Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140605_SFK031_03 C20140605_SFK031_03 TB561787.[MT7]-LEELDDFEEGSQK[MT7].3b6_1.heavy 609.635 / 859.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - C16orf62 chromosome 16 open reading frame 62 3 1 C20140605_SFK031_03 C20140605_SFK031_03 TB561787.[MT7]-LEELDDFEEGSQK[MT7].3b5_1.heavy 609.635 / 744.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - C16orf62 chromosome 16 open reading frame 62 5 1 C20140605_SFK031_03 C20140605_SFK031_03 TB561787.[MT7]-LEELDDFEEGSQK[MT7].3y4_1.heavy 609.635 / 563.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - C16orf62 chromosome 16 open reading frame 62 7 1 C20140605_SFK031_03 C20140605_SFK031_03 TB561787.[MT7]-LEELDDFEEGSQK[MT7].3b3_1.heavy 609.635 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - C16orf62 chromosome 16 open reading frame 62 9 2 C20140605_SFK031_03 C20140605_SFK031_03 TB557359.[MT7]-TLAEIAK[MT7].2y4_1.heavy 517.328 / 604.379 79485.0 28.15690040588379 48 18 10 10 10 3.545512927398203 22.533275929264665 0.0 3 0.9846275212840856 9.941055452824422 79485.0 72.09990773622198 0.0 - - - - - - - 780.2 158 5 NONO;PSPC1 non-POU domain containing, octamer-binding;paraspeckle component 1 11 2 C20140605_SFK031_03 C20140605_SFK031_03 TB557359.[MT7]-TLAEIAK[MT7].2y5_1.heavy 517.328 / 675.416 81171.0 28.15690040588379 48 18 10 10 10 3.545512927398203 22.533275929264665 0.0 3 0.9846275212840856 9.941055452824422 81171.0 65.37552269397825 0.0 - - - - - - - 422.0 162 1 NONO;PSPC1 non-POU domain containing, octamer-binding;paraspeckle component 1 13 2 C20140605_SFK031_03 C20140605_SFK031_03 TB557359.[MT7]-TLAEIAK[MT7].2b4_1.heavy 517.328 / 559.321 102676.0 28.15690040588379 48 18 10 10 10 3.545512927398203 22.533275929264665 0.0 3 0.9846275212840856 9.941055452824422 102676.0 49.190781725808016 0.0 - - - - - - - 1107.0 205 6 NONO;PSPC1 non-POU domain containing, octamer-binding;paraspeckle component 1 15 2 C20140605_SFK031_03 C20140605_SFK031_03 TB557359.[MT7]-TLAEIAK[MT7].2y6_1.heavy 517.328 / 788.5 70629.0 28.15690040588379 48 18 10 10 10 3.545512927398203 22.533275929264665 0.0 3 0.9846275212840856 9.941055452824422 70629.0 99.36962790153622 0.0 - - - - - - - 263.5 141 4 NONO;PSPC1 non-POU domain containing, octamer-binding;paraspeckle component 1 17 3 C20140605_SFK031_03 C20140605_SFK031_03 TB557851.[MT7]-ETIPEEAR.2y4_1.heavy 544.789 / 504.241 6281.0 21.781600952148438 48 18 10 10 10 4.048801744105342 24.698665511491193 0.0 3 0.9872561667268199 10.920688843490357 6281.0 5.605013287798074 0.0 - - - - - - - 1765.4444444444443 12 9 BCL6 B-cell CLL/lymphoma 6 19 3 C20140605_SFK031_03 C20140605_SFK031_03 TB557851.[MT7]-ETIPEEAR.2y5_1.heavy 544.789 / 601.294 173287.0 21.781600952148438 48 18 10 10 10 4.048801744105342 24.698665511491193 0.0 3 0.9872561667268199 10.920688843490357 173287.0 225.45895322165507 0.0 - - - - - - - 699.7142857142857 346 7 BCL6 B-cell CLL/lymphoma 6 21 3 C20140605_SFK031_03 C20140605_SFK031_03 TB557851.[MT7]-ETIPEEAR.2b6_1.heavy 544.789 / 843.422 25751.0 21.781600952148438 48 18 10 10 10 4.048801744105342 24.698665511491193 0.0 3 0.9872561667268199 10.920688843490357 25751.0 64.44234259400159 0.0 - - - - - - - 179.57142857142858 51 14 BCL6 B-cell CLL/lymphoma 6 23 3 C20140605_SFK031_03 C20140605_SFK031_03 TB557851.[MT7]-ETIPEEAR.2y7_1.heavy 544.789 / 815.426 78510.0 21.781600952148438 48 18 10 10 10 4.048801744105342 24.698665511491193 0.0 3 0.9872561667268199 10.920688843490357 78510.0 73.67225754163161 0.0 - - - - - - - 237.11111111111111 157 9 BCL6 B-cell CLL/lymphoma 6 25 4 C20140605_SFK031_03 C20140605_SFK031_03 TB560380.[MT7]-YAEEELEQVR.3b4_1.heavy 470.572 / 637.295 58118.0 30.519899368286133 46 16 10 10 10 4.093909388604644 24.42652987834782 0.0 3 0.9629460029901732 6.3913795054602325 58118.0 51.30488866971775 0.0 - - - - - - - 251.0 116 2 STIM1 stromal interaction molecule 1 27 4 C20140605_SFK031_03 C20140605_SFK031_03 TB560380.[MT7]-YAEEELEQVR.3b5_1.heavy 470.572 / 766.338 43714.0 30.519899368286133 46 16 10 10 10 4.093909388604644 24.42652987834782 0.0 3 0.9629460029901732 6.3913795054602325 43714.0 85.5763660831027 0.0 - - - - - - - 657.75 87 8 STIM1 stromal interaction molecule 1 29 4 C20140605_SFK031_03 C20140605_SFK031_03 TB560380.[MT7]-YAEEELEQVR.3b3_1.heavy 470.572 / 508.252 67011.0 30.519899368286133 46 16 10 10 10 4.093909388604644 24.42652987834782 0.0 3 0.9629460029901732 6.3913795054602325 67011.0 45.679396821953276 0.0 - - - - - - - 376.0 134 1 STIM1 stromal interaction molecule 1 31 4 C20140605_SFK031_03 C20140605_SFK031_03 TB560380.[MT7]-YAEEELEQVR.3y4_1.heavy 470.572 / 531.289 160074.0 30.519899368286133 46 16 10 10 10 4.093909388604644 24.42652987834782 0.0 3 0.9629460029901732 6.3913795054602325 160074.0 142.37925873799838 0.0 - - - - - - - 776.8 320 5 STIM1 stromal interaction molecule 1 33 5 C20140605_SFK031_03 C20140605_SFK031_03 TB294950.[MT7]-FSQLVEELLK[MT7].2b3_1.heavy 747.445 / 507.268 11734.0 50.18830108642578 39 13 10 6 10 1.705989233222978 47.56581061701516 0.0391998291015625 3 0.9288306113454404 4.598389597868691 11734.0 57.22292858110855 0.0 - - - - - - - 263.76190476190476 23 21 BRCA1 breast cancer 1, early onset 35 5 C20140605_SFK031_03 C20140605_SFK031_03 TB294950.[MT7]-FSQLVEELLK[MT7].2y5_1.heavy 747.445 / 775.468 9278.0 50.18830108642578 39 13 10 6 10 1.705989233222978 47.56581061701516 0.0391998291015625 3 0.9288306113454404 4.598389597868691 9278.0 32.55681177608701 0.0 - - - - - - - 243.05 18 20 BRCA1 breast cancer 1, early onset 37 5 C20140605_SFK031_03 C20140605_SFK031_03 TB294950.[MT7]-FSQLVEELLK[MT7].2b4_1.heavy 747.445 / 620.352 15445.0 50.18830108642578 39 13 10 6 10 1.705989233222978 47.56581061701516 0.0391998291015625 3 0.9288306113454404 4.598389597868691 15445.0 45.85673952641166 0.0 - - - - - - - 262.7368421052632 30 19 BRCA1 breast cancer 1, early onset 39 5 C20140605_SFK031_03 C20140605_SFK031_03 TB294950.[MT7]-FSQLVEELLK[MT7].2y6_1.heavy 747.445 / 874.537 11604.0 50.18830108642578 39 13 10 6 10 1.705989233222978 47.56581061701516 0.0391998291015625 3 0.9288306113454404 4.598389597868691 11604.0 52.84010190518387 0.0 - - - - - - - 260.05 23 20 BRCA1 breast cancer 1, early onset 41 6 C20140605_SFK031_03 C20140605_SFK031_03 TB561099.[MT7]-TVDQYFYGIK[MT7].3b4_1.heavy 507.945 / 588.311 49301.0 37.442399978637695 41 16 10 5 10 3.0278652265986463 33.02656905648837 0.044597625732421875 3 0.9634021593354116 6.431335132896708 49301.0 18.9468442199593 0.0 - - - - - - - 1326.2857142857142 98 7 MAN2B1 mannosidase, alpha, class 2B, member 1 43 6 C20140605_SFK031_03 C20140605_SFK031_03 TB561099.[MT7]-TVDQYFYGIK[MT7].3b5_1.heavy 507.945 / 751.374 31266.0 37.442399978637695 41 16 10 5 10 3.0278652265986463 33.02656905648837 0.044597625732421875 3 0.9634021593354116 6.431335132896708 31266.0 96.32623385690746 0.0 - - - - - - - 200.25 62 8 MAN2B1 mannosidase, alpha, class 2B, member 1 45 6 C20140605_SFK031_03 C20140605_SFK031_03 TB561099.[MT7]-TVDQYFYGIK[MT7].3y4_1.heavy 507.945 / 624.384 48874.0 37.442399978637695 41 16 10 5 10 3.0278652265986463 33.02656905648837 0.044597625732421875 3 0.9634021593354116 6.431335132896708 48874.0 77.93716792934325 0.0 - - - - - - - 337.8333333333333 97 6 MAN2B1 mannosidase, alpha, class 2B, member 1 47 6 C20140605_SFK031_03 C20140605_SFK031_03 TB561099.[MT7]-TVDQYFYGIK[MT7].3y5_1.heavy 507.945 / 771.452 5656.0 37.442399978637695 41 16 10 5 10 3.0278652265986463 33.02656905648837 0.044597625732421875 3 0.9634021593354116 6.431335132896708 5656.0 10.947691994689494 1.0 - - - - - - - 266.75 31 8 MAN2B1 mannosidase, alpha, class 2B, member 1 49 7 C20140605_SFK031_03 C20140605_SFK031_03 TB561096.[MT7]-GIVEFSGK[MT7]PAAR.3y10_2.heavy 507.299 / 603.342 13064.0 26.804899215698242 39 13 8 10 8 1.4902602332494874 52.714952681087695 0.0 4 0.9298624464824222 4.632499861945737 13064.0 20.676045283018865 1.0 - - - - - - - 840.25 51 8 NONO non-POU domain containing, octamer-binding 51 7 C20140605_SFK031_03 C20140605_SFK031_03 TB561096.[MT7]-GIVEFSGK[MT7]PAAR.3y7_1.heavy 507.299 / 830.497 7100.0 26.804899215698242 39 13 8 10 8 1.4902602332494874 52.714952681087695 0.0 4 0.9298624464824222 4.632499861945737 7100.0 22.890486257928117 0.0 - - - - - - - 254.92307692307693 14 13 NONO non-POU domain containing, octamer-binding 53 7 C20140605_SFK031_03 C20140605_SFK031_03 TB561096.[MT7]-GIVEFSGK[MT7]PAAR.3b4_1.heavy 507.299 / 543.326 20448.0 26.804899215698242 39 13 8 10 8 1.4902602332494874 52.714952681087695 0.0 4 0.9298624464824222 4.632499861945737 20448.0 22.279281805088814 0.0 - - - - - - - 473.0 40 1 NONO non-POU domain containing, octamer-binding 55 7 C20140605_SFK031_03 C20140605_SFK031_03 TB561096.[MT7]-GIVEFSGK[MT7]PAAR.3y8_1.heavy 507.299 / 977.565 4544.0 26.804899215698242 39 13 8 10 8 1.4902602332494874 52.714952681087695 0.0 4 0.9298624464824222 4.632499861945737 4544.0 36.818285714285715 0.0 - - - - - - - 163.63636363636363 9 11 NONO non-POU domain containing, octamer-binding 57 8 C20140605_SFK031_03 C20140605_SFK031_03 TB560647.[MT7]-ALLALNHGLDK[MT7].3b6_1.heavy 484.964 / 740.479 26391.0 32.48699951171875 50 20 10 10 10 9.535552348693345 10.487069478854362 0.0 3 0.9926556648672895 14.391960809634309 26391.0 67.1429212237675 1.0 - - - - - - - 292.5 56 4 STIM1 stromal interaction molecule 1 59 8 C20140605_SFK031_03 C20140605_SFK031_03 TB560647.[MT7]-ALLALNHGLDK[MT7].3b4_1.heavy 484.964 / 513.352 142746.0 32.48699951171875 50 20 10 10 10 9.535552348693345 10.487069478854362 0.0 3 0.9926556648672895 14.391960809634309 142746.0 72.69925007785737 0.0 - - - - - - - 390.0 285 1 STIM1 stromal interaction molecule 1 61 8 C20140605_SFK031_03 C20140605_SFK031_03 TB560647.[MT7]-ALLALNHGLDK[MT7].3b5_1.heavy 484.964 / 626.436 45372.0 32.48699951171875 50 20 10 10 10 9.535552348693345 10.487069478854362 0.0 3 0.9926556648672895 14.391960809634309 45372.0 45.139323076923084 0.0 - - - - - - - 747.5 90 4 STIM1 stromal interaction molecule 1 63 8 C20140605_SFK031_03 C20140605_SFK031_03 TB560647.[MT7]-ALLALNHGLDK[MT7].3y4_1.heavy 484.964 / 576.347 161206.0 32.48699951171875 50 20 10 10 10 9.535552348693345 10.487069478854362 0.0 3 0.9926556648672895 14.391960809634309 161206.0 131.74468368554523 0.0 - - - - - - - 845.0 322 2 STIM1 stromal interaction molecule 1 65 9 C20140605_SFK031_03 C20140605_SFK031_03 TB560241.[MT7]-LISVEDLWK[MT7].3y3_1.heavy 464.278 / 590.378 42892.0 44.82170104980469 44 14 10 10 10 2.7797868686457665 35.973981001182715 0.0 3 0.9394321468535205 4.989126330919607 42892.0 150.50388578193144 0.0 - - - - - - - 208.08333333333334 85 12 STIM1 stromal interaction molecule 1 67 9 C20140605_SFK031_03 C20140605_SFK031_03 TB560241.[MT7]-LISVEDLWK[MT7].3b6_1.heavy 464.278 / 801.447 92207.0 44.82170104980469 44 14 10 10 10 2.7797868686457665 35.973981001182715 0.0 3 0.9394321468535205 4.989126330919607 92207.0 568.5785675070028 0.0 - - - - - - - 198.22222222222223 184 9 STIM1 stromal interaction molecule 1 69 9 C20140605_SFK031_03 C20140605_SFK031_03 TB560241.[MT7]-LISVEDLWK[MT7].3b4_1.heavy 464.278 / 557.378 54311.0 44.82170104980469 44 14 10 10 10 2.7797868686457665 35.973981001182715 0.0 3 0.9394321468535205 4.989126330919607 54311.0 215.2238338317757 0.0 - - - - - - - 285.3333333333333 108 9 STIM1 stromal interaction molecule 1 71 9 C20140605_SFK031_03 C20140605_SFK031_03 TB560241.[MT7]-LISVEDLWK[MT7].3b5_1.heavy 464.278 / 686.42 39110.0 44.82170104980469 44 14 10 10 10 2.7797868686457665 35.973981001182715 0.0 3 0.9394321468535205 4.989126330919607 39110.0 628.8717914504571 0.0 - - - - - - - 178.3 78 10 STIM1 stromal interaction molecule 1 73 10 C20140605_SFK031_03 C20140605_SFK031_03 TB399824.[MT7]-DAGLLVEQPPLAGVAASPR.3y7_1.heavy 669.045 / 657.368 12411.0 38.528974533081055 42 16 10 6 10 2.659843799578166 37.596192684645374 0.03710174560546875 3 0.9618712243262194 6.300082905374936 12411.0 12.6101014361737 0.0 - - - - - - - 1307.7142857142858 24 7 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 75 10 C20140605_SFK031_03 C20140605_SFK031_03 TB399824.[MT7]-DAGLLVEQPPLAGVAASPR.3y11_1.heavy 669.045 / 1035.59 26140.0 38.528974533081055 42 16 10 6 10 2.659843799578166 37.596192684645374 0.03710174560546875 3 0.9618712243262194 6.300082905374936 26140.0 25.932539682539684 0.0 - - - - - - - 310.3333333333333 52 3 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 77 10 C20140605_SFK031_03 C20140605_SFK031_03 TB399824.[MT7]-DAGLLVEQPPLAGVAASPR.3b5_1.heavy 669.045 / 614.363 32190.0 38.528974533081055 42 16 10 6 10 2.659843799578166 37.596192684645374 0.03710174560546875 3 0.9618712243262194 6.300082905374936 32190.0 23.428269797831163 0.0 - - - - - - - 672.3333333333334 64 3 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 79 10 C20140605_SFK031_03 C20140605_SFK031_03 TB399824.[MT7]-DAGLLVEQPPLAGVAASPR.3y8_1.heavy 669.045 / 728.405 11092.0 38.528974533081055 42 16 10 6 10 2.659843799578166 37.596192684645374 0.03710174560546875 3 0.9618712243262194 6.300082905374936 11092.0 1.3834490821836507 0.0 - - - - - - - 387.6 22 5 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 81 11 C20140605_SFK031_03 C20140605_SFK031_03 TB294956.[MT7]-ALWENIVAFC[CAM]R.2b3_1.heavy 761.901 / 515.31 8261.0 45.96139907836914 50 20 10 10 10 20.48466435005685 4.881700685504397 0.0 3 0.9955442115697186 18.481562987408832 8261.0 31.377636786961585 0.0 - - - - - - - 254.0 16 13 SOLH small optic lobes homolog (Drosophila) 83 11 C20140605_SFK031_03 C20140605_SFK031_03 TB294956.[MT7]-ALWENIVAFC[CAM]R.2y9_1.heavy 761.901 / 1194.57 12161.0 45.96139907836914 50 20 10 10 10 20.48466435005685 4.881700685504397 0.0 3 0.9955442115697186 18.481562987408832 12161.0 38.62755311451687 0.0 - - - - - - - 231.25 24 16 SOLH small optic lobes homolog (Drosophila) 85 11 C20140605_SFK031_03 C20140605_SFK031_03 TB294956.[MT7]-ALWENIVAFC[CAM]R.2b5_1.heavy 761.901 / 758.395 7534.0 45.96139907836914 50 20 10 10 10 20.48466435005685 4.881700685504397 0.0 3 0.9955442115697186 18.481562987408832 7534.0 20.97603264249304 0.0 - - - - - - - 680.8 15 10 SOLH small optic lobes homolog (Drosophila) 87 11 C20140605_SFK031_03 C20140605_SFK031_03 TB294956.[MT7]-ALWENIVAFC[CAM]R.2y7_1.heavy 761.901 / 879.451 12425.0 45.96139907836914 50 20 10 10 10 20.48466435005685 4.881700685504397 0.0 3 0.9955442115697186 18.481562987408832 12425.0 31.447042640990368 0.0 - - - - - - - 283.2142857142857 24 14 SOLH small optic lobes homolog (Drosophila) 89 12 C20140605_SFK031_03 C20140605_SFK031_03 TB558840.[MT7]-HREQEELR.3b6_2.heavy 414.222 / 477.232 11363.0 14.5600004196167 42 12 10 10 10 2.6264502083199717 38.074203608819126 0.0 3 0.8837956569163727 3.5847018087698466 11363.0 8.16058475365928 0.0 - - - - - - - 694.8888888888889 22 9 PSPC1 paraspeckle component 1 91 12 C20140605_SFK031_03 C20140605_SFK031_03 TB558840.[MT7]-HREQEELR.3y3_1.heavy 414.222 / 417.246 3867.0 14.5600004196167 42 12 10 10 10 2.6264502083199717 38.074203608819126 0.0 3 0.8837956569163727 3.5847018087698466 3867.0 6.088852150522117 0.0 - - - - - - - 724.7272727272727 7 11 PSPC1 paraspeckle component 1 93 12 C20140605_SFK031_03 C20140605_SFK031_03 TB558840.[MT7]-HREQEELR.3y6_1.heavy 414.222 / 803.389 2626.0 14.5600004196167 42 12 10 10 10 2.6264502083199717 38.074203608819126 0.0 3 0.8837956569163727 3.5847018087698466 2626.0 32.882286212914494 0.0 - - - - - - - 128.9 5 10 PSPC1 paraspeckle component 1 95 12 C20140605_SFK031_03 C20140605_SFK031_03 TB558840.[MT7]-HREQEELR.3y4_1.heavy 414.222 / 546.288 3772.0 14.5600004196167 42 12 10 10 10 2.6264502083199717 38.074203608819126 0.0 3 0.8837956569163727 3.5847018087698466 3772.0 7.764773854180141 2.0 - - - - - - - 306.05882352941177 7 17 PSPC1 paraspeckle component 1 97 13 C20140605_SFK031_03 C20140605_SFK031_03 TB399820.[MT7]-DAGALGGAEDSLLASPAGTR.2y12_1.heavy 987.006 / 1216.62 5632.0 35.335350036621094 33 8 10 5 10 0.6090481254708817 85.8757775964043 0.0417022705078125 3 0.7778203946946938 2.568148631267323 5632.0 14.576029571513471 0.0 - - - - - - - 323.4 11 10 NKX3-2 NK3 homeobox 2 99 13 C20140605_SFK031_03 C20140605_SFK031_03 TB399820.[MT7]-DAGALGGAEDSLLASPAGTR.2y6_1.heavy 987.006 / 588.31 16296.0 35.335350036621094 33 8 10 5 10 0.6090481254708817 85.8757775964043 0.0417022705078125 3 0.7778203946946938 2.568148631267323 16296.0 160.30070146137788 0.0 - - - - - - - 292.77777777777777 32 9 NKX3-2 NK3 homeobox 2 101 13 C20140605_SFK031_03 C20140605_SFK031_03 TB399820.[MT7]-DAGALGGAEDSLLASPAGTR.2y10_1.heavy 987.006 / 972.547 14259.0 35.335350036621094 33 8 10 5 10 0.6090481254708817 85.8757775964043 0.0417022705078125 3 0.7778203946946938 2.568148631267323 14259.0 76.07444228094576 0.0 - - - - - - - 299.57142857142856 28 14 NKX3-2 NK3 homeobox 2 103 13 C20140605_SFK031_03 C20140605_SFK031_03 TB399820.[MT7]-DAGALGGAEDSLLASPAGTR.2b5_1.heavy 987.006 / 572.316 26121.0 35.335350036621094 33 8 10 5 10 0.6090481254708817 85.8757775964043 0.0417022705078125 3 0.7778203946946938 2.568148631267323 26121.0 83.68313689482471 0.0 - - - - - - - 263.6 52 5 NKX3-2 NK3 homeobox 2 105 14 C20140605_SFK031_03 C20140605_SFK031_03 TB561903.[MT7]-GANTLTSFSIQAILNK[MT7].3y3_1.heavy 656.045 / 518.342 89165.0 45.5536994934082 46 16 10 10 10 1.7231357306741513 45.867515720596096 0.0 3 0.9613895799660176 6.260409633068378 89165.0 166.39253082564812 0.0 - - - - - - - 789.4285714285714 178 7 NKX3-2 NK3 homeobox 2 107 14 C20140605_SFK031_03 C20140605_SFK031_03 TB561903.[MT7]-GANTLTSFSIQAILNK[MT7].3b5_1.heavy 656.045 / 601.343 34561.0 45.5536994934082 46 16 10 10 10 1.7231357306741513 45.867515720596096 0.0 3 0.9613895799660176 6.260409633068378 34561.0 31.34944436019149 0.0 - - - - - - - 694.5714285714286 69 7 NKX3-2 NK3 homeobox 2 109 14 C20140605_SFK031_03 C20140605_SFK031_03 TB561903.[MT7]-GANTLTSFSIQAILNK[MT7].3y4_1.heavy 656.045 / 631.426 68389.0 45.5536994934082 46 16 10 10 10 1.7231357306741513 45.867515720596096 0.0 3 0.9613895799660176 6.260409633068378 68389.0 49.446647746781466 0.0 - - - - - - - 924.0 136 8 NKX3-2 NK3 homeobox 2 111 14 C20140605_SFK031_03 C20140605_SFK031_03 TB561903.[MT7]-GANTLTSFSIQAILNK[MT7].3b7_1.heavy 656.045 / 789.422 18246.0 45.5536994934082 46 16 10 10 10 1.7231357306741513 45.867515720596096 0.0 3 0.9613895799660176 6.260409633068378 18246.0 37.64833770289171 0.0 - - - - - - - 351.0 36 11 NKX3-2 NK3 homeobox 2 113 15 C20140605_SFK031_03 C20140605_SFK031_03 TB555864.[MT7]-VIDILR.2y4_1.heavy 436.788 / 516.314 78759.0 36.680599212646484 48 18 10 10 10 4.072150529983572 19.441045275466777 0.0 3 0.9832002411519217 9.508258077172131 78759.0 48.092547813360454 0.0 - - - - - - - 374.4 157 5 BCL3 B-cell CLL/lymphoma 3 115 15 C20140605_SFK031_03 C20140605_SFK031_03 TB555864.[MT7]-VIDILR.2b3_1.heavy 436.788 / 472.289 294673.0 36.680599212646484 48 18 10 10 10 4.072150529983572 19.441045275466777 0.0 3 0.9832002411519217 9.508258077172131 294673.0 355.9672466748938 0.0 - - - - - - - 390.0 589 6 BCL3 B-cell CLL/lymphoma 3 117 15 C20140605_SFK031_03 C20140605_SFK031_03 TB555864.[MT7]-VIDILR.2y5_1.heavy 436.788 / 629.398 311759.0 36.680599212646484 48 18 10 10 10 4.072150529983572 19.441045275466777 0.0 3 0.9832002411519217 9.508258077172131 311759.0 293.86468759104025 0.0 - - - - - - - 351.0 623 3 BCL3 B-cell CLL/lymphoma 3 119 15 C20140605_SFK031_03 C20140605_SFK031_03 TB555864.[MT7]-VIDILR.2b4_1.heavy 436.788 / 585.373 107899.0 36.680599212646484 48 18 10 10 10 4.072150529983572 19.441045275466777 0.0 3 0.9832002411519217 9.508258077172131 107899.0 68.2093890595323 0.0 - - - - - - - 468.0 215 1 BCL3 B-cell CLL/lymphoma 3 121 16 C20140605_SFK031_03 C20140605_SFK031_03 TB295077.[MT7]-VLPERPGQWAC[CAM]PAC[CAM]TLLNALR.3y20_2.heavy 856.122 / 1162.09 47419.0 45.91910171508789 41 11 10 10 10 0.9280628713824071 63.34957335301243 0.0 3 0.8602813156724217 3.262449408177442 47419.0 64.59662391888088 0.0 - - - - - - - 683.4285714285714 94 7 SOLH small optic lobes homolog (Drosophila) 123 16 C20140605_SFK031_03 C20140605_SFK031_03 TB295077.[MT7]-VLPERPGQWAC[CAM]PAC[CAM]TLLNALR.3y8_1.heavy 856.122 / 960.529 7448.0 45.91910171508789 41 11 10 10 10 0.9280628713824071 63.34957335301243 0.0 3 0.8602813156724217 3.262449408177442 7448.0 -0.3742781852980701 2.0 - - - - - - - 267.0 15 11 SOLH small optic lobes homolog (Drosophila) 125 16 C20140605_SFK031_03 C20140605_SFK031_03 TB295077.[MT7]-VLPERPGQWAC[CAM]PAC[CAM]TLLNALR.3y19_2.heavy 856.122 / 1105.55 60128.0 45.91910171508789 41 11 10 10 10 0.9280628713824071 63.34957335301243 0.0 3 0.8602813156724217 3.262449408177442 60128.0 70.72372682926829 0.0 - - - - - - - 444.0 120 2 SOLH small optic lobes homolog (Drosophila) 127 16 C20140605_SFK031_03 C20140605_SFK031_03 TB295077.[MT7]-VLPERPGQWAC[CAM]PAC[CAM]TLLNALR.3y10_1.heavy 856.122 / 1128.62 29723.0 45.91910171508789 41 11 10 10 10 0.9280628713824071 63.34957335301243 0.0 3 0.8602813156724217 3.262449408177442 29723.0 98.19841985107237 0.0 - - - - - - - 324.75 59 4 SOLH small optic lobes homolog (Drosophila) 129 17 C20140605_SFK031_03 C20140605_SFK031_03 TB557363.[MT7]-SASDVEER.2y4_1.heavy 518.755 / 532.273 11639.0 15.779399871826172 50 20 10 10 10 15.160617732859114 6.596037296241567 0.0 3 0.9991310344223604 41.86293075404937 11639.0 51.43723701765189 0.0 - - - - - - - 257.4117647058824 23 17 SOS1 son of sevenless homolog 1 (Drosophila) 131 17 C20140605_SFK031_03 C20140605_SFK031_03 TB557363.[MT7]-SASDVEER.2b4_1.heavy 518.755 / 505.237 19449.0 15.779399871826172 50 20 10 10 10 15.160617732859114 6.596037296241567 0.0 3 0.9991310344223604 41.86293075404937 19449.0 23.847015075376884 0.0 - - - - - - - 753.7692307692307 38 13 SOS1 son of sevenless homolog 1 (Drosophila) 133 17 C20140605_SFK031_03 C20140605_SFK031_03 TB557363.[MT7]-SASDVEER.2b5_1.heavy 518.755 / 604.306 4775.0 15.779399871826172 50 20 10 10 10 15.160617732859114 6.596037296241567 0.0 3 0.9991310344223604 41.86293075404937 4775.0 14.891851106639837 0.0 - - - - - - - 285.8 9 20 SOS1 son of sevenless homolog 1 (Drosophila) 135 17 C20140605_SFK031_03 C20140605_SFK031_03 TB557363.[MT7]-SASDVEER.2y7_1.heavy 518.755 / 805.369 6516.0 15.779399871826172 50 20 10 10 10 15.160617732859114 6.596037296241567 0.0 3 0.9991310344223604 41.86293075404937 6516.0 36.053251492361134 0.0 - - - - - - - 182.33333333333334 13 18 SOS1 son of sevenless homolog 1 (Drosophila) 137 18 C20140605_SFK031_03 C20140605_SFK031_03 TB561906.[MT7]-DAGALGGAEDSLLASPAGTR.3y6_1.heavy 658.34 / 588.31 184456.0 35.356201171875 46 16 10 10 10 6.2138550589118555 16.093069286606692 0.0 3 0.9663758789690405 6.711389287226658 184456.0 205.10342268029274 0.0 - - - - - - - 501.0 368 1 NKX3-2 NK3 homeobox 2 139 18 C20140605_SFK031_03 C20140605_SFK031_03 TB561906.[MT7]-DAGALGGAEDSLLASPAGTR.3b5_1.heavy 658.34 / 572.316 123513.0 35.356201171875 46 16 10 10 10 6.2138550589118555 16.093069286606692 0.0 3 0.9663758789690405 6.711389287226658 123513.0 128.2104971281442 0.0 - - - - - - - 751.0 247 1 NKX3-2 NK3 homeobox 2 141 18 C20140605_SFK031_03 C20140605_SFK031_03 TB561906.[MT7]-DAGALGGAEDSLLASPAGTR.3y8_1.heavy 658.34 / 772.431 162181.0 35.356201171875 46 16 10 10 10 6.2138550589118555 16.093069286606692 0.0 3 0.9663758789690405 6.711389287226658 162181.0 166.4042207906249 0.0 - - - - - - - 375.0 324 4 NKX3-2 NK3 homeobox 2 143 18 C20140605_SFK031_03 C20140605_SFK031_03 TB561906.[MT7]-DAGALGGAEDSLLASPAGTR.3b7_1.heavy 658.34 / 686.359 94480.0 35.356201171875 46 16 10 10 10 6.2138550589118555 16.093069286606692 0.0 3 0.9663758789690405 6.711389287226658 94480.0 88.38007968649286 0.0 - - - - - - - 776.0 188 5 NKX3-2 NK3 homeobox 2 145 19 C20140605_SFK031_03 C20140605_SFK031_03 TB555761.[MT7]-GFGFIR.2y4_1.heavy 420.746 / 492.293 91186.0 35.31449890136719 48 18 10 10 10 8.551167656139095 11.694309364664079 0.0 3 0.9887484235929046 11.623786706356587 91186.0 121.13684409969481 0.0 - - - - - - - 308.0 182 7 NONO;PSPC1 non-POU domain containing, octamer-binding;paraspeckle component 1 147 19 C20140605_SFK031_03 C20140605_SFK031_03 TB555761.[MT7]-GFGFIR.2y5_1.heavy 420.746 / 639.361 163602.0 35.31449890136719 48 18 10 10 10 8.551167656139095 11.694309364664079 0.0 3 0.9887484235929046 11.623786706356587 163602.0 740.310513858611 0.0 - - - - - - - 253.6 327 10 NONO;PSPC1 non-POU domain containing, octamer-binding;paraspeckle component 1 149 19 C20140605_SFK031_03 C20140605_SFK031_03 TB555761.[MT7]-GFGFIR.2b4_1.heavy 420.746 / 553.289 239189.0 35.31449890136719 48 18 10 10 10 8.551167656139095 11.694309364664079 0.0 3 0.9887484235929046 11.623786706356587 239189.0 555.8793175226779 0.0 - - - - - - - 235.57142857142858 478 7 NONO;PSPC1 non-POU domain containing, octamer-binding;paraspeckle component 1 151 19 C20140605_SFK031_03 C20140605_SFK031_03 TB555761.