / 478.242 16928.0 29.690275192260742 39 13 10 6 10 12.322886220003184 8.114982011087186 0.03929901123046875 3 0.92697735728887 4.538942796748185 16928.0 23.078363728788634 0.0 - - - - - - - 651.0 33 8 ARHGEF6 Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 1773 226 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20797.[MT7]-SAFVVER.2y4_1.heavy 476.273 / 502.298 N/A 27.436766306559246 36 18 2 6 10 3.220837422734013 24.770681948741178 0.030500411987304688 3 0.9807237502809614 8.87464497757792 3516.0 1.92 5.0 - - - - - - - 1273.4615384615386 34 13 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1775 226 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20797.[MT7]-SAFVVER.2y5_1.heavy 476.273 / 649.367 4834.0 27.436766306559246 36 18 2 6 10 3.220837422734013 24.770681948741178 0.030500411987304688 3 0.9807237502809614 8.87464497757792 4834.0 16.264793077080885 1.0 - - - - - - - 702.0 9 12 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1777 226 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20797.[MT7]-SAFVVER.2b4_1.heavy 476.273 / 549.315 7178.0 27.436766306559246 36 18 2 6 10 3.220837422734013 24.770681948741178 0.030500411987304688 3 0.9807237502809614 8.87464497757792 7178.0 13.471191796817983 0.0 - - - - - - - 755.25 14 16 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1779 226 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20797.[MT7]-SAFVVER.2y6_1.heavy 476.273 / 720.404 6812.0 27.436766306559246 36 18 2 6 10 3.220837422734013 24.770681948741178 0.030500411987304688 3 0.9807237502809614 8.87464497757792 6812.0 26.054006318565136 0.0 - - - - - - - 638.2857142857143 13 7 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1781 227 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21458.[MT7]-QVC[CAM]PLDNREWEFQK[MT7].3b6_1.heavy 713.029 / 857.431 2549.0 34.129098892211914 39 13 10 6 10 0.9111045862680011 68.33019433796963 0.039600372314453125 3 0.9110713740735173 4.107422216412351 2549.0 22.443962541383033 0.0 - - - - - - - 276.46153846153845 5 13 RBX1 ring-box 1, E3 ubiquitin protein ligase 1783 227 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21458.[MT7]-QVC[CAM]PLDNREWEFQK[MT7].3y11_2.heavy 713.029 / 803.411 1274.0 34.129098892211914 39 13 10 6 10 0.9111045862680011 68.33019433796963 0.039600372314453125 3 0.9110713740735173 4.107422216412351 1274.0 2.7504321208260176 1.0 - - - - - - - 273.35714285714283 2 14 RBX1 ring-box 1, E3 ubiquitin protein ligase 1785 227 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21458.[MT7]-QVC[CAM]PLDNREWEFQK[MT7].3y8_2.heavy 713.029 / 640.829 7763.0 34.129098892211914 39 13 10 6 10 0.9111045862680011 68.33019433796963 0.039600372314453125 3 0.9110713740735173 4.107422216412351 7763.0 44.50340517241379 0.0 - - - - - - - 221.36363636363637 15 11 RBX1 ring-box 1, E3 ubiquitin protein ligase 1787 227 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21458.[MT7]-QVC[CAM]PLDNREWEFQK[MT7].3y5_1.heavy 713.029 / 881.464 1043.0 34.129098892211914 39 13 10 6 10 0.9111045862680011 68.33019433796963 0.039600372314453125 3 0.9110713740735173 4.107422216412351 1043.0 0.7205526770293611 1.0 - - - - - - - 263.5 2 22 RBX1 ring-box 1, E3 ubiquitin protein ligase 1789 228 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20891.[MT7]-QASQVTK[MT7].2y6_1.heavy 525.313 / 777.459 N/A 16.56679916381836 50 20 10 10 10 6.882410927244399 14.52979211167769 0.0 3 0.9947632306981917 17.04672446476263 1330.0 7.512633710179529 1.0 - - - - - - - 147.1 2 20 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1791 228 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20891.[MT7]-QASQVTK[MT7].2b5_1.heavy 525.313 / 658.364 806.0 16.56679916381836 50 20 10 10 10 6.882410927244399 14.52979211167769 0.0 3 0.9947632306981917 17.04672446476263 806.0 8.042992790574994 0.0 - - - - - - - 0.0 1 0 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1793 228 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20891.[MT7]-QASQVTK[MT7].2y5_1.heavy 525.313 / 706.422 1048.0 16.56679916381836 50 20 10 10 10 6.882410927244399 14.52979211167769 0.0 3 0.9947632306981917 17.04672446476263 1048.0 2.0451257653847845 0.0 - - - - - - - 122.80952380952381 2 21 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1795 228 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20891.[MT7]-QASQVTK[MT7].2b4_1.heavy 525.313 / 559.296 1048.0 16.56679916381836 50 20 10 10 10 6.882410927244399 14.52979211167769 0.0 3 0.9947632306981917 17.04672446476263 1048.0 5.151673349153096 0.0 - - - - - - - 144.5 2 24 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1797 229 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20796.[MT7]-ATTLEK[MT7].2y4_1.heavy 475.792 / 634.389 2289.0 20.803425312042236 41 18 10 3 10 6.402834038008081 15.618084024415847 0.05990028381347656 3 0.9839947253771856 9.74203862636768 2289.0 6.851762440924552 0.0 - - - - - - - 700.4 4 10 CDC16 cell division cycle 16 homolog (S. cerevisiae) 1799 229 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20796.[MT7]-ATTLEK[MT7].2y5_1.heavy 475.792 / 735.437 5218.0 20.803425312042236 41 18 10 3 10 6.402834038008081 15.618084024415847 0.05990028381347656 3 0.9839947253771856 9.74203862636768 5218.0 21.633564728136037 0.0 - - - - - - - 257.4583333333333 10 24 CDC16 cell division cycle 16 homolog (S. cerevisiae) 1801 229 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20796.[MT7]-ATTLEK[MT7].2b4_1.heavy 475.792 / 531.326 1419.0 20.803425312042236 41 18 10 3 10 6.402834038008081 15.618084024415847 0.05990028381347656 3 0.9839947253771856 9.74203862636768 1419.0 3.4280517534086687 7.0 - - - - - - - 661.7692307692307 11 13 CDC16 cell division cycle 16 homolog (S. cerevisiae) 1803 229 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20796.[MT7]-ATTLEK[MT7].2y3_1.heavy 475.792 / 533.341 2472.0 20.803425312042236 41 18 10 3 10 6.402834038008081 15.618084024415847 0.05990028381347656 3 0.9839947253771856 9.74203862636768 2472.0 7.294426229508196 0.0 - - - - - - - 659.0 4 10 CDC16 cell division cycle 16 homolog (S. cerevisiae) 1805 230 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543271.[MT7]-TSLAPIIVHVK[MT7].3b6_1.heavy 489.316 / 727.447 32171.0 33.95289993286133 48 18 10 10 10 4.0614484035253895 24.621758068672918 0.0 3 0.9807885246833384 8.889641819832903 32171.0 158.84420408181606 0.0 - - - - - - - 246.72727272727272 64 11 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1807 230 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543271.[MT7]-TSLAPIIVHVK[MT7].3y3_1.heavy 489.316 / 527.342 47608.0 33.95289993286133 48 18 10 10 10 4.0614484035253895 24.621758068672918 0.0 3 0.9807885246833384 8.889641819832903 47608.0 68.34319883906907 0.0 - - - - - - - 782.0909090909091 95 11 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1809 230 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543271.[MT7]-TSLAPIIVHVK[MT7].3b4_1.heavy 489.316 / 517.31 75537.0 33.95289993286133 48 18 10 10 10 4.0614484035253895 24.621758068672918 0.0 3 0.9807885246833384 8.889641819832903 75537.0 85.34630438322347 0.0 - - - - - - - 1212.142857142857 151 7 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1811 230 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB543271.[MT7]-TSLAPIIVHVK[MT7].3y4_1.heavy 489.316 / 626.411 20269.0 33.95289993286133 48 18 10 10 10 4.0614484035253895 24.621758068672918 0.0 3 0.9807885246833384 8.889641819832903 20269.0 58.321750935947335 0.0 - - - - - - - 177.0 40 10 CACNB4 calcium channel, voltage-dependent, beta 4 subunit 1813 231 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21067.[MT7]-QC[CAM]LPDQLK[MT7].2b3_1.heavy 645.36 / 546.283 N/A 27.672033309936523 27 14 2 3 8 2.686157665119369 37.22789667134306 0.06310081481933594 4 0.94292160214598 5.140895587158831 2583.0 5.374453053995479 7.0 - - - - - - - 679.0 12 15 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1815 231 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21067.[MT7]-QC[CAM]LPDQLK[MT7].2y5_1.heavy 645.36 / 744.437 1771.0 27.672033309936523 27 14 2 3 8 2.686157665119369 37.22789667134306 0.06310081481933594 4 0.94292160214598 5.140895587158831 1771.0 1.3086206896551722 0.0 - - - - - - - 209.16666666666666 3 12 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1817 231 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21067.[MT7]-QC[CAM]LPDQLK[MT7].2b5_1.heavy 645.36 / 758.362 885.0 27.672033309936523 27 14 2 3 8 2.686157665119369 37.22789667134306 0.06310081481933594 4 0.94292160214598 5.140895587158831 885.0 -0.02032520325203263 2.0 - - - - - - - 0.0 1 0 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1819 231 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21067.[MT7]-QC[CAM]LPDQLK[MT7].2y7_1.heavy 645.36 / 1017.55 1254.0 27.672033309936523 27 14 2 3 8 2.686157665119369 37.22789667134306 0.06310081481933594 4 0.94292160214598 5.140895587158831 1254.0 5.083783783783784 1.0 - - - - - - - 189.8095238095238 3 21 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 1821 232 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542325.[MT7]-NAIIDDYK[MT7].3y3_1.heavy 413.899 / 569.305 15682.0 29.721449851989746 43 18 10 5 10 6.2774589276914785 15.930012629612662 0.04269981384277344 3 0.9897480411327908 12.178315251316775 15682.0 23.275341650369363 0.0 - - - - - - - 247.44444444444446 31 9 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1823 232 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542325.[MT7]-NAIIDDYK[MT7].3b4_1.heavy 413.899 / 556.357 8809.0 29.721449851989746 43 18 10 5 10 6.2774589276914785 15.930012629612662 0.04269981384277344 3 0.9897480411327908 12.178315251316775 8809.0 31.99079489256164 0.0 - - - - - - - 738.25 17 8 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1825 232 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542325.[MT7]-NAIIDDYK[MT7].3y4_1.heavy 413.899 / 684.332 13358.0 29.721449851989746 43 18 10 5 10 6.2774589276914785 15.930012629612662 0.04269981384277344 3 0.9897480411327908 12.178315251316775 13358.0 78.32930516431924 0.0 - - - - - - - 301.1111111111111 26 9 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1827 232 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542325.[MT7]-NAIIDDYK[MT7].3b3_1.heavy 413.899 / 443.273 38429.0 29.721449851989746 43 18 10 5 10 6.2774589276914785 15.930012629612662 0.04269981384277344 3 0.9897480411327908 12.178315251316775 38429.0 59.971412203787054 0.0 - - - - - - - 705.4285714285714 76 7 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1829 233 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585179.[MT7]-FLQESNVLYQHNLR.3y7_1.heavy 635.675 / 943.511 23622.0 35.555198669433594 48 18 10 10 10 3.9721350187885793 20.052436209821757 0.0 3 0.9879487984710619 11.230784161516969 23622.0 208.06740475640729 0.0 - - - - - - - 284.3333333333333 47 9 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1831 233 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585179.[MT7]-FLQESNVLYQHNLR.3b6_1.heavy 635.675 / 863.438 22283.0 35.555198669433594 48 18 10 10 10 3.9721350187885793 20.052436209821757 0.0 3 0.9879487984710619 11.230784161516969 22283.0 106.22580821917808 0.0 - - - - - - - 226.35714285714286 44 14 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1833 233 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585179.[MT7]-FLQESNVLYQHNLR.3y6_1.heavy 635.675 / 830.427 33241.0 35.555198669433594 48 18 10 10 10 3.9721350187885793 20.052436209821757 0.0 3 0.9879487984710619 11.230784161516969 33241.0 92.05174727469176 0.0 - - - - - - - 231.5 66 10 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1835 233 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585179.