[MT7]-GFGFIR.2b5_1.heavy 420.746 / 666.373 67851.0 35.31449890136719 48 18 10 10 10 8.551167656139095 11.694309364664079 0.0 3 0.9887484235929046 11.623786706356587 67851.0 136.98624605678233 0.0 - - - - - - - 525.1428571428571 135 7 NONO;PSPC1 non-POU domain containing, octamer-binding;paraspeckle component 1 153 20 C20140605_SFK031_03 C20140605_SFK031_03 TB294828.[MT7]-TDRLEVC[CAM]R.3y3_1.heavy 398.212 / 434.218 81363.0 20.72599983215332 46 16 10 10 10 2.6830980124662847 31.46585602745373 0.0 3 0.9618016890845807 6.29430904567204 81363.0 68.75877724403932 0.0 - - - - - - - 1322.6666666666667 162 9 MBNL1 muscleblind-like (Drosophila) 155 20 C20140605_SFK031_03 C20140605_SFK031_03 TB294828.[MT7]-TDRLEVC[CAM]R.3b5_1.heavy 398.212 / 759.412 13168.0 20.72599983215332 46 16 10 10 10 2.6830980124662847 31.46585602745373 0.0 3 0.9618016890845807 6.29430904567204 13168.0 44.3113318217378 0.0 - - - - - - - 199.30769230769232 26 13 MBNL1 muscleblind-like (Drosophila) 157 20 C20140605_SFK031_03 C20140605_SFK031_03 TB294828.[MT7]-TDRLEVC[CAM]R.3y4_1.heavy 398.212 / 563.261 59341.0 20.72599983215332 46 16 10 10 10 2.6830980124662847 31.46585602745373 0.0 3 0.9618016890845807 6.29430904567204 59341.0 107.82572678131808 0.0 - - - - - - - 1232.2857142857142 118 7 MBNL1 muscleblind-like (Drosophila) 159 20 C20140605_SFK031_03 C20140605_SFK031_03 TB294828.[MT7]-TDRLEVC[CAM]R.3y5_1.heavy 398.212 / 676.345 43413.0 20.72599983215332 46 16 10 10 10 2.6830980124662847 31.46585602745373 0.0 3 0.9618016890845807 6.29430904567204 43413.0 173.52264281517543 0.0 - - - - - - - 308.05882352941177 86 17 MBNL1 muscleblind-like (Drosophila) 161 21 C20140605_SFK031_03 C20140605_SFK031_03 TB557887.[MT7]-TEDDGVGPR.2y8_1.heavy 545.268 / 844.38 12626.0 17.49850082397461 44 14 10 10 10 2.3048034247536022 36.497548993973176 0.0 3 0.9356639902639019 4.839259935957636 12626.0 36.51616959064327 0.0 - - - - - - - 669.3 25 10 NKX3-2 NK3 homeobox 2 163 21 C20140605_SFK031_03 C20140605_SFK031_03 TB557887.[MT7]-TEDDGVGPR.2b4_1.heavy 545.268 / 605.253 24644.0 17.49850082397461 44 14 10 10 10 2.3048034247536022 36.497548993973176 0.0 3 0.9356639902639019 4.839259935957636 24644.0 74.37509404200942 0.0 - - - - - - - 647.7777777777778 49 9 NKX3-2 NK3 homeobox 2 165 21 C20140605_SFK031_03 C20140605_SFK031_03 TB557887.[MT7]-TEDDGVGPR.2y6_1.heavy 545.268 / 600.31 18813.0 17.49850082397461 44 14 10 10 10 2.3048034247536022 36.497548993973176 0.0 3 0.9356639902639019 4.839259935957636 18813.0 17.35981150416297 0.0 - - - - - - - 684.5 37 12 NKX3-2 NK3 homeobox 2 167 21 C20140605_SFK031_03 C20140605_SFK031_03 TB557887.[MT7]-TEDDGVGPR.2b5_1.heavy 545.268 / 662.275 6744.0 17.49850082397461 44 14 10 10 10 2.3048034247536022 36.497548993973176 0.0 3 0.9356639902639019 4.839259935957636 6744.0 37.43179094139808 0.0 - - - - - - - 223.76470588235293 13 17 NKX3-2 NK3 homeobox 2 169 22 C20140605_SFK031_03 C20140605_SFK031_03 TB557060.[MT7]-LGDFGLAR.2y5_1.heavy 496.786 / 563.33 141891.0 35.152400970458984 48 18 10 10 10 3.564320336012066 28.05583970375817 0.0 3 0.9881014909918308 11.302760729883628 141891.0 146.49286392300309 0.0 - - - - - - - 635.0 283 1 IRAK1;NEK2 interleukin-1 receptor-associated kinase 1;NIMA (never in mitosis gene a)-related kinase 2 171 22 C20140605_SFK031_03 C20140605_SFK031_03 TB557060.[MT7]-LGDFGLAR.2b6_1.heavy 496.786 / 747.416 17768.0 35.152400970458984 48 18 10 10 10 3.564320336012066 28.05583970375817 0.0 3 0.9881014909918308 11.302760729883628 17768.0 51.51914483416846 0.0 - - - - - - - 275.1666666666667 35 6 IRAK1;NEK2 interleukin-1 receptor-associated kinase 1;NIMA (never in mitosis gene a)-related kinase 2 173 22 C20140605_SFK031_03 C20140605_SFK031_03 TB557060.[MT7]-LGDFGLAR.2b5_1.heavy 496.786 / 634.332 32617.0 35.152400970458984 48 18 10 10 10 3.564320336012066 28.05583970375817 0.0 3 0.9881014909918308 11.302760729883628 32617.0 23.60310376049653 1.0 - - - - - - - 616.4285714285714 65 7 IRAK1;NEK2 interleukin-1 receptor-associated kinase 1;NIMA (never in mitosis gene a)-related kinase 2 175 22 C20140605_SFK031_03 C20140605_SFK031_03 TB557060.[MT7]-LGDFGLAR.2y7_1.heavy 496.786 / 735.378 92648.0 35.152400970458984 48 18 10 10 10 3.564320336012066 28.05583970375817 0.0 3 0.9881014909918308 11.302760729883628 92648.0 142.84022408963585 0.0 - - - - - - - 707.1428571428571 185 7 IRAK1;NEK2 interleukin-1 receptor-associated kinase 1;NIMA (never in mitosis gene a)-related kinase 2 177 23 C20140605_SFK031_03 C20140605_SFK031_03 TB557166.[MT7]-DLK[MT7]PAPQQC[CAM]R.3y7_1.heavy 500.945 / 856.409 23550.0 18.160950660705566 43 16 10 7 10 3.3405327258529174 22.22050610314922 0.029399871826171875 3 0.9647447868349817 6.55339643591478 23550.0 11.801470588235293 0.0 - - - - - - - 741.3333333333334 47 6 RAGE renal tumor antigen 179 23 C20140605_SFK031_03 C20140605_SFK031_03 TB557166.[MT7]-DLK[MT7]PAPQQC[CAM]R.3y6_1.heavy 500.945 / 759.357 4605.0 18.160950660705566 43 16 10 7 10 3.3405327258529174 22.22050610314922 0.029399871826171875 3 0.9647447868349817 6.55339643591478 4605.0 49.58650591446769 0.0 - - - - - - - 171.68 9 25 RAGE renal tumor antigen 181 23 C20140605_SFK031_03 C20140605_SFK031_03 TB557166.[MT7]-DLK[MT7]PAPQQC[CAM]R.3y4_1.heavy 500.945 / 591.267 6699.0 18.160950660705566 43 16 10 7 10 3.3405327258529174 22.22050610314922 0.029399871826171875 3 0.9647447868349817 6.55339643591478 6699.0 20.739829800563854 0.0 - - - - - - - 639.7777777777778 13 9 RAGE renal tumor antigen 183 23 C20140605_SFK031_03 C20140605_SFK031_03 TB557166.[MT7]-DLK[MT7]PAPQQC[CAM]R.3y5_1.heavy 500.945 / 688.32 36267.0 18.160950660705566 43 16 10 7 10 3.3405327258529174 22.22050610314922 0.029399871826171875 3 0.9647447868349817 6.55339643591478 36267.0 122.29377732240437 0.0 - - - - - - - 206.57894736842104 72 19 RAGE renal tumor antigen 185 24 C20140605_SFK031_03 C20140605_SFK031_03 TB556340.[MT7]-AQEEHR.2y4_1.heavy 457.234 / 570.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - STIM1 stromal interaction molecule 1 187 24 C20140605_SFK031_03 C20140605_SFK031_03 TB556340.[MT7]-AQEEHR.2b3_1.heavy 457.234 / 473.248 N/A N/A - - - - - - - - - 0.0 - - - - - - - STIM1 stromal interaction molecule 1 189 24 C20140605_SFK031_03 C20140605_SFK031_03 TB556340.[MT7]-AQEEHR.2y5_1.heavy 457.234 / 698.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - STIM1 stromal interaction molecule 1 191 24 C20140605_SFK031_03 C20140605_SFK031_03 TB556340.[MT7]-AQEEHR.2b4_1.heavy 457.234 / 602.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - STIM1 stromal interaction molecule 1 193 25 C20140605_SFK031_03 C20140605_SFK031_03 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 3210480.0 30.0531005859375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 3210480.0 4183.3733589195845 0.0 - - - - - - - 315.6666666666667 6420 3 195 25 C20140605_SFK031_03 C20140605_SFK031_03 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 1368960.0 30.0531005859375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1368960.0 2610.0055723032146 0.0 - - - - - - - 296.0 2737 2 197 25 C20140605_SFK031_03 C20140605_SFK031_03 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 1208000.0 30.0531005859375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1208000.0 262.42159849714443 0.0 - - - - - - - 1835.0 2416 2 199 26 C20140605_SFK031_03 C20140605_SFK031_03 TB399607.[MT7]-ALIEMEK[MT7].2y4_1.heavy 561.328 / 680.341 14465.0 30.801650047302246 43 18 10 5 10 3.5466449703248952 28.19566120564906 0.04229927062988281 3 0.9827572275354874 9.384968132011036 14465.0 9.363923634537596 0.0 - - - - - - - 127.0 28 2 NONO non-POU domain containing, octamer-binding 201 26 C20140605_SFK031_03 C20140605_SFK031_03 TB399607.[MT7]-ALIEMEK[MT7].2y5_1.heavy 561.328 / 793.425 8628.0 30.801650047302246 43 18 10 5 10 3.5466449703248952 28.19566120564906 0.04229927062988281 3 0.9827572275354874 9.384968132011036 8628.0 9.023845231563332 0.0 - - - - - - - 296.3333333333333 17 6 NONO non-POU domain containing, octamer-binding 203 26 C20140605_SFK031_03 C20140605_SFK031_03 TB399607.[MT7]-ALIEMEK[MT7].2b4_1.heavy 561.328 / 571.357 8628.0 30.801650047302246 43 18 10 5 10 3.5466449703248952 28.19566120564906 0.04229927062988281 3 0.9827572275354874 9.384968132011036 8628.0 7.566486486486486 0.0 - - - - - - - 1667.7142857142858 17 7 NONO non-POU domain containing, octamer-binding 205 26 C20140605_SFK031_03 C20140605_SFK031_03 TB399607.[MT7]-ALIEMEK[MT7].2y6_1.heavy 561.328 / 906.509 14338.0 30.801650047302246 43 18 10 5 10 3.5466449703248952 28.19566120564906 0.04229927062988281 3 0.9827572275354874 9.384968132011036 14338.0 18.11295792149917 0.0 - - - - - - - 650.125 28 8 NONO non-POU domain containing, octamer-binding 207 27 C20140605_SFK031_03 C20140605_SFK031_03 TB294965.[MT7]-FLPFLDMFQK[MT7].3b6_1.heavy 525.295 / 877.494 13610.0 53.31907558441162 44 16 10 8 10 2.2644351002361724 38.266493892421025 0.016101837158203125 3 0.9636783142943143 6.455888246231135 13610.0 688.3176488095237 0.0 - - - - - - - 72.875 27 40 C16orf62 chromosome 16 open reading frame 62 209 27 C20140605_SFK031_03 C20140605_SFK031_03 TB294965.[MT7]-FLPFLDMFQK[MT7].3y3_1.heavy 525.295 / 566.342 27540.0 53.31907558441162 44 16 10 8 10 2.2644351002361724 38.266493892421025 0.016101837158203125 3 0.9636783142943143 6.455888246231135 27540.0 417.47430451127815 0.0 - - - - - - - 98.46341463414635 55 41 C16orf62 chromosome 16 open reading frame 62 211 27 C20140605_SFK031_03 C20140605_SFK031_03 TB294965.[MT7]-FLPFLDMFQK[MT7].3b4_1.heavy 525.295 / 649.383 20908.0 53.31907558441162 44 16 10 8 10 2.2644351002361724 38.266493892421025 0.016101837158203125 3 0.9636783142943143 6.455888246231135 20908.0 309.6339424460432 0.0 - - - - - - - 100.62222222222222 41 45 C16orf62 chromosome 16 open reading frame 62 213 27 C20140605_SFK031_03 C20140605_SFK031_03 TB294965.[MT7]-FLPFLDMFQK[MT7].3y5_1.heavy 525.295 / 812.409 5958.0 53.31907558441162 44 16 10 8 10 2.2644351002361724 38.266493892421025 0.016101837158203125 3 0.9636783142943143 6.455888246231135 5958.0 226.50852631578945 0.0 - - - - - - - 69.48780487804878 11 41 C16orf62 chromosome 16 open reading frame 62 215 28 C20140605_SFK031_03 C20140605_SFK031_03 TB561248.[MT7]-GREVVENNLPLR.3y6_1.heavy 513.962 / 726.426 19349.0 27.344200134277344 36 8 10 10 8 1.590960627451101 62.855106703810335 0.0 4 0.7917200707885064 2.6557988944563853 19349.0 36.02674334377545 0.0 - - - - - - - 655.1 38 10 BCL6 B-cell CLL/lymphoma 6 217 28 C20140605_SFK031_03 C20140605_SFK031_03 TB561248.[MT7]-GREVVENNLPLR.3b4_1.heavy 513.962 / 586.343 14209.0 27.344200134277344 36 8 10 10 8 1.590960627451101 62.855106703810335 0.0 4 0.7917200707885064 2.6557988944563853 14209.0 14.68619525560007 1.0 - - - - - - - 403.0 49 1 BCL6 B-cell CLL/lymphoma 6 219 28 C20140605_SFK031_03 C20140605_SFK031_03 TB561248.[MT7]-GREVVENNLPLR.3b7_1.heavy 513.962 / 928.497 10783.0 27.344200134277344 36 8 10 10 8 1.590960627451101 62.855106703810335 0.0 4 0.7917200707885064 2.6557988944563853 10783.0 95.46547638692441 0.0 - - - - - - - 210.9090909090909 21 11 BCL6 B-cell CLL/lymphoma 6 221 28 C20140605_SFK031_03 C20140605_SFK031_03 TB561248.[MT7]-GREVVENNLPLR.3b8_2.heavy 513.962 / 521.773 70946.0 27.344200134277344 36 8 10 10 8 1.590960627451101 62.855106703810335 0.0 4 0.7917200707885064 2.6557988944563853 70946.0 80.18545563088207 0.0 - - - - - - - 302.5 141 4 BCL6 B-cell CLL/lymphoma 6 223 29 C20140605_SFK031_03 C20140605_SFK031_03 TB560269.[MT7]-FAC[CAM]HSASLTVR.3y7_1.heavy 464.911 / 733.42 42602.0 25.148099899291992 48 18 10 10 10 4.184796948849854 23.896022010693713 0.0 3 0.9859897188289127 10.414312078710859 42602.0 42.55971513647643 0.0 - - - - - - - 632.2307692307693 85 13 NONO non-POU domain containing, octamer-binding 225 29 C20140605_SFK031_03 C20140605_SFK031_03 TB560269.[MT7]-FAC[CAM]HSASLTVR.3y6_1.heavy 464.911 / 646.388 48724.0 25.148099899291992 48 18 10 10 10 4.184796948849854 23.896022010693713 0.0 3 0.9859897188289127 10.414312078710859 48724.0 50.12310930709801 0.0 - - - - - - - 733.75 97 8 NONO non-POU domain containing, octamer-binding 227 29 C20140605_SFK031_03 C20140605_SFK031_03 TB560269.[MT7]-FAC[CAM]HSASLTVR.3b3_1.heavy 464.911 / 523.245 33294.0 25.148099899291992 48 18 10 10 10 4.184796948849854 23.896022010693713 0.0 3 0.9859897188289127 10.414312078710859 33294.0 22.940812548079727 0.0 - - - - - - - 2252.285714285714 66 7 NONO non-POU domain containing, octamer-binding 229 29 C20140605_SFK031_03 C20140605_SFK031_03 TB560269.[MT7]-FAC[CAM]HSASLTVR.3y5_1.heavy 464.911 / 575.351 66084.0 25.148099899291992 48 18 10 10 10 4.184796948849854 23.896022010693713 0.0 3 0.9859897188289127 10.414312078710859 66084.0 26.514313742245314 0.0 - - - - - - - 1653.142857142857 132 7 NONO non-POU domain containing, octamer-binding 231 30 C20140605_SFK031_03 C20140605_SFK031_03 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 2290160.0 16.01849937438965 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2290160.0 5661.334135652775 0.0 - - - - - - - 835.75 4580 4 233 30 C20140605_SFK031_03 C20140605_SFK031_03 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 3413120.0 16.01849937438965 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 3413120.0 6255.3089371387205 0.0 - - - - - - - 923.0 6826 2 235 30 C20140605_SFK031_03 C20140605_SFK031_03 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 1770700.0 16.01849937438965 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1770700.0 2258.7597392636694 0.0 - - - - - - - 711.25 3541 4 237 31 C20140605_SFK031_03 C20140605_SFK031_03 TB561101.[MT7]-ALWENIVAFC[CAM]R.3b4_1.heavy 508.27 / 644.352 12511.0 45.96139907836914 47 17 10 10 10 3.5897458299652754 27.857125472576236 0.0 3 0.9748668303420118 7.76828084414358 12511.0 52.85553919195681 0.0 - - - - - - - 294.9 25 10 SOLH small optic lobes homolog (Drosophila) 239 31 C20140605_SFK031_03 C20140605_SFK031_03 TB561101.[MT7]-ALWENIVAFC[CAM]R.3b5_1.heavy 508.27 / 758.395 24040.0 45.96139907836914 47 17 10 10 10 3.5897458299652754 27.857125472576236 0.0 3 0.9748668303420118 7.76828084414358 24040.0 131.34048780487805 0.0 - - - - - - - 201.26666666666668 48 15 SOLH small optic lobes homolog (Drosophila) 241 31 C20140605_SFK031_03 C20140605_SFK031_03 TB561101.[MT7]-ALWENIVAFC[CAM]R.3y4_1.heavy 508.27 / 553.255 49129.0 45.96139907836914 47 17 10 10 10 3.5897458299652754 27.857125472576236 0.0 3 0.9748668303420118 7.76828084414358 49129.0 194.63594496831809 0.0 - - - - - - - 276.8888888888889 98 9 SOLH small optic lobes homolog (Drosophila) 243 31 C20140605_SFK031_03 C20140605_SFK031_03 TB561101.[MT7]-ALWENIVAFC[CAM]R.3y5_1.heavy 508.27 / 652.323 43037.0 45.96139907836914 47 17 10 10 10 3.5897458299652754 27.857125472576236 0.0 3 0.9748668303420118 7.76828084414358 43037.0 413.0976541435913 0.0 - - - - - - - 175.0 86 12 SOLH small optic lobes homolog (Drosophila) 245 32 C20140605_SFK031_03 C20140605_SFK031_03 TB558230.[MT7]-QQQDQVDR.2y4_1.heavy 580.792 / 517.273 N/A 14.167699813842773 44 14 10 10 10 2.2151300638250024 35.45857362832773 0.0 3 0.9485127332386787 5.415408491811955 5477.0 16.545584426838325 0.0 - - - - - - - 700.2222222222222 10 9 NONO non-POU domain containing, octamer-binding 247 32 C20140605_SFK031_03 C20140605_SFK031_03 TB558230.[MT7]-QQQDQVDR.2b4_1.heavy 580.792 / 644.312 5559.0 14.167699813842773 44 14 10 10 10 2.2151300638250024 35.45857362832773 0.0 3 0.9485127332386787 5.415408491811955 5559.0 53.72404195804195 0.0 - - - - - - - 131.0909090909091 11 11 NONO non-POU domain containing, octamer-binding 249 32 C20140605_SFK031_03 C20140605_SFK031_03 TB558230.[MT7]-QQQDQVDR.2b6_1.heavy 580.792 / 871.439 2018.0 14.167699813842773 44 14 10 10 10 2.2151300638250024 35.45857362832773 0.0 3 0.9485127332386787 5.415408491811955 2018.0 43.0670731707317 0.0 - - - - - - - 111.57142857142857 4 7 NONO non-POU domain containing, octamer-binding 251 32 C20140605_SFK031_03 C20140605_SFK031_03 TB558230.[MT7]-QQQDQVDR.2y7_1.heavy 580.792 / 888.417 3047.0 14.167699813842773 44 14 10 10 10 2.2151300638250024 35.45857362832773 0.0 3 0.9485127332386787 5.415408491811955 3047.0 22.421771157725683 1.0 - - - - - - - 123.5 6 16 NONO non-POU domain containing, octamer-binding 253 33 C20140605_SFK031_03 C20140605_SFK031_03 TB561103.[MT7]-AAGLPGAALPLRK[MT7].3y4_1.heavy 508.327 / 657.453 120589.0 31.33370018005371 38 8 10 10 10 2.042134130708785 48.9683799395155 0.0 3 0.7784979479862736 2.5722317348763855 120589.0 103.04838247470843 0.0 - - - - - - - 521.0 241 1 BCL3 B-cell CLL/lymphoma 3 255 33 C20140605_SFK031_03 C20140605_SFK031_03 TB561103.[MT7]-AAGLPGAALPLRK[MT7].3y8_1.heavy 508.327 / 969.633 37154.0 31.33370018005371 38 8 10 10 10 2.042134130708785 48.9683799395155 0.0 3 0.7784979479862736 2.5722317348763855 37154.0 297.18267689357623 0.0 - - - - - - - 260.75 74 4 BCL3 B-cell CLL/lymphoma 3 257 33 C20140605_SFK031_03 C20140605_SFK031_03 TB561103.[MT7]-AAGLPGAALPLRK[MT7].3y9_2.heavy 508.327 / 533.846 327088.0 31.33370018005371 38 8 10 10 10 2.042134130708785 48.9683799395155 0.0 3 0.7784979479862736 2.5722317348763855 327088.0 297.7925511632328 0.0 - - - - - - - 261.0 654 1 BCL3 B-cell CLL/lymphoma 3 259 33 C20140605_SFK031_03 C20140605_SFK031_03 TB561103.[MT7]-AAGLPGAALPLRK[MT7].3y9_1.heavy 508.327 / 1066.69 913.0 31.33370018005371 38 8 10 10 10 2.042134130708785 48.9683799395155 0.0 3 0.7784979479862736 2.5722317348763855 913.0 0.467007672634271 0.0 - - - - - - - 0.0 1 0 BCL3 B-cell CLL/lymphoma 3 261 34 C20140605_SFK031_03 C20140605_SFK031_03 TB399808.[MT7]-DHNNPQEGPTSSSGRR.3y15_2.heavy 628.301 / 812.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 263 34 C20140605_SFK031_03 C20140605_SFK031_03 TB399808.[MT7]-DHNNPQEGPTSSSGRR.3b4_1.heavy 628.301 / 625.281 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 265 34 C20140605_SFK031_03 C20140605_SFK031_03 TB399808.[MT7]-DHNNPQEGPTSSSGRR.3b3_1.heavy 628.301 / 511.238 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 267 34 C20140605_SFK031_03 C20140605_SFK031_03 TB399808.[MT7]-DHNNPQEGPTSSSGRR.3y12_2.heavy 628.301 / 629.81 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 269 35 C20140605_SFK031_03 C20140605_SFK031_03 TB560763.[MT7]-LPVSEGVFVVK[MT7].3b6_1.heavy 487.969 / 727.411 49895.0 39.41999816894531 44 14 10 10 10 1.551483633781694 42.463511011110555 0.0 3 0.9366406633347584 4.87682191829914 49895.0 107.11473958612316 0.0 - - - - - - - 334.09090909090907 99 11 MAN2B1 mannosidase, alpha, class 2B, member 1 271 35 C20140605_SFK031_03 C20140605_SFK031_03 TB560763.[MT7]-LPVSEGVFVVK[MT7].3b4_1.heavy 487.969 / 541.347 15189.0 39.41999816894531 44 14 10 10 10 1.551483633781694 42.463511011110555 0.0 3 0.9366406633347584 4.87682191829914 15189.0 22.70728893897896 0.0 - - - - - - - 245.0 30 3 MAN2B1 mannosidase, alpha, class 2B, member 1 273 35 C20140605_SFK031_03 C20140605_SFK031_03 TB560763.[MT7]-LPVSEGVFVVK[MT7].3y4_1.heavy 487.969 / 636.42 52100.0 39.41999816894531 44 14 10 10 10 1.551483633781694 42.463511011110555 0.0 3 0.9366406633347584 4.87682191829914 52100.0 149.38877551020406 0.0 - - - - - - - 359.4 104 10 MAN2B1 mannosidase, alpha, class 2B, member 1 275 35 C20140605_SFK031_03 C20140605_SFK031_03 TB560763.[MT7]-LPVSEGVFVVK[MT7].3b7_1.heavy 487.969 / 826.479 27030.0 39.41999816894531 44 14 10 10 10 1.551483633781694 42.463511011110555 0.0 3 0.9366406633347584 4.87682191829914 27030.0 139.31949541284405 0.0 - - - - - - - 245.07142857142858 54 14 MAN2B1 mannosidase, alpha, class 2B, member 1 277 36 C20140605_SFK031_03 C20140605_SFK031_03 TB559098.[MT7]-AAGLPGAALPLR.2y8_1.heavy 625.889 / 794.488 42420.0 35.29414939880371 43 20 10 5 8 47.96230756918684 2.084970575190684 0.040699005126953125 4 0.9997396259957997 76.48110166342404 42420.0 55.949609810825976 1.0 - - - - - - - 311.0 84 2 BCL3 B-cell CLL/lymphoma 3 279 36 C20140605_SFK031_03 C20140605_SFK031_03 TB559098.[MT7]-AAGLPGAALPLR.2y10_1.heavy 625.889 / 964.594 5598.0 35.29414939880371 43 20 10 5 8 47.96230756918684 2.084970575190684 0.040699005126953125 4 0.9997396259957997 76.48110166342404 5598.0 2.044416243654822 1.0 - - - - - - - 248.83333333333334 14 6 BCL3 B-cell CLL/lymphoma 3 281 36 C20140605_SFK031_03 C20140605_SFK031_03 TB559098.[MT7]-AAGLPGAALPLR.2y11_1.heavy 625.889 / 1035.63 12440.0 35.29414939880371 43 20 10 5 8 47.96230756918684 2.084970575190684 0.040699005126953125 4 0.9997396259957997 76.48110166342404 12440.0 21.34219839142091 0.0 - - - - - - - 373.5 24 2 BCL3 B-cell CLL/lymphoma 3 283 36 C20140605_SFK031_03 C20140605_SFK031_03 TB559098.[MT7]-AAGLPGAALPLR.2y7_1.heavy 625.889 / 697.435 4354.0 35.29414939880371 43 20 10 5 8 47.96230756918684 2.084970575190684 0.040699005126953125 4 0.9997396259957997 76.48110166342404 4354.0 0.4055687028446963 6.0 - - - - - - - 342.25 51 4 BCL3 B-cell CLL/lymphoma 3 285 37 C20140605_SFK031_03 C20140605_SFK031_03 TB559099.[MT7]-EFLDGTRK[MT7].3b4_1.heavy 418.575 / 649.331 182588.0 23.65850067138672 48 18 10 10 10 5.290320571555159 18.90244620291577 0.0 3 0.9804270753241865 8.806910521544356 182588.0 230.9214581439285 0.0 - - - - - - - 807.5 365 8 PML promyelocytic leukemia 287 37 C20140605_SFK031_03 C20140605_SFK031_03 TB559099.[MT7]-EFLDGTRK[MT7].3y7_2.heavy 418.575 / 490.786 124019.0 23.65850067138672 48 18 10 10 10 5.290320571555159 18.90244620291577 0.0 3 0.9804270753241865 8.806910521544356 124019.0 121.06256576962835 0.0 - - - - - - - 1785.5714285714287 248 7 PML promyelocytic leukemia 289 37 C20140605_SFK031_03 C20140605_SFK031_03 TB559099.[MT7]-EFLDGTRK[MT7].3y4_1.heavy 418.575 / 605.385 21068.0 23.65850067138672 48 18 10 10 10 5.290320571555159 18.90244620291577 0.0 3 0.9804270753241865 8.806910521544356 21068.0 36.787776986951364 1.0 - - - - - - - 713.0769230769231 50 13 PML promyelocytic leukemia 291 37 C20140605_SFK031_03 C20140605_SFK031_03 TB559099.[MT7]-EFLDGTRK[MT7].3b3_1.heavy 418.575 / 534.304 48597.0 23.65850067138672 48 18 10 10 10 5.290320571555159 18.90244620291577 0.0 3 0.9804270753241865 8.806910521544356 48597.0 22.83676514496033 0.0 - - - - - - - 913.0 97 1 PML promyelocytic leukemia 293 38 C20140605_SFK031_03 C20140605_SFK031_03 TB559096.[MT7]-TDGFDEFK[MT7].2y4_1.heavy 623.813 / 682.353 6698.0 30.9512996673584 45 15 10 10 10 1.8800619650953414 37.82119636594683 0.0 3 0.958534121828424 6.039551588718304 6698.0 5.475069353961356 1.0 - - - - - - - 730.2222222222222 13 9 PML promyelocytic leukemia 295 38 C20140605_SFK031_03 C20140605_SFK031_03 TB559096.[MT7]-TDGFDEFK[MT7].2y3_1.heavy 623.813 / 567.326 20093.0 30.9512996673584 45 15 10 10 10 1.8800619650953414 37.82119636594683 0.0 3 0.958534121828424 6.039551588718304 20093.0 6.485455285487295 0.0 - - - - - - - 1832.5 40 4 PML promyelocytic leukemia 297 38 C20140605_SFK031_03 C20140605_SFK031_03 TB559096.[MT7]-TDGFDEFK[MT7].2y6_1.heavy 623.813 / 886.443 13522.0 30.9512996673584 45 15 10 10 10 1.8800619650953414 37.82119636594683 0.0 3 0.958534121828424 6.039551588718304 13522.0 2.6621094998985866 0.0 - - - - - - - 210.33333333333334 27 3 PML promyelocytic leukemia 299 38 C20140605_SFK031_03 C20140605_SFK031_03 TB559096.[MT7]-TDGFDEFK[MT7].2b5_1.heavy 623.813 / 680.301 11626.0 30.9512996673584 45 15 10 10 10 1.8800619650953414 37.82119636594683 0.0 3 0.958534121828424 6.039551588718304 11626.0 9.813637752756913 0.0 - - - - - - - 686.0 23 7 PML promyelocytic leukemia 301 39 C20140605_SFK031_03 C20140605_SFK031_03 TB399804.[MT7]-ELVDYFLNVATAQGR.2b4_1.heavy 920.49 / 601.331 122952.0 49.5265007019043 45 15 10 10 10 1.122944886365208 57.03668174614645 0.0 3 0.9525206228045223 5.641263305696474 122952.0 452.04856961220594 0.0 - - - - - - - 249.07692307692307 245 13 MAN2B1 mannosidase, alpha, class 2B, member 1 303 39 C20140605_SFK031_03 C20140605_SFK031_03 TB399804.[MT7]-ELVDYFLNVATAQGR.2y10_1.heavy 920.49 / 1076.58 63663.0 49.5265007019043 45 15 10 10 10 1.122944886365208 57.03668174614645 0.0 3 0.9525206228045223 5.641263305696474 63663.0 226.09586913086912 0.0 - - - - - - - 621.25 127 8 MAN2B1 mannosidase, alpha, class 2B, member 1 305 39 C20140605_SFK031_03 C20140605_SFK031_03 TB399804.[MT7]-ELVDYFLNVATAQGR.2b5_1.heavy 920.49 / 764.395 37194.0 49.5265007019043 45 15 10 10 10 1.122944886365208 57.03668174614645 0.0 3 0.9525206228045223 5.641263305696474 37194.0 169.7861305361305 0.0 - - - - - - - 241.15 74 20 MAN2B1 mannosidase, alpha, class 2B, member 1 307 39 C20140605_SFK031_03 C20140605_SFK031_03 TB399804.[MT7]-ELVDYFLNVATAQGR.2y11_1.heavy 920.49 / 1239.65 39471.0 49.5265007019043 45 15 10 10 10 1.122944886365208 57.03668174614645 0.0 3 0.9525206228045223 5.641263305696474 39471.0 115.90427599067598 0.0 - - - - - - - 394.0 78 15 MAN2B1 mannosidase, alpha, class 2B, member 1 309 40 C20140605_SFK031_03 C20140605_SFK031_03 TB559097.[MT7]-AELDGTILK[MT7].2y5_1.heavy 624.376 / 675.452 55227.0 31.670900344848633 48 18 10 10 10 8.566450581911637 11.673446200828327 0.0 3 0.9804477597195675 8.811583021920816 55227.0 79.68285495011511 0.0 - - - - - - - 260.75 110 4 PSPC1 paraspeckle component 1 311 40 C20140605_SFK031_03 C20140605_SFK031_03 TB559097.[MT7]-AELDGTILK[MT7].2b4_1.heavy 624.376 / 573.3 55487.0 31.670900344848633 48 18 10 10 10 8.566450581911637 11.673446200828327 0.0 3 0.9804477597195675 8.811583021920816 55487.0 55.50916080575428 0.0 - - - - - - - 765.5 110 8 PSPC1 paraspeckle component 1 313 40 C20140605_SFK031_03 C20140605_SFK031_03 TB559097.[MT7]-AELDGTILK[MT7].2b6_1.heavy 624.376 / 731.369 8727.0 31.670900344848633 48 18 10 10 10 8.566450581911637 11.673446200828327 0.0 3 0.9804477597195675 8.811583021920816 8727.0 6.15607778669238 0.0 - - - - - - - 1302.6666666666667 17 9 PSPC1 paraspeckle component 1 315 40 C20140605_SFK031_03 C20140605_SFK031_03 TB559097.[MT7]-AELDGTILK[MT7].2y6_1.heavy 624.376 / 790.479 31912.0 31.670900344848633 48 18 10 10 10 8.566450581911637 11.673446200828327 0.0 3 0.9804477597195675 8.811583021920816 31912.0 36.12520420730576 0.0 - - - - - - - 765.375 63 8 PSPC1 paraspeckle component 1 317 41 C20140605_SFK031_03 C20140605_SFK031_03 TB558223.[MT7]-ELLEAVDAR.2b3_1.heavy 580.326 / 500.32 74658.0 33.37089920043945 50 20 10 10 10 8.671043107358361 11.532637857046137 0.0 3 0.9950638724456927 17.55861986073418 74658.0 36.784652163540954 0.0 - - - - - - - 1851.0 149 6 PML promyelocytic leukemia 319 41 C20140605_SFK031_03 C20140605_SFK031_03 TB558223.[MT7]-ELLEAVDAR.2y8_1.heavy 580.326 / 886.499 100362.0 33.37089920043945 50 20 10 10 10 8.671043107358361 11.532637857046137 0.0 3 0.9950638724456927 17.55861986073418 100362.0 107.15125773101504 0.0 - - - - - - - 258.0 200 3 PML promyelocytic leukemia 321 41 C20140605_SFK031_03 C20140605_SFK031_03 TB558223.[MT7]-ELLEAVDAR.2b4_1.heavy 580.326 / 629.363 110308.0 33.37089920043945 50 20 10 10 10 8.671043107358361 11.532637857046137 0.0 3 0.9950638724456927 17.55861986073418 110308.0 77.07866726112422 0.0 - - - - - - - 904.0 220 1 PML promyelocytic leukemia 323 41 C20140605_SFK031_03 C20140605_SFK031_03 TB558223.[MT7]-ELLEAVDAR.2y7_1.heavy 580.326 / 773.415 67295.0 33.37089920043945 50 20 10 10 10 8.671043107358361 11.532637857046137 0.0 3 0.9950638724456927 17.55861986073418 67295.0 96.78243077984047 0.0 - - - - - - - 258.0 134 4 PML promyelocytic leukemia 325 42 C20140605_SFK031_03 C20140605_SFK031_03 TB558226.[MT7]-LVNAQQAK[MT7].2y5_1.heavy 580.355 / 689.406 10292.0 21.202800750732422 47 17 10 10 10 2.80180604787502 29.136053027679623 0.0 3 0.9703321989594592 7.147268361570152 10292.0 11.616491117052881 0.0 - - - - - - - 285.84615384615387 20 13 MAN2B1 mannosidase, alpha, class 2B, member 1 327 42 C20140605_SFK031_03 C20140605_SFK031_03 TB558226.[MT7]-LVNAQQAK[MT7].2b4_1.heavy 580.355 / 542.342 N/A 21.202800750732422 47 17 10 10 10 2.80180604787502 29.136053027679623 0.0 3 0.9703321989594592 7.147268361570152 20462.0 4.203161078037926 1.0 - - - - - - - 244.0 45 1 MAN2B1 mannosidase, alpha, class 2B, member 1 329 42 C20140605_SFK031_03 C20140605_SFK031_03 TB558226.[MT7]-LVNAQQAK[MT7].2y6_1.heavy 580.355 / 803.449 20219.0 21.202800750732422 47 17 10 10 10 2.80180604787502 29.136053027679623 0.0 3 0.9703321989594592 7.147268361570152 20219.0 89.48685716123222 0.0 - - - - - - - 220.16666666666666 40 18 MAN2B1 mannosidase, alpha, class 2B, member 1 331 42 C20140605_SFK031_03 C20140605_SFK031_03 TB558226.[MT7]-LVNAQQAK[MT7].2y7_1.heavy 580.355 / 902.518 27344.0 21.202800750732422 47 17 10 10 10 2.80180604787502 29.136053027679623 0.0 3 0.9703321989594592 7.147268361570152 27344.0 138.03013859190625 0.0 - - - - - - - 236.94444444444446 54 18 MAN2B1 mannosidase, alpha, class 2B, member 1 333 43 C20140605_SFK031_03 C20140605_SFK031_03 TB556882.[MT7]-YLSGPER.2b3_1.heavy 483.262 / 508.289 14569.0 23.974000930786133 46 20 10 10 6 18.24394374422881 5.481271012559082 0.0 5 0.9980611783743287 28.0235563498024 14569.0 11.635480975245182 0.0 - - - - - - - 787.9090909090909 29 11 NKX3-2 NK3 homeobox 2 335 43 C20140605_SFK031_03 C20140605_SFK031_03 TB556882.[MT7]-YLSGPER.2y5_1.heavy 483.262 / 545.268 90766.0 23.974000930786133 46 20 10 10 6 18.24394374422881 5.481271012559082 0.0 5 0.9980611783743287 28.0235563498024 90766.0 96.08004855936866 0.0 - - - - - - - 1654.7142857142858 181 7 NKX3-2 NK3 homeobox 2 337 43 C20140605_SFK031_03 C20140605_SFK031_03 TB556882.[MT7]-YLSGPER.2b4_1.heavy 483.262 / 565.31 33072.0 23.974000930786133 46 20 10 10 6 18.24394374422881 5.481271012559082 0.0 5 0.9980611783743287 28.0235563498024 33072.0 51.33454278144154 0.0 - - - - - - - 1274.8333333333333 66 12 NKX3-2 NK3 homeobox 2 339 43 C20140605_SFK031_03 C20140605_SFK031_03 TB556882.[MT7]-YLSGPER.2b6_1.heavy 483.262 / 791.406 17993.0 23.974000930786133 46 20 10 10 6 18.24394374422881 5.481271012559082 0.0 5 0.9980611783743287 28.0235563498024 17993.0 16.986052760547636 2.0 - - - - - - - 718.1428571428571 58 7 NKX3-2 NK3 homeobox 2 341 44 C20140605_SFK031_03 C20140605_SFK031_03 TB560379.[MT7]-YAEEELEQVR.2y8_1.heavy 705.355 / 1031.5 35659.0 30.519899368286133 47 17 10 10 10 2.870551883724038 27.271355716726532 0.0 3 0.9709465682117704 7.222815573404252 35659.0 65.35115537848606 0.0 - - - - - - - 272.3333333333333 71 6 STIM1 stromal interaction molecule 1 343 44 C20140605_SFK031_03 C20140605_SFK031_03 TB560379.[MT7]-YAEEELEQVR.2y9_1.heavy 705.355 / 1102.54 62403.0 30.519899368286133 47 17 10 10 10 2.870551883724038 27.271355716726532 0.0 3 0.9709465682117704 7.222815573404252 62403.0 30.40832026751724 1.0 - - - - - - - 298.25 137 8 STIM1 stromal interaction molecule 1 345 44 C20140605_SFK031_03 C20140605_SFK031_03 TB560379.[MT7]-YAEEELEQVR.2b5_1.heavy 705.355 / 766.338 13937.0 30.519899368286133 47 17 10 10 10 2.870551883724038 27.271355716726532 0.0 3 0.9709465682117704 7.222815573404252 13937.0 61.44865869853918 0.0 - - - - - - - 659.125 27 8 STIM1 stromal interaction molecule 1 347 44 C20140605_SFK031_03 C20140605_SFK031_03 TB560379.[MT7]-YAEEELEQVR.2y7_1.heavy 705.355 / 902.458 23982.0 30.519899368286133 47 17 10 10 10 2.870551883724038 27.271355716726532 0.0 3 0.9709465682117704 7.222815573404252 23982.0 46.11960703262037 0.0 - - - - - - - 699.4285714285714 47 7 STIM1 stromal interaction molecule 1 349 45 C20140605_SFK031_03 C20140605_SFK031_03 TB558432.[MT7]-TFATSSGLK[MT7].2y4_1.heavy 600.347 / 548.352 6164.0 25.931049346923828 42 16 10 6 10 4.680796742075196 17.10645538103541 0.035400390625 3 0.9697126510989716 7.073420324699649 6164.0 1.7142630115216528 3.0 - - - - - - - 1215.375 14 8 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 351 45 C20140605_SFK031_03 C20140605_SFK031_03 TB558432.[MT7]-TFATSSGLK[MT7].2y8_1.heavy 600.347 / 954.538 11893.0 25.931049346923828 42 16 10 6 10 4.680796742075196 17.10645538103541 0.035400390625 3 0.9697126510989716 7.073420324699649 11893.0 50.24959849906191 0.0 - - - - - - - 153.69230769230768 23 13 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 353 45 C20140605_SFK031_03 C20140605_SFK031_03 TB558432.[MT7]-TFATSSGLK[MT7].2y5_1.heavy 600.347 / 635.385 10851.0 25.931049346923828 42 16 10 6 10 4.680796742075196 17.10645538103541 0.035400390625 3 0.9697126510989716 7.073420324699649 10851.0 19.22073985478532 0.0 - - - - - - - 694.4444444444445 21 9 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 355 45 C20140605_SFK031_03 C20140605_SFK031_03 TB558432.[MT7]-TFATSSGLK[MT7].2y6_1.heavy 600.347 / 736.432 14584.0 25.931049346923828 42 16 10 6 10 4.680796742075196 17.10645538103541 0.035400390625 3 0.9697126510989716 7.073420324699649 14584.0 30.247842156792245 0.0 - - - - - - - 675.1111111111111 29 9 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 357 46 C20140605_SFK031_03 C20140605_SFK031_03 TB561920.[MT7]-QTPLHLAVITTLPSVVR.4b8_2.heavy 498.055 / 502.804 42730.0 41.806800842285156 30 2 10 10 8 0.26498800454252996 156.53543646134227 0.0 4 0.4189022216310328 1.5329264837730046 42730.0 83.39327215672299 0.0 - - - - - - - 806.5714285714286 85 7 BCL3 B-cell CLL/lymphoma 3 359 46 C20140605_SFK031_03 C20140605_SFK031_03 TB561920.[MT7]-QTPLHLAVITTLPSVVR.4b4_1.heavy 498.055 / 584.352 10108.0 41.806800842285156 30 2 10 10 8 0.26498800454252996 156.53543646134227 0.0 4 0.4189022216310328 1.5329264837730046 10108.0 22.304368686868685 1.0 - - - - - - - 224.07142857142858 21 14 BCL3 B-cell CLL/lymphoma 3 361 46 C20140605_SFK031_03 C20140605_SFK031_03 TB561920.[MT7]-QTPLHLAVITTLPSVVR.4b5_2.heavy 498.055 / 361.209 12617.0 41.806800842285156 30 2 10 10 8 0.26498800454252996 156.53543646134227 0.0 4 0.4189022216310328 1.5329264837730046 12617.0 13.70641728871681 1.0 - - - - - - - 736.8571428571429 28 7 BCL3 B-cell CLL/lymphoma 3 363 46 C20140605_SFK031_03 C20140605_SFK031_03 TB561920.[MT7]-QTPLHLAVITTLPSVVR.4b5_1.heavy 498.055 / 721.411 4461.0 41.806800842285156 30 2 10 10 8 0.26498800454252996 156.53543646134227 0.0 4 0.4189022216310328 1.5329264837730046 4461.0 12.340881147540983 0.0 - - - - - - - 213.5625 8 16 BCL3 B-cell CLL/lymphoma 3 365 47 C20140605_SFK031_03 C20140605_SFK031_03 TB294800.[MT7]-RSLQESTR.3y3_1.heavy 374.211 / 363.199 44125.0 15.081199645996094 43 13 10 10 10 1.1626997425045276 56.70091293279529 0.0 3 0.9148580495375789 4.199135827091821 44125.0 4.9978098085950595 0.0 - - - - - - - 1678.0 88 1 BRCA1 breast cancer 1, early onset 367 47 C20140605_SFK031_03 C20140605_SFK031_03 TB294800.[MT7]-RSLQESTR.3b4_1.heavy 374.211 / 629.385 5923.0 15.081199645996094 43 13 10 10 10 1.1626997425045276 56.70091293279529 0.0 3 0.9148580495375789 4.199135827091821 5923.0 11.32588595721244 0.0 - - - - - - - 257.2105263157895 11 19 BRCA1 breast cancer 1, early onset 369 47 C20140605_SFK031_03 C20140605_SFK031_03 TB294800.[MT7]-RSLQESTR.3y4_1.heavy 374.211 / 492.241 37215.0 15.081199645996094 43 13 10 10 10 1.1626997425045276 56.70091293279529 0.0 3 0.9148580495375789 4.199135827091821 37215.0 49.08057093906682 0.0 - - - - - - - 723.9166666666666 74 12 BRCA1 breast cancer 1, early onset 371 47 C20140605_SFK031_03 C20140605_SFK031_03 TB294800.[MT7]-RSLQESTR.3b3_1.heavy 374.211 / 501.327 13672.0 15.081199645996094 43 13 10 10 10 1.1626997425045276 56.70091293279529 0.0 3 0.9148580495375789 4.199135827091821 13672.0 11.367159325625966 0.0 - - - - - - - 1213.4166666666667 27 12 BRCA1 breast cancer 1, early onset 373 48 C20140605_SFK031_03 C20140605_SFK031_03 TB560377.[MT7]-QIVDAQAVC[CAM]TR.3b4_1.heavy 468.918 / 600.347 226165.0 25.40220069885254 48 18 10 10 10 4.19932055629538 23.81337615440806 0.0 3 0.9858919006726057 10.378060556837726 226165.0 135.66143630898574 0.0 - - - - - - - 829.75 452 4 PML promyelocytic leukemia 375 48 C20140605_SFK031_03 C20140605_SFK031_03 TB560377.[MT7]-QIVDAQAVC[CAM]TR.3b5_1.heavy 468.918 / 671.385 71900.0 25.40220069885254 48 18 10 10 10 4.19932055629538 23.81337615440806 0.0 3 0.9858919006726057 10.378060556837726 71900.0 65.8137903530529 0.0 - - - - - - - 718.7777777777778 143 9 PML promyelocytic leukemia 377 48 C20140605_SFK031_03 C20140605_SFK031_03 TB560377.[MT7]-QIVDAQAVC[CAM]TR.3y4_1.heavy 468.918 / 535.266 179451.0 25.40220069885254 48 18 10 10 10 4.19932055629538 23.81337615440806 0.0 3 0.9858919006726057 10.378060556837726 179451.0 67.01820891787916 0.0 - - - - - - - 1799.142857142857 358 7 PML promyelocytic leukemia 379 48 C20140605_SFK031_03 C20140605_SFK031_03 TB560377.[MT7]-QIVDAQAVC[CAM]TR.3y5_1.heavy 468.918 / 606.303 188471.0 25.40220069885254 48 18 10 10 10 4.19932055629538 23.81337615440806 0.0 3 0.9858919006726057 10.378060556837726 188471.0 176.27833882928218 0.0 - - - - - - - 802.4285714285714 376 7 PML promyelocytic leukemia 381 49 C20140605_SFK031_03 C20140605_SFK031_03 TB562236.[MT7]-AAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPK[MT7].4y5_1.heavy 873.483 / 695.457 46739.0 47.47420120239258 40 10 10 10 10 1.2186579917051081 71.77705720765144 0.0 3 0.8214281865389241 2.8758785733969168 46739.0 51.657383078537165 0.0 - - - - - - - 358.0 93 6 MBNL1 muscleblind-like (Drosophila) 383 49 C20140605_SFK031_03 C20140605_SFK031_03 TB562236.[MT7]-AAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPK[MT7].4b7_1.heavy 873.483 / 919.475 2863.0 47.47420120239258 40 10 10 10 10 1.2186579917051081 71.77705720765144 0.0 3 0.8214281865389241 2.8758785733969168 2863.0 23.501308392715757 0.0 - - - - - - - 258.4 5 15 MBNL1 muscleblind-like (Drosophila) 385 49 C20140605_SFK031_03 C20140605_SFK031_03 TB562236.[MT7]-AAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPK[MT7].4b5_1.heavy 873.483 / 706.364 5769.0 47.47420120239258 40 10 10 10 10 1.2186579917051081 71.77705720765144 0.0 3 0.8214281865389241 2.8758785733969168 5769.0 6.812233589297024 1.0 - - - - - - - 191.88888888888889 12 9 MBNL1 muscleblind-like (Drosophila) 387 49 C20140605_SFK031_03 C20140605_SFK031_03 TB562236.[MT7]-AAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPK[MT7].4b6_1.heavy 873.483 / 805.432 7411.0 47.47420120239258 40 10 10 10 10 1.2186579917051081 71.77705720765144 0.0 3 0.8214281865389241 2.8758785733969168 7411.0 28.001998021760627 0.0 - - - - - - - 307.4 14 10 MBNL1 muscleblind-like (Drosophila) 389 50 C20140605_SFK031_03 C20140605_SFK031_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 3397620.0 18.787399291992188 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 3397620.0 9341.165498652292 0.0 - - - - - - - 229.66666666666666 6795 15 391 50 C20140605_SFK031_03 C20140605_SFK031_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 1998990.0 18.787399291992188 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1998990.0 6676.53396226415 0.0 - - - - - - - 188.44444444444446 3997 18 393 50 C20140605_SFK031_03 C20140605_SFK031_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 2428840.0 18.787399291992188 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2428840.0 11548.63567812767 0.0 - - - - - - - 150.16666666666666 4857 18 395 51 C20140605_SFK031_03 C20140605_SFK031_03 TB560374.[MT7]-VELIAYFEK[MT7].3y3_1.heavy 467.274 / 567.326 39101.0 43.51240158081055 42 12 10 10 10 1.2919900307774348 51.008441737767924 0.0 3 0.8986412179064814 3.8432023005976363 39101.0 145.71888179395282 0.0 - - - - - - - 192.22222222222223 78 9 MECP2 methyl CpG binding protein 2 (Rett syndrome) 397 51 C20140605_SFK031_03 C20140605_SFK031_03 TB560374.[MT7]-VELIAYFEK[MT7].3b4_1.heavy 467.274 / 599.388 29136.0 43.51240158081055 42 12 10 10 10 1.2919900307774348 51.008441737767924 0.0 3 0.8986412179064814 3.8432023005976363 29136.0 131.48014440433212 0.0 - - - - - - - 237.28571428571428 58 14 MECP2 methyl CpG binding protein 2 (Rett syndrome) 399 51 C20140605_SFK031_03 C20140605_SFK031_03 TB560374.[MT7]-VELIAYFEK[MT7].3b5_1.heavy 467.274 / 670.426 30520.0 43.51240158081055 42 12 10 10 10 1.2919900307774348 51.008441737767924 0.0 3 0.8986412179064814 3.8432023005976363 30520.0 120.84508670520232 0.0 - - - - - - - 227.42857142857142 61 14 MECP2 methyl CpG binding protein 2 (Rett syndrome) 401 51 C20140605_SFK031_03 C20140605_SFK031_03 TB560374.[MT7]-VELIAYFEK[MT7].3b3_1.heavy 467.274 / 486.304 31904.0 43.51240158081055 42 12 10 10 10 1.2919900307774348 51.008441737767924 0.0 3 0.8986412179064814 3.8432023005976363 31904.0 168.7408092485549 0.0 - - - - - - - 212.92307692307693 63 13 MECP2 methyl CpG binding protein 2 (Rett syndrome) 403 52 C20140605_SFK031_03 C20140605_SFK031_03 TB561518.[MT7]-FLEDTFGNDGRPR.3b4_1.heavy 556.613 / 649.331 69439.0 33.523101806640625 41 11 10 10 10 1.0751027295903495 61.266475586817464 0.0 3 0.8692292685814117 3.3748665446625283 69439.0 58.66451014507459 0.0 - - - - - - - 387.0 138 1 MAN2B1 mannosidase, alpha, class 2B, member 1 405 52 C20140605_SFK031_03 C20140605_SFK031_03 TB561518.[MT7]-FLEDTFGNDGRPR.3b3_1.heavy 556.613 / 534.304 37688.0 33.523101806640625 41 11 10 10 10 1.0751027295903495 61.266475586817464 0.0 3 0.8692292685814117 3.3748665446625283 37688.0 7.101566002720387 1.0 - - - - - - - 1420.0 95 1 MAN2B1 mannosidase, alpha, class 2B, member 1 407 52 C20140605_SFK031_03 C20140605_SFK031_03 TB561518.[MT7]-FLEDTFGNDGRPR.3y12_2.heavy 556.613 / 688.831 65696.0 33.523101806640625 41 11 10 10 10 1.0751027295903495 61.266475586817464 0.0 3 0.8692292685814117 3.3748665446625283 65696.0 100.97920778166333 0.0 - - - - - - - 290.25 131 4 MAN2B1 mannosidase, alpha, class 2B, member 1 409 52 C20140605_SFK031_03 C20140605_SFK031_03 TB561518.[MT7]-FLEDTFGNDGRPR.3y9_2.heavy 556.613 / 510.254 104545.0 33.523101806640625 41 11 10 10 10 1.0751027295903495 61.266475586817464 0.0 3 0.8692292685814117 3.3748665446625283 104545.0 77.77234358372918 0.0 - - - - - - - 1194.25 209 4 MAN2B1 mannosidase, alpha, class 2B, member 1 411 53 C20140605_SFK031_03 C20140605_SFK031_03 TB558022.[MT7]-NSPDRVK[MT7].2y5_1.heavy 552.324 / 758.464 778.0 14.722200075785318 35 17 2 6 10 3.2168313190488753 24.76522427301213 0.03479957580566406 3 0.9791928582803427 8.540833045306737 778.0 0.9139500734214391 1.0 - - - - - - - 0.0 1 0 SOX2 SRY (sex determining region Y)-box 2 413 53 C20140605_SFK031_03 C20140605_SFK031_03 TB558022.[MT7]-NSPDRVK[MT7].2b4_1.heavy 552.324 / 558.264 681.0 14.722200075785318 35 17 2 6 10 3.2168313190488753 24.76522427301213 0.03479957580566406 3 0.9791928582803427 8.540833045306737 681.0 4.439450266956694 3.0 - - - - - - - 0.0 1 0 SOX2 SRY (sex determining region Y)-box 2 415 53 C20140605_SFK031_03 C20140605_SFK031_03 TB558022.[MT7]-NSPDRVK[MT7].2y3_1.heavy 552.324 / 546.384 N/A 14.722200075785318 35 17 2 6 10 3.2168313190488753 24.76522427301213 0.03479957580566406 3 0.9791928582803427 8.540833045306737 1994.0 2.126066743632344 15.0 - - - - - - - 738.5454545454545 8 11 SOX2 SRY (sex determining region Y)-box 2 417 53 C20140605_SFK031_03 C20140605_SFK031_03 TB558022.[MT7]-NSPDRVK[MT7].2y6_1.heavy 552.324 / 845.496 1167.0 14.722200075785318 35 17 2 6 10 3.2168313190488753 24.76522427301213 0.03479957580566406 3 0.9791928582803427 8.540833045306737 1167.0 14.816170032481287 1.0 - - - - - - - 181.16666666666666 2 18 SOX2 SRY (sex determining region Y)-box 2 419 54 C20140605_SFK031_03 C20140605_SFK031_03 TB557845.[MT7]-C[CAM]PAGAMDEGPVDLR.3y6_1.heavy 544.593 / 656.373 37851.0 30.9512996673584 48 18 10 10 10 5.563053692249104 17.97573878162062 0.0 3 0.987485678826599 11.020588089579723 37851.0 16.055883574955075 1.0 - - - - - - - 129.0 76 1 BCL3 B-cell CLL/lymphoma 3 421 54 C20140605_SFK031_03 C20140605_SFK031_03 TB557845.[MT7]-C[CAM]PAGAMDEGPVDLR.3b4_1.heavy 544.593 / 530.251 38109.0 30.9512996673584 48 18 10 10 10 5.563053692249104 17.97573878162062 0.0 3 0.987485678826599 11.020588089579723 38109.0 12.368923892221595 1.0 - - - - - - - 1159.0 76 1 BCL3 B-cell CLL/lymphoma 3 423 54 C20140605_SFK031_03 C20140605_SFK031_03 TB557845.[MT7]-C[CAM]PAGAMDEGPVDLR.3b5_1.heavy 544.593 / 601.288 81882.0 30.9512996673584 48 18 10 10 10 5.563053692249104 17.97573878162062 0.0 3 0.987485678826599 11.020588089579723 81882.0 52.95429592469088 1.0 - - - - - - - 257.0 163 1 BCL3 B-cell CLL/lymphoma 3 425 54 C20140605_SFK031_03 C20140605_SFK031_03 TB557845.[MT7]-C[CAM]PAGAMDEGPVDLR.3y5_1.heavy 544.593 / 599.351 33216.0 30.9512996673584 48 18 10 10 10 5.563053692249104 17.97573878162062 0.0 3 0.987485678826599 11.020588089579723 33216.0 35.12317193861572 0.0 - - - - - - - 129.0 66 1 BCL3 B-cell CLL/lymphoma 3 427 55 C20140605_SFK031_03 C20140605_SFK031_03 TB294984.[MT7]-LFSANDVENIFSR.2y5_1.heavy 828.429 / 636.346 3100.0 44.8120756149292 41 16 9 6 10 2.3918668948355943 33.35982825077214 0.038501739501953125 3 0.963774026100546 6.464463353278057 3100.0 5.5513465038452665 1.0 - - - - - - - 303.38461538461536 13 13 SOS1 son of sevenless homolog 1 (Drosophila) 429 55 C20140605_SFK031_03 C20140605_SFK031_03 TB294984.[MT7]-LFSANDVENIFSR.2y3_1.heavy 828.429 / 409.219 4297.0 44.8120756149292 41 16 9 6 10 2.3918668948355943 33.35982825077214 0.038501739501953125 3 0.963774026100546 6.464463353278057 4297.0 7.272551750710825 0.0 - - - - - - - 748.625 8 8 SOS1 son of sevenless homolog 1 (Drosophila) 431 55 C20140605_SFK031_03 C20140605_SFK031_03 TB294984.[MT7]-LFSANDVENIFSR.2b6_1.heavy 828.429 / 792.401 5847.0 44.8120756149292 41 16 9 6 10 2.3918668948355943 33.35982825077214 0.038501739501953125 3 0.963774026100546 6.464463353278057 5847.0 13.722890100522148 0.0 - - - - - - - 704.5555555555555 11 9 SOS1 son of sevenless homolog 1 (Drosophila) 433 55 C20140605_SFK031_03 C20140605_SFK031_03 TB294984.[MT7]-LFSANDVENIFSR.2y7_1.heavy 828.429 / 864.457 5636.0 44.8120756149292 41 16 9 6 10 2.3918668948355943 33.35982825077214 0.038501739501953125 3 0.963774026100546 6.464463353278057 5636.0 11.175294440631436 0.0 - - - - - - - 775.0 11 8 SOS1 son of sevenless homolog 1 (Drosophila) 435 56 C20140605_SFK031_03 C20140605_SFK031_03 TB294985.[MT7]-ALDTVLFGPPLLTR.2b4_1.heavy 828.994 / 545.305 20768.0 48.29997444152832 38 12 10 6 10 2.2943541239742853 34.64553025277875 0.03549957275390625 3 0.895575642333236 3.7853645636321236 20768.0 35.23142857142857 1.0 - - - - - - - 280.0 41 10 STIM1 stromal interaction molecule 1 437 56 C20140605_SFK031_03 C20140605_SFK031_03 TB294985.[MT7]-ALDTVLFGPPLLTR.2y9_1.heavy 828.994 / 1013.61 48070.0 48.29997444152832 38 12 10 6 10 2.2943541239742853 34.64553025277875 0.03549957275390625 3 0.895575642333236 3.7853645636321236 48070.0 111.59524658780708 0.0 - - - - - - - 379.125 96 8 STIM1 stromal interaction molecule 1 439 56 C20140605_SFK031_03 C20140605_SFK031_03 TB294985.[MT7]-ALDTVLFGPPLLTR.2b5_1.heavy 828.994 / 644.374 40463.0 48.29997444152832 38 12 10 6 10 2.2943541239742853 34.64553025277875 0.03549957275390625 3 0.895575642333236 3.7853645636321236 40463.0 64.6041272417721 0.0 - - - - - - - 373.5 80 2 STIM1 stromal interaction molecule 1 441 56 C20140605_SFK031_03 C20140605_SFK031_03 TB294985.[MT7]-ALDTVLFGPPLLTR.2y11_1.heavy 828.994 / 1213.73 16568.0 48.29997444152832 38 12 10 6 10 2.2943541239742853 34.64553025277875 0.03549957275390625 3 0.895575642333236 3.7853645636321236 16568.0 31.183350058241622 0.0 - - - - - - - 267.1818181818182 33 11 STIM1 stromal interaction molecule 1 443 57 C20140605_SFK031_03 C20140605_SFK031_03 TB561516.[MT7]-LIEGVHPGSLVEK[MT7].3y7_1.heavy 555.997 / 873.516 43301.0 32.19110107421875 45 15 10 10 10 2.280146920844987 29.795749503613315 0.0 3 0.9540714627203497 5.736469347989952 43301.0 167.78907358623113 0.0 - - - - - - - 238.33333333333334 86 6 STIM1 stromal interaction molecule 1 445 57 C20140605_SFK031_03 C20140605_SFK031_03 TB561516.[MT7]-LIEGVHPGSLVEK[MT7].3y3_1.heavy 555.997 / 519.326 46032.0 32.19110107421875 45 15 10 10 10 2.280146920844987 29.795749503613315 0.0 3 0.9540714627203497 5.736469347989952 46032.0 24.385657957309252 0.0 - - - - - - - 1300.0 92 2 STIM1 stromal interaction molecule 1 447 57 C20140605_SFK031_03 C20140605_SFK031_03 TB561516.[MT7]-LIEGVHPGSLVEK[MT7].3y6_1.heavy 555.997 / 776.463 22626.0 32.19110107421875 45 15 10 10 10 2.280146920844987 29.795749503613315 0.0 3 0.9540714627203497 5.736469347989952 22626.0 52.23726343492489 0.0 - - - - - - - 303.3333333333333 45 3 STIM1 stromal interaction molecule 1 449 57 C20140605_SFK031_03 C20140605_SFK031_03 TB561516.[MT7]-LIEGVHPGSLVEK[MT7].3b5_1.heavy 555.997 / 656.41 72559.0 32.19110107421875 45 15 10 10 10 2.280146920844987 29.795749503613315 0.0 3 0.9540714627203497 5.736469347989952 72559.0 61.39130766601595 0.0 - - - - - - - 130.0 145 1 STIM1 stromal interaction molecule 1 451 58 C20140605_SFK031_03 C20140605_SFK031_03 TB295054.[MT7]-QLAAGWGPC[CAM]EVLLSNALAR.2b3_1.heavy 1085.58 / 457.289 3568.0 47.47420120239258 42 18 8 10 6 3.1507278404072805 31.738698188248925 0.0 6 0.9818609539275873 9.149481424523575 3568.0 9.848448599325632 2.0 - - - - - - - 219.5 7 8 MAN2B1 mannosidase, alpha, class 2B, member 1 453 58 C20140605_SFK031_03 C20140605_SFK031_03 TB295054.[MT7]-QLAAGWGPC[CAM]EVLLSNALAR.2y9_1.heavy 1085.58 / 956.589 793.0 47.47420120239258 42 18 8 10 6 3.1507278404072805 31.738698188248925 0.0 6 0.9818609539275873 9.149481424523575 793.0 5.701686885854383 4.0 - - - - - - - 180.5625 3 16 MAN2B1 mannosidase, alpha, class 2B, member 1 455 58 C20140605_SFK031_03 C20140605_SFK031_03 TB295054.