[MT7]-FLQESNVLYQHNLR.3b3_1.heavy 635.675 / 533.32 14977.0 35.555198669433594 48 18 10 10 10 3.9721350187885793 20.052436209821757 0.0 3 0.9879487984710619 11.230784161516969 14977.0 82.31800471592184 0.0 - - - - - - - 297.77777777777777 29 9 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1837 234 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 241816.0 44.294700622558594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 241816.0 474.72683245510905 0.0 - - - - - - - 757.4285714285714 483 7 1839 234 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 347099.0 44.294700622558594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 347099.0 329.49992416088276 0.0 - - - - - - - 234.2 694 10 1841 234 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 385069.0 44.294700622558594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 385069.0 1202.8687563073513 0.0 - - - - - - - 234.26666666666668 770 15 1843 235 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21065.[MT7]-LQNLSLEGLR.2y8_1.heavy 643.881 / 901.51 13163.0 37.679100036621094 43 18 10 5 10 5.123753418811593 19.51694233232521 0.04360198974609375 3 0.9825458714918595 9.32780735364803 13163.0 62.564111896636604 0.0 - - - - - - - 209.375 26 8 SKP2 S-phase kinase-associated protein 2 (p45) 1845 235 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21065.[MT7]-LQNLSLEGLR.2y9_1.heavy 643.881 / 1029.57 26437.0 37.679100036621094 43 18 10 5 10 5.123753418811593 19.51694233232521 0.04360198974609375 3 0.9825458714918595 9.32780735364803 26437.0 118.97862569027961 0.0 - - - - - - - 233.45454545454547 52 11 SKP2 S-phase kinase-associated protein 2 (p45) 1847 235 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21065.[MT7]-LQNLSLEGLR.2y6_1.heavy 643.881 / 674.383 15505.0 37.679100036621094 43 18 10 5 10 5.123753418811593 19.51694233232521 0.04360198974609375 3 0.9825458714918595 9.32780735364803 15505.0 39.62771915941265 0.0 - - - - - - - 302.7142857142857 31 7 SKP2 S-phase kinase-associated protein 2 (p45) 1849 235 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21065.[MT7]-LQNLSLEGLR.2y7_1.heavy 643.881 / 787.467 6247.0 37.679100036621094 43 18 10 5 10 5.123753418811593 19.51694233232521 0.04360198974609375 3 0.9825458714918595 9.32780735364803 6247.0 17.773816702665368 0.0 - - - - - - - 223.3125 12 16 SKP2 S-phase kinase-associated protein 2 (p45) 1851 236 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539471.[MT7]-DPVNQR.2b3_1.heavy 436.739 / 456.258 4509.0 16.366100311279297 50 20 10 10 10 9.087469253516243 11.004163778744745 0.0 3 0.9991606969823064 42.596370651902134 4509.0 17.36930548464584 0.0 - - - - - - - 266.2 9 20 SHC4;SHC1 SHC (Src homology 2 domain containing) family, member 4;SHC (Src homology 2 domain containing) transforming protein 1 1853 236 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539471.[MT7]-DPVNQR.2y4_1.heavy 436.739 / 516.289 2064.0 16.366100311279297 50 20 10 10 10 9.087469253516243 11.004163778744745 0.0 3 0.9991606969823064 42.596370651902134 2064.0 0.0 2.0 - - - - - - - 218.47826086956522 4 23 SHC4;SHC1 SHC (Src homology 2 domain containing) family, member 4;SHC (Src homology 2 domain containing) transforming protein 1 1855 236 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539471.[MT7]-DPVNQR.2y5_1.heavy 436.739 / 613.342 63992.0 16.366100311279297 50 20 10 10 10 9.087469253516243 11.004163778744745 0.0 3 0.9991606969823064 42.596370651902134 63992.0 246.6767280163599 0.0 - - - - - - - 265.3076923076923 127 13 SHC4;SHC1 SHC (Src homology 2 domain containing) family, member 4;SHC (Src homology 2 domain containing) transforming protein 1 1857 236 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539471.[MT7]-DPVNQR.2b4_1.heavy 436.739 / 570.3 2309.0 16.366100311279297 50 20 10 10 10 9.087469253516243 11.004163778744745 0.0 3 0.9991606969823064 42.596370651902134 2309.0 13.539908088235293 0.0 - - - - - - - 177.75 4 24 SHC4;SHC1 SHC (Src homology 2 domain containing) family, member 4;SHC (Src homology 2 domain containing) transforming protein 1 1859 237 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544971.[MT7]-ETSILEEYSINWTQK[MT7].3b6_1.heavy 710.372 / 817.442 10043.0 42.58060073852539 48 18 10 10 10 18.037136336235786 5.544117321944535 0.0 3 0.9823490921242126 9.275513474824532 10043.0 33.5841291701573 0.0 - - - - - - - 281.0 20 20 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1861 237 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544971.[MT7]-ETSILEEYSINWTQK[MT7].3b4_1.heavy 710.372 / 575.316 21539.0 42.58060073852539 48 18 10 10 10 18.037136336235786 5.544117321944535 0.0 3 0.9823490921242126 9.275513474824532 21539.0 46.22454540840293 0.0 - - - - - - - 688.2 43 10 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1863 237 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544971.[MT7]-ETSILEEYSINWTQK[MT7].3b5_1.heavy 710.372 / 688.4 19076.0 42.58060073852539 48 18 10 10 10 18.037136336235786 5.544117321944535 0.0 3 0.9823490921242126 9.275513474824532 19076.0 32.77598840893641 0.0 - - - - - - - 646.0 38 13 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1865 237 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544971.[MT7]-ETSILEEYSINWTQK[MT7].3b7_1.heavy 710.372 / 946.485 16423.0 42.58060073852539 48 18 10 10 10 18.037136336235786 5.544117321944535 0.0 3 0.9823490921242126 9.275513474824532 16423.0 20.40075299760192 0.0 - - - - - - - 631.4444444444445 32 9 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1867 238 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540081.[MT7]-QIALALR.2y5_1.heavy 464.807 / 543.361 10893.0 32.94240093231201 44 18 10 6 10 6.101357174317214 16.38979609666774 0.039203643798828125 3 0.9891928725667841 11.860836882501653 10893.0 12.857242769625584 0.0 - - - - - - - 287.1111111111111 21 9 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1869 238 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540081.[MT7]-QIALALR.2b4_1.heavy 464.807 / 570.373 5615.0 32.94240093231201 44 18 10 6 10 6.101357174317214 16.38979609666774 0.039203643798828125 3 0.9891928725667841 11.860836882501653 5615.0 6.843129770992366 0.0 - - - - - - - 272.57142857142856 11 7 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1871 238 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540081.[MT7]-QIALALR.2y6_1.heavy 464.807 / 656.445 15721.0 32.94240093231201 44 18 10 6 10 6.101357174317214 16.38979609666774 0.039203643798828125 3 0.9891928725667841 11.860836882501653 15721.0 15.956280623608016 1.0 - - - - - - - 757.875 31 8 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1873 238 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540081.[MT7]-QIALALR.2b5_1.heavy 464.807 / 641.41 6288.0 32.94240093231201 44 18 10 6 10 6.101357174317214 16.38979609666774 0.039203643798828125 3 0.9891928725667841 11.860836882501653 6288.0 15.06336819054571 0.0 - - - - - - - 673.5714285714286 12 7 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1875 239 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20884.[MT7]-LDDDFK[MT7].2y4_1.heavy 520.779 / 668.337 5082.0 29.021799087524414 43 15 10 10 8 1.9636508521285105 41.90899123068185 0.0 4 0.9501381769606406 5.5037285660593 5082.0 16.80220472440945 0.0 - - - - - - - 233.07142857142858 10 14 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 1877 239 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20884.[MT7]-LDDDFK[MT7].2y5_1.heavy 520.779 / 783.364 7441.0 29.021799087524414 43 15 10 10 8 1.9636508521285105 41.90899123068185 0.0 4 0.9501381769606406 5.5037285660593 7441.0 15.259382579933849 1.0 - - - - - - - 259.2857142857143 25 14 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 1879 239 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20884.[MT7]-LDDDFK[MT7].2b4_1.heavy 520.779 / 603.274 18784.0 29.021799087524414 43 15 10 10 8 1.9636508521285105 41.90899123068185 0.0 4 0.9501381769606406 5.5037285660593 18784.0 63.13650324287976 0.0 - - - - - - - 317.6 37 10 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 1881 239 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20884.[MT7]-LDDDFK[MT7].2y3_1.heavy 520.779 / 553.31 9256.0 29.021799087524414 43 15 10 10 8 1.9636508521285105 41.90899123068185 0.0 4 0.9501381769606406 5.5037285660593 9256.0 38.448484678221035 0.0 - - - - - - - 258.15384615384613 18 13 SH3GL1;SH3GL2 SH3-domain GRB2-like 1;SH3-domain GRB2-like 2 1883 240 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21463.[MT7]-LTLLEFLDFLQEEQK[MT7].3b6_1.heavy 718.736 / 861.52 17292.0 55.145599365234375 46 18 10 8 10 5.209308898217076 19.196404351108022 0.0149993896484375 3 0.9891905572121042 11.859564236816736 17292.0 157.5742857142857 0.0 - - - - - - - 83.44444444444444 34 36 PLCD4 phospholipase C, delta 4 1885 240 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21463.[MT7]-LTLLEFLDFLQEEQK[MT7].3b4_1.heavy 718.736 / 585.409 19759.0 55.145599365234375 46 18 10 8 10 5.209308898217076 19.196404351108022 0.0149993896484375 3 0.9891905572121042 11.859564236816736 19759.0 139.21113636363637 0.0 - - - - - - - 87.75555555555556 39 45 PLCD4 phospholipase C, delta 4 1887 240 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21463.[MT7]-LTLLEFLDFLQEEQK[MT7].3b5_1.heavy 718.736 / 714.452 40333.0 55.145599365234375 46 18 10 8 10 5.209308898217076 19.196404351108022 0.0149993896484375 3 0.9891905572121042 11.859564236816736 40333.0 227.95510530525195 0.0 - - - - - - - 105.28571428571429 80 35 PLCD4 phospholipase C, delta 4 1889 240 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21463.[MT7]-LTLLEFLDFLQEEQK[MT7].3b8_1.heavy 718.736 / 1089.63 30398.0 55.145599365234375 46 18 10 8 10 5.209308898217076 19.196404351108022 0.0149993896484375 3 0.9891905572121042 11.859564236816736 30398.0 99.43027692644326 1.0 - - - - - - - 79.40625 60 32 PLCD4 phospholipase C, delta 4 1891 241 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20886.[MT7]-VK[MT7]PEER.2y4_1.heavy 523.316 / 530.257 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1893 241 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20886.[MT7]-VK[MT7]PEER.2b5_1.heavy 523.316 / 871.513 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1895 241 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20886.[MT7]-VK[MT7]PEER.2y5_1.heavy 523.316 / 802.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1897 241 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20886.[MT7]-VK[MT7]PEER.2b4_1.heavy 523.316 / 742.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 1899 242 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21464.[MT7]-C[CAM]LLIVMEC[CAM]LDGGELFSR.2b3_1.heavy 1078.54 / 531.308 1390.0 52.448299407958984 42 12 10 10 10 2.8440084432111417 35.16163963532084 0.0 3 0.881981173969574 3.556476453878237 1390.0 36.52028301886793 0.0 - - - - - - - 83.18181818181819 2 11 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1901 242 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21464.[MT7]-C[CAM]LLIVMEC[CAM]LDGGELFSR.2b5_1.heavy 1078.54 / 743.461 516.0 52.448299407958984 42 12 10 10 10 2.8440084432111417 35.16163963532084 0.0 3 0.881981173969574 3.556476453878237 516.0 19.35 0.0 - - - - - - - 0.0 1 0 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1903 242 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21464.[MT7]-C[CAM]LLIVMEC[CAM]LDGGELFSR.2b4_1.heavy 1078.54 / 644.392 1112.0 52.448299407958984 42 12 10 10 10 2.8440084432111417 35.16163963532084 0.0 3 0.881981173969574 3.556476453878237 1112.0 50.04 0.0 - - - - - - - 92.66666666666667 2 12 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1905 242 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21464.[MT7]-C[CAM]LLIVMEC[CAM]LDGGELFSR.2y7_1.heavy 1078.54 / 765.389 318.0 52.448299407958984 42 12 10 10 10 2.8440084432111417 35.16163963532084 0.0 3 0.881981173969574 3.556476453878237 318.0 11.774050632911393 0.0 - - - - - - - 0.0 0 0 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 1907 243 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20881.[MT7]-ITDFGLAR.2y5_1.heavy 518.799 / 563.33 58889.0 35.20310020446777 41 18 10 5 8 9.120001950099658 10.964909936111061 0.044200897216796875 4 0.9873128348415702 10.945102611068416 58889.0 74.86187955126054 0.0 - - - - - - - 344.0 117 7 ERBB2;ERBB4;MAP3K9;MAP3K10;MAP3K11;KIAA1804 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian);v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian);mitogen-activated protein kinase kinase kinase 9;mitogen-activated protein kinase kinase kinase 10;mitogen-activated protein kinase kinase kinase 11;mixed lineage kinase 4 1909 243 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20881.[MT7]-ITDFGLAR.2b4_1.heavy 518.799 / 621.336 3492.0 35.20310020446777 41 18 10 5 8 9.120001950099658 10.964909936111061 0.044200897216796875 4 0.9873128348415702 10.945102611068416 3492.0 10.290523152424147 1.0 - - - - - - - 321.06666666666666 8 15 ERBB2;ERBB4;MAP3K9;MAP3K10;MAP3K11;KIAA1804 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian);v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian);mitogen-activated protein kinase kinase kinase 9;mitogen-activated protein kinase kinase kinase 10;mitogen-activated protein kinase kinase kinase 11;mixed lineage kinase 4 1911 243 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20881.[MT7]-ITDFGLAR.2b7_1.heavy 518.799 / 862.479 1806.0 35.20310020446777 41 18 10 5 8 9.120001950099658 10.964909936111061 0.044200897216796875 4 0.9873128348415702 10.945102611068416 1806.0 10.59756922334226 0.0 - - - - - - - 225.625 3 16 ERBB2;ERBB4;MAP3K9;MAP3K10;MAP3K11;KIAA1804 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian);v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian);mitogen-activated protein kinase kinase kinase 9;mitogen-activated protein kinase kinase kinase 10;mitogen-activated protein kinase kinase kinase 11;mixed lineage kinase 4 1913 243 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20881.[MT7]-ITDFGLAR.2y7_1.heavy 518.799 / 779.405 39259.0 35.20310020446777 41 18 10 5 8 9.120001950099658 10.964909936111061 0.044200897216796875 4 0.9873128348415702 10.945102611068416 39259.0 56.739749483348874 0.0 - - - - - - - 307.6666666666667 78 9 ERBB2;ERBB4;MAP3K9;MAP3K10;MAP3K11;KIAA1804 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian);v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian);mitogen-activated protein kinase kinase kinase 9;mitogen-activated protein kinase kinase kinase 10;mitogen-activated protein kinase kinase kinase 11;mixed lineage kinase 4 1915 244 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20785.[MT7]-IVELFR.2y4_1.heavy 460.788 / 564.314 25477.0 39.52360153198242 50 20 10 10 10 8.748837391648056 11.43009013922964 0.0 3 0.9968047784682321 21.82710692646144 25477.0 92.29691616766466 0.0 - - - - - - - 276.46153846153845 50 13 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1917 244 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20785.[MT7]-IVELFR.2b3_1.heavy 460.788 / 486.304 35500.0 39.52360153198242 50 20 10 10 10 8.748837391648056 11.43009013922964 0.0 3 0.9968047784682321 21.82710692646144 35500.0 175.45470811365317 0.0 - - - - - - - 720.5 71 8 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1919 244 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20785.[MT7]-IVELFR.2y5_1.heavy 460.788 / 663.382 75010.0 39.52360153198242 50 20 10 10 10 8.748837391648056 11.43009013922964 0.0 3 0.9968047784682321 21.82710692646144 75010.0 158.9950562771835 0.0 - - - - - - - 271.625 150 8 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1921 244 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20785.[MT7]-IVELFR.2b4_1.heavy 460.788 / 599.388 20047.0 39.52360153198242 50 20 10 10 10 8.748837391648056 11.43009013922964 0.0 3 0.9968047784682321 21.82710692646144 20047.0 136.43114958911963 0.0 - - - - - - - 237.0 40 12 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1923 245 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20883.[MT7]-LETLFK[MT7].2b3_1.heavy 519.826 / 488.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN8;CAPN2 calpain 8;calpain 2, (m/II) large subunit 1925 245 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20883.[MT7]-LETLFK[MT7].2y4_1.heavy 519.826 / 652.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN8;CAPN2 calpain 8;calpain 2, (m/II) large subunit 1927 245 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20883.[MT7]-LETLFK[MT7].2y5_1.heavy 519.826 / 781.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN8;CAPN2 calpain 8;calpain 2, (m/II) large subunit 1929 245 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20883.[MT7]-LETLFK[MT7].2y3_1.heavy 519.826 / 551.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - CAPN8;CAPN2 calpain 8;calpain 2, (m/II) large subunit 1931 246 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21073.[MT7]-FNILGTNTK[MT7].2b3_1.heavy 648.382 / 519.305 7837.0 34.80619812011719 44 14 10 10 10 7.4978367516380215 13.337180217767933 0.0 3 0.9409052425956613 5.051561287631774 7837.0 19.29326810354874 0.0 - - - - - - - 356.1 15 10 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1933 246 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21073.[MT7]-FNILGTNTK[MT7].2y8_1.heavy 648.382 / 1004.59 3919.0 34.80619812011719 44 14 10 10 10 7.4978367516380215 13.337180217767933 0.0 3 0.9409052425956613 5.051561287631774 3919.0 15.841010526315788 0.0 - - - - - - - 226.72727272727272 7 11 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1935 246 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21073.[MT7]-FNILGTNTK[MT7].2y5_1.heavy 648.382 / 664.375 7600.0 34.80619812011719 44 14 10 10 10 7.4978367516380215 13.337180217767933 0.0 3 0.9409052425956613 5.051561287631774 7600.0 9.575029994832484 0.0 - - - - - - - 678.5714285714286 15 7 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1937 246 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21073.[MT7]-FNILGTNTK[MT7].2y6_1.heavy 648.382 / 777.459 3562.0 34.80619812011719 44 14 10 10 10 7.4978367516380215 13.337180217767933 0.0 3 0.9409052425956613 5.051561287631774 3562.0 3.4265649760356207 1.0 - - - - - - - 301.38461538461536 8 13 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1939 247 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20787.[MT7]-QFLQSR.2b3_1.heavy 461.765 / 533.32 8710.0 25.24074935913086 46 20 10 6 10 4.873055852525076 20.521004278697706 0.030300140380859375 3 0.9952037318425214 17.812993360168914 8710.0 17.50170551766204 0.0 - - - - - - - 740.75 17 12 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1941 247 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20787.[MT7]-QFLQSR.2y4_1.heavy 461.765 / 503.294 9717.0 25.24074935913086 46 20 10 6 10 4.873055852525076 20.521004278697706 0.030300140380859375 3 0.9952037318425214 17.812993360168914 9717.0 18.958502817626016 0.0 - - - - - - - 726.0 19 12 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1943 247 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20787.[MT7]-QFLQSR.2y5_1.heavy 461.765 / 650.362 26842.0 25.24074935913086 46 20 10 6 10 4.873055852525076 20.521004278697706 0.030300140380859375 3 0.9952037318425214 17.812993360168914 26842.0 52.947827004219405 0.0 - - - - - - - 790.1111111111111 53 9 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1945 247 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB20787.[MT7]-QFLQSR.2y3_1.heavy 461.765 / 390.21 5511.0 25.24074935913086 46 20 10 6 10 4.873055852525076 20.521004278697706 0.030300140380859375 3 0.9952037318425214 17.812993360168914 5511.0 6.885675453673545 0.0 - - - - - - - 788.2 11 10 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1947 248 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544877.[MT7]-VVENLQDDFDFNYK[MT7].3y3_1.heavy 678.673 / 568.321 18278.0 40.89579963684082 46 20 10 6 10 13.826500890547166 7.23248787177727 0.034198760986328125 3 0.9982758399174181 29.71742378101796 18278.0 46.54157676222285 0.0 - - - - - - - 681.5714285714286 36 14 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1949 248 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544877.[MT7]-VVENLQDDFDFNYK[MT7].3b4_1.heavy 678.673 / 586.332 49663.0 40.89579963684082 46 20 10 6 10 13.826500890547166 7.23248787177727 0.034198760986328125 3 0.9982758399174181 29.71742378101796 49663.0 103.01575561454774 0.0 - - - - - - - 685.5833333333334 99 12 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1951 248 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544877.[MT7]-VVENLQDDFDFNYK[MT7].3b5_1.heavy 678.673 / 699.416 20244.0 40.89579963684082 46 20 10 6 10 13.826500890547166 7.23248787177727 0.034198760986328125 3 0.9982758399174181 29.71742378101796 20244.0 36.94354918946736 0.0 - - - - - - - 684.5 40 10 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1953 248 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544877.[MT7]-VVENLQDDFDFNYK[MT7].3y4_1.heavy 678.673 / 715.39 14054.0 40.89579963684082 46 20 10 6 10 13.826500890547166 7.23248787177727 0.034198760986328125 3 0.9982758399174181 29.71742378101796 14054.0 24.602540045766588 0.0 - - - - - - - 792.0 28 8 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1955 249 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21074.[MT7]-FNILGTNTK[MT7].3y3_1.heavy 432.59 / 506.306 22107.0 34.80619812011719 44 14 10 10 10 2.80849405741484 35.606270818335965 0.0 3 0.9341815235955491 4.783845342043296 22107.0 34.55041107469909 0.0 - - - - - - - 223.125 44 8 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1957 249 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21074.[MT7]-FNILGTNTK[MT7].3b4_1.heavy 432.59 / 632.389 8914.0 34.80619812011719 44 14 10 10 10 2.80849405741484 35.606270818335965 0.0 3 0.9341815235955491 4.783845342043296 8914.0 23.877301055426056 0.0 - - - - - - - 297.3333333333333 17 6 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1959 249 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21074.[MT7]-FNILGTNTK[MT7].3b3_1.heavy 432.59 / 519.305 33161.0 34.80619812011719 44 14 10 10 10 2.80849405741484 35.606270818335965 0.0 3 0.9341815235955491 4.783845342043296 33161.0 62.619662468365604 0.0 - - - - - - - 297.3333333333333 66 6 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1961 249 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21074.[MT7]-FNILGTNTK[MT7].3y5_1.heavy 432.59 / 664.375 19374.0 34.80619812011719 44 14 10 10 10 2.80849405741484 35.606270818335965 0.0 3 0.9341815235955491 4.783845342043296 19374.0 128.0746218487395 0.0 - - - - - - - 309.1 38 10 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1963 250 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21281.[MT7]-VNIFGVESGK[MT7]K[MT7].4y4_1.heavy 403.246 / 707.465 9576.0 32.25112533569336 37 11 10 6 10 1.0854867957337149 62.91516420621773 0.0384979248046875 3 0.870296444715869 3.389038573619291 9576.0 113.50739601877326 0.0 - - - - - - - 235.0 19 9 WDR61 WD repeat domain 61 1965 250 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21281.