[MT7]-QLAAGWGPC[CAM]EVLLSNALAR.2b4_1.heavy 1085.58 / 528.326 3342.0 47.47420120239258 42 18 8 10 6 3.1507278404072805 31.738698188248925 0.0 6 0.9818609539275873 9.149481424523575 3342.0 8.212431963804338 2.0 - - - - - - - 247.1818181818182 8 11 MAN2B1 mannosidase, alpha, class 2B, member 1 457 58 C20140605_SFK031_03 C20140605_SFK031_03 TB295054.[MT7]-QLAAGWGPC[CAM]EVLLSNALAR.2b5_1.heavy 1085.58 / 585.348 N/A 47.47420120239258 42 18 8 10 6 3.1507278404072805 31.738698188248925 0.0 6 0.9818609539275873 9.149481424523575 0.0 0.0 46.0 - - - - - - - 234.71428571428572 6 7 MAN2B1 mannosidase, alpha, class 2B, member 1 459 59 C20140605_SFK031_03 C20140605_SFK031_03 TB295052.[MT7]-LFVGNLPTDITEEDFK[MT7].4b4_1.heavy 532.287 / 561.352 10613.0 44.187599182128906 43 17 10 6 10 3.815303948223874 26.210231571865375 0.03639984130859375 3 0.9771411866791673 8.147131989581084 10613.0 25.674703773464113 0.0 - - - - - - - 811.9 21 10 PSPC1 paraspeckle component 1 461 59 C20140605_SFK031_03 C20140605_SFK031_03 TB295052.[MT7]-LFVGNLPTDITEEDFK[MT7].4b5_1.heavy 532.287 / 675.395 19943.0 44.187599182128906 43 17 10 6 10 3.815303948223874 26.210231571865375 0.03639984130859375 3 0.9771411866791673 8.147131989581084 19943.0 31.148989622418284 0.0 - - - - - - - 776.4 39 10 PSPC1 paraspeckle component 1 463 59 C20140605_SFK031_03 C20140605_SFK031_03 TB295052.[MT7]-LFVGNLPTDITEEDFK[MT7].4b6_1.heavy 532.287 / 788.479 8405.0 44.187599182128906 43 17 10 6 10 3.815303948223874 26.210231571865375 0.03639984130859375 3 0.9771411866791673 8.147131989581084 8405.0 55.638732394366194 1.0 - - - - - - - 209.0625 16 16 PSPC1 paraspeckle component 1 465 59 C20140605_SFK031_03 C20140605_SFK031_03 TB295052.[MT7]-LFVGNLPTDITEEDFK[MT7].4b3_1.heavy 532.287 / 504.33 11325.0 44.187599182128906 43 17 10 6 10 3.815303948223874 26.210231571865375 0.03639984130859375 3 0.9771411866791673 8.147131989581084 11325.0 6.337752657019291 1.0 - - - - - - - 926.0 22 4 PSPC1 paraspeckle component 1 467 60 C20140605_SFK031_03 C20140605_SFK031_03 TB295051.[MT7]-LFVGNLPTDITEEDFK[MT7].2b3_1.heavy 1063.57 / 504.33 17008.0 44.187599182128906 36 10 10 6 10 0.827099820142441 70.77260688138612 0.03639984130859375 3 0.8485877389665554 3.1307130364700892 17008.0 68.64470821466878 0.0 - - - - - - - 336.3636363636364 34 11 PSPC1 paraspeckle component 1 469 60 C20140605_SFK031_03 C20140605_SFK031_03 TB295051.[MT7]-LFVGNLPTDITEEDFK[MT7].2y8_1.heavy 1063.57 / 1140.55 1993.0 44.187599182128906 36 10 10 6 10 0.827099820142441 70.77260688138612 0.03639984130859375 3 0.8485877389665554 3.1307130364700892 1993.0 6.01475064064656 0.0 - - - - - - - 256.8888888888889 3 18 PSPC1 paraspeckle component 1 471 60 C20140605_SFK031_03 C20140605_SFK031_03 TB295051.[MT7]-LFVGNLPTDITEEDFK[MT7].2b6_1.heavy 1063.57 / 788.479 32592.0 44.187599182128906 36 10 10 6 10 0.827099820142441 70.77260688138612 0.03639984130859375 3 0.8485877389665554 3.1307130364700892 32592.0 66.81975049698926 0.0 - - - - - - - 310.54545454545456 65 11 PSPC1 paraspeckle component 1 473 60 C20140605_SFK031_03 C20140605_SFK031_03 TB295051.[MT7]-LFVGNLPTDITEEDFK[MT7].2b5_1.heavy 1063.57 / 675.395 20708.0 44.187599182128906 36 10 10 6 10 0.827099820142441 70.77260688138612 0.03639984130859375 3 0.8485877389665554 3.1307130364700892 20708.0 46.673222107438015 0.0 - - - - - - - 314.3333333333333 41 12 PSPC1 paraspeckle component 1 475 61 C20140605_SFK031_03 C20140605_SFK031_03 TB561512.[MT7]-ALDTVLFGPPLLTR.3y6_1.heavy 552.998 / 696.44 75632.0 48.291099548339844 47 17 10 10 10 3.019433344472049 26.42263760526936 0.0 3 0.9761007928268797 7.967129322450169 75632.0 251.09242523860019 0.0 - - - - - - - 279.22222222222223 151 9 STIM1 stromal interaction molecule 1 477 61 C20140605_SFK031_03 C20140605_SFK031_03 TB561512.[MT7]-ALDTVLFGPPLLTR.3b4_1.heavy 552.998 / 545.305 65063.0 48.291099548339844 47 17 10 10 10 3.019433344472049 26.42263760526936 0.0 3 0.9761007928268797 7.967129322450169 65063.0 204.69863405135695 0.0 - - - - - - - 157.11111111111111 130 9 STIM1 stromal interaction molecule 1 479 61 C20140605_SFK031_03 C20140605_SFK031_03 TB561512.[MT7]-ALDTVLFGPPLLTR.3b5_1.heavy 552.998 / 644.374 90759.0 48.291099548339844 47 17 10 10 10 3.019433344472049 26.42263760526936 0.0 3 0.9761007928268797 7.967129322450169 90759.0 365.71876363303926 0.0 - - - - - - - 668.1111111111111 181 9 STIM1 stromal interaction molecule 1 481 61 C20140605_SFK031_03 C20140605_SFK031_03 TB561512.[MT7]-ALDTVLFGPPLLTR.3y5_1.heavy 552.998 / 599.388 81211.0 48.291099548339844 47 17 10 10 10 3.019433344472049 26.42263760526936 0.0 3 0.9761007928268797 7.967129322450169 81211.0 204.8131515525338 0.0 - - - - - - - 267.2 162 10 STIM1 stromal interaction molecule 1 483 62 C20140605_SFK031_03 C20140605_SFK031_03 TB561510.[MT7]-QMAADLLASAPAAK[MT7].3b6_1.heavy 549.311 / 774.394 62974.0 35.03369903564453 42 12 10 10 10 1.2005669720416976 60.94622455945341 0.0 3 0.8893300141382505 3.6750083054287424 62974.0 44.16714160908196 0.0 - - - - - - - 315.0 125 2 NKX3-2 NK3 homeobox 2 485 62 C20140605_SFK031_03 C20140605_SFK031_03 TB561510.[MT7]-QMAADLLASAPAAK[MT7].3b5_1.heavy 549.311 / 661.31 60329.0 35.03369903564453 42 12 10 10 10 1.2005669720416976 60.94622455945341 0.0 3 0.8893300141382505 3.6750083054287424 60329.0 69.09984639926451 0.0 - - - - - - - 252.0 120 5 NKX3-2 NK3 homeobox 2 487 62 C20140605_SFK031_03 C20140605_SFK031_03 TB561510.[MT7]-QMAADLLASAPAAK[MT7].3y4_1.heavy 549.311 / 530.342 119021.0 35.03369903564453 42 12 10 10 10 1.2005669720416976 60.94622455945341 0.0 3 0.8893300141382505 3.6750083054287424 119021.0 44.791473191610265 0.0 - - - - - - - 819.0 238 2 NKX3-2 NK3 homeobox 2 489 62 C20140605_SFK031_03 C20140605_SFK031_03 TB561510.[MT7]-QMAADLLASAPAAK[MT7].3b7_1.heavy 549.311 / 887.478 12091.0 35.03369903564453 42 12 10 10 10 1.2005669720416976 60.94622455945341 0.0 3 0.8893300141382505 3.6750083054287424 12091.0 32.75445502645503 0.0 - - - - - - - 277.2 24 10 NKX3-2 NK3 homeobox 2 491 63 C20140605_SFK031_03 C20140605_SFK031_03 TB556460.[MT7]-APQPIPR.2y4_1.heavy 461.783 / 482.309 86990.0 21.366775035858154 46 20 10 6 10 6.940880214881512 14.407394581683775 0.03289985656738281 3 0.9931064363672891 14.85561627987482 86990.0 128.01897494633832 0.0 - - - - - - - 813.8 173 10 MAN2B1 mannosidase, alpha, class 2B, member 1 493 63 C20140605_SFK031_03 C20140605_SFK031_03 TB556460.[MT7]-APQPIPR.2y5_1.heavy 461.783 / 610.367 12207.0 21.366775035858154 46 20 10 6 10 6.940880214881512 14.407394581683775 0.03289985656738281 3 0.9931064363672891 14.85561627987482 12207.0 5.596867381259949 1.0 - - - - - - - 308.0 24 1 MAN2B1 mannosidase, alpha, class 2B, member 1 495 63 C20140605_SFK031_03 C20140605_SFK031_03 TB556460.[MT7]-APQPIPR.2y6_1.heavy 461.783 / 707.42 298824.0 21.366775035858154 46 20 10 6 10 6.940880214881512 14.407394581683775 0.03289985656738281 3 0.9931064363672891 14.85561627987482 298824.0 727.2146366897871 0.0 - - - - - - - 678.2 597 10 MAN2B1 mannosidase, alpha, class 2B, member 1 497 63 C20140605_SFK031_03 C20140605_SFK031_03 TB556460.[MT7]-APQPIPR.2b5_1.heavy 461.783 / 651.395 15351.0 21.366775035858154 46 20 10 6 10 6.940880214881512 14.407394581683775 0.03289985656738281 3 0.9931064363672891 14.85561627987482 15351.0 22.220161811252503 0.0 - - - - - - - 1171.3333333333333 30 9 MAN2B1 mannosidase, alpha, class 2B, member 1 499 64 C20140605_SFK031_03 C20140605_SFK031_03 TB561619.[MT7]-SRDILTDVVIVVSR.3y6_1.heavy 572.676 / 672.44 77051.0 43.62310028076172 44 14 10 10 10 3.05978483547172 32.682036606205756 0.0 3 0.9359668193861326 4.8508148532455895 77051.0 206.82760416666667 0.0 - - - - - - - 731.4545454545455 154 11 BCL6 B-cell CLL/lymphoma 6 501 64 C20140605_SFK031_03 C20140605_SFK031_03 TB561619.[MT7]-SRDILTDVVIVVSR.3b3_1.heavy 572.676 / 503.269 11235.0 43.62310028076172 44 14 10 10 10 3.05978483547172 32.682036606205756 0.0 3 0.9359668193861326 4.8508148532455895 11235.0 8.641401320584952 1.0 - - - - - - - 832.4444444444445 87 9 BCL6 B-cell CLL/lymphoma 6 503 64 C20140605_SFK031_03 C20140605_SFK031_03 TB561619.[MT7]-SRDILTDVVIVVSR.3b8_1.heavy 572.676 / 1044.58 30585.0 43.62310028076172 44 14 10 10 10 3.05978483547172 32.682036606205756 0.0 3 0.9359668193861326 4.8508148532455895 30585.0 137.6586204938704 0.0 - - - - - - - 198.73333333333332 61 15 BCL6 B-cell CLL/lymphoma 6 505 64 C20140605_SFK031_03 C20140605_SFK031_03 TB561619.[MT7]-SRDILTDVVIVVSR.3b7_1.heavy 572.676 / 945.512 78022.0 43.62310028076172 44 14 10 10 10 3.05978483547172 32.682036606205756 0.0 3 0.9359668193861326 4.8508148532455895 78022.0 895.2344452130603 0.0 - - - - - - - 247.0 156 16 BCL6 B-cell CLL/lymphoma 6 507 65 C20140605_SFK031_03 C20140605_SFK031_03 TB561680.[MT7]-ALLDSAAPGTLDLEAR.3b6_1.heavy 586.324 / 715.411 103295.0 38.062599182128906 46 16 10 10 10 4.156948966747526 24.056104801845052 0.0 3 0.9611797259470711 6.243354732731334 103295.0 73.7442122010415 0.0 - - - - - - - 671.0 206 2 BCL3 B-cell CLL/lymphoma 3 509 65 C20140605_SFK031_03 C20140605_SFK031_03 TB561680.[MT7]-ALLDSAAPGTLDLEAR.3b5_1.heavy 586.324 / 644.374 112023.0 38.062599182128906 46 16 10 10 10 4.156948966747526 24.056104801845052 0.0 3 0.9611797259470711 6.243354732731334 112023.0 89.82623911473449 0.0 - - - - - - - 384.0 224 2 BCL3 B-cell CLL/lymphoma 3 511 65 C20140605_SFK031_03 C20140605_SFK031_03 TB561680.[MT7]-ALLDSAAPGTLDLEAR.3y8_1.heavy 586.324 / 874.463 85648.0 38.062599182128906 46 16 10 10 10 4.156948966747526 24.056104801845052 0.0 3 0.9611797259470711 6.243354732731334 85648.0 162.99887159668577 0.0 - - - - - - - 276.0 171 8 BCL3 B-cell CLL/lymphoma 3 513 65 C20140605_SFK031_03 C20140605_SFK031_03 TB561680.[MT7]-ALLDSAAPGTLDLEAR.3y9_1.heavy 586.324 / 971.516 188943.0 38.062599182128906 46 16 10 10 10 4.156948966747526 24.056104801845052 0.0 3 0.9611797259470711 6.243354732731334 188943.0 119.96413227786542 0.0 - - - - - - - 288.0 377 8 BCL3 B-cell CLL/lymphoma 3 515 66 C20140605_SFK031_03 C20140605_SFK031_03 TB294854.[MT7]-LLSDTSVIQFYPSK[MT7].3b4_1.heavy 629.355 / 573.336 15287.0 41.69130039215088 30 7 10 3 10 0.4683719007294957 98.93580481271022 0.056400299072265625 3 0.7375673408001477 2.3543039341270755 15287.0 17.70548183631046 1.0 - - - - - - - 1769.5714285714287 30 7 C16orf62 chromosome 16 open reading frame 62 517 66 C20140605_SFK031_03 C20140605_SFK031_03 TB294854.[MT7]-LLSDTSVIQFYPSK[MT7].3y4_1.heavy 629.355 / 638.363 35882.0 41.69130039215088 30 7 10 3 10 0.4683719007294957 98.93580481271022 0.056400299072265625 3 0.7375673408001477 2.3543039341270755 35882.0 31.662053171566825 0.0 - - - - - - - 1294.0 71 7 C16orf62 chromosome 16 open reading frame 62 519 66 C20140605_SFK031_03 C20140605_SFK031_03 TB294854.[MT7]-LLSDTSVIQFYPSK[MT7].3b8_1.heavy 629.355 / 973.569 9696.0 41.69130039215088 30 7 10 3 10 0.4683719007294957 98.93580481271022 0.056400299072265625 3 0.7375673408001477 2.3543039341270755 9696.0 9.322122353457418 2.0 - - - - - - - 720.6363636363636 23 11 C16orf62 chromosome 16 open reading frame 62 521 66 C20140605_SFK031_03 C20140605_SFK031_03 TB294854.[MT7]-LLSDTSVIQFYPSK[MT7].3b7_1.heavy 629.355 / 860.485 23567.0 41.69130039215088 30 7 10 3 10 0.4683719007294957 98.93580481271022 0.056400299072265625 3 0.7375673408001477 2.3543039341270755 23567.0 15.530095521320437 0.0 - - - - - - - 778.6666666666666 47 9 C16orf62 chromosome 16 open reading frame 62 523 67 C20140605_SFK031_03 C20140605_SFK031_03 TB399795.[MT7]-ILEC[CAM]PIC[CAM]LELIK[MT7].3y6_1.heavy 597.012 / 919.54 44833.0 44.94020080566406 44 14 10 10 10 2.1312717140996456 38.31391781366971 0.0 3 0.9475136405284903 5.363163690739179 44833.0 144.65180631980184 0.0 - - - - - - - 231.5 89 16 BRCA1 breast cancer 1, early onset 525 67 C20140605_SFK031_03 C20140605_SFK031_03 TB399795.[MT7]-ILEC[CAM]PIC[CAM]LELIK[MT7].3b4_1.heavy 597.012 / 660.351 88491.0 44.94020080566406 44 14 10 10 10 2.1312717140996456 38.31391781366971 0.0 3 0.9475136405284903 5.363163690739179 88491.0 134.48644466090914 0.0 - - - - - - - 352.6666666666667 176 3 BRCA1 breast cancer 1, early onset 527 67 C20140605_SFK031_03 C20140605_SFK031_03 TB399795.[MT7]-ILEC[CAM]PIC[CAM]LELIK[MT7].3b3_1.heavy 597.012 / 500.32 36431.0 44.94020080566406 44 14 10 10 10 2.1312717140996456 38.31391781366971 0.0 3 0.9475136405284903 5.363163690739179 36431.0 38.86291230366492 0.0 - - - - - - - 835.6666666666666 72 9 BRCA1 breast cancer 1, early onset 529 67 C20140605_SFK031_03 C20140605_SFK031_03 TB399795.[MT7]-ILEC[CAM]PIC[CAM]LELIK[MT7].3y5_1.heavy 597.012 / 759.51 22505.0 44.94020080566406 44 14 10 10 10 2.1312717140996456 38.31391781366971 0.0 3 0.9475136405284903 5.363163690739179 22505.0 21.911933325165016 0.0 - - - - - - - 271.75 45 8 BRCA1 breast cancer 1, early onset 531 68 C20140605_SFK031_03 C20140605_SFK031_03 TB561883.[MT7]-TGEGFLC[CAM]VFAINNSK[MT7].3b6_1.heavy 649.008 / 749.395 25834.0 43.77789878845215 38 12 10 6 10 1.0964743383373354 59.907362634738504 0.03639984130859375 3 0.8821265902112212 3.558714612258339 25834.0 52.991648508469396 0.0 - - - - - - - 296.0 51 4 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 533 68 C20140605_SFK031_03 C20140605_SFK031_03 TB561883.[MT7]-TGEGFLC[CAM]VFAINNSK[MT7].3b5_1.heavy 649.008 / 636.311 42825.0 43.77789878845215 38 12 10 6 10 1.0964743383373354 59.907362634738504 0.03639984130859375 3 0.8821265902112212 3.558714612258339 42825.0 36.0244142611778 0.0 - - - - - - - 348.0 85 1 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 535 68 C20140605_SFK031_03 C20140605_SFK031_03 TB561883.[MT7]-TGEGFLC[CAM]VFAINNSK[MT7].3y4_1.heavy 649.008 / 606.333 65317.0 43.77789878845215 38 12 10 6 10 1.0964743383373354 59.907362634738504 0.03639984130859375 3 0.8821265902112212 3.558714612258339 65317.0 48.37077238280334 0.0 - - - - - - - 418.0 130 1 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 537 68 C20140605_SFK031_03 C20140605_SFK031_03 TB561883.[MT7]-TGEGFLC[CAM]VFAINNSK[MT7].3b7_1.heavy 649.008 / 909.426 27506.0 43.77789878845215 38 12 10 6 10 1.0964743383373354 59.907362634738504 0.03639984130859375 3 0.8821265902112212 3.558714612258339 27506.0 121.15760373506173 0.0 - - - - - - - 278.2857142857143 55 7 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 539 69 C20140605_SFK031_03 C20140605_SFK031_03 TB561362.[MT7]-WAIADAQSAIEK[MT7].3b6_1.heavy 530.963 / 772.411 21666.0 35.521400451660156 41 13 8 10 10 1.1436099645320332 50.7467959717458 0.0 3 0.9244114184096089 4.460257269048351 21666.0 20.66398336800086 1.0 - - - - - - - 809.5 43 8 SOS1;SOS2 son of sevenless homolog 1 (Drosophila);son of sevenless homolog 2 (Drosophila) 541 69 C20140605_SFK031_03 C20140605_SFK031_03 TB561362.[MT7]-WAIADAQSAIEK[MT7].3y3_1.heavy 530.963 / 533.341 59518.0 35.521400451660156 41 13 8 10 10 1.1436099645320332 50.7467959717458 0.0 3 0.9244114184096089 4.460257269048351 59518.0 50.55987694771473 0.0 - - - - - - - 1334.142857142857 167 7 SOS1;SOS2 son of sevenless homolog 1 (Drosophila);son of sevenless homolog 2 (Drosophila) 543 69 C20140605_SFK031_03 C20140605_SFK031_03 TB561362.[MT7]-WAIADAQSAIEK[MT7].3b5_1.heavy 530.963 / 701.374 56530.0 35.521400451660156 41 13 8 10 10 1.1436099645320332 50.7467959717458 0.0 3 0.9244114184096089 4.460257269048351 56530.0 54.60909536850305 0.0 - - - - - - - 373.8333333333333 113 6 SOS1;SOS2 son of sevenless homolog 1 (Drosophila);son of sevenless homolog 2 (Drosophila) 545 69 C20140605_SFK031_03 C20140605_SFK031_03 TB561362.[MT7]-WAIADAQSAIEK[MT7].3b3_1.heavy 530.963 / 515.31 31004.0 35.521400451660156 41 13 8 10 10 1.1436099645320332 50.7467959717458 0.0 3 0.9244114184096089 4.460257269048351 31004.0 19.368853190539937 0.0 - - - - - - - 623.0 62 1 SOS1;SOS2 son of sevenless homolog 1 (Drosophila);son of sevenless homolog 2 (Drosophila) 547 70 C20140605_SFK031_03 C20140605_SFK031_03 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - 549 70 C20140605_SFK031_03 C20140605_SFK031_03 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - 551 70 C20140605_SFK031_03 C20140605_SFK031_03 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - 553 71 C20140605_SFK031_03 C20140605_SFK031_03 TB555896.[MT7]-DAAVSK[MT7].2y4_1.heavy 439.763 / 548.352 10517.0 16.053499221801758 50 20 10 10 10 4.512065589752735 22.162798392627106 0.0 3 0.9907489190749593 12.821261340721797 10517.0 20.670824129697387 0.0 - - - - - - - 726.1428571428571 21 7 PML promyelocytic leukemia 555 71 C20140605_SFK031_03 C20140605_SFK031_03 TB555896.[MT7]-DAAVSK[MT7].2y5_1.heavy 439.763 / 619.39 21981.0 16.053499221801758 50 20 10 10 10 4.512065589752735 22.162798392627106 0.0 3 0.9907489190749593 12.821261340721797 21981.0 20.994269340974213 0.0 - - - - - - - 692.2222222222222 43 9 PML promyelocytic leukemia 557 71 C20140605_SFK031_03 C20140605_SFK031_03 TB555896.[MT7]-DAAVSK[MT7].2b4_1.heavy 439.763 / 501.279 11414.0 16.053499221801758 50 20 10 10 10 4.512065589752735 22.162798392627106 0.0 3 0.9907489190749593 12.821261340721797 11414.0 16.173358921169285 0.0 - - - - - - - 847.2222222222222 22 9 PML promyelocytic leukemia 559 71 C20140605_SFK031_03 C20140605_SFK031_03 TB555896.[MT7]-DAAVSK[MT7].2y3_1.heavy 439.763 / 477.315 16697.0 16.053499221801758 50 20 10 10 10 4.512065589752735 22.162798392627106 0.0 3 0.9907489190749593 12.821261340721797 16697.0 28.069464822356277 0.0 - - - - - - - 1239.142857142857 33 7 PML promyelocytic leukemia 561 72 C20140605_SFK031_03 C20140605_SFK031_03 TB294716.[MT7]-DLEDLGR.2b3_1.heavy 481.257 / 502.263 7501.0 27.904924392700195 27 17 0 6 4 5.279345750895797 18.941741025965584 0.03730010986328125 7 0.9757299029932217 7.905772539578675 7501.0 0.49495216100296935 6.0 - - - - - - - 1387.0 163 2 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 563 72 C20140605_SFK031_03 C20140605_SFK031_03 TB294716.[MT7]-DLEDLGR.2y5_1.heavy 481.257 / 589.294 3802.0 27.904924392700195 27 17 0 6 4 5.279345750895797 18.941741025965584 0.03730010986328125 7 0.9757299029932217 7.905772539578675 3802.0 1.523411562678878 12.0 - - - - - - - 744.75 10 4 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 565 72 C20140605_SFK031_03 C20140605_SFK031_03 TB294716.[MT7]-DLEDLGR.2b4_1.heavy 481.257 / 617.29 21680.0 27.904924392700195 27 17 0 6 4 5.279345750895797 18.941741025965584 0.03730010986328125 7 0.9757299029932217 7.905772539578675 21680.0 38.97443911169885 1.0 - - - - - - - 1695.25 67 8 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 567 72 C20140605_SFK031_03 C20140605_SFK031_03 TB294716.[MT7]-DLEDLGR.2y6_1.heavy 481.257 / 702.378 10480.0 27.904924392700195 27 17 0 6 4 5.279345750895797 18.941741025965584 0.03730010986328125 7 0.9757299029932217 7.905772539578675 10480.0 18.040906553075082 0.0 - - - - - - - 779.1666666666666 20 12 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 569 73 C20140605_SFK031_03 C20140605_SFK031_03 TB555892.[MT7]-LYPGQR.2y4_1.heavy 439.254 / 457.252 77450.0 23.004199981689453 50 20 10 10 10 7.713172554079585 12.964833769615183 0.0 3 0.9933543943823062 15.1305348926088 77450.0 40.574777362376025 1.0 - - - - - - - 1306.6 154 5 MAN2B1 mannosidase, alpha, class 2B, member 1 571 73 C20140605_SFK031_03 C20140605_SFK031_03 TB555892.[MT7]-LYPGQR.2y5_1.heavy 439.254 / 620.315 82249.0 23.004199981689453 50 20 10 10 10 7.713172554079585 12.964833769615183 0.0 3 0.9933543943823062 15.1305348926088 82249.0 83.38010798478686 0.0 - - - - - - - 844.0 164 3 MAN2B1 mannosidase, alpha, class 2B, member 1 573 73 C20140605_SFK031_03 C20140605_SFK031_03 TB555892.[MT7]-LYPGQR.2b4_1.heavy 439.254 / 575.331 13397.0 23.004199981689453 50 20 10 10 10 7.713172554079585 12.964833769615183 0.0 3 0.9933543943823062 15.1305348926088 13397.0 19.06769496239472 0.0 - - - - - - - 766.5 26 10 MAN2B1 mannosidase, alpha, class 2B, member 1 575 73 C20140605_SFK031_03 C20140605_SFK031_03 TB555892.[MT7]-LYPGQR.2y3_1.heavy 439.254 / 360.199 7598.0 23.004199981689453 50 20 10 10 10 7.713172554079585 12.964833769615183 0.0 3 0.9933543943823062 15.1305348926088 7598.0 2.896236820762368 5.0 - - - - - - - 822.0 28 3 MAN2B1 mannosidase, alpha, class 2B, member 1 577 74 C20140605_SFK031_03 C20140605_SFK031_03 TB294907.[MT7]-TALLLAVELK[MT7].2y5_1.heavy 679.947 / 703.447 37437.0 44.096500396728516 50 20 10 10 10 5.325347106721563 18.778118683340224 0.0 3 0.9939339227629608 15.837572598787268 37437.0 38.101476229588286 0.0 - - - - - - - 806.3076923076923 74 13 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 579 74 C20140605_SFK031_03 C20140605_SFK031_03 TB294907.[MT7]-TALLLAVELK[MT7].2b4_1.heavy 679.947 / 543.362 59757.0 44.096500396728516 50 20 10 10 10 5.325347106721563 18.778118683340224 0.0 3 0.9939339227629608 15.837572598787268 59757.0 108.43754672897195 0.0 - - - - - - - 798.6 119 10 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 581 74 C20140605_SFK031_03 C20140605_SFK031_03 TB294907.[MT7]-TALLLAVELK[MT7].2y6_1.heavy 679.947 / 816.531 40718.0 44.096500396728516 50 20 10 10 10 5.325347106721563 18.778118683340224 0.0 3 0.9939339227629608 15.837572598787268 40718.0 28.65131296157475 0.0 - - - - - - - 741.4 81 5 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 583 74 C20140605_SFK031_03 C20140605_SFK031_03 TB294907.[MT7]-TALLLAVELK[MT7].2b5_1.heavy 679.947 / 656.446 31376.0 44.096500396728516 50 20 10 10 10 5.325347106721563 18.778118683340224 0.0 3 0.9939339227629608 15.837572598787268 31376.0 35.48313151353959 0.0 - - - - - - - 812.8 62 10 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 585 75 C20140605_SFK031_03 C20140605_SFK031_03 TB294709.[MT7]-SPTDPK[MT7].2b4_1.heavy 466.768 / 545.269 126180.0 16.193599700927734 50 20 10 10 10 14.109025981591781 7.087661482122949 0.0 2 0.9923585324089317 14.109026195867836 126180.0 403.6939483844747 0.0 - - - - - - - 759.5 252 8 BCL6 B-cell CLL/lymphoma 6 587 75 C20140605_SFK031_03 C20140605_SFK031_03 TB294709.[MT7]-SPTDPK[MT7].2y5_1.heavy 466.768 / 701.395 16837.0 16.193599700927734 50 20 10 10 10 14.109025981591781 7.087661482122949 0.0 2 0.9923585324089317 14.109026195867836 16837.0 48.66720930544922 0.0 - - - - - - - 268.0769230769231 33 13 BCL6 B-cell CLL/lymphoma 6 589 76 C20140605_SFK031_03 C20140605_SFK031_03 TB561547.[MT7]-LFGTTGNC[CAM]AAC[CAM]SK[MT7].3b6_1.heavy 558.944 / 721.4 15472.0 28.389349937438965 43 17 10 6 10 2.304112107019519 34.71551449943353 0.03410148620605469 3 0.9713468174665172 7.273332678699451 15472.0 26.572170472706837 0.0 - - - - - - - 739.2857142857143 30 14 LMO1 LIM domain only 1 (rhombotin 1) 591 76 C20140605_SFK031_03 C20140605_SFK031_03 TB561547.[MT7]-LFGTTGNC[CAM]AAC[CAM]SK[MT7].3y3_1.heavy 558.944 / 538.278 100085.0 28.389349937438965 43 17 10 6 10 2.304112107019519 34.71551449943353 0.03410148620605469 3 0.9713468174665172 7.273332678699451 100085.0 44.78460885178768 0.0 - - - - - - - 854.0 200 1 LMO1 LIM domain only 1 (rhombotin 1) 593 76 C20140605_SFK031_03 C20140605_SFK031_03 TB561547.[MT7]-LFGTTGNC[CAM]AAC[CAM]SK[MT7].3y5_1.heavy 558.944 / 680.352 29556.0 28.389349937438965 43 17 10 6 10 2.304112107019519 34.71551449943353 0.03410148620605469 3 0.9713468174665172 7.273332678699451 29556.0 50.4915 0.0 - - - - - - - 773.5 59 12 LMO1 LIM domain only 1 (rhombotin 1) 595 76 C20140605_SFK031_03 C20140605_SFK031_03 TB561547.[MT7]-LFGTTGNC[CAM]AAC[CAM]SK[MT7].3b7_1.heavy 558.944 / 835.443 17819.0 28.389349937438965 43 17 10 6 10 2.304112107019519 34.71551449943353 0.03410148620605469 3 0.9713468174665172 7.273332678699451 17819.0 52.997962529274005 0.0 - - - - - - - 252.27272727272728 35 11 LMO1 LIM domain only 1 (rhombotin 1) 597 77 C20140605_SFK031_03 C20140605_SFK031_03 TB557815.[MT7]-FFIDEK[MT7].2y4_1.heavy 543.807 / 648.369 23853.0 34.420000076293945 39 14 10 5 10 1.4893401576091712 44.95007105868738 0.042400360107421875 3 0.945416250621596 5.258176558337424 23853.0 21.05633728173387 0.0 - - - - - - - 1713.0 47 7 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 599 77 C20140605_SFK031_03 C20140605_SFK031_03 TB557815.[MT7]-FFIDEK[MT7].2y5_1.heavy 543.807 / 795.437 36992.0 34.420000076293945 39 14 10 5 10 1.4893401576091712 44.95007105868738 0.042400360107421875 3 0.945416250621596 5.258176558337424 36992.0 65.45965634633427 0.0 - - - - - - - 351.0 73 4 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 601 77 C20140605_SFK031_03 C20140605_SFK031_03 TB557815.[MT7]-FFIDEK[MT7].2b4_1.heavy 543.807 / 667.357 46049.0 34.420000076293945 39 14 10 5 10 1.4893401576091712 44.95007105868738 0.042400360107421875 3 0.945416250621596 5.258176558337424 46049.0 59.066911968754816 0.0 - - - - - - - 234.16666666666666 92 6 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 603 77 C20140605_SFK031_03 C20140605_SFK031_03 TB557815.