[MT7]-VNIFGVESGK[MT7]K[MT7].4y5_2.heavy 403.246 / 418.758 121924.0 32.25112533569336 37 11 10 6 10 1.0854867957337149 62.91516420621773 0.0384979248046875 3 0.870296444715869 3.389038573619291 121924.0 490.4176649869889 0.0 - - - - - - - 272.0 243 9 WDR61 WD repeat domain 61 1967 250 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21281.[MT7]-VNIFGVESGK[MT7]K[MT7].4y7_2.heavy 403.246 / 496.803 112460.0 32.25112533569336 37 11 10 6 10 1.0854867957337149 62.91516420621773 0.0384979248046875 3 0.870296444715869 3.389038573619291 112460.0 394.95871795734377 0.0 - - - - - - - 259.6666666666667 224 9 WDR61 WD repeat domain 61 1969 250 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21281.[MT7]-VNIFGVESGK[MT7]K[MT7].4b3_1.heavy 403.246 / 471.305 74268.0 32.25112533569336 37 11 10 6 10 1.0854867957337149 62.91516420621773 0.0384979248046875 3 0.870296444715869 3.389038573619291 74268.0 197.7813020685202 0.0 - - - - - - - 333.75 148 4 WDR61 WD repeat domain 61 1971 251 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21078.[MT7]-RSVLNNPSK[MT7].3b6_1.heavy 434.929 / 828.481 7129.0 19.75227451324463 46 20 10 6 10 9.598264605004811 10.418550031206383 0.030300140380859375 3 0.9905125903709104 12.660317117869948 7129.0 188.3096384742952 0.0 - - - - - - - 146.16666666666666 14 18 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1973 251 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21078.[MT7]-RSVLNNPSK[MT7].3y3_1.heavy 434.929 / 475.3 26423.0 19.75227451324463 46 20 10 6 10 9.598264605004811 10.418550031206383 0.030300140380859375 3 0.9905125903709104 12.660317117869948 26423.0 41.40835617281839 0.0 - - - - - - - 687.0 52 12 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1975 251 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21078.[MT7]-RSVLNNPSK[MT7].3b4_1.heavy 434.929 / 600.395 9446.0 19.75227451324463 46 20 10 6 10 9.598264605004811 10.418550031206383 0.030300140380859375 3 0.9905125903709104 12.660317117869948 9446.0 21.349646869189606 0.0 - - - - - - - 668.4444444444445 18 9 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1977 251 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21078.[MT7]-RSVLNNPSK[MT7].3b5_1.heavy 434.929 / 714.438 26066.0 19.75227451324463 46 20 10 6 10 9.598264605004811 10.418550031206383 0.030300140380859375 3 0.9905125903709104 12.660317117869948 26066.0 125.683882129775 0.0 - - - - - - - 318.8421052631579 52 19 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1979 252 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584701.[MT7]-FPELNYQLK[MT7].3y3_1.heavy 480.609 / 532.357 8073.0 37.97114944458008 40 14 10 6 10 1.9833784417665838 43.601062601622544 0.038299560546875 3 0.9319647755352639 4.704374428105935 8073.0 17.331628528166686 0.0 - - - - - - - 327.0 16 11 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1981 252 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584701.[MT7]-FPELNYQLK[MT7].3b4_1.heavy 480.609 / 631.357 12764.0 37.97114944458008 40 14 10 6 10 1.9833784417665838 43.601062601622544 0.038299560546875 3 0.9319647755352639 4.704374428105935 12764.0 56.67684403669725 0.0 - - - - - - - 722.875 25 8 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1983 252 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584701.[MT7]-FPELNYQLK[MT7].3b5_1.heavy 480.609 / 745.4 15709.0 37.97114944458008 40 14 10 6 10 1.9833784417665838 43.601062601622544 0.038299560546875 3 0.9319647755352639 4.704374428105935 15709.0 56.686911314984705 0.0 - - - - - - - 205.1764705882353 31 17 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1985 252 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584701.[MT7]-FPELNYQLK[MT7].3b3_1.heavy 480.609 / 518.273 15491.0 37.97114944458008 40 14 10 6 10 1.9833784417665838 43.601062601622544 0.038299560546875 3 0.9319647755352639 4.704374428105935 15491.0 55.781811926605506 1.0 - - - - - - - 316.1 30 10 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 1987 253 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21381.[MT7]-DVK[MT7]PENLLYTSK[MT7].3b6_1.heavy 613.691 / 971.54 1851.0 31.018400192260742 38 8 10 10 10 1.050752439421708 76.84464488963326 0.0 3 0.7621423504233545 2.4785253447659645 1851.0 11.122981651376147 0.0 - - - - - - - 230.11111111111111 3 9 MAPKAPK3;MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 3;mitogen-activated protein kinase-activated protein kinase 2 1989 253 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21381.[MT7]-DVK[MT7]PENLLYTSK[MT7].3b3_1.heavy 613.691 / 631.402 871.0 31.018400192260742 38 8 10 10 10 1.050752439421708 76.84464488963326 0.0 3 0.7621423504233545 2.4785253447659645 871.0 -0.25630492480731737 11.0 - - - - - - - 190.75 2 12 MAPKAPK3;MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 3;mitogen-activated protein kinase-activated protein kinase 2 1991 253 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21381.[MT7]-DVK[MT7]PENLLYTSK[MT7].3y4_1.heavy 613.691 / 642.358 5772.0 31.018400192260742 38 8 10 10 10 1.050752439421708 76.84464488963326 0.0 3 0.7621423504233545 2.4785253447659645 5772.0 15.592975511088637 0.0 - - - - - - - 261.6 11 5 MAPKAPK3;MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 3;mitogen-activated protein kinase-activated protein kinase 2 1993 253 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21381.[MT7]-DVK[MT7]PENLLYTSK[MT7].3b7_2.heavy 613.691 / 542.816 11762.0 31.018400192260742 38 8 10 10 10 1.050752439421708 76.84464488963326 0.0 3 0.7621423504233545 2.4785253447659645 11762.0 30.165454081928672 0.0 - - - - - - - 314.8888888888889 23 9 MAPKAPK3;MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 3;mitogen-activated protein kinase-activated protein kinase 2 1995 254 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539640.[MT7]-IFELAR.2y4_1.heavy 446.772 / 488.283 14740.0 36.0054988861084 45 20 10 5 10 8.11789548914456 12.318463588712412 0.046199798583984375 3 0.9986126666448042 33.130022720110034 14740.0 21.447683426269986 0.0 - - - - - - - 292.4 29 5 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1997 254 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539640.[MT7]-IFELAR.2b3_1.heavy 446.772 / 534.304 32403.0 36.0054988861084 45 20 10 5 10 8.11789548914456 12.318463588712412 0.046199798583984375 3 0.9986126666448042 33.130022720110034 32403.0 34.73112931296589 0.0 - - - - - - - 311.22222222222223 64 9 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 1999 254 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539640.[MT7]-IFELAR.2y5_1.heavy 446.772 / 635.351 100010.0 36.0054988861084 45 20 10 5 10 8.11789548914456 12.318463588712412 0.046199798583984375 3 0.9986126666448042 33.130022720110034 100010.0 130.24854545008947 0.0 - - - - - - - 310.0 200 11 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 2001 254 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539640.[MT7]-IFELAR.2b4_1.heavy 446.772 / 647.388 17054.0 36.0054988861084 45 20 10 5 10 8.11789548914456 12.318463588712412 0.046199798583984375 3 0.9986126666448042 33.130022720110034 17054.0 70.35141172792109 0.0 - - - - - - - 330.57142857142856 34 7 CACNB1;CACNB2;CACNB4 calcium channel, voltage-dependent, beta 1 subunit;calcium channel, voltage-dependent, beta 2 subunit;calcium channel, voltage-dependent, beta 4 subunit 2003 255 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21173.[MT7]-FPELNYQLK[MT7].2b8_1.heavy 720.41 / 1149.61 3589.0 37.990299224853516 45 15 10 10 10 3.4486746554912613 24.271647028524967 0.0 3 0.9562787942054558 5.880593273932289 3589.0 18.11447517539126 0.0 - - - - - - - 235.75 7 12 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 2005 255 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21173.[MT7]-FPELNYQLK[MT7].2y4_1.heavy 720.41 / 695.421 1523.0 37.990299224853516 45 15 10 10 10 3.4486746554912613 24.271647028524967 0.0 3 0.9562787942054558 5.880593273932289 1523.0 0.6222676200204291 4.0 - - - - - - - 783.2 7 10 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 2007 255 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21173.[MT7]-FPELNYQLK[MT7].2y8_1.heavy 720.41 / 1148.64 15443.0 37.990299224853516 45 15 10 10 10 3.4486746554912613 24.271647028524967 0.0 3 0.9562787942054558 5.880593273932289 15443.0 65.29626532734616 0.0 - - - - - - - 194.5 30 14 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 2009 255 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21173.[MT7]-FPELNYQLK[MT7].2y5_1.heavy 720.41 / 809.464 2610.0 37.990299224853516 45 15 10 10 10 3.4486746554912613 24.271647028524967 0.0 3 0.9562787942054558 5.880593273932289 2610.0 2.4000000000000004 0.0 - - - - - - - 241.0 5 14 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 2011 256 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21182.[MT7]-IEEGLDQINK[MT7].2b3_1.heavy 723.906 / 516.279 2480.0 30.76289939880371 48 18 10 10 10 3.541872024131613 22.360184163820698 0.0 3 0.9808234646151722 8.897762754907806 2480.0 15.155555555555555 0.0 - - - - - - - 230.26666666666668 4 15 SNAP23 synaptosomal-associated protein, 23kDa 2013 256 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21182.[MT7]-IEEGLDQINK[MT7].2y4_1.heavy 723.906 / 646.4 1941.0 30.76289939880371 48 18 10 10 10 3.541872024131613 22.360184163820698 0.0 3 0.9808234646151722 8.897762754907806 1941.0 6.1420711557443886 1.0 - - - - - - - 273.3333333333333 3 15 SNAP23 synaptosomal-associated protein, 23kDa 2015 256 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21182.[MT7]-IEEGLDQINK[MT7].2y9_1.heavy 723.906 / 1189.62 1833.0 30.76289939880371 48 18 10 10 10 3.541872024131613 22.360184163820698 0.0 3 0.9808234646151722 8.897762754907806 1833.0 11.993703703703705 0.0 - - - - - - - 233.91666666666666 3 12 SNAP23 synaptosomal-associated protein, 23kDa 2017 256 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21182.[MT7]-IEEGLDQINK[MT7].2b6_1.heavy 723.906 / 801.411 3774.0 30.76289939880371 48 18 10 10 10 3.541872024131613 22.360184163820698 0.0 3 0.9808234646151722 8.897762754907806 3774.0 34.94444444444444 0.0 - - - - - - - 162.0 7 10 SNAP23 synaptosomal-associated protein, 23kDa 2019 257 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21577.[MT7]-FSLTPAEGDTEEDDGFVDILESDLK[MT7].4y5_1.heavy 758.369 / 735.401 8071.0 49.82034969329834 44 18 10 6 10 2.8832963919050023 27.265593089019227 0.032199859619140625 3 0.9801959890177259 8.755207489855268 8071.0 36.6669982270218 0.0 - - - - - - - 226.65 16 20 CDC25B cell division cycle 25 homolog B (S. pombe) 2021 257 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21577.[MT7]-FSLTPAEGDTEEDDGFVDILESDLK[MT7].4b4_1.heavy 758.369 / 593.341 12207.0 49.82034969329834 44 18 10 6 10 2.8832963919050023 27.265593089019227 0.032199859619140625 3 0.9801959890177259 8.755207489855268 12207.0 28.519857532319058 0.0 - - - - - - - 273.95 24 20 CDC25B cell division cycle 25 homolog B (S. pombe) 2023 257 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21577.[MT7]-FSLTPAEGDTEEDDGFVDILESDLK[MT7].4y3_1.heavy 758.369 / 519.326 4833.0 49.82034969329834 44 18 10 6 10 2.8832963919050023 27.265593089019227 0.032199859619140625 3 0.9801959890177259 8.755207489855268 4833.0 17.392566964285713 0.0 - - - - - - - 283.85 9 20 CDC25B cell division cycle 25 homolog B (S. pombe) 2025 257 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21577.[MT7]-FSLTPAEGDTEEDDGFVDILESDLK[MT7].4b6_1.heavy 758.369 / 761.431 4036.0 49.82034969329834 44 18 10 6 10 2.8832963919050023 27.265593089019227 0.032199859619140625 3 0.9801959890177259 8.755207489855268 4036.0 3.2370370370370365 1.0 - - - - - - - 237.77272727272728 8 22 CDC25B cell division cycle 25 homolog B (S. pombe) 2027 258 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21378.[MT7]-ELFRPHMIEDIQR.4y5_1.heavy 457.747 / 660.331 15639.0 32.89339828491211 44 18 10 6 10 3.635297299884351 21.608437035634587 0.0391998291015625 3 0.9893554075127559 11.951209382794334 15639.0 39.526173840807814 0.0 - - - - - - - 285.3333333333333 31 15 CASP9 caspase 9, apoptosis-related cysteine peptidase 2029 258 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21378.[MT7]-ELFRPHMIEDIQR.4y4_1.heavy 457.747 / 531.289 17552.0 32.89339828491211 44 18 10 6 10 3.635297299884351 21.608437035634587 0.0391998291015625 3 0.9893554075127559 11.951209382794334 17552.0 43.684977777777775 0.0 - - - - - - - 1237.857142857143 35 7 CASP9 caspase 9, apoptosis-related cysteine peptidase 2031 258 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21378.[MT7]-ELFRPHMIEDIQR.4b7_2.heavy 457.747 / 528.282 22952.0 32.89339828491211 44 18 10 6 10 3.635297299884351 21.608437035634587 0.0391998291015625 3 0.9893554075127559 11.951209382794334 22952.0 20.40170222123464 0.0 - - - - - - - 1157.5714285714287 45 7 CASP9 caspase 9, apoptosis-related cysteine peptidase 2033 258 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21378.[MT7]-ELFRPHMIEDIQR.4b6_2.heavy 457.747 / 462.762 38704.0 32.89339828491211 44 18 10 6 10 3.635297299884351 21.608437035634587 0.0391998291015625 3 0.9893554075127559 11.951209382794334 38704.0 58.91608888888889 0.0 - - - - - - - 239.125 77 8 CASP9 caspase 9, apoptosis-related cysteine peptidase 2035 259 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21183.[MT7]-LC[CAM]NEEQELLR.2y8_1.heavy 724.37 / 1030.52 N/A 33.56966654459635 34 20 0 6 8 12.992875226061509 7.696525846674562 0.03730010986328125 4 0.9974966574052075 24.66105118833343 3263.0 13.487066666666665 1.0 - - - - - - - 217.21428571428572 6 14 CDC16 cell division cycle 16 homolog (S. cerevisiae) 2037 259 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21183.[MT7]-LC[CAM]NEEQELLR.2y5_1.heavy 724.37 / 658.388 1575.0 33.56966654459635 34 20 0 6 8 12.992875226061509 7.696525846674562 0.03730010986328125 4 0.9974966574052075 24.66105118833343 1575.0 3.533259325044405 1.0 - - - - - - - 647.25 3 8 CDC16 cell division cycle 16 homolog (S. cerevisiae) 2039 259 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21183.[MT7]-LC[CAM]NEEQELLR.2y9_1.heavy 724.37 / 1190.55 4839.0 33.56966654459635 34 20 0 6 8 12.992875226061509 7.696525846674562 0.03730010986328125 4 0.9974966574052075 24.66105118833343 4839.0 20.124852728468113 1.0 - - - - - - - 285.26666666666665 33 15 CDC16 cell division cycle 16 homolog (S. cerevisiae) 2041 259 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21183.[MT7]-LC[CAM]NEEQELLR.2b5_1.heavy 724.37 / 790.352 1125.0 33.56966654459635 34 20 0 6 8 12.992875226061509 7.696525846674562 0.03730010986328125 4 0.9974966574052075 24.66105118833343 1125.0 1.8298816568047336 3.0 - - - - - - - 240.4 2 15 CDC16 cell division cycle 16 homolog (S. cerevisiae) 2043 260 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21470.[MT7]-ILLDDTGLAYIC[CAM]QTYER.3y7_1.heavy 730.041 / 969.446 15275.0 45.224374771118164 43 17 10 6 10 3.0970592355914235 27.37789689485689 0.03170013427734375 3 0.9758962071967134 7.9331095380370575 15275.0 56.641025641025635 0.0 - - - - - - - 209.1 30 20 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2045 260 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21470.[MT7]-ILLDDTGLAYIC[CAM]QTYER.3y6_1.heavy 730.041 / 856.362 23705.0 45.224374771118164 43 17 10 6 10 3.0970592355914235 27.37789689485689 0.03170013427734375 3 0.9758962071967134 7.9331095380370575 23705.0 108.54394736842104 0.0 - - - - - - - 279.5882352941176 47 17 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2047 260 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21470.[MT7]-ILLDDTGLAYIC[CAM]QTYER.3b5_1.heavy 730.041 / 714.415 5641.0 45.224374771118164 43 17 10 6 10 3.0970592355914235 27.37789689485689 0.03170013427734375 3 0.9758962071967134 7.9331095380370575 5641.0 8.274652996845425 1.0 - - - - - - - 226.42857142857142 11 14 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2049 260 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21470.[MT7]-ILLDDTGLAYIC[CAM]QTYER.3b7_1.heavy 730.041 / 872.485 23198.0 45.224374771118164 43 17 10 6 10 3.0970592355914235 27.37789689485689 0.03170013427734375 3 0.9758962071967134 7.9331095380370575 23198.0 117.75979594886269 0.0 - - - - - - - 253.57894736842104 46 19 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2051 261 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544460.[MT7]-AHQITDESLESTRR.4y8_2.heavy 447.485 / 489.254 41629.0 21.928199768066406 44 14 10 10 10 2.0341812697937085 39.16050554833592 0.0 3 0.9490790609324389 5.445701440840943 41629.0 33.14553650825985 0.0 - - - - - - - 1211.142857142857 83 7 SNAP23 synaptosomal-associated protein, 23kDa 2053 261 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544460.[MT7]-AHQITDESLESTRR.4y9_2.heavy 447.485 / 546.768 37295.0 21.928199768066406 44 14 10 10 10 2.0341812697937085 39.16050554833592 0.0 3 0.9490790609324389 5.445701440840943 37295.0 79.10382159551965 0.0 - - - - - - - 281.45454545454544 74 11 SNAP23 synaptosomal-associated protein, 23kDa 2055 261 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544460.[MT7]-AHQITDESLESTRR.4y10_2.heavy 447.485 / 597.292 78781.0 21.928199768066406 44 14 10 10 10 2.0341812697937085 39.16050554833592 0.0 3 0.9490790609324389 5.445701440840943 78781.0 146.56509428562077 0.0 - - - - - - - 251.71428571428572 157 7 SNAP23 synaptosomal-associated protein, 23kDa 2057 261 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544460.[MT7]-AHQITDESLESTRR.4b3_1.heavy 447.485 / 481.264 54775.0 21.928199768066406 44 14 10 10 10 2.0341812697937085 39.16050554833592 0.0 3 0.9490790609324389 5.445701440840943 54775.0 65.07940829932755 0.0 - - - - - - - 728.1428571428571 109 7 SNAP23 synaptosomal-associated protein, 23kDa 2059 262 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585570.[MT7]-SLAEELPLEQGFTIVFHGR.3y7_1.heavy 763.078 / 829.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD4 phospholipase C, delta 4 2061 262 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585570.[MT7]-SLAEELPLEQGFTIVFHGR.3b6_1.heavy 763.078 / 787.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD4 phospholipase C, delta 4 2063 262 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585570.[MT7]-SLAEELPLEQGFTIVFHGR.3b5_1.heavy 763.078 / 674.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD4 phospholipase C, delta 4 2065 262 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585570.[MT7]-SLAEELPLEQGFTIVFHGR.3y9_1.heavy 763.078 / 1033.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLCD4 phospholipase C, delta 4 2067 263 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21372.[MT7]-YISPETMVALLTGK[MT7].3b6_1.heavy 604.346 / 835.432 2518.0 52.084099769592285 31 15 2 6 8 1.7438409628518057 39.51556227152531 0.038799285888671875 4 0.9597488757952184 6.13063916089224 2518.0 64.97544222714954 0.0 - - - - - - - 247.66666666666666 5 6 CDC25B cell division cycle 25 homolog B (S. pombe) 2069 263 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21372.[MT7]-YISPETMVALLTGK[MT7].3y4_1.heavy 604.346 / 562.368 3427.0 52.084099769592285 31 15 2 6 8 1.7438409628518057 39.51556227152531 0.038799285888671875 4 0.9597488757952184 6.13063916089224 3427.0 17.34328481763922 1.0 - - - - - - - 148.0 13 12 CDC25B cell division cycle 25 homolog B (S. pombe) 2071 263 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21372.[MT7]-YISPETMVALLTGK[MT7].3b3_1.heavy 604.346 / 508.289 2229.0 52.084099769592285 31 15 2 6 8 1.7438409628518057 39.51556227152531 0.038799285888671875 4 0.9597488757952184 6.13063916089224 2229.0 51.64756097560976 0.0 - - - - - - - 126.85714285714286 4 14 CDC25B cell division cycle 25 homolog B (S. pombe) 2073 263 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21372.[MT7]-YISPETMVALLTGK[MT7].3b7_1.heavy 604.346 / 966.472 1858.0 52.084099769592285 31 15 2 6 8 1.7438409628518057 39.51556227152531 0.038799285888671875 4 0.9597488757952184 6.13063916089224 1858.0 45.27175609756098 0.0 - - - - - - - 188.57142857142858 3 7 CDC25B cell division cycle 25 homolog B (S. pombe) 2075 264 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544640.[MT7]-RILGLAIESQDAGIK[MT7].3b6_1.heavy 624.71 / 768.521 22832.0 35.84809875488281 44 14 10 10 10 2.6132827916687122 38.266046184823715 0.0 3 0.9416134322716263 5.082411518050102 22832.0 123.21794098360655 0.0 - - - - - - - 266.1818181818182 45 11 SNAP23 synaptosomal-associated protein, 23kDa 2077 264 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544640.[MT7]-RILGLAIESQDAGIK[MT7].3b5_1.heavy 624.71 / 697.484 4151.0 35.84809875488281 44 14 10 10 10 2.6132827916687122 38.266046184823715 0.0 3 0.9416134322716263 5.082411518050102 4151.0 22.11598360655738 2.0 - - - - - - - 233.83333333333334 8 12 SNAP23 synaptosomal-associated protein, 23kDa 2079 264 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544640.[MT7]-RILGLAIESQDAGIK[MT7].3y4_1.heavy 624.71 / 532.357 17704.0 35.84809875488281 44 14 10 10 10 2.6132827916687122 38.266046184823715 0.0 3 0.9416134322716263 5.082411518050102 17704.0 32.37186883025901 0.0 - - - - - - - 376.1666666666667 35 12 SNAP23 synaptosomal-associated protein, 23kDa 2081 264 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544640.[MT7]-RILGLAIESQDAGIK[MT7].3y5_1.heavy 624.71 / 647.385 15507.0 35.84809875488281 44 14 10 10 10 2.6132827916687122 38.266046184823715 0.0 3 0.9416134322716263 5.082411518050102 15507.0 30.83593218715579 0.0 - - - - - - - 321.6363636363636 31 11 SNAP23 synaptosomal-associated protein, 23kDa 2083 265 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540292.[MT7]-LAEIVK[MT7].2y4_1.heavy 480.82 / 632.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 2085 265 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540292.[MT7]-LAEIVK[MT7].2y5_1.heavy 480.82 / 703.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 2087 265 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540292.[MT7]-LAEIVK[MT7].2b4_1.heavy 480.82 / 571.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 2089 265 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB540292.[MT7]-LAEIVK[MT7].2y3_1.heavy 480.82 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 2091 266 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21081.[MT7]-ENALLELSK[MT7].3b6_1.heavy 435.594 / 814.443 16218.0 35.51430130004883 48 18 10 10 10 11.524845727863733 8.676905735773019 0.0 3 0.9844519549052573 9.884624152326491 16218.0 179.60429752066116 0.0 - - - - - - - 201.66666666666666 32 6 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2093 266 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21081.[MT7]-ENALLELSK[MT7].3y3_1.heavy 435.594 / 491.331 90893.0 35.51430130004883 48 18 10 10 10 11.524845727863733 8.676905735773019 0.0 3 0.9844519549052573 9.884624152326491 90893.0 372.6880960349984 0.0 - - - - - - - 217.8 181 5 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2095 266 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21081.[MT7]-ENALLELSK[MT7].3b4_1.heavy 435.594 / 572.316 167383.0 35.51430130004883 48 18 10 10 10 11.524845727863733 8.676905735773019 0.0 3 0.9844519549052573 9.884624152326491 167383.0 295.1105234159779 0.0 - - - - - - - 777.8571428571429 334 7 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2097 266 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21081.