[MT7]-FFIDEK[MT7].2y3_1.heavy 543.807 / 535.284 35079.0 34.420000076293945 39 14 10 5 10 1.4893401576091712 44.95007105868738 0.042400360107421875 3 0.945416250621596 5.258176558337424 35079.0 7.17936233624029 0.0 - - - - - - - 1276.0 70 1 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 605 78 C20140605_SFK031_03 C20140605_SFK031_03 TB399799.[MT7]-LEELDDFEEGSQK[MT7].2y4_1.heavy 913.949 / 563.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - C16orf62 chromosome 16 open reading frame 62 607 78 C20140605_SFK031_03 C20140605_SFK031_03 TB399799.[MT7]-LEELDDFEEGSQK[MT7].2b3_1.heavy 913.949 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - C16orf62 chromosome 16 open reading frame 62 609 78 C20140605_SFK031_03 C20140605_SFK031_03 TB399799.[MT7]-LEELDDFEEGSQK[MT7].2y9_1.heavy 913.949 / 1198.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - C16orf62 chromosome 16 open reading frame 62 611 78 C20140605_SFK031_03 C20140605_SFK031_03 TB399799.[MT7]-LEELDDFEEGSQK[MT7].2b6_1.heavy 913.949 / 859.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - C16orf62 chromosome 16 open reading frame 62 613 79 C20140605_SFK031_03 C20140605_SFK031_03 TB562212.[MT7]-VLDENLADPQAEDRPLVFFDLK[MT7].4b4_1.heavy 708.881 / 601.331 28272.0 45.515201568603516 44 14 10 10 10 1.1244125571863504 56.241390876211895 0.0 3 0.9311226307639151 4.675189840727504 28272.0 47.064435734492584 0.0 - - - - - - - 1183.75 56 8 PML promyelocytic leukemia 615 79 C20140605_SFK031_03 C20140605_SFK031_03 TB562212.[MT7]-VLDENLADPQAEDRPLVFFDLK[MT7].4b5_1.heavy 708.881 / 715.374 58776.0 45.515201568603516 44 14 10 10 10 1.1244125571863504 56.241390876211895 0.0 3 0.9311226307639151 4.675189840727504 58776.0 51.62378458297198 0.0 - - - - - - - 831.0 117 7 PML promyelocytic leukemia 617 79 C20140605_SFK031_03 C20140605_SFK031_03 TB562212.[MT7]-VLDENLADPQAEDRPLVFFDLK[MT7].4b6_1.heavy 708.881 / 828.458 14407.0 45.515201568603516 44 14 10 10 10 1.1244125571863504 56.241390876211895 0.0 3 0.9311226307639151 4.675189840727504 14407.0 31.26568209443665 0.0 - - - - - - - 318.7142857142857 28 7 PML promyelocytic leukemia 619 79 C20140605_SFK031_03 C20140605_SFK031_03 TB562212.[MT7]-VLDENLADPQAEDRPLVFFDLK[MT7].4y14_2.heavy 708.881 / 909.997 40582.0 45.515201568603516 44 14 10 10 10 1.1244125571863504 56.241390876211895 0.0 3 0.9311226307639151 4.675189840727504 40582.0 69.81758837453786 0.0 - - - - - - - 744.0 81 9 PML promyelocytic leukemia 621 80 C20140605_SFK031_03 C20140605_SFK031_03 TB562213.[MT7]-GGLAAPEGRPAPGGTAASVAAAPAVC[CAM]C[CAM]WR.4b16_2.heavy 731.37 / 752.903 33526.0 32.52859878540039 48 18 10 10 10 2.5731706788218736 29.052512100256227 0.0 3 0.9899659180939816 12.310047634301856 33526.0 113.37027146439517 0.0 - - - - - - - 295.7142857142857 67 7 NKX3-2 NK3 homeobox 2 623 80 C20140605_SFK031_03 C20140605_SFK031_03 TB562213.[MT7]-GGLAAPEGRPAPGGTAASVAAAPAVC[CAM]C[CAM]WR.4b15_2.heavy 731.37 / 717.385 37150.0 32.52859878540039 48 18 10 10 10 2.5731706788218736 29.052512100256227 0.0 3 0.9899659180939816 12.310047634301856 37150.0 23.815645206417624 1.0 - - - - - - - 733.6666666666666 79 3 NKX3-2 NK3 homeobox 2 625 80 C20140605_SFK031_03 C20140605_SFK031_03 TB562213.[MT7]-GGLAAPEGRPAPGGTAASVAAAPAVC[CAM]C[CAM]WR.4b18_2.heavy 731.37 / 831.938 47376.0 32.52859878540039 48 18 10 10 10 2.5731706788218736 29.052512100256227 0.0 3 0.9899659180939816 12.310047634301856 47376.0 394.37437240104725 0.0 - - - - - - - 215.33333333333334 94 6 NKX3-2 NK3 homeobox 2 627 80 C20140605_SFK031_03 C20140605_SFK031_03 TB562213.[MT7]-GGLAAPEGRPAPGGTAASVAAAPAVC[CAM]C[CAM]WR.4y7_1.heavy 731.37 / 948.418 193906.0 32.52859878540039 48 18 10 10 10 2.5731706788218736 29.052512100256227 0.0 3 0.9899659180939816 12.310047634301856 193906.0 223.50050887659438 0.0 - - - - - - - 258.75 387 4 NKX3-2 NK3 homeobox 2 629 81 C20140605_SFK031_03 C20140605_SFK031_03 TB562010.[MT7]-LFVGNLPTDITEEDFK[MT7].3y6_1.heavy 709.38 / 912.443 111717.0 44.196699142456055 43 17 10 6 10 4.142927764937959 24.13751956920676 0.03639984130859375 3 0.9740150244683932 7.639347637415673 111717.0 115.30201505579049 0.0 - - - - - - - 826.3 223 10 PSPC1 paraspeckle component 1 631 81 C20140605_SFK031_03 C20140605_SFK031_03 TB562010.[MT7]-LFVGNLPTDITEEDFK[MT7].3b6_1.heavy 709.38 / 788.479 174771.0 44.196699142456055 43 17 10 6 10 4.142927764937959 24.13751956920676 0.03639984130859375 3 0.9740150244683932 7.639347637415673 174771.0 91.26085344126834 0.0 - - - - - - - 807.3333333333334 349 3 PSPC1 paraspeckle component 1 633 81 C20140605_SFK031_03 C20140605_SFK031_03 TB562010.[MT7]-LFVGNLPTDITEEDFK[MT7].3b5_1.heavy 709.38 / 675.395 179117.0 44.196699142456055 43 17 10 6 10 4.142927764937959 24.13751956920676 0.03639984130859375 3 0.9740150244683932 7.639347637415673 179117.0 107.72466642867107 0.0 - - - - - - - 926.0 358 1 PSPC1 paraspeckle component 1 635 81 C20140605_SFK031_03 C20140605_SFK031_03 TB562010.[MT7]-LFVGNLPTDITEEDFK[MT7].3b3_1.heavy 709.38 / 504.33 69680.0 44.196699142456055 43 17 10 6 10 4.142927764937959 24.13751956920676 0.03639984130859375 3 0.9740150244683932 7.639347637415673 69680.0 44.728507284540825 0.0 - - - - - - - 1232.6 139 10 PSPC1 paraspeckle component 1 637 82 C20140605_SFK031_03 C20140605_SFK031_03 TB559905.[MT7]-C[CAM]DISAEIQQR.2y8_1.heavy 682.341 / 944.516 13241.0 26.144700050354004 42 16 10 6 10 2.314134294057378 34.60670655738975 0.03719902038574219 3 0.9642203353673515 6.504901862708692 13241.0 70.56751412429378 1.0 - - - - - - - 212.0 26 15 PML promyelocytic leukemia 639 82 C20140605_SFK031_03 C20140605_SFK031_03 TB559905.[MT7]-C[CAM]DISAEIQQR.2y9_1.heavy 682.341 / 1059.54 16507.0 26.144700050354004 42 16 10 6 10 2.314134294057378 34.60670655738975 0.03719902038574219 3 0.9642203353673515 6.504901862708692 16507.0 49.10014164305949 0.0 - - - - - - - 251.30769230769232 33 13 PML promyelocytic leukemia 641 82 C20140605_SFK031_03 C20140605_SFK031_03 TB559905.[MT7]-C[CAM]DISAEIQQR.2b6_1.heavy 682.341 / 820.363 5296.0 26.144700050354004 42 16 10 6 10 2.314134294057378 34.60670655738975 0.03719902038574219 3 0.9642203353673515 6.504901862708692 5296.0 20.49492209937236 0.0 - - - - - - - 224.07692307692307 10 13 PML promyelocytic leukemia 643 82 C20140605_SFK031_03 C20140605_SFK031_03 TB559905.[MT7]-C[CAM]DISAEIQQR.2y7_1.heavy 682.341 / 831.432 11917.0 26.144700050354004 42 16 10 6 10 2.314134294057378 34.60670655738975 0.03719902038574219 3 0.9642203353673515 6.504901862708692 11917.0 47.9518529224721 0.0 - - - - - - - 289.92857142857144 23 14 PML promyelocytic leukemia 645 83 C20140605_SFK031_03 C20140605_SFK031_03 TB559902.[MT7]-IEELNQSLK[MT7].2b3_1.heavy 681.398 / 516.279 8281.0 30.413299560546875 39 14 10 5 10 2.5392832540414925 31.18202313612369 0.04199981689453125 3 0.9461622420026528 5.2948164701950455 8281.0 15.858169986719787 0.0 - - - - - - - 313.5 16 4 C16orf62 chromosome 16 open reading frame 62 647 83 C20140605_SFK031_03 C20140605_SFK031_03 TB559902.[MT7]-IEELNQSLK[MT7].2y8_1.heavy 681.398 / 1104.6 11795.0 30.413299560546875 39 14 10 5 10 2.5392832540414925 31.18202313612369 0.04199981689453125 3 0.9461622420026528 5.2948164701950455 11795.0 6.096005376672719 0.0 - - - - - - - 752.5555555555555 23 9 C16orf62 chromosome 16 open reading frame 62 649 83 C20140605_SFK031_03 C20140605_SFK031_03 TB559902.[MT7]-IEELNQSLK[MT7].2y5_1.heavy 681.398 / 733.432 5897.0 30.413299560546875 39 14 10 5 10 2.5392832540414925 31.18202313612369 0.04199981689453125 3 0.9461622420026528 5.2948164701950455 5897.0 6.065073041168659 1.0 - - - - - - - 589.6 11 10 C16orf62 chromosome 16 open reading frame 62 651 83 C20140605_SFK031_03 C20140605_SFK031_03 TB559902.[MT7]-IEELNQSLK[MT7].2b6_1.heavy 681.398 / 871.464 3513.0 30.413299560546875 39 14 10 5 10 2.5392832540414925 31.18202313612369 0.04199981689453125 3 0.9461622420026528 5.2948164701950455 3513.0 3.1877091633466135 2.0 - - - - - - - 716.8571428571429 7 7 C16orf62 chromosome 16 open reading frame 62 653 84 C20140605_SFK031_03 C20140605_SFK031_03 TB562219.[MT7]-ELLNLTQQDYVNRIEELNQSLK[MT7].4b16_2.heavy 737.904 / 1052.05 83837.0 43.768798828125 46 16 10 10 10 1.140030426817205 53.86469984146928 0.0 3 0.9610938313955184 6.236413798818873 83837.0 113.36889816360599 0.0 - - - - - - - 755.0 167 7 C16orf62 chromosome 16 open reading frame 62 655 84 C20140605_SFK031_03 C20140605_SFK031_03 TB562219.[MT7]-ELLNLTQQDYVNRIEELNQSLK[MT7].4b4_1.heavy 737.904 / 614.363 179509.0 43.768798828125 46 16 10 10 10 1.140030426817205 53.86469984146928 0.0 3 0.9610938313955184 6.236413798818873 179509.0 172.36700798300393 0.0 - - - - - - - 1247.0 359 10 C16orf62 chromosome 16 open reading frame 62 657 84 C20140605_SFK031_03 C20140605_SFK031_03 TB562219.[MT7]-ELLNLTQQDYVNRIEELNQSLK[MT7].4b5_1.heavy 737.904 / 727.447 65308.0 43.768798828125 46 16 10 10 10 1.140030426817205 53.86469984146928 0.0 3 0.9610938313955184 6.236413798818873 65308.0 75.04742654356342 0.0 - - - - - - - 1258.142857142857 130 7 C16orf62 chromosome 16 open reading frame 62 659 84 C20140605_SFK031_03 C20140605_SFK031_03 TB562219.[MT7]-ELLNLTQQDYVNRIEELNQSLK[MT7].4b3_1.heavy 737.904 / 500.32 67703.0 43.768798828125 46 16 10 10 10 1.140030426817205 53.86469984146928 0.0 3 0.9610938313955184 6.236413798818873 67703.0 72.56169952056847 0.0 - - - - - - - 1250.625 135 8 C16orf62 chromosome 16 open reading frame 62 661 85 C20140605_SFK031_03 C20140605_SFK031_03 TB561941.[MT7]-IEITPSHELIQAVGPLR.3y7_1.heavy 673.057 / 740.441 77235.0 38.97107410430908 37 11 10 6 10 1.5342160407040455 52.26623479011873 0.038097381591796875 3 0.8590985623113283 3.248390065176369 77235.0 103.70983487517609 0.0 - - - - - - - 655.75 154 8 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 663 85 C20140605_SFK031_03 C20140605_SFK031_03 TB561941.[MT7]-IEITPSHELIQAVGPLR.3b4_1.heavy 673.057 / 601.368 35699.0 38.97107410430908 37 11 10 6 10 1.5342160407040455 52.26623479011873 0.038097381591796875 3 0.8590985623113283 3.248390065176369 35699.0 13.30657582355141 0.0 - - - - - - - 1691.857142857143 71 7 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 665 85 C20140605_SFK031_03 C20140605_SFK031_03 TB561941.[MT7]-IEITPSHELIQAVGPLR.3y8_1.heavy 673.057 / 853.525 54395.0 38.97107410430908 37 11 10 6 10 1.5342160407040455 52.26623479011873 0.038097381591796875 3 0.8590985623113283 3.248390065176369 54395.0 70.14028357666984 0.0 - - - - - - - 394.6666666666667 108 3 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 667 85 C20140605_SFK031_03 C20140605_SFK031_03 TB561941.[MT7]-IEITPSHELIQAVGPLR.3b8_2.heavy 673.057 / 526.281 160985.0 38.97107410430908 37 11 10 6 10 1.5342160407040455 52.26623479011873 0.038097381591796875 3 0.8590985623113283 3.248390065176369 160985.0 97.82946035956995 0.0 - - - - - - - 338.0 321 1 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 669 86 C20140605_SFK031_03 C20140605_SFK031_03 TB294861.[MT7]-TPLILAVEK[MT7].2y4_1.heavy 636.412 / 590.363 23977.0 37.60179901123047 37 9 10 10 8 0.7145987831127586 72.33791966145398 0.0 4 0.8017813308280785 2.724836118634697 23977.0 17.606904352661473 1.0 - - - - - - - 809.6666666666666 52 3 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 671 86 C20140605_SFK031_03 C20140605_SFK031_03 TB294861.[MT7]-TPLILAVEK[MT7].2y8_1.heavy 636.412 / 1026.67 79113.0 37.60179901123047 37 9 10 10 8 0.7145987831127586 72.33791966145398 0.0 4 0.8017813308280785 2.724836118634697 79113.0 206.66106438199023 0.0 - - - - - - - 679.0 158 7 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 673 86 C20140605_SFK031_03 C20140605_SFK031_03 TB294861.[MT7]-TPLILAVEK[MT7].2y5_1.heavy 636.412 / 703.447 27885.0 37.60179901123047 37 9 10 10 8 0.7145987831127586 72.33791966145398 0.0 4 0.8017813308280785 2.724836118634697 27885.0 28.141257606490868 0.0 - - - - - - - 352.3333333333333 55 3 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 675 86 C20140605_SFK031_03 C20140605_SFK031_03 TB294861.[MT7]-TPLILAVEK[MT7].2y3_1.heavy 636.412 / 519.326 15527.0 37.60179901123047 37 9 10 10 8 0.7145987831127586 72.33791966145398 0.0 4 0.8017813308280785 2.724836118634697 15527.0 4.367465887903625 1.0 - - - - - - - 598.6666666666666 31 3 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 677 87 C20140605_SFK031_03 C20140605_SFK031_03 TB558143.[MT7]-LVLYVVK[MT7].2y4_1.heavy 561.38 / 652.415 37352.0 38.90449905395508 50 20 10 10 10 9.043802389213973 11.057296001874644 0.0 3 0.9933824369856461 15.162595119315261 37352.0 36.343934090468764 0.0 - - - - - - - 916.2 74 5 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 679 87 C20140605_SFK031_03 C20140605_SFK031_03 TB558143.[MT7]-LVLYVVK[MT7].2y5_1.heavy 561.38 / 765.499 24138.0 38.90449905395508 50 20 10 10 10 9.043802389213973 11.057296001874644 0.0 3 0.9933824369856461 15.162595119315261 24138.0 50.16598936586764 0.0 - - - - - - - 293.3333333333333 48 6 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 681 87 C20140605_SFK031_03 C20140605_SFK031_03 TB558143.[MT7]-LVLYVVK[MT7].2b4_1.heavy 561.38 / 633.409 16209.0 38.90449905395508 50 20 10 10 10 9.043802389213973 11.057296001874644 0.0 3 0.9933824369856461 15.162595119315261 16209.0 11.881280950384724 0.0 - - - - - - - 793.0 32 2 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 683 87 C20140605_SFK031_03 C20140605_SFK031_03 TB558143.[MT7]-LVLYVVK[MT7].2y6_1.heavy 561.38 / 864.568 21759.0 38.90449905395508 50 20 10 10 10 9.043802389213973 11.057296001874644 0.0 3 0.9933824369856461 15.162595119315261 21759.0 71.57957885126213 0.0 - - - - - - - 440.0 43 1 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 685 88 C20140605_SFK031_03 C20140605_SFK031_03 TB294918.[MT7]-LISVEDLWK[MT7].2y8_1.heavy 695.913 / 1133.63 38178.0 44.82170104980469 41 11 10 10 10 1.0334291421036825 67.14471547718213 0.0 3 0.8759372228615812 3.4669364001645864 38178.0 90.71333509757895 0.0 - - - - - - - 311.8181818181818 76 11 STIM1 stromal interaction molecule 1 687 88 C20140605_SFK031_03 C20140605_SFK031_03 TB294918.[MT7]-LISVEDLWK[MT7].2b6_1.heavy 695.913 / 801.447 31453.0 44.82170104980469 41 11 10 10 10 1.0334291421036825 67.14471547718213 0.0 3 0.8759372228615812 3.4669364001645864 31453.0 47.008889290615386 0.0 - - - - - - - 740.7142857142857 62 7 STIM1 stromal interaction molecule 1 689 88 C20140605_SFK031_03 C20140605_SFK031_03 TB294918.[MT7]-LISVEDLWK[MT7].2y3_1.heavy 695.913 / 590.378 39439.0 44.82170104980469 41 11 10 10 10 1.0334291421036825 67.14471547718213 0.0 3 0.8759372228615812 3.4669364001645864 39439.0 48.59234015783152 0.0 - - - - - - - 691.875 78 8 STIM1 stromal interaction molecule 1 691 88 C20140605_SFK031_03 C20140605_SFK031_03 TB294918.[MT7]-LISVEDLWK[MT7].2y7_1.heavy 695.913 / 1020.55 76216.0 44.82170104980469 41 11 10 10 10 1.0334291421036825 67.14471547718213 0.0 3 0.8759372228615812 3.4669364001645864 76216.0 177.7717221693625 0.0 - - - - - - - 653.6666666666666 152 9 STIM1 stromal interaction molecule 1 693 89 C20140605_SFK031_03 C20140605_SFK031_03 TB294919.[MT7]-NAPYFPC[CAM]DK[MT7].2y4_1.heavy 700.35 / 663.325 15207.0 28.26689910888672 43 13 10 10 10 1.635655405337034 38.21935999534041 0.0 3 0.9238256206434152 4.442850868612882 15207.0 29.670070796460173 0.0 - - - - - - - 1155.75 30 8 BCL6 B-cell CLL/lymphoma 6 695 89 C20140605_SFK031_03 C20140605_SFK031_03 TB294919.[MT7]-NAPYFPC[CAM]DK[MT7].2y5_1.heavy 700.35 / 810.394 3082.0 28.26689910888672 43 13 10 10 10 1.635655405337034 38.21935999534041 0.0 3 0.9238256206434152 4.442850868612882 3082.0 4.520180683594472 0.0 - - - - - - - 184.8 6 10 BCL6 B-cell CLL/lymphoma 6 697 89 C20140605_SFK031_03 C20140605_SFK031_03 TB294919.[MT7]-NAPYFPC[CAM]DK[MT7].2b4_1.heavy 700.35 / 590.305 5857.0 28.26689910888672 43 13 10 10 10 1.635655405337034 38.21935999534041 0.0 3 0.9238256206434152 4.442850868612882 5857.0 16.95323335889498 0.0 - - - - - - - 693.625 11 8 BCL6 B-cell CLL/lymphoma 6 699 89 C20140605_SFK031_03 C20140605_SFK031_03 TB294919.[MT7]-NAPYFPC[CAM]DK[MT7].2y7_1.heavy 700.35 / 1070.51 15515.0 28.26689910888672 43 13 10 10 10 1.635655405337034 38.21935999534041 0.0 3 0.9238256206434152 4.442850868612882 15515.0 61.439182169182175 0.0 - - - - - - - 226.06666666666666 31 15 BCL6 B-cell CLL/lymphoma 6 701 90 C20140605_SFK031_03 C20140605_SFK031_03 TB294725.[MT7]-EFLDGTR.2b3_1.heavy 491.26 / 534.304 7964.0 26.72209930419922 46 18 10 10 8 4.570041631782826 21.88163873706088 0.0 4 0.9884029214311713 11.448997552528054 7964.0 2.6939697528388633 1.0 - - - - - - - 1792.0 27 8 PML promyelocytic leukemia 703 90 C20140605_SFK031_03 C20140605_SFK031_03 TB294725.[MT7]-EFLDGTR.2y5_1.heavy 491.26 / 561.299 7402.0 26.72209930419922 46 18 10 10 8 4.570041631782826 21.88163873706088 0.0 4 0.9884029214311713 11.448997552528054 7402.0 9.067586090772 3.0 - - - - - - - 749.6666666666666 42 9 PML promyelocytic leukemia 705 90 C20140605_SFK031_03 C20140605_SFK031_03 TB294725.[MT7]-EFLDGTR.2b4_1.heavy 491.26 / 649.331 20050.0 26.72209930419922 46 18 10 10 8 4.570041631782826 21.88163873706088 0.0 4 0.9884029214311713 11.448997552528054 20050.0 12.967923608491233 1.0 - - - - - - - 1288.25 49 8 PML promyelocytic leukemia 707 90 C20140605_SFK031_03 C20140605_SFK031_03 TB294725.[MT7]-EFLDGTR.2y6_1.heavy 491.26 / 708.367 22954.0 26.72209930419922 46 18 10 10 8 4.570041631782826 21.88163873706088 0.0 4 0.9884029214311713 11.448997552528054 22954.0 49.52958208178141 0.0 - - - - - - - 749.5714285714286 45 7 PML promyelocytic leukemia 709 91 C20140605_SFK031_03 C20140605_SFK031_03 TB561459.[MT7]-LFQYASTDMDK[MT7].3b4_1.heavy 536.272 / 696.384 20432.0 35.29414939880371 43 18 10 5 10 4.973306164865463 20.107348448897515 0.040699005126953125 3 0.9895879299996917 12.084154893786664 20432.0 29.884067172756396 0.0 - - - - - - - 327.6 40 5 MEF2A;MEF2C;MEF2D myocyte enhancer factor 2A;myocyte enhancer factor 2C;myocyte enhancer factor 2D 711 91 C20140605_SFK031_03 C20140605_SFK031_03 TB561459.[MT7]-LFQYASTDMDK[MT7].3b5_1.heavy 536.272 / 767.421 7819.0 35.29414939880371 43 18 10 5 10 4.973306164865463 20.107348448897515 0.040699005126953125 3 0.9895879299996917 12.084154893786664 7819.0 25.22772836244435 0.0 - - - - - - - 616.6666666666666 15 9 MEF2A;MEF2C;MEF2D myocyte enhancer factor 2A;myocyte enhancer factor 2C;myocyte enhancer factor 2D 713 91 C20140605_SFK031_03 C20140605_SFK031_03 TB561459.[MT7]-LFQYASTDMDK[MT7].3y4_1.heavy 536.272 / 652.309 19170.0 35.29414939880371 43 18 10 5 10 4.973306164865463 20.107348448897515 0.040699005126953125 3 0.9895879299996917 12.084154893786664 19170.0 18.786543657880767 0.0 - - - - - - - 741.125 38 8 MEF2A;MEF2C;MEF2D myocyte enhancer factor 2A;myocyte enhancer factor 2C;myocyte enhancer factor 2D 715 91 C20140605_SFK031_03 C20140605_SFK031_03 TB561459.[MT7]-LFQYASTDMDK[MT7].3b3_1.heavy 536.272 / 533.32 48683.0 35.29414939880371 43 18 10 5 10 4.973306164865463 20.107348448897515 0.040699005126953125 3 0.9895879299996917 12.084154893786664 48683.0 13.922444706180286 0.0 - - - - - - - 1640.0 97 1 MEF2A;MEF2C;MEF2D myocyte enhancer factor 2A;myocyte enhancer factor 2C;myocyte enhancer factor 2D 717 92 C20140605_SFK031_03 C20140605_SFK031_03 TB561252.[MT7]-QGVEDAFYTLVR.2y9_1.heavy 771.408 / 1113.56 9061.0 42.37845039367676 42 16 10 6 10 3.8664974002072463 25.863201148057144 0.033702850341796875 3 0.9692809715769029 7.023289305611741 9061.0 15.860141554375936 0.0 - - - - - - - 705.0 18 9 HRAS;NRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 719 92 C20140605_SFK031_03 C20140605_SFK031_03 TB561252.[MT7]-QGVEDAFYTLVR.2b6_1.heavy 771.408 / 744.364 2858.0 42.37845039367676 42 16 10 6 10 3.8664974002072463 25.863201148057144 0.033702850341796875 3 0.9692809715769029 7.023289305611741 2858.0 2.85187256516851 2.0 - - - - - - - 1264.5714285714287 5 7 HRAS;NRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 721 92 C20140605_SFK031_03 C20140605_SFK031_03 TB561252.[MT7]-QGVEDAFYTLVR.2b5_1.heavy 771.408 / 673.327 11361.0 42.37845039367676 42 16 10 6 10 3.8664974002072463 25.863201148057144 0.033702850341796875 3 0.9692809715769029 7.023289305611741 11361.0 36.320956940753106 0.0 - - - - - - - 717.0 22 7 HRAS;NRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 723 92 C20140605_SFK031_03 C20140605_SFK031_03 TB561252.[MT7]-QGVEDAFYTLVR.2y7_1.heavy 771.408 / 869.488 14846.0 42.37845039367676 42 16 10 6 10 3.8664974002072463 25.863201148057144 0.033702850341796875 3 0.9692809715769029 7.023289305611741 14846.0 23.05201687763713 0.0 - - - - - - - 1174.857142857143 29 7 HRAS;NRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 725 93 C20140605_SFK031_03 C20140605_SFK031_03 TB559398.[MT7]-ELDIYNNLR.2b3_1.heavy 647.35 / 502.263 79586.0 34.82659912109375 44 14 10 10 10 1.3035328365256966 44.09151339775981 0.0 3 0.9454563570822538 5.260127337018735 79586.0 50.270061473707294 0.0 - - - - - - - 1144.0 159 7 BCL3 B-cell CLL/lymphoma 3 727 93 C20140605_SFK031_03 C20140605_SFK031_03 TB559398.[MT7]-ELDIYNNLR.2y8_1.heavy 647.35 / 1020.55 79840.0 34.82659912109375 44 14 10 10 10 1.3035328365256966 44.09151339775981 0.0 3 0.9454563570822538 5.260127337018735 79840.0 47.52833494090068 0.0 - - - - - - - 317.5 159 2 BCL3 B-cell CLL/lymphoma 3 729 93 C20140605_SFK031_03 C20140605_SFK031_03 TB559398.[MT7]-ELDIYNNLR.2y6_1.heavy 647.35 / 792.436 52252.0 34.82659912109375 44 14 10 10 10 1.3035328365256966 44.09151339775981 0.0 3 0.9454563570822538 5.260127337018735 52252.0 64.75482307875008 0.0 - - - - - - - 381.0 104 2 BCL3 B-cell CLL/lymphoma 3 731 93 C20140605_SFK031_03 C20140605_SFK031_03 TB559398.[MT7]-ELDIYNNLR.2y7_1.heavy 647.35 / 907.463 32546.0 34.82659912109375 44 14 10 10 10 1.3035328365256966 44.09151339775981 0.0 3 0.9454563570822538 5.260127337018735 32546.0 52.329561676855256 0.0 - - - - - - - 1252.857142857143 65 7 BCL3 B-cell CLL/lymphoma 3 733 94 C20140605_SFK031_03 C20140605_SFK031_03 TB294921.[MT7]-QIVDAQAVC[CAM]TR.2y8_1.heavy 702.873 / 920.425 30718.0 25.40220069885254 43 13 10 10 10 1.053894349974853 58.04752651777721 0.0 3 0.9161524326900117 4.231894536420615 30718.0 86.06065439672803 0.0 - - - - - - - 229.36363636363637 61 11 PML promyelocytic leukemia 735 94 C20140605_SFK031_03 C20140605_SFK031_03 TB294921.[MT7]-QIVDAQAVC[CAM]TR.2y9_1.heavy 702.873 / 1019.49 42451.0 25.40220069885254 43 13 10 10 10 1.053894349974853 58.04752651777721 0.0 3 0.9161524326900117 4.231894536420615 42451.0 156.67942381109626 0.0 - - - - - - - 264.6875 84 16 PML promyelocytic leukemia 737 94 C20140605_SFK031_03 C20140605_SFK031_03 TB294921.[MT7]-QIVDAQAVC[CAM]TR.2y10_1.heavy 702.873 / 1132.58 30147.0 25.40220069885254 43 13 10 10 10 1.053894349974853 58.04752651777721 0.0 3 0.9161524326900117 4.231894536420615 30147.0 99.95529340829955 0.0 - - - - - - - 281.27272727272725 60 11 PML promyelocytic leukemia 739 94 C20140605_SFK031_03 C20140605_SFK031_03 TB294921.[MT7]-QIVDAQAVC[CAM]TR.2y7_1.heavy 702.873 / 805.398 38947.0 25.40220069885254 43 13 10 10 10 1.053894349974853 58.04752651777721 0.0 3 0.9161524326900117 4.231894536420615 38947.0 242.5500626334233 0.0 - - - - - - - 222.33333333333334 77 15 PML promyelocytic leukemia 741 95 C20140605_SFK031_03 C20140605_SFK031_03 TB561456.[MT7]-LVNLFQQGGRELDIYNNLR.3y18_2.heavy 802.772 / 1075.06 89714.0 44.706298828125 39 9 10 10 10 0.6909579028755688 85.18109552386291 0.0 3 0.802602057073479 2.7306963155746313 89714.0 161.62932740292615 0.0 - - - - - - - 768.75 179 8 BCL3 B-cell CLL/lymphoma 3 743 95 C20140605_SFK031_03 C20140605_SFK031_03 TB561456.[MT7]-LVNLFQQGGRELDIYNNLR.3y6_1.heavy 802.772 / 792.436 25804.0 44.706298828125 39 9 10 10 10 0.6909579028755688 85.18109552386291 0.0 3 0.802602057073479 2.7306963155746313 25804.0 83.17327044025157 0.0 - - - - - - - 724.75 51 8 BCL3 B-cell CLL/lymphoma 3 745 95 C20140605_SFK031_03 C20140605_SFK031_03 TB561456.[MT7]-LVNLFQQGGRELDIYNNLR.3y17_2.heavy 802.772 / 1025.53 63415.0 44.706298828125 39 9 10 10 10 0.6909579028755688 85.18109552386291 0.0 3 0.802602057073479 2.7306963155746313 63415.0 98.697220016813 0.0 - - - - - - - 289.8 126 10 BCL3 B-cell CLL/lymphoma 3 747 95 C20140605_SFK031_03 C20140605_SFK031_03 TB561456.[MT7]-LVNLFQQGGRELDIYNNLR.3b4_1.heavy 802.772 / 584.389 17886.0 44.706298828125 39 9 10 10 10 0.6909579028755688 85.18109552386291 0.0 3 0.802602057073479 2.7306963155746313 17886.0 36.2256197203136 0.0 - - - - - - - 707.0 35 12 BCL3 B-cell CLL/lymphoma 3 749 96 C20140605_SFK031_03 C20140605_SFK031_03 TB556301.[MT7]-GTFPDAR.2y4_1.heavy 454.241 / 458.236 9816.0 22.00160026550293 40 17 10 3 10 5.569240960957707 17.955768245804833 0.0615997314453125 3 0.9762693059206177 7.9954800836266875 9816.0 0.0 3.0 - - - - - - - 944.0 19 1 NONO non-POU domain containing, octamer-binding 751 96 C20140605_SFK031_03 C20140605_SFK031_03 TB556301.