[MT7]-ENALLELSK[MT7].3b5_1.heavy 435.594 / 685.4 43207.0 35.51430130004883 48 18 10 10 10 11.524845727863733 8.676905735773019 0.0 3 0.9844519549052573 9.884624152326491 43207.0 155.33095041322315 0.0 - - - - - - - 311.14285714285717 86 14 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2099 267 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21379.[MT7]-IVDVYENLYAGRK[MT7].3y7_1.heavy 610.012 / 965.565 5098.0 36.91350173950195 48 18 10 10 10 4.03867614281591 20.837802632817098 0.0 3 0.9856808291012936 10.301105608440409 5098.0 78.22793103448276 0.0 - - - - - - - 165.71428571428572 10 7 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 2101 267 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21379.[MT7]-IVDVYENLYAGRK[MT7].3b4_1.heavy 610.012 / 571.357 6836.0 36.91350173950195 48 18 10 10 10 4.03867614281591 20.837802632817098 0.0 3 0.9856808291012936 10.301105608440409 6836.0 38.33062858419602 0.0 - - - - - - - 252.23529411764707 13 17 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 2103 267 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21379.[MT7]-IVDVYENLYAGRK[MT7].3y4_1.heavy 610.012 / 575.375 6605.0 36.91350173950195 48 18 10 10 10 4.03867614281591 20.837802632817098 0.0 3 0.9856808291012936 10.301105608440409 6605.0 12.012133927110643 0.0 - - - - - - - 337.09090909090907 13 11 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 2105 267 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21379.[MT7]-IVDVYENLYAGRK[MT7].3y8_1.heavy 610.012 / 1094.61 3129.0 36.91350173950195 48 18 10 10 10 4.03867614281591 20.837802632817098 0.0 3 0.9856808291012936 10.301105608440409 3129.0 35.06637931034483 0.0 - - - - - - - 212.66666666666666 6 6 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2 2107 268 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21277.[MT7]-TLTDEELADWK[MT7].3y3_1.heavy 536.95 / 592.321 24073.0 37.00429916381836 48 18 10 10 10 2.5197665364468373 31.32111560248091 0.0 3 0.9815347831709701 9.068064728762318 24073.0 63.12588916736482 0.0 - - - - - - - 279.1 48 10 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 2109 268 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21277.[MT7]-TLTDEELADWK[MT7].3b6_1.heavy 536.95 / 833.401 35935.0 37.00429916381836 48 18 10 10 10 2.5197665364468373 31.32111560248091 0.0 3 0.9815347831709701 9.068064728762318 35935.0 148.88828080229226 0.0 - - - - - - - 305.25 71 8 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 2111 268 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21277.[MT7]-TLTDEELADWK[MT7].3b5_1.heavy 536.95 / 704.358 22561.0 37.00429916381836 48 18 10 10 10 2.5197665364468373 31.32111560248091 0.0 3 0.9815347831709701 9.068064728762318 22561.0 85.16544720818759 0.0 - - - - - - - 232.66666666666666 45 9 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 2113 268 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21277.[MT7]-TLTDEELADWK[MT7].3y4_1.heavy 536.95 / 663.358 14653.0 37.00429916381836 48 18 10 10 10 2.5197665364468373 31.32111560248091 0.0 3 0.9815347831709701 9.068064728762318 14653.0 33.40324530814974 1.0 - - - - - - - 271.25 31 12 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 2115 269 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21576.[MT7]-FSLTPAEGDTEEDDGFVDILESDLK[MT7].3b4_1.heavy 1010.82 / 593.341 4627.0 49.80424976348877 40 14 10 6 10 1.165690029757578 51.44240600977639 0.032199859619140625 3 0.9324817537426671 4.722559120051261 4627.0 55.18597308488613 0.0 - - - - - - - 159.1904761904762 9 21 CDC25B cell division cycle 25 homolog B (S. pombe) 2117 269 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21576.[MT7]-FSLTPAEGDTEEDDGFVDILESDLK[MT7].3y4_1.heavy 1010.82 / 606.358 2166.0 49.80424976348877 40 14 10 6 10 1.165690029757578 51.44240600977639 0.032199859619140625 3 0.9324817537426671 4.722559120051261 2166.0 15.808422280148168 0.0 - - - - - - - 147.53846153846155 4 13 CDC25B cell division cycle 25 homolog B (S. pombe) 2119 269 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21576.[MT7]-FSLTPAEGDTEEDDGFVDILESDLK[MT7].3y8_1.heavy 1010.82 / 1076.6 3790.0 49.80424976348877 40 14 10 6 10 1.165690029757578 51.44240600977639 0.032199859619140625 3 0.9324817537426671 4.722559120051261 3790.0 34.856174467150076 0.0 - - - - - - - 147.625 7 16 CDC25B cell division cycle 25 homolog B (S. pombe) 2121 269 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21576.[MT7]-FSLTPAEGDTEEDDGFVDILESDLK[MT7].3y5_1.heavy 1010.82 / 735.401 2117.0 49.80424976348877 40 14 10 6 10 1.165690029757578 51.44240600977639 0.032199859619140625 3 0.9324817537426671 4.722559120051261 2117.0 47.48062778410857 0.0 - - - - - - - 125.66666666666667 4 18 CDC25B cell division cycle 25 homolog B (S. pombe) 2123 270 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21088.[MT7]-WFLDALEK[MT7].2y4_1.heavy 655.373 / 604.379 2435.0 44.781700134277344 37 15 8 6 8 2.0819667903014785 38.29071688809649 0.03440093994140625 4 0.956952511948872 5.92677006735376 2435.0 1.9506008010680906 2.0 - - - - - - - 255.9 10 20 CDC16 cell division cycle 16 homolog (S. cerevisiae) 2125 270 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21088.[MT7]-WFLDALEK[MT7].2y5_1.heavy 655.373 / 719.406 2122.0 44.781700134277344 37 15 8 6 8 2.0819667903014785 38.29071688809649 0.03440093994140625 4 0.956952511948872 5.92677006735376 2122.0 10.201923076923077 0.0 - - - - - - - 170.1818181818182 4 22 CDC16 cell division cycle 16 homolog (S. cerevisiae) 2127 270 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21088.[MT7]-WFLDALEK[MT7].2b4_1.heavy 655.373 / 706.368 2435.0 44.781700134277344 37 15 8 6 8 2.0819667903014785 38.29071688809649 0.03440093994140625 4 0.956952511948872 5.92677006735376 2435.0 12.860266192170819 0.0 - - - - - - - 221.3181818181818 4 22 CDC16 cell division cycle 16 homolog (S. cerevisiae) 2129 270 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21088.[MT7]-WFLDALEK[MT7].2y7_1.heavy 655.373 / 979.558 3933.0 44.781700134277344 37 15 8 6 8 2.0819667903014785 38.29071688809649 0.03440093994140625 4 0.956952511948872 5.92677006735376 3933.0 25.337672681281617 0.0 - - - - - - - 179.88235294117646 7 17 CDC16 cell division cycle 16 homolog (S. cerevisiae) 2131 271 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585292.[MT7]-NVIQLVDVLYNEEK[MT7].3b4_1.heavy 655.37 / 599.363 80526.0 48.32760047912598 46 20 10 6 10 19.39629024178144 5.155625057857226 0.033397674560546875 3 0.9987222720560143 34.52207724158978 80526.0 605.3621355083254 0.0 - - - - - - - 201.73333333333332 161 15 STK11 serine/threonine kinase 11 2133 271 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585292.[MT7]-NVIQLVDVLYNEEK[MT7].3b5_1.heavy 655.37 / 712.447 50974.0 48.32760047912598 46 20 10 6 10 19.39629024178144 5.155625057857226 0.033397674560546875 3 0.9987222720560143 34.52207724158978 50974.0 416.66949438202244 0.0 - - - - - - - 222.5 101 16 STK11 serine/threonine kinase 11 2135 271 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585292.[MT7]-NVIQLVDVLYNEEK[MT7].3y5_1.heavy 655.37 / 826.406 48897.0 48.32760047912598 46 20 10 6 10 19.39629024178144 5.155625057857226 0.033397674560546875 3 0.9987222720560143 34.52207724158978 48897.0 392.82421348314597 0.0 - - - - - - - 218.6875 97 16 STK11 serine/threonine kinase 11 2137 271 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB585292.[MT7]-NVIQLVDVLYNEEK[MT7].3b7_1.heavy 655.37 / 926.543 63732.0 48.32760047912598 46 20 10 6 10 19.39629024178144 5.155625057857226 0.033397674560546875 3 0.9987222720560143 34.52207724158978 63732.0 152.75535053710334 0.0 - - - - - - - 165.21428571428572 127 14 STK11 serine/threonine kinase 11 2139 272 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21087.[MT7]-TVATFILQK[MT7].2y4_1.heavy 654.91 / 645.442 5039.0 38.12804985046387 44 18 10 6 10 4.333007434412814 23.078658763841116 0.038303375244140625 3 0.9884498259345307 11.472265848311698 5039.0 7.021786530177103 0.0 - - - - - - - 631.1111111111111 10 9 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2141 272 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21087.[MT7]-TVATFILQK[MT7].2b6_1.heavy 654.91 / 777.463 3752.0 38.12804985046387 44 18 10 6 10 4.333007434412814 23.078658763841116 0.038303375244140625 3 0.9884498259345307 11.472265848311698 3752.0 23.65076792366512 0.0 - - - - - - - 175.92857142857142 7 14 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2143 272 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21087.[MT7]-TVATFILQK[MT7].2y6_1.heavy 654.91 / 893.558 4717.0 38.12804985046387 44 18 10 6 10 4.333007434412814 23.078658763841116 0.038303375244140625 3 0.9884498259345307 11.472265848311698 4717.0 54.18238578974864 0.0 - - - - - - - 238.22222222222223 9 9 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2145 272 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21087.[MT7]-TVATFILQK[MT7].2b5_1.heavy 654.91 / 664.379 4395.0 38.12804985046387 44 18 10 6 10 4.333007434412814 23.078658763841116 0.038303375244140625 3 0.9884498259345307 11.472265848311698 4395.0 12.500130466548377 0.0 - - - - - - - 286.0 8 15 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2147 273 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539634.[MT7]-GDLTAK[MT7].2y4_1.heavy 446.771 / 576.384 9759.0 19.202500343322754 43 17 10 6 10 3.2444241581580893 26.37289889318825 0.034000396728515625 3 0.9722996247461054 7.397958711403026 9759.0 23.14743981979559 0.0 - - - - - - - 697.2857142857143 19 7 CASP9 caspase 9, apoptosis-related cysteine peptidase 2149 273 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539634.[MT7]-GDLTAK[MT7].2y5_1.heavy 446.771 / 691.411 2909.0 19.202500343322754 43 17 10 6 10 3.2444241581580893 26.37289889318825 0.034000396728515625 3 0.9722996247461054 7.397958711403026 2909.0 22.947813310845874 0.0 - - - - - - - 232.5 5 22 CASP9 caspase 9, apoptosis-related cysteine peptidase 2151 273 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539634.[MT7]-GDLTAK[MT7].2b4_1.heavy 446.771 / 531.289 1924.0 19.202500343322754 43 17 10 6 10 3.2444241581580893 26.37289889318825 0.034000396728515625 3 0.9722996247461054 7.397958711403026 1924.0 2.400414627570792 1.0 - - - - - - - 735.1111111111111 3 9 CASP9 caspase 9, apoptosis-related cysteine peptidase 2153 273 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539634.[MT7]-GDLTAK[MT7].2y3_1.heavy 446.771 / 463.3 9619.0 19.202500343322754 43 17 10 6 10 3.2444241581580893 26.37289889318825 0.034000396728515625 3 0.9722996247461054 7.397958711403026 9619.0 21.63913295552956 0.0 - - - - - - - 740.2222222222222 19 9 CASP9 caspase 9, apoptosis-related cysteine peptidase 2155 274 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584715.[MT7]-K[MT7]LEELQQK[MT7].3y3_1.heavy 483.3 / 547.332 N/A 24.375500361124676 44 20 10 6 8 6.455911300181321 15.48967997704544 0.03479957580566406 4 0.9943144046193514 16.359439183764394 17706.0 21.518528933257084 1.0 - - - - - - - 710.9166666666666 35 12 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 2157 274 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584715.[MT7]-K[MT7]LEELQQK[MT7].3b4_1.heavy 483.3 / 788.476 5084.0 24.375500361124676 44 20 10 6 8 6.455911300181321 15.48967997704544 0.03479957580566406 4 0.9943144046193514 16.359439183764394 5084.0 16.881196581196583 1.0 - - - - - - - 218.0 10 15 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 2159 274 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584715.[MT7]-K[MT7]LEELQQK[MT7].3b5_1.heavy 483.3 / 901.56 1636.0 24.375500361124676 44 20 10 6 8 6.455911300181321 15.48967997704544 0.03479957580566406 4 0.9943144046193514 16.359439183764394 1636.0 27.314482758620688 0.0 - - - - - - - 80.61538461538461 3 13 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 2161 274 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584715.[MT7]-K[MT7]LEELQQK[MT7].3b3_1.heavy 483.3 / 659.433 4149.0 24.375500361124676 44 20 10 6 8 6.455911300181321 15.48967997704544 0.03479957580566406 4 0.9943144046193514 16.359439183764394 4149.0 8.778793740336532 1.0 - - - - - - - 296.0 9 15 STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 2163 275 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21292.[MT7]-SEAGSGAASSSGEDK[MT7].3b6_1.heavy 543.26 / 633.296 5310.0 15.559200286865234 48 18 10 10 10 3.151096879639317 21.31237905430133 0.0 3 0.9865357093898218 10.623855012841464 5310.0 80.38342541436464 0.0 - - - - - - - 93.92307692307692 10 13 CDC25B cell division cycle 25 homolog B (S. pombe) 2165 275 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21292.[MT7]-SEAGSGAASSSGEDK[MT7].3y4_1.heavy 543.26 / 592.306 5604.0 15.559200286865234 48 18 10 10 10 3.151096879639317 21.31237905430133 0.0 3 0.9865357093898218 10.623855012841464 5604.0 96.48740239458616 0.0 - - - - - - - 119.22222222222223 11 18 CDC25B cell division cycle 25 homolog B (S. pombe) 2167 275 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21292.[MT7]-SEAGSGAASSSGEDK[MT7].3y5_1.heavy 543.26 / 679.338 3548.0 15.559200286865234 48 18 10 10 10 3.151096879639317 21.31237905430133 0.0 3 0.9865357093898218 10.623855012841464 3548.0 174.35969400110073 0.0 - - - - - - - 91.92857142857143 7 14 CDC25B cell division cycle 25 homolog B (S. pombe) 2169 275 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21292.[MT7]-SEAGSGAASSSGEDK[MT7].3b7_1.heavy 543.26 / 704.333 5175.0 15.559200286865234 48 18 10 10 10 3.151096879639317 21.31237905430133 0.0 3 0.9865357093898218 10.623855012841464 5175.0 84.67784810126582 0.0 - - - - - - - 91.75 10 16 CDC25B cell division cycle 25 homolog B (S. pombe) 2171 276 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21491.[MT7]-VK[MT7]EEIIEAFVQELRK[MT7].4y5_1.heavy 566.59 / 817.501 5194.0 46.090599060058594 39 11 10 10 8 1.0455668917041867 60.05313460802647 0.0 4 0.8778541760826909 3.4946202503638966 5194.0 56.40359375 1.0 - - - - - - - 135.11111111111111 10 9 VASP vasodilator-stimulated phosphoprotein 2173 276 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21491.[MT7]-VK[MT7]EEIIEAFVQELRK[MT7].4b4_1.heavy 566.59 / 774.46 4938.0 46.090599060058594 39 11 10 10 8 1.0455668917041867 60.05313460802647 0.0 4 0.8778541760826909 3.4946202503638966 4938.0 108.40453124999999 0.0 - - - - - - - 113.77777777777777 9 9 VASP vasodilator-stimulated phosphoprotein 2175 276 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21491.[MT7]-VK[MT7]EEIIEAFVQELRK[MT7].4b5_1.heavy 566.59 / 887.544 3591.0 46.090599060058594 39 11 10 10 8 1.0455668917041867 60.05313460802647 0.0 4 0.8778541760826909 3.4946202503638966 3591.0 79.6753125 0.0 - - - - - - - 104.81818181818181 7 11 VASP vasodilator-stimulated phosphoprotein 2177 276 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21491.[MT7]-VK[MT7]EEIIEAFVQELRK[MT7].4b3_1.heavy 566.59 / 645.417 1731.0 46.090599060058594 39 11 10 10 8 1.0455668917041867 60.05313460802647 0.0 4 0.8778541760826909 3.4946202503638966 1731.0 3.404014036103172 1.0 - - - - - - - 149.5 3 12 VASP vasodilator-stimulated phosphoprotein 2179 277 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21490.[MT7]-NHPFFQGLDWVALAARK[MT7].4y8_1.heavy 565.316 / 1058.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 2181 277 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21490.[MT7]-NHPFFQGLDWVALAARK[MT7].4y8_2.heavy 565.316 / 529.833 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 2183 277 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21490.[MT7]-NHPFFQGLDWVALAARK[MT7].4y7_1.heavy 565.316 / 872.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 2185 277 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21490.[MT7]-NHPFFQGLDWVALAARK[MT7].4y6_1.heavy 565.316 / 773.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 2187 278 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21392.[MT7]-LEGLRGSSWLQDGSAR.3y6_1.heavy 625.998 / 633.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 2189 278 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21392.[MT7]-LEGLRGSSWLQDGSAR.3y8_1.heavy 625.998 / 932.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 2191 278 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21392.[MT7]-LEGLRGSSWLQDGSAR.3y5_1.heavy 625.998 / 505.237 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 2193 278 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21392.[MT7]-LEGLRGSSWLQDGSAR.3y9_1.heavy 625.998 / 1019.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 2195 279 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21391.[MT7]-RILGLAIESQDAGIK[MT7].2b8_1.heavy 936.561 / 1010.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNAP23 synaptosomal-associated protein, 23kDa 2197 279 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21391.[MT7]-RILGLAIESQDAGIK[MT7].2y4_1.heavy 936.561 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNAP23 synaptosomal-associated protein, 23kDa 2199 279 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21391.[MT7]-RILGLAIESQDAGIK[MT7].2y5_1.heavy 936.561 / 647.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNAP23 synaptosomal-associated protein, 23kDa 2201 279 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21391.[MT7]-RILGLAIESQDAGIK[MT7].2b6_1.heavy 936.561 / 768.521 N/A N/A - - - - - - - - - 0.0 - - - - - - - SNAP23 synaptosomal-associated protein, 23kDa 2203 280 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584711.[MT7]-IEEGLDQINK[MT7].3y3_1.heavy 482.94 / 518.342 27541.0 30.76289939880371 47 17 10 10 10 3.7541734845865258 26.6370215469714 0.0 3 0.9795304331496678 8.611214931483318 27541.0 54.61448302469135 0.0 - - - - - - - 696.0 55 9 SNAP23 synaptosomal-associated protein, 23kDa 2205 280 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584711.[MT7]-IEEGLDQINK[MT7].3b6_1.heavy 482.94 / 801.411 23437.0 30.76289939880371 47 17 10 10 10 3.7541734845865258 26.6370215469714 0.0 3 0.9795304331496678 8.611214931483318 23437.0 75.51922222222223 0.0 - - - - - - - 198.0 46 12 SNAP23 synaptosomal-associated protein, 23kDa 2207 280 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584711.[MT7]-IEEGLDQINK[MT7].3b4_1.heavy 482.94 / 573.3 43093.0 30.76289939880371 47 17 10 10 10 3.7541734845865258 26.6370215469714 0.0 3 0.9795304331496678 8.611214931483318 43093.0 46.361075837742504 0.0 - - - - - - - 262.2857142857143 86 7 SNAP23 synaptosomal-associated protein, 23kDa 2209 280 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB584711.[MT7]-IEEGLDQINK[MT7].3b5_1.heavy 482.94 / 686.384 20088.0 30.76289939880371 47 17 10 10 10 3.7541734845865258 26.6370215469714 0.0 3 0.9795304331496678 8.611214931483318 20088.0 50.158 0.0 - - - - - - - 607.5 40 8 SNAP23 synaptosomal-associated protein, 23kDa 2211 281 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542004.[MT7]-DAESFLLK[MT7].3b6_1.heavy 404.236 / 807.401 733.0 36.218299865722656 31 13 0 10 8 1.0220223795286802 61.0920714184066 0.0 4 0.9223703070854927 4.400459823969603 733.0 5.006830601092896 1.0 - - - - - - - 284.6666666666667 3 3 CDC25B cell division cycle 25 homolog B (S. pombe) 2213 281 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542004.[MT7]-DAESFLLK[MT7].3b4_1.heavy 404.236 / 547.248 8425.0 36.218299865722656 31 13 0 10 8 1.0220223795286802 61.0920714184066 0.0 4 0.9223703070854927 4.400459823969603 8425.0 137.00983606557378 0.0 - - - - - - - 219.6 16 5 CDC25B cell division cycle 25 homolog B (S. pombe) 2215 281 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542004.[MT7]-DAESFLLK[MT7].3b5_1.heavy 404.236 / 694.316 10745.0 36.218299865722656 31 13 0 10 8 1.0220223795286802 61.0920714184066 0.0 4 0.9223703070854927 4.400459823969603 10745.0 30.772139441019544 1.0 - - - - - - - 284.6666666666667 136 9 CDC25B cell division cycle 25 homolog B (S. pombe) 2217 281 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542004.[MT7]-DAESFLLK[MT7].3b3_1.heavy 404.236 / 460.216 12210.0 36.218299865722656 31 13 0 10 8 1.0220223795286802 61.0920714184066 0.0 4 0.9223703070854927 4.400459823969603 12210.0 62.12559944292498 0.0 - - - - - - - 284.6666666666667 24 9 CDC25B cell division cycle 25 homolog B (S. pombe) 2219 282 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21184.[MT7]-K[MT7]LEELQQK[MT7].2y4_1.heavy 724.446 / 660.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 2221 282 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21184.[MT7]-K[MT7]LEELQQK[MT7].2y5_1.heavy 724.446 / 789.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 2223 282 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21184.[MT7]-K[MT7]LEELQQK[MT7].2b4_1.heavy 724.446 / 788.476 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 2225 282 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21184.[MT7]-K[MT7]LEELQQK[MT7].2b6_1.heavy 724.446 / 1029.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) 2227 283 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21192.[MT7]-LSDPIVNTLAK[MT7].2y8_1.heavy 729.942 / 999.632 33649.0 36.312400817871094 43 13 10 10 10 3.2485266205566705 30.783186250406622 0.0 3 0.9204641250900762 4.346697539462313 33649.0 76.12738636363636 0.0 - - - - - - - 266.2 67 10 SKP2 S-phase kinase-associated protein 2 (p45) 2229 283 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21192.[MT7]-LSDPIVNTLAK[MT7].2y5_1.heavy 729.942 / 690.427 4478.0 36.312400817871094 43 13 10 10 10 3.2485266205566705 30.783186250406622 0.0 3 0.9204641250900762 4.346697539462313 4478.0 12.027685950413224 0.0 - - - - - - - 282.3333333333333 8 12 SKP2 S-phase kinase-associated protein 2 (p45) 2231 283 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21192.[MT7]-LSDPIVNTLAK[MT7].2y6_1.heavy 729.942 / 789.495 1816.0 36.312400817871094 43 13 10 10 10 3.2485266205566705 30.783186250406622 0.0 3 0.9204641250900762 4.346697539462313 1816.0 2.7901332161432224 3.0 - - - - - - - 309.22222222222223 7 9 SKP2 S-phase kinase-associated protein 2 (p45) 2233 283 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21192.[MT7]-LSDPIVNTLAK[MT7].2b5_1.heavy 729.942 / 670.389 2421.0 36.312400817871094 43 13 10 10 10 3.2485266205566705 30.783186250406622 0.0 3 0.9204641250900762 4.346697539462313 2421.0 5.773813459268005 0.0 - - - - - - - 795.1428571428571 4 7 SKP2 S-phase kinase-associated protein 2 (p45) 2235 284 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21193.[MT7]-LTSLGVIGALVK[MT7].3y3_1.heavy 486.988 / 503.367 35679.0 45.54237461090088 35 9 10 6 10 1.3461985747859733 53.2730277067512 0.035701751708984375 3 0.8042764960814496 2.742764883585993 35679.0 149.55156513264532 0.0 - - - - - - - 254.875 71 8 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2237 284 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21193.[MT7]-LTSLGVIGALVK[MT7].3b6_1.heavy 486.988 / 715.447 40393.0 45.54237461090088 35 9 10 6 10 1.3461985747859733 53.2730277067512 0.035701751708984375 3 0.8042764960814496 2.742764883585993 40393.0 157.04119500681438 0.0 - - - - - - - 191.0909090909091 80 11 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2239 284 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21193.