[MT7]-GTFPDAR.2y5_1.heavy 454.241 / 605.304 4153.0 22.00160026550293 40 17 10 3 10 5.569240960957707 17.955768245804833 0.0615997314453125 3 0.9762693059206177 7.9954800836266875 4153.0 0.36505543625409015 4.0 - - - - - - - 314.5 31 4 NONO non-POU domain containing, octamer-binding 753 96 C20140605_SFK031_03 C20140605_SFK031_03 TB556301.[MT7]-GTFPDAR.2y6_1.heavy 454.241 / 706.352 6859.0 22.00160026550293 40 17 10 3 10 5.569240960957707 17.955768245804833 0.0615997314453125 3 0.9762693059206177 7.9954800836266875 6859.0 2.601494029863879 1.0 - - - - - - - 338.25 13 8 NONO non-POU domain containing, octamer-binding 755 96 C20140605_SFK031_03 C20140605_SFK031_03 TB556301.[MT7]-GTFPDAR.2b5_1.heavy 454.241 / 662.327 93571.0 22.00160026550293 40 17 10 3 10 5.569240960957707 17.955768245804833 0.0615997314453125 3 0.9762693059206177 7.9954800836266875 93571.0 80.5784641916625 0.0 - - - - - - - 315.0 187 1 NONO non-POU domain containing, octamer-binding 757 97 C20140605_SFK031_03 C20140605_SFK031_03 TB399545.[MT7]-EPVSTK[MT7].2b3_1.heavy 474.784 / 470.273 3343.0 16.712900161743164 35 11 10 10 4 1.187008531375443 52.68654191116609 0.0 10 0.855502634502961 3.206701555908396 3343.0 0.9229768995268578 16.0 - - - - - - - 1316.0 12 8 BRCA1 breast cancer 1, early onset 759 97 C20140605_SFK031_03 C20140605_SFK031_03 TB399545.[MT7]-EPVSTK[MT7].2y4_1.heavy 474.784 / 578.363 2944.0 16.712900161743164 35 11 10 10 4 1.187008531375443 52.68654191116609 0.0 10 0.855502634502961 3.206701555908396 2944.0 1.6300242828926095 14.0 - - - - - - - 1801.7777777777778 18 9 BRCA1 breast cancer 1, early onset 761 97 C20140605_SFK031_03 C20140605_SFK031_03 TB399545.[MT7]-EPVSTK[MT7].2y5_1.heavy 474.784 / 675.416 23801.0 16.712900161743164 35 11 10 10 4 1.187008531375443 52.68654191116609 0.0 10 0.855502634502961 3.206701555908396 23801.0 53.14782124865471 0.0 - - - - - - - 769.25 47 12 BRCA1 breast cancer 1, early onset 763 97 C20140605_SFK031_03 C20140605_SFK031_03 TB399545.[MT7]-EPVSTK[MT7].2y3_1.heavy 474.784 / 479.295 6088.0 16.712900161743164 35 11 10 10 4 1.187008531375443 52.68654191116609 0.0 10 0.855502634502961 3.206701555908396 6088.0 8.099914163090128 0.0 - - - - - - - 786.0 12 8 BRCA1 breast cancer 1, early onset 765 98 C20140605_SFK031_03 C20140605_SFK031_03 TB558891.[MT7]-SFADINLYR.2y8_1.heavy 621.834 / 1011.53 99690.0 36.59469985961914 45 15 10 10 10 2.8798744531829086 34.7237359217092 0.0 3 0.9596770757120489 6.125141339044115 99690.0 133.1888752528544 0.0 - - - - - - - 300.14285714285717 199 7 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 767 98 C20140605_SFK031_03 C20140605_SFK031_03 TB558891.[MT7]-SFADINLYR.2b6_1.heavy 621.834 / 792.401 24864.0 36.59469985961914 45 15 10 10 10 2.8798744531829086 34.7237359217092 0.0 3 0.9596770757120489 6.125141339044115 24864.0 43.907588785046734 0.0 - - - - - - - 350.0 49 9 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 769 98 C20140605_SFK031_03 C20140605_SFK031_03 TB558891.[MT7]-SFADINLYR.2y6_1.heavy 621.834 / 793.42 29417.0 36.59469985961914 45 15 10 10 10 2.8798744531829086 34.7237359217092 0.0 3 0.9596770757120489 6.125141339044115 29417.0 37.955257717360524 0.0 - - - - - - - 210.2 58 5 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 771 98 C20140605_SFK031_03 C20140605_SFK031_03 TB558891.[MT7]-SFADINLYR.2y7_1.heavy 621.834 / 864.457 36421.0 36.59469985961914 45 15 10 10 10 2.8798744531829086 34.7237359217092 0.0 3 0.9596770757120489 6.125141339044115 36421.0 90.19870592146162 0.0 - - - - - - - 283.42857142857144 72 7 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 773 99 C20140605_SFK031_03 C20140605_SFK031_03 TB561356.[MT7]-EDGVPMLSVQPK[MT7].3b6_1.heavy 529.96 / 773.362 14761.0 33.6234016418457 50 20 10 10 10 40.792677736003675 2.4514203418360023 0.0 3 0.9996462488768953 65.61462522299433 14761.0 39.00406883642127 0.0 - - - - - - - 321.0 29 2 LMO1 LIM domain only 1 (rhombotin 1) 775 99 C20140605_SFK031_03 C20140605_SFK031_03 TB561356.[MT7]-EDGVPMLSVQPK[MT7].3b4_1.heavy 529.96 / 545.269 75091.0 33.6234016418457 50 20 10 10 10 40.792677736003675 2.4514203418360023 0.0 3 0.9996462488768953 65.61462522299433 75091.0 36.33009347743091 0.0 - - - - - - - 1027.0 150 1 LMO1 LIM domain only 1 (rhombotin 1) 777 99 C20140605_SFK031_03 C20140605_SFK031_03 TB561356.[MT7]-EDGVPMLSVQPK[MT7].3b5_1.heavy 529.96 / 642.321 5905.0 33.6234016418457 50 20 10 10 10 40.792677736003675 2.4514203418360023 0.0 3 0.9996462488768953 65.61462522299433 5905.0 5.18547926152296 1.0 - - - - - - - 321.0 11 4 LMO1 LIM domain only 1 (rhombotin 1) 779 99 C20140605_SFK031_03 C20140605_SFK031_03 TB561356.[MT7]-EDGVPMLSVQPK[MT7].3y5_1.heavy 529.96 / 702.427 6546.0 33.6234016418457 50 20 10 10 10 40.792677736003675 2.4514203418360023 0.0 3 0.9996462488768953 65.61462522299433 6546.0 2.7702967646287244 1.0 - - - - - - - 257.0 13 1 LMO1 LIM domain only 1 (rhombotin 1) 781 100 C20140605_SFK031_03 C20140605_SFK031_03 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 2594760.0 35.17899958292643 23 -3 10 6 10 null 0.0 0.039897918701171875 3 0.0 0.0 2594760.0 133.06804437964857 0.0 - - - - - - - 2019.0 5189 1 783 100 C20140605_SFK031_03 C20140605_SFK031_03 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 487168.0 35.17899958292643 23 -3 10 6 10 null 0.0 0.039897918701171875 3 0.0 0.0 487168.0 311.0123650328719 0.0 - - - - - - - 1830.0 974 2 785 100 C20140605_SFK031_03 C20140605_SFK031_03 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 737892.0 35.17899958292643 23 -3 10 6 10 null 0.0 0.039897918701171875 3 0.0 0.0 737892.0 258.42081669179663 0.0 - - - - - - - 1578.0 1475 2 787 101 C20140605_SFK031_03 C20140605_SFK031_03 TB560698.[MT7]-YGEPSEVFINR.2y8_1.heavy 727.873 / 961.51 23041.0 32.95309829711914 46 20 10 10 6 4.80905463879741 20.794107680383263 0.0 5 0.9906409228710037 12.746958080736338 23041.0 33.03362053983058 0.0 - - - - - - - 647.1428571428571 46 7 PSPC1 paraspeckle component 1 789 101 C20140605_SFK031_03 C20140605_SFK031_03 TB560698.[MT7]-YGEPSEVFINR.2y5_1.heavy 727.873 / 648.383 2589.0 32.95309829711914 46 20 10 10 6 4.80905463879741 20.794107680383263 0.0 5 0.9906409228710037 12.746958080736338 2589.0 3.254730372816172 3.0 - - - - - - - 355.75 6 4 PSPC1 paraspeckle component 1 791 101 C20140605_SFK031_03 C20140605_SFK031_03 TB560698.[MT7]-YGEPSEVFINR.2b6_1.heavy 727.873 / 807.364 2201.0 32.95309829711914 46 20 10 10 6 4.80905463879741 20.794107680383263 0.0 5 0.9906409228710037 12.746958080736338 2201.0 2.394856242679276 2.0 - - - - - - - 665.7142857142857 5 7 PSPC1 paraspeckle component 1 793 101 C20140605_SFK031_03 C20140605_SFK031_03 TB560698.[MT7]-YGEPSEVFINR.2y10_1.heavy 727.873 / 1147.57 8414.0 32.95309829711914 46 20 10 10 6 4.80905463879741 20.794107680383263 0.0 5 0.9906409228710037 12.746958080736338 8414.0 42.50206524917498 0.0 - - - - - - - 271.6 16 10 PSPC1 paraspeckle component 1 795 102 C20140605_SFK031_03 C20140605_SFK031_03 TB556231.[MT7]-C[CAM]DLPTR.2b3_1.heavy 453.235 / 533.251 71733.0 19.7091007232666 48 20 10 10 8 9.142191402719291 10.938296475641014 0.0 4 0.9929282635160672 14.667059982538769 71733.0 17.333275834220068 0.0 - - - - - - - 911.6 143 5 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 797 102 C20140605_SFK031_03 C20140605_SFK031_03 TB556231.[MT7]-C[CAM]DLPTR.2y4_1.heavy 453.235 / 486.303 97109.0 19.7091007232666 48 20 10 10 8 9.142191402719291 10.938296475641014 0.0 4 0.9929282635160672 14.667059982538769 97109.0 58.6308758276505 0.0 - - - - - - - 742.0 194 2 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 799 102 C20140605_SFK031_03 C20140605_SFK031_03 TB556231.[MT7]-C[CAM]DLPTR.2y5_1.heavy 453.235 / 601.33 31416.0 19.7091007232666 48 20 10 10 8 9.142191402719291 10.938296475641014 0.0 4 0.9929282635160672 14.667059982538769 31416.0 38.884833375072255 1.0 - - - - - - - 1755.5714285714287 88 7 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 801 102 C20140605_SFK031_03 C20140605_SFK031_03 TB556231.[MT7]-C[CAM]DLPTR.2y3_1.heavy 453.235 / 373.219 26489.0 19.7091007232666 48 20 10 10 8 9.142191402719291 10.938296475641014 0.0 4 0.9929282635160672 14.667059982538769 26489.0 15.243575141844206 0.0 - - - - - - - 1736.2222222222222 52 9 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 803 103 C20140605_SFK031_03 C20140605_SFK031_03 TB559782.[MT7]-ATIDC[CAM]AGILK[MT7].3b4_1.heavy 450.595 / 545.305 102533.0 31.162599563598633 44 14 10 10 10 2.194694227923124 36.03151864095513 0.0 3 0.9487344993478034 5.427211161476978 102533.0 103.13627068569079 0.0 - - - - - - - 775.5 205 2 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 805 103 C20140605_SFK031_03 C20140605_SFK031_03 TB559782.[MT7]-ATIDC[CAM]AGILK[MT7].3b5_1.heavy 450.595 / 705.336 35686.0 31.162599563598633 44 14 10 10 10 2.194694227923124 36.03151864095513 0.0 3 0.9487344993478034 5.427211161476978 35686.0 78.19899601686973 0.0 - - - - - - - 660.6666666666666 71 9 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 807 103 C20140605_SFK031_03 C20140605_SFK031_03 TB559782.[MT7]-ATIDC[CAM]AGILK[MT7].3y4_1.heavy 450.595 / 574.404 123738.0 31.162599563598633 44 14 10 10 10 2.194694227923124 36.03151864095513 0.0 3 0.9487344993478034 5.427211161476978 123738.0 33.36478408627951 0.0 - - - - - - - 1077.3333333333333 247 3 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 809 103 C20140605_SFK031_03 C20140605_SFK031_03 TB559782.[MT7]-ATIDC[CAM]AGILK[MT7].3b7_1.heavy 450.595 / 833.394 51460.0 31.162599563598633 44 14 10 10 10 2.194694227923124 36.03151864095513 0.0 3 0.9487344993478034 5.427211161476978 51460.0 221.05666114977367 0.0 - - - - - - - 215.5 102 6 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 811 104 C20140605_SFK031_03 C20140605_SFK031_03 TB559784.[MT7]-LIPAFEMVMR.2y4_1.heavy 675.873 / 536.268 6912.0 47.8109016418457 46 20 10 6 10 5.5241679847913945 18.102273550570935 0.0391998291015625 3 0.9919378439068199 13.735502654925178 6912.0 29.360923800732515 0.0 - - - - - - - 348.54545454545456 13 11 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 813 104 C20140605_SFK031_03 C20140605_SFK031_03 TB559784.[MT7]-LIPAFEMVMR.2y8_1.heavy 675.873 / 980.469 202068.0 47.8109016418457 46 20 10 6 10 5.5241679847913945 18.102273550570935 0.0391998291015625 3 0.9919378439068199 13.735502654925178 202068.0 519.3628272362902 0.0 - - - - - - - 340.8 404 5 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 815 104 C20140605_SFK031_03 C20140605_SFK031_03 TB559784.[MT7]-LIPAFEMVMR.2y9_1.heavy 675.873 / 1093.55 30443.0 47.8109016418457 46 20 10 6 10 5.5241679847913945 18.102273550570935 0.0391998291015625 3 0.9919378439068199 13.735502654925178 30443.0 150.20208734306289 0.0 - - - - - - - 254.375 60 8 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 817 104 C20140605_SFK031_03 C20140605_SFK031_03 TB559784.[MT7]-LIPAFEMVMR.2y7_1.heavy 675.873 / 883.417 7433.0 47.8109016418457 46 20 10 6 10 5.5241679847913945 18.102273550570935 0.0391998291015625 3 0.9919378439068199 13.735502654925178 7433.0 26.23508923970138 0.0 - - - - - - - 267.14285714285717 14 14 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 819 105 C20140605_SFK031_03 C20140605_SFK031_03 TB556339.[MT7]-GLLPLVR.2y4_1.heavy 456.312 / 484.324 373032.0 38.24209976196289 50 20 10 10 10 9.03144225574439 11.072428651846348 0.0 3 0.9954179409230743 18.22493793004866 373032.0 417.59948230769857 0.0 - - - - - - - 392.4 746 5 BCL3 B-cell CLL/lymphoma 3 821 105 C20140605_SFK031_03 C20140605_SFK031_03 TB556339.[MT7]-GLLPLVR.2y5_1.heavy 456.312 / 597.408 125293.0 38.24209976196289 50 20 10 10 10 9.03144225574439 11.072428651846348 0.0 3 0.9954179409230743 18.22493793004866 125293.0 288.7145595623797 0.0 - - - - - - - 687.0 250 7 BCL3 B-cell CLL/lymphoma 3 823 105 C20140605_SFK031_03 C20140605_SFK031_03 TB556339.[MT7]-GLLPLVR.2y6_1.heavy 456.312 / 710.492 99881.0 38.24209976196289 50 20 10 10 10 9.03144225574439 11.072428651846348 0.0 3 0.9954179409230743 18.22493793004866 99881.0 456.9756770044262 0.0 - - - - - - - 245.125 199 8 BCL3 B-cell CLL/lymphoma 3 825 105 C20140605_SFK031_03 C20140605_SFK031_03 TB556339.[MT7]-GLLPLVR.2b5_1.heavy 456.312 / 638.436 140893.0 38.24209976196289 50 20 10 10 10 9.03144225574439 11.072428651846348 0.0 3 0.9954179409230743 18.22493793004866 140893.0 358.69098168303356 0.0 - - - - - - - 235.4 281 5 BCL3 B-cell CLL/lymphoma 3 827 106 C20140605_SFK031_03 C20140605_SFK031_03 TB294934.[MT7]-LGEVGSTLYTK[MT7].2b4_1.heavy 728.419 / 543.326 5852.0 32.19110107421875 44 14 10 10 10 3.2288876982287733 24.696717215144307 0.0 3 0.9467478469473979 5.324115000210217 5852.0 10.353538461538463 0.0 - - - - - - - 1151.4285714285713 11 7 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 829 106 C20140605_SFK031_03 C20140605_SFK031_03 TB294934.[MT7]-LGEVGSTLYTK[MT7].2y3_1.heavy 728.419 / 555.326 4031.0 32.19110107421875 44 14 10 10 10 3.2288876982287733 24.696717215144307 0.0 3 0.9467478469473979 5.324115000210217 4031.0 3.0342821289475106 0.0 - - - - - - - 278.57142857142856 8 7 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 831 106 C20140605_SFK031_03 C20140605_SFK031_03 TB294934.[MT7]-LGEVGSTLYTK[MT7].2y10_1.heavy 728.419 / 1198.64 4682.0 32.19110107421875 44 14 10 10 10 3.2288876982287733 24.696717215144307 0.0 3 0.9467478469473979 5.324115000210217 4682.0 9.975610741430812 1.0 - - - - - - - 273.0 9 10 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 833 106 C20140605_SFK031_03 C20140605_SFK031_03 TB294934.[MT7]-LGEVGSTLYTK[MT7].2y7_1.heavy 728.419 / 913.511 6892.0 32.19110107421875 44 14 10 10 10 3.2288876982287733 24.696717215144307 0.0 3 0.9467478469473979 5.324115000210217 6892.0 25.04976923076923 0.0 - - - - - - - 668.5714285714286 13 7 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 835 107 C20140605_SFK031_03 C20140605_SFK031_03 TB294933.[MT7]-FQVIVYNPLGR.2b3_1.heavy 725.42 / 519.305 36203.0 41.65580081939697 41 14 10 7 10 1.5992337823000589 41.794035913678286 0.029201507568359375 3 0.9451317996427576 5.244402103310222 36203.0 65.45779324086263 0.0 - - - - - - - 767.0 72 13 MAN2B1 mannosidase, alpha, class 2B, member 1 837 107 C20140605_SFK031_03 C20140605_SFK031_03 TB294933.[MT7]-FQVIVYNPLGR.2y8_1.heavy 725.42 / 931.536 38254.0 41.65580081939697 41 14 10 7 10 1.5992337823000589 41.794035913678286 0.029201507568359375 3 0.9451317996427576 5.244402103310222 38254.0 61.72846675584677 0.0 - - - - - - - 757.6428571428571 76 14 MAN2B1 mannosidase, alpha, class 2B, member 1 839 107 C20140605_SFK031_03 C20140605_SFK031_03 TB294933.[MT7]-FQVIVYNPLGR.2y6_1.heavy 725.42 / 719.383 15203.0 41.65580081939697 41 14 10 7 10 1.5992337823000589 41.794035913678286 0.029201507568359375 3 0.9451317996427576 5.244402103310222 15203.0 6.24794200669628 0.0 - - - - - - - 1767.6363636363637 30 11 MAN2B1 mannosidase, alpha, class 2B, member 1 841 107 C20140605_SFK031_03 C20140605_SFK031_03 TB294933.[MT7]-FQVIVYNPLGR.2y10_1.heavy 725.42 / 1158.66 18243.0 41.65580081939697 41 14 10 7 10 1.5992337823000589 41.794035913678286 0.029201507568359375 3 0.9451317996427576 5.244402103310222 18243.0 27.750301462292974 0.0 - - - - - - - 742.4 36 10 MAN2B1 mannosidase, alpha, class 2B, member 1 843 108 C20140605_SFK031_03 C20140605_SFK031_03 TB295085.[MT7]-NLSPVVSNELLEQAFSQFGPVEK[MT7].4y4_1.heavy 705.881 / 616.379 37777.0 49.89390182495117 45 15 10 10 10 2.1547006663507937 37.0379050069063 0.0 3 0.9593533939259664 6.100537333310752 37777.0 59.130287088566874 0.0 - - - - - - - 704.8888888888889 75 9 PSPC1 paraspeckle component 1 845 108 C20140605_SFK031_03 C20140605_SFK031_03 TB295085.[MT7]-NLSPVVSNELLEQAFSQFGPVEK[MT7].4y5_1.heavy 705.881 / 673.4 49227.0 49.89390182495117 45 15 10 10 10 2.1547006663507937 37.0379050069063 0.0 3 0.9593533939259664 6.100537333310752 49227.0 121.91864652717592 0.0 - - - - - - - 786.0 98 9 PSPC1 paraspeckle component 1 847 108 C20140605_SFK031_03 C20140605_SFK031_03 TB295085.[MT7]-NLSPVVSNELLEQAFSQFGPVEK[MT7].4b5_1.heavy 705.881 / 655.39 42226.0 49.89390182495117 45 15 10 10 10 2.1547006663507937 37.0379050069063 0.0 3 0.9593533939259664 6.100537333310752 42226.0 115.06728640237743 0.0 - - - - - - - 321.6363636363636 84 11 PSPC1 paraspeckle component 1 849 108 C20140605_SFK031_03 C20140605_SFK031_03 TB295085.[MT7]-NLSPVVSNELLEQAFSQFGPVEK[MT7].4b6_1.heavy 705.881 / 754.458 26838.0 49.89390182495117 45 15 10 10 10 2.1547006663507937 37.0379050069063 0.0 3 0.9593533939259664 6.100537333310752 26838.0 71.23121979286536 0.0 - - - - - - - 239.22222222222223 53 9 PSPC1 paraspeckle component 1 851 109 C20140605_SFK031_03 C20140605_SFK031_03 TB559387.[MT7]-MPVANPFPK[MT7].3y3_1.heavy 430.249 / 535.336 21375.0 34.46240043640137 27 2 10 5 10 3.7354009222299513 26.770888073856934 0.042400360107421875 3 0.46747716840717757 1.6095454622570609 21375.0 27.283607845817386 0.0 - - - - - - - 1158.9 42 10 BCL6 B-cell CLL/lymphoma 6 853 109 C20140605_SFK031_03 C20140605_SFK031_03 TB559387.[MT7]-MPVANPFPK[MT7].3b4_1.heavy 430.249 / 543.308 77260.0 34.46240043640137 27 2 10 5 10 3.7354009222299513 26.770888073856934 0.042400360107421875 3 0.46747716840717757 1.6095454622570609 77260.0 141.37106719503717 1.0 - - - - - - - 708.5 154 2 BCL6 B-cell CLL/lymphoma 6 855 109 C20140605_SFK031_03 C20140605_SFK031_03 TB559387.[MT7]-MPVANPFPK[MT7].3b5_1.heavy 430.249 / 657.351 2318.0 34.46240043640137 27 2 10 5 10 3.7354009222299513 26.770888073856934 0.042400360107421875 3 0.46747716840717757 1.6095454622570609 2318.0 5.684511405881276 8.0 - - - - - - - 729.5555555555555 172 9 BCL6 B-cell CLL/lymphoma 6 857 109 C20140605_SFK031_03 C20140605_SFK031_03 TB559387.[MT7]-MPVANPFPK[MT7].3b3_1.heavy 430.249 / 472.271 201521.0 34.46240043640137 27 2 10 5 10 3.7354009222299513 26.770888073856934 0.042400360107421875 3 0.46747716840717757 1.6095454622570609 201521.0 602.917365125677 0.0 - - - - - - - 257.6666666666667 403 3 BCL6 B-cell CLL/lymphoma 6 859 110 C20140605_SFK031_03 C20140605_SFK031_03 TB561489.[MT7]-TQPAVATAATAAEK[MT7].3b6_1.heavy 539.973 / 712.411 12985.0 24.172100067138672 44 18 10 6 10 4.021155904635302 24.86847124846045 0.036800384521484375 3 0.9860400839721705 10.433125764816138 12985.0 37.60491519323345 0.0 - - - - - - - 225.75 25 12 MECP2 methyl CpG binding protein 2 (Rett syndrome) 861 110 C20140605_SFK031_03 C20140605_SFK031_03 TB561489.[MT7]-TQPAVATAATAAEK[MT7].3b4_1.heavy 539.973 / 542.305 23261.0 24.172100067138672 44 18 10 6 10 4.021155904635302 24.86847124846045 0.036800384521484375 3 0.9860400839721705 10.433125764816138 23261.0 28.686533282979212 0.0 - - - - - - - 1172.4285714285713 46 7 MECP2 methyl CpG binding protein 2 (Rett syndrome) 863 110 C20140605_SFK031_03 C20140605_SFK031_03 TB561489.[MT7]-TQPAVATAATAAEK[MT7].3b5_1.heavy 539.973 / 641.374 21668.0 24.172100067138672 44 18 10 6 10 4.021155904635302 24.86847124846045 0.036800384521484375 3 0.9860400839721705 10.433125764816138 21668.0 37.37407085507504 0.0 - - - - - - - 770.1666666666666 43 12 MECP2 methyl CpG binding protein 2 (Rett syndrome) 865 110 C20140605_SFK031_03 C20140605_SFK031_03 TB561489.[MT7]-TQPAVATAATAAEK[MT7].3y5_1.heavy 539.973 / 663.379 16410.0 24.172100067138672 44 18 10 6 10 4.021155904635302 24.86847124846045 0.036800384521484375 3 0.9860400839721705 10.433125764816138 16410.0 33.70601570959592 0.0 - - - - - - - 727.0 32 8 MECP2 methyl CpG binding protein 2 (Rett syndrome) 867 111 C20140605_SFK031_03 C20140605_SFK031_03 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 1885250.0 22.50510025024414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1885250.0 662.1583321741549 0.0 - - - - - - - 461.0 3770 1 869 111 C20140605_SFK031_03 C20140605_SFK031_03 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 2491150.0 22.50510025024414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2491150.0 731.4603613120596 0.0 - - - - - - - 254.66666666666666 4982 15 871 111 C20140605_SFK031_03 C20140605_SFK031_03 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 7109000.0 22.50510025024414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 7109000.0 12429.9360523545 0.0 - - - - - - - 762.1428571428571 14218 7 873 112 C20140605_SFK031_03 C20140605_SFK031_03 TB399657.[MT7]-EFLDGTRK[MT7].2y4_1.heavy 627.358 / 605.385 N/A 23.65850067138672 50 20 10 10 10 3.6281840056103967 21.60804496845803 0.0 3 0.9925367971410991 14.276747344973192 4524.0 3.0927828039151803 2.0 - - - - - - - 1746.25 9 8 PML promyelocytic leukemia 875 112 C20140605_SFK031_03 C20140605_SFK031_03 TB399657.[MT7]-EFLDGTRK[MT7].2y5_1.heavy 627.358 / 720.412 1530.0 23.65850067138672 50 20 10 10 10 3.6281840056103967 21.60804496845803 0.0 3 0.9925367971410991 14.276747344973192 1530.0 3.766802171180396 0.0 - - - - - - - 247.83333333333334 3 18 PML promyelocytic leukemia 877 112 C20140605_SFK031_03 C20140605_SFK031_03 TB399657.[MT7]-EFLDGTRK[MT7].2y6_1.heavy 627.358 / 833.496 1264.0 23.65850067138672 50 20 10 10 10 3.6281840056103967 21.60804496845803 0.0 3 0.9925367971410991 14.276747344973192 1264.0 4.0680178891337695 1.0 - - - - - - - 213.1 2 20 PML promyelocytic leukemia 879 112 C20140605_SFK031_03 C20140605_SFK031_03 TB399657.[MT7]-EFLDGTRK[MT7].2y7_1.heavy 627.358 / 980.565 2728.0 23.65850067138672 50 20 10 10 10 3.6281840056103967 21.60804496845803 0.0 3 0.9925367971410991 14.276747344973192 2728.0 15.283637092731832 0.0 - - - - - - - 189.3684210526316 5 19 PML promyelocytic leukemia 881 113 C20140605_SFK031_03 C20140605_SFK031_03 TB559678.[MT7]-GSC[CAM]QEEAGPVR.2b8_1.heavy 667.318 / 963.396 3262.0 17.46862506866455 38 15 10 3 10 2.9440309484747225 24.03135231915783 0.05970001220703125 3 0.9536667520050127 5.71116506176091 3262.0 51.80823529411765 0.0 - - - - - - - 120.21428571428571 6 14 SOLH small optic lobes homolog (Drosophila) 883 113 C20140605_SFK031_03 C20140605_SFK031_03 TB559678.[MT7]-GSC[CAM]QEEAGPVR.2b4_1.heavy 667.318 / 577.252 1733.0 17.46862506866455 38 15 10 3 10 2.9440309484747225 24.03135231915783 0.05970001220703125 3 0.9536667520050127 5.71116506176091 1733.0 1.8194278762154086 0.0 - - - - - - - 199.75 3 24 SOLH small optic lobes homolog (Drosophila) 885 113 C20140605_SFK031_03 C20140605_SFK031_03 TB559678.[MT7]-GSC[CAM]QEEAGPVR.2y10_1.heavy 667.318 / 1132.51 4281.0 17.46862506866455 38 15 10 3 10 2.9440309484747225 24.03135231915783 0.05970001220703125 3 0.9536667520050127 5.71116506176091 4281.0 142.7 0.0 - - - - - - - 82.875 8 8 SOLH small optic lobes homolog (Drosophila) 887 113 C20140605_SFK031_03 C20140605_SFK031_03 TB559678.[MT7]-GSC[CAM]QEEAGPVR.2b5_1.heavy 667.318 / 706.295 2956.0 17.46862506866455 38 15 10 3 10 2.9440309484747225 24.03135231915783 0.05970001220703125 3 0.9536667520050127 5.71116506176091 2956.0 54.193333333333335 0.0 - - - - - - - 125.53846153846153 5 13 SOLH small optic lobes homolog (Drosophila) 889 114 C20140605_SFK031_03 C20140605_SFK031_03 TB294847.[MT7]-LVVVGAGGVGK[MT7].2y8_1.heavy 622.402 / 788.475 134022.0 31.07699966430664 50 20 10 10 10 8.260762975120615 12.10541935426248 0.0 3 0.9947899432395229 17.09040693844827 134022.0 175.40409943538177 0.0 - - - - - - - 1234.857142857143 268 7 HRAS;KRAS;NRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 891 114 C20140605_SFK031_03 C20140605_SFK031_03 TB294847.[MT7]-LVVVGAGGVGK[MT7].2y5_1.heavy 622.402 / 561.348 83294.0 31.07699966430664 50 20 10 10 10 8.260762975120615 12.10541935426248 0.0 3 0.9947899432395229 17.09040693844827 83294.0 45.316664695446484 0.0 - - - - - - - 376.0 166 2 HRAS;KRAS;NRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 893 114 C20140605_SFK031_03 C20140605_SFK031_03 TB294847.[MT7]-LVVVGAGGVGK[MT7].2y9_1.heavy 622.402 / 887.543 85799.0 31.07699966430664 50 20 10 10 10 8.260762975120615 12.10541935426248 0.0 3 0.9947899432395229 17.09040693844827 85799.0 214.4975 0.0 - - - - - - - 250.71428571428572 171 7 HRAS;KRAS;NRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 895 114 C20140605_SFK031_03 C20140605_SFK031_03 TB294847.[MT7]-LVVVGAGGVGK[MT7].2y7_1.heavy 622.402 / 689.406 228713.0 31.07699966430664 50 20 10 10 10 8.260762975120615 12.10541935426248 0.0 3 0.9947899432395229 17.09040693844827 228713.0 151.8331035368624 0.0 - - - - - - - 250.66666666666666 457 3 HRAS;KRAS;NRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 897 115 C20140605_SFK031_03 C20140605_SFK031_03 TB559501.[MT7]-C[CAM]TFLNPAGQR.2y5_1.heavy 654.336 / 528.289 15096.0 29.08414936065674 40 15 10 5 10 2.14290557049096 37.20914349685485 0.04030036926269531 3 0.9569493876664857 5.926553435937439 15096.0 17.833739130434783 0.0 - - - - - - - 249.75 30 4 SOLH small optic lobes homolog (Drosophila) 899 115 C20140605_SFK031_03 C20140605_SFK031_03 TB559501.[MT7]-C[CAM]TFLNPAGQR.2y9_1.heavy 654.336 / 1003.53 27860.0 29.08414936065674 40 15 10 5 10 2.14290557049096 37.20914349685485 0.04030036926269531 3 0.9569493876664857 5.926553435937439 27860.0 48.97670870870871 0.0 - - - - - - - 283.6666666666667 55 9 SOLH small optic lobes homolog (Drosophila) 901 115 C20140605_SFK031_03 C20140605_SFK031_03 TB559501.[MT7]-C[CAM]TFLNPAGQR.2y6_1.heavy 654.336 / 642.332 11322.0 29.08414936065674 40 15 10 5 10 2.14290557049096 37.20914349685485 0.04030036926269531 3 0.9569493876664857 5.926553435937439 11322.0 9.243325942350332 1.0 - - - - - - - 333.0 22 5 SOLH small optic lobes homolog (Drosophila) 903 115 C20140605_SFK031_03 C20140605_SFK031_03 TB559501.[MT7]-C[CAM]TFLNPAGQR.2b5_1.heavy 654.336 / 780.383 14097.0 29.08414936065674 40 15 10 5 10 2.14290557049096 37.20914349685485 0.04030036926269531 3 0.9569493876664857 5.926553435937439 14097.0 15.209761904761905 0.0 - - - - - - - 185.0 28 6 SOLH small optic lobes homolog (Drosophila) 905 116 C20140605_SFK031_03 C20140605_SFK031_03 TB561650.[MT7]-LAVTNTTMTGTVLK[MT7].3y6_1.heavy 580.006 / 762.484 49839.0 34.312400817871094 46 16 10 10 10 1.9960578798418445 33.7519123684756 0.0 3 0.965943192995398 6.668376001219418 49839.0 36.25385372302223 0.0 - - - - - - - 254.0 99 1 STIM1 stromal interaction molecule 1 907 116 C20140605_SFK031_03 C20140605_SFK031_03 TB561650.[MT7]-LAVTNTTMTGTVLK[MT7].3b6_1.heavy 580.006 / 744.437 45771.0 34.312400817871094 46 16 10 10 10 1.9960578798418445 33.7519123684756 0.0 3 0.965943192995398 6.668376001219418 45771.0 48.10972316149214 0.0 - - - - - - - 1162.142857142857 91 7 STIM1 stromal interaction molecule 1 909 116 C20140605_SFK031_03 C20140605_SFK031_03 TB561650.[MT7]-LAVTNTTMTGTVLK[MT7].3b5_1.heavy 580.006 / 643.39 49331.0 34.312400817871094 46 16 10 10 10 1.9960578798418445 33.7519123684756 0.0 3 0.965943192995398 6.668376001219418 49331.0 28.638621524484012 0.0 - - - - - - - 381.0 98 1 STIM1 stromal interaction molecule 1 911 116 C20140605_SFK031_03 C20140605_SFK031_03 TB561650.[MT7]-LAVTNTTMTGTVLK[MT7].3y5_1.heavy 580.006 / 661.437 58612.0 34.312400817871094 46 16 10 10 10 1.9960578798418445 33.7519123684756 0.0 3 0.965943192995398 6.668376001219418 58612.0 39.94307295533299 0.0 - - - - - - - 381.0 117 1 STIM1 stromal interaction molecule 1 913 117 C20140605_SFK031_03 C20140605_SFK031_03 TB556840.[MT7]-LDAVLQR.2y4_1.heavy 479.794 / 515.33 21703.0 30.738100051879883 50 20 10 10 10 6.82315408057687 14.65597857223611 0.0 3 0.9920962803200806 13.872672853196713 21703.0 16.166860864716774 0.0 - - - - - - - 252.0 43 1 PML promyelocytic leukemia 915 117 C20140605_SFK031_03 C20140605_SFK031_03 TB556840.[MT7]-LDAVLQR.2y5_1.heavy 479.794 / 586.367 87443.0 30.738100051879883 50 20 10 10 10 6.82315408057687 14.65597857223611 0.0 3 0.9920962803200806 13.872672853196713 87443.0 59.59708027036832 0.0 - - - - - - - 379.0 174 2 PML promyelocytic leukemia 917 117 C20140605_SFK031_03 C20140605_SFK031_03 TB556840.[MT7]-LDAVLQR.2b4_1.heavy 479.794 / 543.326 59304.0 30.738100051879883 50 20 10 10 10 6.82315408057687 14.65597857223611 0.0 3 0.9920962803200806 13.872672853196713 59304.0 26.89461367013373 0.0 - - - - - - - 1262.0 118 2 PML promyelocytic leukemia 919 117 C20140605_SFK031_03 C20140605_SFK031_03 TB556840.[MT7]-LDAVLQR.2y6_1.heavy 479.794 / 701.394 101070.0 30.738100051879883 50 20 10 10 10 6.82315408057687 14.65597857223611 0.0 3 0.9920962803200806 13.872672853196713 101070.0 65.0633499481529 0.0 - - - - - - - 757.0 202 2 PML promyelocytic leukemia 921 118 C20140605_SFK031_03 C20140605_SFK031_03 TB556843.[MT7]-QLLVAK[MT7].2b3_1.heavy 480.328 / 499.336 44840.0 27.047800064086914 50 20 10 10 10 10.241374658419295 9.764314199538767 0.0 3 0.9942648119396427 16.288487397439035 44840.0 26.022061518823634 0.0 - - - - - - - 916.0 89 2 STIM1 stromal interaction molecule 1 923 118 C20140605_SFK031_03 C20140605_SFK031_03 TB556843.[MT7]-QLLVAK[MT7].2y4_1.heavy 480.328 / 574.404 56701.0 27.047800064086914 50 20 10 10 10 10.241374658419295 9.764314199538767 0.0 3 0.9942648119396427 16.288487397439035 56701.0 43.74997886052172 0.0 - - - - - - - 868.0 113 2 STIM1 stromal interaction molecule 1 925 118 C20140605_SFK031_03 C20140605_SFK031_03 TB556843.[MT7]-QLLVAK[MT7].2y5_1.heavy 480.328 / 687.489 70394.0 27.047800064086914 50 20 10 10 10 10.241374658419295 9.764314199538767 0.0 3 0.9942648119396427 16.288487397439035 70394.0 63.506647974469466 1.0 - - - - - - - 321.3333333333333 140 3 STIM1 stromal interaction molecule 1 927 118 C20140605_SFK031_03 C20140605_SFK031_03 TB556843.[MT7]-QLLVAK[MT7].2b4_1.heavy 480.328 / 598.404 23433.0 27.047800064086914 50 20 10 10 10 10.241374658419295 9.764314199538767 0.0 3 0.9942648119396427 16.288487397439035 23433.0 30.820546812181 1.0 - - - - - - - 386.0 46 1 STIM1 stromal interaction molecule 1 929 119 C20140605_SFK031_03 C20140605_SFK031_03 TB294846.[MT7]-EDIVELLLR.2b3_1.heavy 622.373 / 502.263 75008.0 49.26729965209961 42 12 10 10 10 0.9151353983687677 65.51475207918004 0.0 3 0.8912940556118121 3.708691265564363 75008.0 173.0969555392197 0.0 - - - - - - - 185.7 150 10 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 931 119 C20140605_SFK031_03 C20140605_SFK031_03 TB294846.[MT7]-EDIVELLLR.2y8_1.heavy 622.373 / 970.593 107388.0 49.26729965209961 42 12 10 10 10 0.9151353983687677 65.51475207918004 0.0 3 0.8912940556118121 3.708691265564363 107388.0 598.28900456621 0.0 - - - - - - - 195.35714285714286 214 14 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 933 119 C20140605_SFK031_03 C20140605_SFK031_03 TB294846.[MT7]-EDIVELLLR.2b4_1.heavy 622.373 / 601.331 41497.0 49.26729965209961 42 12 10 10 10 0.9151353983687677 65.51475207918004 0.0 3 0.8912940556118121 3.708691265564363 41497.0 66.32082567860922 0.0 - - - - - - - 288.0 82 10 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 935 119 C20140605_SFK031_03 C20140605_SFK031_03 TB294846.[MT7]-EDIVELLLR.2b5_1.heavy 622.373 / 730.374 47367.0 49.26729965209961 42 12 10 10 10 0.9151353983687677 65.51475207918004 0.0 3 0.8912940556118121 3.708691265564363 47367.0 170.97606352322083 0.0 - - - - - - - 216.0 94 13 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 937 120 C20140605_SFK031_03 C20140605_SFK031_03 TB561755.[MT7]-TRQGVEDAFYTLVR.3y7_1.heavy 600.324 / 869.488 103288.0 38.712398529052734 45 15 10 10 10 6.089055954821574 16.42290705520874 0.0 3 0.9519582397583618 5.607879911153014 103288.0 321.77538592148846 0.0 - - - - - - - 718.2857142857143 206 7 HRAS;NRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 939 120 C20140605_SFK031_03 C20140605_SFK031_03 TB561755.[MT7]-TRQGVEDAFYTLVR.3y6_1.heavy 600.324 / 798.451 137382.0 38.712398529052734 45 15 10 10 10 6.089055954821574 16.42290705520874 0.0 3 0.9519582397583618 5.607879911153014 137382.0 84.68577580291453 0.0 - - - - - - - 335.3333333333333 274 6 HRAS;NRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 941 120 C20140605_SFK031_03 C20140605_SFK031_03 TB561755.[MT7]-TRQGVEDAFYTLVR.3b7_1.heavy 600.324 / 930.476 101551.0 38.712398529052734 45 15 10 10 10 6.089055954821574 16.42290705520874 0.0 3 0.9519582397583618 5.607879911153014 101551.0 202.97935910781462 0.0 - - - - - - - 324.09090909090907 203 11 HRAS;NRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 943 120 C20140605_SFK031_03 C20140605_SFK031_03 TB561755.[MT7]-TRQGVEDAFYTLVR.3y5_1.heavy 600.324 / 651.382 275677.0 38.712398529052734 45 15 10 10 10 6.089055954821574 16.42290705520874 0.0 3 0.9519582397583618 5.607879911153014 275677.0 342.3772589962121 0.0 - - - - - - - 304.6666666666667 551 3 HRAS;NRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 945 121 C20140605_SFK031_03 C20140605_SFK031_03 TB294746.[MT7]-SLLC[CAM]C[CAM]AR.2y4_1.heavy 512.263 / 566.217 13358.0 26.43199920654297 48 18 10 10 10 8.965794211069097 11.153501591252319 0.0 3 0.9802462517945034 8.766376072191175 13358.0 20.784104289318755 0.0 - - - - - - - 1267.857142857143 26 7 AVPR2 arginine vasopressin receptor 2 947 121 C20140605_SFK031_03 C20140605_SFK031_03 TB294746.[MT7]-SLLC[CAM]C[CAM]AR.2y5_1.heavy 512.263 / 679.301 13175.0 26.43199920654297 48 18 10 10 10 8.965794211069097 11.153501591252319 0.0 3 0.9802462517945034 8.766376072191175 13175.0 21.75059910063752 0.0 - - - - - - - 388.75 26 4 AVPR2 arginine vasopressin receptor 2 949 121 C20140605_SFK031_03 C20140605_SFK031_03 TB294746.[MT7]-SLLC[CAM]C[CAM]AR.2y3_1.heavy 512.263 / 406.187 4392.0 26.43199920654297 48 18 10 10 10 8.965794211069097 11.153501591252319 0.0 3 0.9802462517945034 8.766376072191175 4392.0 0.8470588235294118 17.0 - - - - - - - 1372.0 24 1 AVPR2 arginine vasopressin receptor 2 951 121 C20140605_SFK031_03 C20140605_SFK031_03 TB294746.[MT7]-SLLC[CAM]C[CAM]AR.2y6_1.heavy 512.263 / 792.385 13358.0 26.43199920654297 48 18 10 10 10 8.965794211069097 11.153501591252319 0.0 3 0.9802462517945034 8.766376072191175 13358.0 36.590792008196715 1.0 - - - - - - - 274.2 26 5 AVPR2 arginine vasopressin receptor 2 953 122 C20140605_SFK031_03 C20140605_SFK031_03 TB294842.[MT7]-TAGLVATEPAR.2y5_1.heavy 615.352 / 573.299 4371.0 24.1358003616333 42 16 10 6 10 7.461133540339546 13.402789195413481 0.03579902648925781 3 0.9689339578851162 6.983749125652536 4371.0 5.470457108654749 1.0 - - - - - - - 1181.888888888889 8 9 SOLH small optic lobes homolog (Drosophila) 955 122 C20140605_SFK031_03 C20140605_SFK031_03 TB294842.[MT7]-TAGLVATEPAR.2y9_1.heavy 615.352 / 913.51 6192.0 24.1358003616333 42 16 10 6 10 7.461133540339546 13.402789195413481 0.03579902648925781 3 0.9689339578851162 6.983749125652536 6192.0 36.4509835731279 0.0 - - - - - - - 187.52380952380952 12 21 SOLH small optic lobes homolog (Drosophila) 957 122 C20140605_SFK031_03 C20140605_SFK031_03 TB294842.[MT7]-TAGLVATEPAR.2y6_1.heavy 615.352 / 644.336 8887.0 24.1358003616333 42 16 10 6 10 7.461133540339546 13.402789195413481 0.03579902648925781 3 0.9689339578851162 6.983749125652536 8887.0 16.554453448500883 0.0 - - - - - - - 692.0 17 8 SOLH small optic lobes homolog (Drosophila) 959 122 C20140605_SFK031_03 C20140605_SFK031_03 TB294842.[MT7]-TAGLVATEPAR.2y7_1.heavy 615.352 / 743.405 8377.0 24.1358003616333 42 16 10 6 10 7.461133540339546 13.402789195413481 0.03579902648925781 3 0.9689339578851162 6.983749125652536 8377.0 29.26272927301531 0.0 - - - - - - - 257.11764705882354 16 17 SOLH small optic lobes homolog (Drosophila) 961 123 C20140605_SFK031_03 C20140605_SFK031_03 TB399521.[MT7]-ASGVC[CAM]AR.2y5_1.heavy 432.728 / 562.277 5643.0 15.081199645996094 45 15 10 10 10 2.375879961883273 42.08966850359463 0.0 3 0.9500068150193668 5.496431726093173 5643.0 16.60121397469945 0.0 - - - - - - - 704.5882352941177 11 17 MAN2B1 mannosidase, alpha, class 2B, member 1 963 123 C20140605_SFK031_03 C20140605_SFK031_03 TB399521.[MT7]-ASGVC[CAM]AR.2b4_1.heavy 432.728 / 459.268 6207.0 15.081199645996094 45 15 10 10 10 2.375879961883273 42.08966850359463 0.0 3 0.9500068150193668 5.496431726093173 6207.0 7.030138337298885 0.0 - - - - - - - 1289.857142857143 12 7 MAN2B1 mannosidase, alpha, class 2B, member 1 965 123 C20140605_SFK031_03 C20140605_SFK031_03 TB399521.[MT7]-ASGVC[CAM]AR.2y6_1.heavy 432.728 / 649.309 30254.0 15.081199645996094 45 15 10 10 10 2.375879961883273 42.08966850359463 0.0 3 0.9500068150193668 5.496431726093173 30254.0 34.98103384527872 2.0 - - - - - - - 293.0 60 12 MAN2B1 mannosidase, alpha, class 2B, member 1 967 123 C20140605_SFK031_03 C20140605_SFK031_03 TB399521.[MT7]-ASGVC[CAM]AR.2b5_1.heavy 432.728 / 619.299 3993.0 15.081199645996094 45 15 10 10 10 2.375879961883273 42.08966850359463 0.0 3 0.9500068150193668 5.496431726093173 3993.0 3.4404929675018243 2.0 - - - - - - - 804.9090909090909 9 11 MAN2B1 mannosidase, alpha, class 2B, member 1 969 124 C20140605_SFK031_03 C20140605_SFK031_03 TB559400.[MT7]-ELDIYNNLR.3b4_1.heavy 431.902 / 615.347 55912.0 34.82659912109375 47 17 10 10 10 3.83898553070887 26.048548294875957 0.0 3 0.9754014697719494 7.852600398528773 55912.0 53.496441549497206 0.0 - - - - - - - 349.25 111 4 BCL3 B-cell CLL/lymphoma 3 971 124 C20140605_SFK031_03 C20140605_SFK031_03 TB559400.[MT7]-ELDIYNNLR.3y4_1.heavy 431.902 / 516.289 116781.0 34.82659912109375 47 17 10 10 10 3.83898553070887 26.048548294875957 0.0 3 0.9754014697719494 7.852600398528773 116781.0 57.906664602399715 0.0 - - - - - - - 381.0 233 2 BCL3 B-cell CLL/lymphoma 3 973 124 C20140605_SFK031_03 C20140605_SFK031_03 TB559400.[MT7]-ELDIYNNLR.3b3_1.heavy 431.902 / 502.263 185781.0 34.82659912109375 47 17 10 10 10 3.83898553070887 26.048548294875957 0.0 3 0.9754014697719494 7.852600398528773 185781.0 148.2906239460371 0.0 - - - - - - - 211.66666666666666 371 3 BCL3 B-cell CLL/lymphoma 3 975 124 C20140605_SFK031_03 C20140605_SFK031_03 TB559400.[MT7]-ELDIYNNLR.3y5_1.heavy 431.902 / 679.352 22111.0 34.82659912109375 47 17 10 10 10 3.83898553070887 26.048548294875957 0.0 3 0.9754014697719494 7.852600398528773 22111.0 66.14875181249197 0.0 - - - - - - - 279.4 44 5 BCL3 B-cell CLL/lymphoma 3 977 125 C20140605_SFK031_03 C20140605_SFK031_03 TB562134.[MT7]-ESADFWC[CAM]FEC[CAM]EQLLC[CAM]AK[MT7].3y3_1.heavy 827.709 / 522.283 30101.0 44.65820026397705 37 11 10 6 10 0.9546436493617599 69.83408595577794 0.038402557373046875 3 0.8612934780598962 3.2746222182905913 30101.0 51.56099769183858 0.0 - - - - - - - 829.5 60 8 PML promyelocytic leukemia 979 125 C20140605_SFK031_03 C20140605_SFK031_03 TB562134.[MT7]-ESADFWC[CAM]FEC[CAM]EQLLC[CAM]AK[MT7].3b4_1.heavy 827.709 / 547.248 17333.0 44.65820026397705 37 11 10 6 10 0.9546436493617599 69.83408595577794 0.038402557373046875 3 0.8612934780598962 3.2746222182905913 17333.0 20.89842974405208 0.0 - - - - - - - 756.1 34 10 PML promyelocytic leukemia 981 125 C20140605_SFK031_03 C20140605_SFK031_03 TB562134.[MT7]-ESADFWC[CAM]FEC[CAM]EQLLC[CAM]AK[MT7].3b5_1.heavy 827.709 / 694.316 18545.0 44.65820026397705 37 11 10 6 10 0.9546436493617599 69.83408595577794 0.038402557373046875 3 0.8612934780598962 3.2746222182905913 18545.0 39.64643691588785 0.0 - - - - - - - 811.5 37 8 PML promyelocytic leukemia 983 125 C20140605_SFK031_03 C20140605_SFK031_03 TB562134.[MT7]-ESADFWC[CAM]FEC[CAM]EQLLC[CAM]AK[MT7].3b7_1.heavy 827.709 / 1040.43 11341.0 44.65820026397705 37 11 10 6 10 0.9546436493617599 69.83408595577794 0.038402557373046875 3 0.8612934780598962 3.2746222182905913 11341.0 25.96771028037383 0.0 - - - - - - - 733.7142857142857 22 7 PML promyelocytic leukemia 985 126 C20140605_SFK031_03 C20140605_SFK031_03 TB294942.[MT7]-DILTDVVIVVSR.2y9_1.heavy 736.944 / 987.583 21399.0 49.60820007324219 48 18 10 10 10 3.5279548622915278 22.267465546186113 0.0 3 0.9811731465350889 8.980277725751886 21399.0 90.27951747989738 0.0 - - - - - - - 260.0 42 18 BCL6 B-cell CLL/lymphoma 6 987 126 C20140605_SFK031_03 C20140605_SFK031_03 TB294942.[MT7]-DILTDVVIVVSR.2y10_1.heavy 736.944 / 1100.67 10567.0 49.60820007324219 48 18 10 10 10 3.5279548622915278 22.267465546186113 0.0 3 0.9811731465350889 8.980277725751886 10567.0 22.272805429864253 1.0 - - - - - - - 264.89473684210526 21 19 BCL6 B-cell CLL/lymphoma 6 989 126 C20140605_SFK031_03 C20140605_SFK031_03 TB294942.[MT7]-DILTDVVIVVSR.2b5_1.heavy 736.944 / 702.379 7918.0 49.60820007324219 48 18 10 10 10 3.5279548622915278 22.267465546186113 0.0 3 0.9811731465350889 8.980277725751886 7918.0 15.415270034843207 0.0 - - - - - - - 662.3 15 10 BCL6 B-cell CLL/lymphoma 6 991 126 C20140605_SFK031_03 C20140605_SFK031_03 TB294942.[MT7]-DILTDVVIVVSR.2y7_1.heavy 736.944 / 771.509 7977.0 49.60820007324219 48 18 10 10 10 3.5279548622915278 22.267465546186113 0.0 3 0.9811731465350889 8.980277725751886 7977.0 47.37147462540643 0.0 - - - - - - - 233.8421052631579 15 19 BCL6 B-cell CLL/lymphoma 6 993 127 C20140605_SFK031_03 C20140605_SFK031_03 TB294949.[MT7]-TNSDIVEALNK[MT7].2y4_1.heavy 746.417 / 589.379 4853.0 31.484649658203125 43 18 10 5 10 5.061742553146173 19.75604230164651 0.041500091552734375 3 0.9812265393787071 8.993079173750008 4853.0 4.605006070482597 1.0 - - - - - - - 654.75 9 8 MEF2A;MEF2C myocyte enhancer factor 2A;myocyte enhancer factor 2C 995 127 C20140605_SFK031_03 C20140605_SFK031_03 TB294949.[MT7]-TNSDIVEALNK[MT7].2b4_1.heavy 746.417 / 562.259 7663.0 31.484649658203125 43 18 10 5 10 5.061742553146173 19.75604230164651 0.041500091552734375 3 0.9812265393787071 8.993079173750008 7663.0 19.882730182079268 0.0 - - - - - - - 276.5 15 6 MEF2A;MEF2C myocyte enhancer factor 2A;myocyte enhancer factor 2C 997 127 C20140605_SFK031_03 C20140605_SFK031_03 TB294949.[MT7]-TNSDIVEALNK[MT7].2y3_1.heavy 746.417 / 518.342 2554.0 31.484649658203125 43 18 10 5 10 5.061742553146173 19.75604230164651 0.041500091552734375 3 0.9812265393787071 8.993079173750008 2554.0 5.198018280848421 7.0 - - - - - - - 306.4 10 5 MEF2A;MEF2C myocyte enhancer factor 2A;myocyte enhancer factor 2C 999 127 C20140605_SFK031_03 C20140605_SFK031_03 TB294949.[MT7]-TNSDIVEALNK[MT7].2y6_1.heavy 746.417 / 817.49 3448.0 31.484649658203125 43 18 10 5 10 5.061742553146173 19.75604230164651 0.041500091552734375 3 0.9812265393787071 8.993079173750008 3448.0 28.831032289628183 0.0 - - - - - - - 693.4285714285714 6 7 MEF2A;MEF2C myocyte enhancer factor 2A;myocyte enhancer factor 2C 1001 128 C20140605_SFK031_03 C20140605_SFK031_03 TB295091.[MT7]-ELLNLTQQDYVNRIEELNQSLK[MT7].3y17_2.heavy 983.536 / 1111.58 23486.0 43.768798828125 44 14 10 10 10 1.642209160086287 41.12247299991632 0.0 3 0.9376628051802933 4.917070649418557 23486.0 74.47668656854577 0.0 - - - - - - - 189.33333333333334 46 15 C16orf62 chromosome 16 open reading frame 62 1003 128 C20140605_SFK031_03 C20140605_SFK031_03 TB295091.[MT7]-ELLNLTQQDYVNRIEELNQSLK[MT7].3b4_1.heavy 983.536 / 614.363 17944.0 43.768798828125 44 14 10 10 10 1.642209160086287 41.12247299991632 0.0 3 0.9376628051802933 4.917070649418557 17944.0 49.565521502382026 0.0 - - - - - - - 311.7857142857143 35 14 C16orf62 chromosome 16 open reading frame 62 1005 128 C20140605_SFK031_03 C20140605_SFK031_03 TB295091.[MT7]-ELLNLTQQDYVNRIEELNQSLK[MT7].3b3_1.heavy 983.536 / 500.32 18983.0 43.768798828125 44 14 10 10 10 1.642209160086287 41.12247299991632 0.0 3 0.9376628051802933 4.917070649418557 18983.0 53.128273532023535 0.0 - - - - - - - 264.94117647058823 37 17 C16orf62 chromosome 16 open reading frame 62 1007 128 C20140605_SFK031_03 C20140605_SFK031_03 TB295091.[MT7]-ELLNLTQQDYVNRIEELNQSLK[MT7].3y13_2.heavy 983.536 / 875.484 9976.0 43.768798828125 44 14 10 10 10 1.642209160086287 41.12247299991632 0.0 3 0.9376628051802933 4.917070649418557 9976.0 38.55418709960143 0.0 - - - - - - - 244.8 19 15 C16orf62 chromosome 16 open reading frame 62 1009 129 C20140605_SFK031_03 C20140605_SFK031_03 TB559273.[MT7]-WAQIHLVK[MT7].3y3_1.heavy 428.267 / 503.367 135078.0 33.57320022583008 47 17 10 10 10 2.8120846940421345 28.2053350232663 0.0 3 0.9702716532374256 7.139950050242851 135078.0 111.78317330294865 0.0 - - - - - - - 257.3333333333333 270 3 MAN2B1 mannosidase, alpha, class 2B, member 1 1011 129 C20140605_SFK031_03 C20140605_SFK031_03 TB559273.[MT7]-WAQIHLVK[MT7].3b4_1.heavy 428.267 / 643.368 67410.0 33.57320022583008 47 17 10 10 10 2.8120846940421345 28.2053350232663 0.0 3 0.9702716532374256 7.139950050242851 67410.0 86.37696900346033 0.0 - - - - - - - 661.7142857142857 134 7 MAN2B1 mannosidase, alpha, class 2B, member 1 1013 129 C20140605_SFK031_03 C20140605_SFK031_03 TB559273.[MT7]-WAQIHLVK[MT7].3y4_1.heavy 428.267 / 640.426 27144.0 33.57320022583008 47 17 10 10 10 2.8120846940421345 28.2053350232663 0.0 3 0.9702716532374256 7.139950050242851 27144.0 93.12913811170333 0.0 - - - - - - - 239.0 54 7 MAN2B1 mannosidase, alpha, class 2B, member 1 1015 129 C20140605_SFK031_03 C20140605_SFK031_03 TB559273.[MT7]-WAQIHLVK[MT7].3b3_1.heavy 428.267 / 530.284 119898.0 33.57320022583008 47 17 10 10 10 2.8120846940421345 28.2053350232663 0.0 3 0.9702716532374256 7.139950050242851 119898.0 165.05241378268553 0.0 - - - - - - - 283.0 239 5 MAN2B1 mannosidase, alpha, class 2B, member 1 1017 130 C20140605_SFK031_03 C20140605_SFK031_03 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 1478480.0 32.27870178222656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1478480.0 1064.3206670502648 0.0 - - - - - - - 325.5 2956 2 1019 130 C20140605_SFK031_03 C20140605_SFK031_03 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 1266230.0 32.27870178222656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1266230.0 1090.9058533456919 0.0 - - - - - - - 694.3333333333334 2532 3 1021 130 C20140605_SFK031_03 C20140605_SFK031_03 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 2492130.0 32.27870178222656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2492130.0 947.7177489112365 0.0 - - - - - - - 1042.0 4984 1 1023 131 C20140605_SFK031_03 C20140605_SFK031_03 TB556845.[MT7]-QEVAVK[MT7].2b3_1.heavy 481.3 / 501.279 8314.0 18.80305004119873 30 16 2 6 6 2.442421161068177 35.675919440127274 0.03130149841308594 6 0.9677490761549569 6.853574322343287 8314.0 13.95169526701585 0.0 - - - - - - - 1300.4444444444443 16 9 KIF13B;RNASEL kinesin family member 13B;ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1025 131 C20140605_SFK031_03 C20140605_SFK031_03 TB556845.[MT7]-QEVAVK[MT7].2y4_1.heavy 481.3 / 560.389 12816.0 18.80305004119873 30 16 2 6 6 2.442421161068177 35.675919440127274 0.03130149841308594 6 0.9677490761549569 6.853574322343287 12816.0 14.812836884489471 3.0 - - - - - - - 424.0 36 1 KIF13B;RNASEL kinesin family member 13B;ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1027 131 C20140605_SFK031_03 C20140605_SFK031_03 TB556845.[MT7]-QEVAVK[MT7].2y5_1.heavy 481.3 / 689.431 18006.0 18.80305004119873 30 16 2 6 6 2.442421161068177 35.675919440127274 0.03130149841308594 6 0.9677490761549569 6.853574322343287 18006.0 18.751214384299786 2.0 - - - - - - - 847.0 106 4 KIF13B;RNASEL kinesin family member 13B;ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1029 131 C20140605_SFK031_03 C20140605_SFK031_03 TB556845.[MT7]-QEVAVK[MT7].2b4_1.heavy 481.3 / 572.316 8844.0 18.80305004119873 30 16 2 6 6 2.442421161068177 35.675919440127274 0.03130149841308594 6 0.9677490761549569 6.853574322343287 8844.0 16.151633200420154 0.0 - - - - - - - 1235.6666666666667 17 12 KIF13B;RNASEL kinesin family member 13B;ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1031 132 C20140605_SFK031_03 C20140605_SFK031_03 TB559276.[MT7]-LGRLDAVLQR.3b6_1.heavy 428.934 / 770.464 14579.0 33.226200103759766 47 17 10 10 10 3.4088925484886032 29.3350402154321 0.0 3 0.9778393236913958 8.27495354827572 14579.0 159.35186046511626 0.0 - - - - - - - 215.0 29 6 PML promyelocytic leukemia 1033 132 C20140605_SFK031_03 C20140605_SFK031_03 TB559276.[MT7]-LGRLDAVLQR.3b5_1.heavy 428.934 / 699.427 9935.0 33.226200103759766 47 17 10 10 10 3.4088925484886032 29.3350402154321 0.0 3 0.9778393236913958 8.27495354827572 9935.0 36.967441860465115 0.0 - - - - - - - 215.0 19 9 PML promyelocytic leukemia 1035 132 C20140605_SFK031_03 C20140605_SFK031_03 TB559276.[MT7]-LGRLDAVLQR.3y4_1.heavy 428.934 / 515.33 34449.0 33.226200103759766 47 17 10 10 10 3.4088925484886032 29.3350402154321 0.0 3 0.9778393236913958 8.27495354827572 34449.0 37.38651162790698 0.0 - - - - - - - 387.0 68 1 PML promyelocytic leukemia 1037 132 C20140605_SFK031_03 C20140605_SFK031_03 TB559276.[MT7]-LGRLDAVLQR.3y5_1.heavy 428.934 / 586.367 78058.0 33.226200103759766 47 17 10 10 10 3.4088925484886032 29.3350402154321 0.0 3 0.9778393236913958 8.27495354827572 78058.0 167.00781395348838 0.0 - - - - - - - 645.0 156 7 PML promyelocytic leukemia 1039 133 C20140605_SFK031_03 C20140605_SFK031_03 TB294940.[MT7]-LPVSEGVFVVK[MT7].2y4_1.heavy 731.45 / 636.42 6803.0 39.40079879760742 43 17 10 6 10 18.655814395165564 5.3602591600564935 0.03839874267578125 3 0.9745544881035544 7.720253189859142 6803.0 13.71728073845572 0.0 - - - - - - - 1191.0 13 7 MAN2B1 mannosidase, alpha, class 2B, member 1 1041 133 C20140605_SFK031_03 C20140605_SFK031_03 TB294940.[MT7]-LPVSEGVFVVK[MT7].2b6_1.heavy 731.45 / 727.411 3061.0 39.40079879760742 43 17 10 6 10 18.655814395165564 5.3602591600564935 0.03839874267578125 3 0.9745544881035544 7.720253189859142 3061.0 2.6592135643881054 13.0 - - - - - - - 1658.5 7 8 MAN2B1 mannosidase, alpha, class 2B, member 1 1043 133 C20140605_SFK031_03 C20140605_SFK031_03 TB294940.[MT7]-LPVSEGVFVVK[MT7].2y6_1.heavy 731.45 / 792.51 4337.0 39.40079879760742 43 17 10 6 10 18.655814395165564 5.3602591600564935 0.03839874267578125 3 0.9745544881035544 7.720253189859142 4337.0 6.375799130735418 0.0 - - - - - - - 697.0 8 10 MAN2B1 mannosidase, alpha, class 2B, member 1 1045 133 C20140605_SFK031_03 C20140605_SFK031_03 TB294940.