[MT7]-LTSLGVIGALVK[MT7].3b5_1.heavy 486.988 / 616.379 32620.0 45.54237461090088 35 9 10 6 10 1.3461985747859733 53.2730277067512 0.035701751708984375 3 0.8042764960814496 2.742764883585993 32620.0 302.39315111789034 0.0 - - - - - - - 151.25 65 8 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2241 284 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21193.[MT7]-LTSLGVIGALVK[MT7].3y5_1.heavy 486.988 / 631.426 58296.0 45.54237461090088 35 9 10 6 10 1.3461985747859733 53.2730277067512 0.035701751708984375 3 0.8042764960814496 2.742764883585993 58296.0 238.65358073907103 0.0 - - - - - - - 170.11111111111111 116 9 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2243 285 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539932.[MT7]-IDIANAR.2b3_1.heavy 458.77 / 486.304 6833.0 26.965599060058594 50 20 10 10 10 6.694027687277402 14.938689331993494 0.0 3 0.9938105890346715 15.678822839464987 6833.0 8.173524359214314 0.0 - - - - - - - 1766.2857142857142 13 7 SNAP23 synaptosomal-associated protein, 23kDa 2245 285 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539932.[MT7]-IDIANAR.2y5_1.heavy 458.77 / 544.32 16985.0 26.965599060058594 50 20 10 10 10 6.694027687277402 14.938689331993494 0.0 3 0.9938105890346715 15.678822839464987 16985.0 16.00115079886549 0.0 - - - - - - - 709.5 33 10 SNAP23 synaptosomal-associated protein, 23kDa 2247 285 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539932.[MT7]-IDIANAR.2b4_1.heavy 458.77 / 557.341 4946.0 26.965599060058594 50 20 10 10 10 6.694027687277402 14.938689331993494 0.0 3 0.9938105890346715 15.678822839464987 4946.0 5.242864507065391 0.0 - - - - - - - 1287.2222222222222 9 9 SNAP23 synaptosomal-associated protein, 23kDa 2249 285 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539932.[MT7]-IDIANAR.2y6_1.heavy 458.77 / 659.347 20694.0 26.965599060058594 50 20 10 10 10 6.694027687277402 14.938689331993494 0.0 3 0.9938105890346715 15.678822839464987 20694.0 34.98744960171354 0.0 - - - - - - - 692.3636363636364 41 11 SNAP23 synaptosomal-associated protein, 23kDa 2251 286 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21486.[MT7]-RAEVQELFESFSADGQK[MT7].4b7_1.heavy 558.04 / 970.544 11823.0 40.321001052856445 26 12 0 6 8 0.8171984577550824 62.83567951204017 0.034801483154296875 4 0.8878115594281735 3.6495715946361518 11823.0 43.13740168929925 1.0 - - - - - - - 241.76923076923077 177 13 PLCD4 phospholipase C, delta 4 2253 286 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21486.[MT7]-RAEVQELFESFSADGQK[MT7].4b4_1.heavy 558.04 / 600.359 2918.0 40.321001052856445 26 12 0 6 8 0.8171984577550824 62.83567951204017 0.034801483154296875 4 0.8878115594281735 3.6495715946361518 2918.0 5.199109131403119 3.0 - - - - - - - 289.26666666666665 8 15 PLCD4 phospholipase C, delta 4 2255 286 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21486.[MT7]-RAEVQELFESFSADGQK[MT7].4b5_1.heavy 558.04 / 728.417 3442.0 40.321001052856445 26 12 0 6 8 0.8171984577550824 62.83567951204017 0.034801483154296875 4 0.8878115594281735 3.6495715946361518 3442.0 22.298554707379132 0.0 - - - - - - - 199.6 6 15 PLCD4 phospholipase C, delta 4 2257 286 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21486.[MT7]-RAEVQELFESFSADGQK[MT7].4b6_1.heavy 558.04 / 857.46 11299.0 40.321001052856445 26 12 0 6 8 0.8171984577550824 62.83567951204017 0.034801483154296875 4 0.8878115594281735 3.6495715946361518 11299.0 60.75694136745607 0.0 - - - - - - - 190.54545454545453 22 11 PLCD4 phospholipase C, delta 4 2259 287 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21194.[MT7]-QEEASGGPTAPK[MT7].2b3_1.heavy 730.385 / 531.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - VASP vasodilator-stimulated phosphoprotein 2261 287 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21194.[MT7]-QEEASGGPTAPK[MT7].2y8_1.heavy 730.385 / 858.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - VASP vasodilator-stimulated phosphoprotein 2263 287 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21194.[MT7]-QEEASGGPTAPK[MT7].2b4_1.heavy 730.385 / 602.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - VASP vasodilator-stimulated phosphoprotein 2265 287 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21194.[MT7]-QEEASGGPTAPK[MT7].2b7_1.heavy 730.385 / 803.365 N/A N/A - - - - - - - - - 0.0 - - - - - - - VASP vasodilator-stimulated phosphoprotein 2267 288 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21483.[MT7]-IEINFPAEYPFK[MT7]PPK[MT7].4b4_1.heavy 556.32 / 614.363 5893.0 41.067100524902344 35 9 10 6 10 0.909236931126674 71.3725181254689 0.03420257568359375 3 0.809199039298075 2.7791479788182523 5893.0 2.794204235463029 0.0 - - - - - - - 255.77777777777777 11 9 UBE2L3 ubiquitin-conjugating enzyme E2L 3 2269 288 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21483.[MT7]-IEINFPAEYPFK[MT7]PPK[MT7].4b5_1.heavy 556.32 / 761.431 3252.0 41.067100524902344 35 9 10 6 10 0.909236931126674 71.3725181254689 0.03420257568359375 3 0.809199039298075 2.7791479788182523 3252.0 0.5053613053613054 2.0 - - - - - - - 231.33333333333334 10 12 UBE2L3 ubiquitin-conjugating enzyme E2L 3 2271 288 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21483.[MT7]-IEINFPAEYPFK[MT7]PPK[MT7].4y6_2.heavy 556.32 / 501.323 11651.0 41.067100524902344 35 9 10 6 10 0.909236931126674 71.3725181254689 0.03420257568359375 3 0.809199039298075 2.7791479788182523 11651.0 18.938716071325683 0.0 - - - - - - - 745.125 23 8 UBE2L3 ubiquitin-conjugating enzyme E2L 3 2273 288 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21483.[MT7]-IEINFPAEYPFK[MT7]PPK[MT7].4b3_1.heavy 556.32 / 500.32 3522.0 41.067100524902344 35 9 10 6 10 0.909236931126674 71.3725181254689 0.03420257568359375 3 0.809199039298075 2.7791479788182523 3522.0 3.5647021613073275 0.0 - - - - - - - 308.44444444444446 7 9 UBE2L3 ubiquitin-conjugating enzyme E2L 3 2275 289 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542738.[MT7]-RWLAQLVK[MT7].3b4_1.heavy 434.615 / 671.411 23153.0 35.35139846801758 37 7 10 10 10 0.9306384092384026 69.2390186525139 0.0 3 0.713300834334134 2.247399028657937 23153.0 213.62970182000066 0.0 - - - - - - - 220.27272727272728 46 11 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2277 289 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542738.[MT7]-RWLAQLVK[MT7].3b5_1.heavy 434.615 / 799.469 13577.0 35.35139846801758 37 7 10 10 10 0.9306384092384026 69.2390186525139 0.0 3 0.713300834334134 2.247399028657937 13577.0 11.032816322753078 1.0 - - - - - - - 201.77777777777777 32 9 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2279 289 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542738.[MT7]-RWLAQLVK[MT7].3b5_2.heavy 434.615 / 400.238 106188.0 35.35139846801758 37 7 10 10 10 0.9306384092384026 69.2390186525139 0.0 3 0.713300834334134 2.247399028657937 106188.0 124.39361845462898 0.0 - - - - - - - 1246.857142857143 212 7 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2281 289 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB542738.[MT7]-RWLAQLVK[MT7].3b3_1.heavy 434.615 / 600.374 16001.0 35.35139846801758 37 7 10 10 10 0.9306384092384026 69.2390186525139 0.0 3 0.713300834334134 2.247399028657937 16001.0 71.67367610739777 0.0 - - - - - - - 282.8 32 15 RQCD1 RCD1 required for cell differentiation1 homolog (S. pombe) 2283 290 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544854.[MT7]-NHPFFQGLDWVALAAR.3y7_1.heavy 662.687 / 786.462 3912.0 46.513325691223145 39 13 10 6 10 1.4955588748154485 54.523475035392515 0.037899017333984375 3 0.9180292317074757 4.280757523049972 3912.0 30.36747081712062 0.0 - - - - - - - 120.1875 7 16 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 2285 290 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544854.[MT7]-NHPFFQGLDWVALAAR.3y8_1.heavy 662.687 / 901.489 6093.0 46.513325691223145 39 13 10 6 10 1.4955588748154485 54.523475035392515 0.037899017333984375 3 0.9180292317074757 4.280757523049972 6093.0 32.687292147105225 0.0 - - - - - - - 230.86666666666667 12 15 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 2287 290 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544854.[MT7]-NHPFFQGLDWVALAAR.3y5_1.heavy 662.687 / 501.314 11673.0 46.513325691223145 39 13 10 6 10 1.4955588748154485 54.523475035392515 0.037899017333984375 3 0.9180292317074757 4.280757523049972 11673.0 57.00062337662338 0.0 - - - - - - - 275.0 23 14 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 2289 290 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB544854.[MT7]-NHPFFQGLDWVALAAR.3y10_1.heavy 662.687 / 1071.59 2373.0 46.513325691223145 39 13 10 6 10 1.4955588748154485 54.523475035392515 0.037899017333984375 3 0.9180292317074757 4.280757523049972 2373.0 33.370312500000004 0.0 - - - - - - - 163.0909090909091 4 11 RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 2291 291 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21091.[MT7]-NITNSQAPDGR.2y8_1.heavy 658.837 / 844.391 1647.0 18.95852565765381 41 15 10 6 10 1.7426602017359114 38.03724272046715 0.035900115966796875 3 0.9543072712025421 5.75136747713139 1647.0 49.76042553191489 0.0 - - - - - - - 84.6 3 10 CDC25B cell division cycle 25 homolog B (S. pombe) 2293 291 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21091.[MT7]-NITNSQAPDGR.2y9_1.heavy 658.837 / 945.438 2870.0 18.95852565765381 41 15 10 6 10 1.7426602017359114 38.03724272046715 0.035900115966796875 3 0.9543072712025421 5.75136747713139 2870.0 68.02510638297872 0.0 - - - - - - - 151.07142857142858 5 14 CDC25B cell division cycle 25 homolog B (S. pombe) 2295 291 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21091.[MT7]-NITNSQAPDGR.2y10_1.heavy 658.837 / 1058.52 2917.0 18.95852565765381 41 15 10 6 10 1.7426602017359114 38.03724272046715 0.035900115966796875 3 0.9543072712025421 5.75136747713139 2917.0 41.2103829787234 0.0 - - - - - - - 180.16666666666666 5 12 CDC25B cell division cycle 25 homolog B (S. pombe) 2297 291 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB21091.[MT7]-NITNSQAPDGR.2y7_1.heavy 658.837 / 730.348 1129.0 18.95852565765381 41 15 10 6 10 1.7426602017359114 38.03724272046715 0.035900115966796875 3 0.9543072712025421 5.75136747713139 1129.0 22.08 1.0 - - - - - - - 87.28571428571429 2 14 CDC25B cell division cycle 25 homolog B (S. pombe) 2299 292 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539067.[MT7]-QFSGAR.2y4_1.heavy 405.223 / 390.21 N/A 18.25469970703125 46 20 10 6 10 9.06058063100267 11.036820273728276 0.03989982604980469 3 0.9964713921508467 20.769827259379124 36896.0 9.865332102846466 0.0 - - - - - - - 1586.5 73 2 CSDA cold shock domain protein A 2301 292 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539067.[MT7]-QFSGAR.2y5_1.heavy 405.223 / 537.278 8929.0 18.25469970703125 46 20 10 6 10 9.06058063100267 11.036820273728276 0.03989982604980469 3 0.9964713921508467 20.769827259379124 8929.0 21.56957578561226 0.0 - - - - - - - 268.61538461538464 17 13 CSDA cold shock domain protein A 2303 292 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539067.[MT7]-QFSGAR.2b4_1.heavy 405.223 / 564.29 3354.0 18.25469970703125 46 20 10 6 10 9.06058063100267 11.036820273728276 0.03989982604980469 3 0.9964713921508467 20.769827259379124 3354.0 4.507240237431767 1.0 - - - - - - - 777.0 6 7 CSDA cold shock domain protein A 2305 292 C20140311_KEGG1700_set08_04 C20140311_KEGG1700_set08_04 TB539067.[MT7]-QFSGAR.2b5_1.heavy 405.223 / 635.327 2674.0 18.25469970703125 46 20 10 6 10 9.06058063100267 11.036820273728276 0.03989982604980469 3 0.9964713921508467 20.769827259379124 2674.0 10.601762114537445 0.0 - - - - - - - 264.89473684210526 5 19 CSDA cold shock domain protein A