[MT7]-LPVSEGVFVVK[MT7].2y10_1.heavy 731.45 / 1204.71 15817.0 39.40079879760742 43 17 10 6 10 18.655814395165564 5.3602591600564935 0.03839874267578125 3 0.9745544881035544 7.720253189859142 15817.0 30.384701026492102 0.0 - - - - - - - 680.0 31 14 MAN2B1 mannosidase, alpha, class 2B, member 1 1047 134 C20140605_SFK031_03 C20140605_SFK031_03 TB399688.[MT7]-GAPQGSGWAGASR.2y9_1.heavy 673.34 / 848.401 3676.0 22.155500411987305 39 16 10 3 10 2.62035775786077 38.162727856534694 0.0615997314453125 3 0.9624420845804781 6.34808752790695 3676.0 0.0 0.0 - - - - - - - 201.0 7 15 SOLH small optic lobes homolog (Drosophila) 1049 134 C20140605_SFK031_03 C20140605_SFK031_03 TB399688.[MT7]-GAPQGSGWAGASR.2y10_1.heavy 673.34 / 976.459 1507.0 22.155500411987305 39 16 10 3 10 2.62035775786077 38.162727856534694 0.0615997314453125 3 0.9624420845804781 6.34808752790695 1507.0 5.752863070539419 0.0 - - - - - - - 135.5 3 16 SOLH small optic lobes homolog (Drosophila) 1051 134 C20140605_SFK031_03 C20140605_SFK031_03 TB399688.[MT7]-GAPQGSGWAGASR.2y11_1.heavy 673.34 / 1073.51 14764.0 22.155500411987305 39 16 10 3 10 2.62035775786077 38.162727856534694 0.0615997314453125 3 0.9624420845804781 6.34808752790695 14764.0 50.705754766967374 0.0 - - - - - - - 244.05 29 20 SOLH small optic lobes homolog (Drosophila) 1053 134 C20140605_SFK031_03 C20140605_SFK031_03 TB399688.[MT7]-GAPQGSGWAGASR.2y7_1.heavy 673.34 / 704.347 1507.0 22.155500411987305 39 16 10 3 10 2.62035775786077 38.162727856534694 0.0615997314453125 3 0.9624420845804781 6.34808752790695 1507.0 7.38116513419997 0.0 - - - - - - - 197.66666666666666 3 18 SOLH small optic lobes homolog (Drosophila) 1055 135 C20140605_SFK031_03 C20140605_SFK031_03 TB556523.[MT7]-HASDVLLNLNR.3b4_1.heavy 465.932 / 555.264 118701.0 31.33370018005371 45 15 10 10 10 1.9132277127062072 41.756527057559 0.0 3 0.9513535516347642 5.572631317511058 118701.0 101.83398209190557 0.0 - - - - - - - 615.0 237 4 BCL6 B-cell CLL/lymphoma 6 1057 135 C20140605_SFK031_03 C20140605_SFK031_03 TB556523.[MT7]-HASDVLLNLNR.3b5_1.heavy 465.932 / 654.333 92683.0 31.33370018005371 45 15 10 10 10 1.9132277127062072 41.756527057559 0.0 3 0.9513535516347642 5.572631317511058 92683.0 136.94788834695848 0.0 - - - - - - - 215.66666666666666 185 3 BCL6 B-cell CLL/lymphoma 6 1059 135 C20140605_SFK031_03 C20140605_SFK031_03 TB556523.[MT7]-HASDVLLNLNR.3y4_1.heavy 465.932 / 516.289 137989.0 31.33370018005371 45 15 10 10 10 1.9132277127062072 41.756527057559 0.0 3 0.9513535516347642 5.572631317511058 137989.0 107.5316529533748 0.0 - - - - - - - 518.0 275 2 BCL6 B-cell CLL/lymphoma 6 1061 135 C20140605_SFK031_03 C20140605_SFK031_03 TB556523.[MT7]-HASDVLLNLNR.3y5_1.heavy 465.932 / 629.373 102391.0 31.33370018005371 45 15 10 10 10 1.9132277127062072 41.756527057559 0.0 3 0.9513535516347642 5.572631317511058 102391.0 105.69463075658751 0.0 - - - - - - - 345.0 204 3 BCL6 B-cell CLL/lymphoma 6 1063 136 C20140605_SFK031_03 C20140605_SFK031_03 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 1467790.0 26.43199920654297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1467790.0 774.7943369741179 0.0 - - - - - - - 10733.0 2935 2 1065 136 C20140605_SFK031_03 C20140605_SFK031_03 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 1969670.0 26.43199920654297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1969670.0 2110.9432332576384 0.0 - - - - - - - 12916.0 3939 1 1067 136 C20140605_SFK031_03 C20140605_SFK031_03 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 2775540.0 26.43199920654297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2775540.0 3644.0082398144527 0.0 - - - - - - - 16373.0 5551 1 1069 137 C20140605_SFK031_03 C20140605_SFK031_03 TB561412.[MT7]-SYGIPFIETSAK[MT7].3b6_1.heavy 534.299 / 809.431 50814.0 39.37232494354248 46 20 10 6 10 7.883732846143032 12.684346609857933 0.037097930908203125 3 0.9922813043166068 14.03817542876027 50814.0 97.59514285714286 0.0 - - - - - - - 168.0 101 1 KRAS;NRAS v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 1071 137 C20140605_SFK031_03 C20140605_SFK031_03 TB561412.[MT7]-SYGIPFIETSAK[MT7].3b4_1.heavy 534.299 / 565.31 221568.0 39.37232494354248 46 20 10 6 10 7.883732846143032 12.684346609857933 0.037097930908203125 3 0.9922813043166068 14.03817542876027 221568.0 145.64091126186165 0.0 - - - - - - - 784.0 443 3 KRAS;NRAS v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 1073 137 C20140605_SFK031_03 C20140605_SFK031_03 TB561412.[MT7]-SYGIPFIETSAK[MT7].3y4_1.heavy 534.299 / 550.332 95582.0 39.37232494354248 46 20 10 6 10 7.883732846143032 12.684346609857933 0.037097930908203125 3 0.9922813043166068 14.03817542876027 95582.0 72.96239817380687 0.0 - - - - - - - 924.0 191 1 KRAS;NRAS v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 1075 137 C20140605_SFK031_03 C20140605_SFK031_03 TB561412.[MT7]-SYGIPFIETSAK[MT7].3y5_1.heavy 534.299 / 679.374 65765.0 39.37232494354248 46 20 10 6 10 7.883732846143032 12.684346609857933 0.037097930908203125 3 0.9922813043166068 14.03817542876027 65765.0 207.47291666666666 0.0 - - - - - - - 322.0 131 6 KRAS;NRAS v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 1077 138 C20140605_SFK031_03 C20140605_SFK031_03 TB560700.[MT7]-LGEVGSTLYTK[MT7].3b6_1.heavy 485.948 / 687.379 16531.0 32.19110107421875 46 16 10 10 10 3.393806040097811 29.465443463327077 0.0 3 0.9655901462292423 6.6338812109730645 16531.0 21.939134051379476 1.0 - - - - - - - 667.25 66 8 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 1079 138 C20140605_SFK031_03 C20140605_SFK031_03 TB560700.[MT7]-LGEVGSTLYTK[MT7].3y3_1.heavy 485.948 / 555.326 141621.0 32.19110107421875 46 16 10 10 10 3.393806040097811 29.465443463327077 0.0 3 0.9655901462292423 6.6338812109730645 141621.0 157.73316111823425 0.0 - - - - - - - 743.8571428571429 283 7 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 1081 138 C20140605_SFK031_03 C20140605_SFK031_03 TB560700.[MT7]-LGEVGSTLYTK[MT7].3b4_1.heavy 485.948 / 543.326 29418.0 32.19110107421875 46 16 10 10 10 3.393806040097811 29.465443463327077 0.0 3 0.9655901462292423 6.6338812109730645 29418.0 15.004252767830744 1.0 - - - - - - - 260.0 58 2 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 1083 138 C20140605_SFK031_03 C20140605_SFK031_03 TB560700.[MT7]-LGEVGSTLYTK[MT7].3b5_1.heavy 485.948 / 600.347 31630.0 32.19110107421875 46 16 10 10 10 3.393806040097811 29.465443463327077 0.0 3 0.9655901462292423 6.6338812109730645 31630.0 15.160212924312079 1.0 - - - - - - - 260.0 63 1 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 1085 139 C20140605_SFK031_03 C20140605_SFK031_03 TB558185.[MT7]-ELNLIIK[MT7].2b3_1.heavy 565.873 / 501.279 11312.0 36.811100006103516 34 14 0 10 10 1.1288346431491583 53.65570602626062 0.0 3 0.9343008683713646 4.788237183030259 11312.0 10.00712643678161 0.0 - - - - - - - 336.0 22 1 SOS1 son of sevenless homolog 1 (Drosophila) 1087 139 C20140605_SFK031_03 C20140605_SFK031_03 TB558185.[MT7]-ELNLIIK[MT7].2b4_1.heavy 565.873 / 614.363 14448.0 36.811100006103516 34 14 0 10 10 1.1288346431491583 53.65570602626062 0.0 3 0.9343008683713646 4.788237183030259 14448.0 6.955659824046921 0.0 - - - - - - - 224.0 28 1 SOS1 son of sevenless homolog 1 (Drosophila) 1089 139 C20140605_SFK031_03 C20140605_SFK031_03 TB558185.[MT7]-ELNLIIK[MT7].2y3_1.heavy 565.873 / 517.383 14000.0 36.811100006103516 34 14 0 10 10 1.1288346431491583 53.65570602626062 0.0 3 0.9343008683713646 4.788237183030259 14000.0 5.812013348164628 0.0 - - - - - - - 896.0 28 1 SOS1 son of sevenless homolog 1 (Drosophila) 1091 139 C20140605_SFK031_03 C20140605_SFK031_03 TB558185.[MT7]-ELNLIIK[MT7].2b5_1.heavy 565.873 / 727.447 9296.0 36.811100006103516 34 14 0 10 10 1.1288346431491583 53.65570602626062 0.0 3 0.9343008683713646 4.788237183030259 9296.0 12.97818181818182 1.0 - - - - - - - 1243.2 148 10 SOS1 son of sevenless homolog 1 (Drosophila) 1093 140 C20140605_SFK031_03 C20140605_SFK031_03 TB558188.[MT7]-APC[CAM]QAGDLR.2y8_1.heavy 566.289 / 916.43 120181.0 20.377899169921875 44 14 10 10 10 2.2380084815909003 44.68258311912851 0.0 3 0.9475374595294983 5.364391899522555 120181.0 555.9975088967972 0.0 - - - - - - - 260.45454545454544 240 11 SOX2 SRY (sex determining region Y)-box 2 1095 140 C20140605_SFK031_03 C20140605_SFK031_03 TB558188.[MT7]-APC[CAM]QAGDLR.2y6_1.heavy 566.289 / 659.347 5787.0 20.377899169921875 44 14 10 10 10 2.2380084815909003 44.68258311912851 0.0 3 0.9475374595294983 5.364391899522555 5787.0 22.843834595540535 0.0 - - - - - - - 296.44444444444446 11 18 SOX2 SRY (sex determining region Y)-box 2 1097 140 C20140605_SFK031_03 C20140605_SFK031_03 TB558188.[MT7]-APC[CAM]QAGDLR.2b7_1.heavy 566.289 / 844.374 68490.0 20.377899169921875 44 14 10 10 10 2.2380084815909003 44.68258311912851 0.0 3 0.9475374595294983 5.364391899522555 68490.0 137.35319915097628 0.0 - - - - - - - 624.3333333333334 136 9 SOX2 SRY (sex determining region Y)-box 2 1099 140 C20140605_SFK031_03 C20140605_SFK031_03 TB558188.[MT7]-APC[CAM]QAGDLR.2y7_1.heavy 566.289 / 819.378 5338.0 20.377899169921875 44 14 10 10 10 2.2380084815909003 44.68258311912851 0.0 3 0.9475374595294983 5.364391899522555 5338.0 37.02364191379992 0.0 - - - - - - - 168.47058823529412 10 17 SOX2 SRY (sex determining region Y)-box 2 1101 141 C20140605_SFK031_03 C20140605_SFK031_03 TB294751.[MT7]-RVIDILR.2y6_1.heavy 514.839 / 728.466 11822.0 31.077374935150146 42 20 10 2 10 5.139997184165087 19.45526357642226 0.08410072326660156 3 0.99368135535472 15.517489462826015 11822.0 15.747869351414185 0.0 - - - - - - - 1159.875 23 8 BCL3 B-cell CLL/lymphoma 3 1103 141 C20140605_SFK031_03 C20140605_SFK031_03 TB294751.[MT7]-RVIDILR.2b5_1.heavy 514.839 / 741.474 10424.0 31.077374935150146 42 20 10 2 10 5.139997184165087 19.45526357642226 0.08410072326660156 3 0.99368135535472 15.517489462826015 10424.0 18.531827024493147 0.0 - - - - - - - 381.0 20 1 BCL3 B-cell CLL/lymphoma 3 1105 141 C20140605_SFK031_03 C20140605_SFK031_03 TB294751.[MT7]-RVIDILR.2b4_1.heavy 514.839 / 628.39 60000.0 31.077374935150146 42 20 10 2 10 5.139997184165087 19.45526357642226 0.08410072326660156 3 0.99368135535472 15.517489462826015 60000.0 29.41047388025583 0.0 - - - - - - - 1334.5 120 2 BCL3 B-cell CLL/lymphoma 3 1107 141 C20140605_SFK031_03 C20140605_SFK031_03 TB294751.[MT7]-RVIDILR.2b6_1.heavy 514.839 / 854.558 9153.0 31.077374935150146 42 20 10 2 10 5.139997184165087 19.45526357642226 0.08410072326660156 3 0.99368135535472 15.517489462826015 9153.0 26.37294835851339 0.0 - - - - - - - 1144.0 18 7 BCL3 B-cell CLL/lymphoma 3 1109 142 C20140605_SFK031_03 C20140605_SFK031_03 TB294653.[MT7]-LVNAQQAK[MT7].3y6_2.heavy 387.239 / 402.228 4123.0 21.202800750732422 45 15 10 10 10 2.1920296327877833 45.619821239743835 0.0 3 0.9535470079915583 5.703741442398505 4123.0 0.1750185715801762 34.0 - - - - - - - 1472.0 41 2 MAN2B1 mannosidase, alpha, class 2B, member 1 1111 142 C20140605_SFK031_03 C20140605_SFK031_03 TB294653.[MT7]-LVNAQQAK[MT7].3y3_1.heavy 387.239 / 490.311 82218.0 21.202800750732422 45 15 10 10 10 2.1920296327877833 45.619821239743835 0.0 3 0.9535470079915583 5.703741442398505 82218.0 74.57693206221555 0.0 - - - - - - - 753.8 164 5 MAN2B1 mannosidase, alpha, class 2B, member 1 1113 142 C20140605_SFK031_03 C20140605_SFK031_03 TB294653.[MT7]-LVNAQQAK[MT7].3b4_1.heavy 387.239 / 542.342 107189.0 21.202800750732422 45 15 10 10 10 2.1920296327877833 45.619821239743835 0.0 3 0.9535470079915583 5.703741442398505 107189.0 50.530631016846414 0.0 - - - - - - - 353.0 214 1 MAN2B1 mannosidase, alpha, class 2B, member 1 1115 142 C20140605_SFK031_03 C20140605_SFK031_03 TB294653.[MT7]-LVNAQQAK[MT7].3b3_1.heavy 387.239 / 471.305 209313.0 21.202800750732422 45 15 10 10 10 2.1920296327877833 45.619821239743835 0.0 3 0.9535470079915583 5.703741442398505 209313.0 166.08827571559442 0.0 - - - - - - - 353.0 418 1 MAN2B1 mannosidase, alpha, class 2B, member 1 1117 143 C20140605_SFK031_03 C20140605_SFK031_03 TB399679.[MT7]-EVVENNLPLR.3b4_1.heavy 442.921 / 601.331 66569.0 30.65049934387207 50 20 10 10 10 7.936097657295205 12.60065139295201 0.0 3 0.994895429302825 17.266242831667643 66569.0 62.41307323311242 0.0 - - - - - - - 250.0 133 1 BCL6 B-cell CLL/lymphoma 6 1119 143 C20140605_SFK031_03 C20140605_SFK031_03 TB399679.[MT7]-EVVENNLPLR.3b5_1.heavy 442.921 / 715.374 45172.0 30.65049934387207 50 20 10 10 10 7.936097657295205 12.60065139295201 0.0 3 0.994895429302825 17.266242831667643 45172.0 12.585360234005464 1.0 - - - - - - - 661.7142857142857 95 7 BCL6 B-cell CLL/lymphoma 6 1121 143 C20140605_SFK031_03 C20140605_SFK031_03 TB399679.[MT7]-EVVENNLPLR.3y4_1.heavy 442.921 / 498.34 50553.0 30.65049934387207 50 20 10 10 10 7.936097657295205 12.60065139295201 0.0 3 0.994895429302825 17.266242831667643 50553.0 16.267056991957165 0.0 - - - - - - - 876.0 101 1 BCL6 B-cell CLL/lymphoma 6 1123 143 C20140605_SFK031_03 C20140605_SFK031_03 TB399679.[MT7]-EVVENNLPLR.3b3_1.heavy 442.921 / 472.289 114369.0 30.65049934387207 50 20 10 10 10 7.936097657295205 12.60065139295201 0.0 3 0.994895429302825 17.266242831667643 114369.0 52.61189987619483 0.0 - - - - - - - 1251.0 228 1 BCL6 B-cell CLL/lymphoma 6 1125 144 C20140605_SFK031_03 C20140605_SFK031_03 TB558595.[MT7]-DAWASDQK[MT7].2b3_1.heavy 604.811 / 517.253 9058.0 22.388150215148926 42 18 8 6 10 5.652644993568585 17.690833249527802 0.03149986267089844 3 0.9898425215792249 12.234919540683084 9058.0 8.346499627619961 0.0 - - - - - - - 792.4444444444445 18 9 C16orf62 chromosome 16 open reading frame 62 1127 144 C20140605_SFK031_03 C20140605_SFK031_03 TB558595.[MT7]-DAWASDQK[MT7].2y4_1.heavy 604.811 / 621.332 8416.0 22.388150215148926 42 18 8 6 10 5.652644993568585 17.690833249527802 0.03149986267089844 3 0.9898425215792249 12.234919540683084 8416.0 26.38462967700241 0.0 - - - - - - - 666.5 16 8 C16orf62 chromosome 16 open reading frame 62 1129 144 C20140605_SFK031_03 C20140605_SFK031_03 TB558595.[MT7]-DAWASDQK[MT7].2y5_1.heavy 604.811 / 692.37 10986.0 22.388150215148926 42 18 8 6 10 5.652644993568585 17.690833249527802 0.03149986267089844 3 0.9898425215792249 12.234919540683084 10986.0 49.200793073593076 0.0 - - - - - - - 666.25 21 8 C16orf62 chromosome 16 open reading frame 62 1131 144 C20140605_SFK031_03 C20140605_SFK031_03 TB558595.[MT7]-DAWASDQK[MT7].2b4_1.heavy 604.811 / 588.29 8030.0 22.388150215148926 42 18 8 6 10 5.652644993568585 17.690833249527802 0.03149986267089844 3 0.9898425215792249 12.234919540683084 8030.0 4.97590558118581 1.0 - - - - - - - 1807.857142857143 28 7 C16orf62 chromosome 16 open reading frame 62 1133 145 C20140605_SFK031_03 C20140605_SFK031_03 TB558594.[MT7]-ANLTWSVK[MT7].3y3_1.heavy 402.908 / 477.315 102344.0 32.23529815673828 48 18 10 10 10 3.9823025362955784 25.111100698296546 0.0 3 0.987377954548388 10.973360122891505 102344.0 105.94251822674248 0.0 - - - - - - - 312.6 204 5 MAN2B1 mannosidase, alpha, class 2B, member 1 1135 145 C20140605_SFK031_03 C20140605_SFK031_03 TB558594.[MT7]-ANLTWSVK[MT7].3b4_1.heavy 402.908 / 544.321 44401.0 32.23529815673828 48 18 10 10 10 3.9823025362955784 25.111100698296546 0.0 3 0.987377954548388 10.973360122891505 44401.0 110.41713965660682 0.0 - - - - - - - 284.0 88 11 MAN2B1 mannosidase, alpha, class 2B, member 1 1137 145 C20140605_SFK031_03 C20140605_SFK031_03 TB558594.[MT7]-ANLTWSVK[MT7].3y4_1.heavy 402.908 / 663.395 33984.0 32.23529815673828 48 18 10 10 10 3.9823025362955784 25.111100698296546 0.0 3 0.987377954548388 10.973360122891505 33984.0 143.58779388749446 0.0 - - - - - - - 182.1 67 10 MAN2B1 mannosidase, alpha, class 2B, member 1 1139 145 C20140605_SFK031_03 C20140605_SFK031_03 TB558594.[MT7]-ANLTWSVK[MT7].3b3_1.heavy 402.908 / 443.273 89193.0 32.23529815673828 48 18 10 10 10 3.9823025362955784 25.111100698296546 0.0 3 0.987377954548388 10.973360122891505 89193.0 151.38446937880963 0.0 - - - - - - - 325.5 178 2 MAN2B1 mannosidase, alpha, class 2B, member 1 1141 146 C20140605_SFK031_03 C20140605_SFK031_03 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 970343.0 37.64739990234375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 970343.0 122.40015148070331 0.0 - - - - - - - 1226.75 1940 8 1143 146 C20140605_SFK031_03 C20140605_SFK031_03 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 1889680.0 37.64739990234375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1889680.0 286.74496802865445 0.0 - - - - - - - 357.0 3779 4 1145 146 C20140605_SFK031_03 C20140605_SFK031_03 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 1969150.0 37.64739990234375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1969150.0 481.48243347897835 0.0 - - - - - - - 826.0 3938 3 1147 147 C20140605_SFK031_03 C20140605_SFK031_03 TB561292.[MT7]-LLVTAGASPMALDR.3b6_1.heavy 520.296 / 699.452 26710.0 38.2848014831543 47 17 10 10 10 3.823879419546168 26.15145223691922 0.0 3 0.9778502497123092 8.277001827724384 26710.0 48.13277718100288 0.0 - - - - - - - 741.5555555555555 53 9 BCL3 B-cell CLL/lymphoma 3 1149 147 C20140605_SFK031_03 C20140605_SFK031_03 TB561292.[MT7]-LLVTAGASPMALDR.3y6_1.heavy 520.296 / 702.36 44109.0 38.2848014831543 47 17 10 10 10 3.823879419546168 26.15145223691922 0.0 3 0.9778502497123092 8.277001827724384 44109.0 104.08107712765957 0.0 - - - - - - - 832.5714285714286 88 7 BCL3 B-cell CLL/lymphoma 3 1151 147 C20140605_SFK031_03 C20140605_SFK031_03 TB561292.[MT7]-LLVTAGASPMALDR.3b4_1.heavy 520.296 / 571.394 11380.0 38.2848014831543 47 17 10 10 10 3.823879419546168 26.15145223691922 0.0 3 0.9778502497123092 8.277001827724384 11380.0 11.913942414511574 1.0 - - - - - - - 741.5555555555555 30 9 BCL3 B-cell CLL/lymphoma 3 1153 147 C20140605_SFK031_03 C20140605_SFK031_03 TB561292.[MT7]-LLVTAGASPMALDR.3y5_1.heavy 520.296 / 605.308 22854.0 38.2848014831543 47 17 10 10 10 3.823879419546168 26.15145223691922 0.0 3 0.9778502497123092 8.277001827724384 22854.0 33.12425406886533 0.0 - - - - - - - 805.7142857142857 45 7 BCL3 B-cell CLL/lymphoma 3 1155 148 C20140605_SFK031_03 C20140605_SFK031_03 TB558196.[MT7]-IDNETQK[MT7].2y5_1.heavy 568.313 / 763.407 9930.0 17.614700317382812 47 17 10 10 10 2.7444434347805577 29.706788439303885 0.0 3 0.9766602105314856 8.062422808534793 9930.0 69.42738433441558 0.0 - - - - - - - 176.86363636363637 19 22 PML promyelocytic leukemia 1157 148 C20140605_SFK031_03 C20140605_SFK031_03 TB558196.[MT7]-IDNETQK[MT7].2b4_1.heavy 568.313 / 616.306 6245.0 17.614700317382812 47 17 10 10 10 2.7444434347805577 29.706788439303885 0.0 3 0.9766602105314856 8.062422808534793 6245.0 16.27929776354339 1.0 - - - - - - - 224.42307692307693 12 26 PML promyelocytic leukemia 1159 148 C20140605_SFK031_03 C20140605_SFK031_03 TB558196.[MT7]-IDNETQK[MT7].2y3_1.heavy 568.313 / 520.321 7985.0 17.614700317382812 47 17 10 10 10 2.7444434347805577 29.706788439303885 0.0 3 0.9766602105314856 8.062422808534793 7985.0 15.095891641023053 0.0 - - - - - - - 702.0714285714286 15 14 PML promyelocytic leukemia 1161 148 C20140605_SFK031_03 C20140605_SFK031_03 TB558196.[MT7]-IDNETQK[MT7].2y6_1.heavy 568.313 / 878.434 17045.0 17.614700317382812 47 17 10 10 10 2.7444434347805577 29.706788439303885 0.0 3 0.9766602105314856 8.062422808534793 17045.0 52.51459124186551 0.0 - - - - - - - 555.8571428571429 34 7 PML promyelocytic leukemia 1163 149 C20140605_SFK031_03 C20140605_SFK031_03 TB558194.[MT7]-IAELLC[CAM]K[MT7].2y4_1.heavy 567.843 / 677.414 17115.0 35.64590072631836 48 18 10 10 10 8.041725995353199 12.43514141837009 0.0 3 0.9836743772457038 9.645724887928912 17115.0 16.87958284459554 0.0 - - - - - - - 818.8888888888889 34 9 LOC100510476;RGPD4;RGPD1;RANBP2;RNASEL;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent);RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 1165 149 C20140605_SFK031_03 C20140605_SFK031_03 TB558194.[MT7]-IAELLC[CAM]K[MT7].2b4_1.heavy 567.843 / 571.357 21238.0 35.64590072631836 48 18 10 10 10 8.041725995353199 12.43514141837009 0.0 3 0.9836743772457038 9.645724887928912 21238.0 17.14807618219134 1.0 - - - - - - - 312.5 42 2 LOC100510476;RGPD4;RGPD1;RANBP2;RNASEL;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent);RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 1167 149 C20140605_SFK031_03 C20140605_SFK031_03 TB558194.[MT7]-IAELLC[CAM]K[MT7].2y3_1.heavy 567.843 / 564.33 29733.0 35.64590072631836 48 18 10 10 10 8.041725995353199 12.43514141837009 0.0 3 0.9836743772457038 9.645724887928912 29733.0 18.713528860204 0.0 - - - - - - - 832.6666666666666 59 3 LOC100510476;RGPD4;RGPD1;RANBP2;RNASEL;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent);RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 1169 149 C20140605_SFK031_03 C20140605_SFK031_03 TB558194.[MT7]-IAELLC[CAM]K[MT7].2y6_1.heavy 567.843 / 877.493 46098.0 35.64590072631836 48 18 10 10 10 8.041725995353199 12.43514141837009 0.0 3 0.9836743772457038 9.645724887928912 46098.0 39.66411205602802 0.0 - - - - - - - 735.7777777777778 92 9 LOC100510476;RGPD4;RGPD1;RANBP2;RNASEL;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent);RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 1171 150 C20140605_SFK031_03 C20140605_SFK031_03 TB561299.[MT7]-APASEEEFQFLR.2y5_1.heavy 784.397 / 710.398 5320.0 38.45417404174805 42 16 10 6 10 2.9129759725952815 27.37766459537137 0.03790283203125 3 0.9663594218489325 6.709738148696934 5320.0 3.173333333333334 2.0 - - - - - - - 748.125 10 8 PML promyelocytic leukemia 1173 150 C20140605_SFK031_03 C20140605_SFK031_03 TB561299.[MT7]-APASEEEFQFLR.2y9_1.heavy 784.397 / 1184.56 9499.0 38.45417404174805 42 16 10 6 10 2.9129759725952815 27.37766459537137 0.03790283203125 3 0.9663594218489325 6.709738148696934 9499.0 18.67111133603239 0.0 - - - - - - - 257.85714285714283 18 7 PML promyelocytic leukemia 1175 150 C20140605_SFK031_03 C20140605_SFK031_03 TB561299.[MT7]-APASEEEFQFLR.2y6_1.heavy 784.397 / 839.441 5415.0 38.45417404174805 42 16 10 6 10 2.9129759725952815 27.37766459537137 0.03790283203125 3 0.9663594218489325 6.709738148696934 5415.0 7.491428571428571 1.0 - - - - - - - 294.5 10 10 PML promyelocytic leukemia 1177 150 C20140605_SFK031_03 C20140605_SFK031_03 TB561299.[MT7]-APASEEEFQFLR.2y7_1.heavy 784.397 / 968.484 8644.0 38.45417404174805 42 16 10 6 10 2.9129759725952815 27.37766459537137 0.03790283203125 3 0.9663594218489325 6.709738148696934 8644.0 15.538202429149798 0.0 - - - - - - - 732.8571428571429 17 7 PML promyelocytic leukemia 1179 151 C20140605_SFK031_03 C20140605_SFK031_03 TB559426.[MT7]-QALSEVTAALR.2y8_1.heavy 651.879 / 846.468 55910.0 36.59469985961914 48 18 10 10 10 7.964567087129038 12.555610230417017 0.0 3 0.9897013493106833 12.150629528011258 55910.0 84.04320060621876 0.0 - - - - - - - 296.2 111 5 STIM1 stromal interaction molecule 1 1181 151 C20140605_SFK031_03 C20140605_SFK031_03 TB559426.[MT7]-QALSEVTAALR.2y9_1.heavy 651.879 / 959.552 41448.0 36.59469985961914 48 18 10 10 10 7.964567087129038 12.555610230417017 0.0 3 0.9897013493106833 12.150629528011258 41448.0 90.73184935599889 0.0 - - - - - - - 351.90909090909093 82 11 STIM1 stromal interaction molecule 1 1183 151 C20140605_SFK031_03 C20140605_SFK031_03 TB559426.[MT7]-QALSEVTAALR.2y10_1.heavy 651.879 / 1030.59 105329.0 36.59469985961914 48 18 10 10 10 7.964567087129038 12.555610230417017 0.0 3 0.9897013493106833 12.150629528011258 105329.0 109.97454132730147 1.0 - - - - - - - 748.1428571428571 210 7 STIM1 stromal interaction molecule 1 1185 151 C20140605_SFK031_03 C20140605_SFK031_03 TB559426.[MT7]-QALSEVTAALR.2b5_1.heavy 651.879 / 673.364 19586.0 36.59469985961914 48 18 10 10 10 7.964567087129038 12.555610230417017 0.0 3 0.9897013493106833 12.150629528011258 19586.0 13.756984871142857 0.0 - - - - - - - 2716.714285714286 39 7 STIM1 stromal interaction molecule 1 1187 152 C20140605_SFK031_03 C20140605_SFK031_03 TB560991.[MT7]-GNC[CAM]NRGENDC[CAM]R.3b9_2.heavy 499.213 / 581.245 N/A N/A - - - - - - - - - 0.0 - - - - - - - MBNL1 muscleblind-like (Drosophila) 1189 152 C20140605_SFK031_03 C20140605_SFK031_03 TB560991.[MT7]-GNC[CAM]NRGENDC[CAM]R.3y6_1.heavy 499.213 / 750.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - MBNL1 muscleblind-like (Drosophila) 1191 152 C20140605_SFK031_03 C20140605_SFK031_03 TB560991.[MT7]-GNC[CAM]NRGENDC[CAM]R.3y4_1.heavy 499.213 / 564.219 N/A N/A - - - - - - - - - 0.0 - - - - - - - MBNL1 muscleblind-like (Drosophila) 1193 152 C20140605_SFK031_03 C20140605_SFK031_03 TB560991.[MT7]-GNC[CAM]NRGENDC[CAM]R.3b8_2.heavy 499.213 / 523.731 N/A N/A - - - - - - - - - 0.0 - - - - - - - MBNL1 muscleblind-like (Drosophila) 1195 153 C20140605_SFK031_03 C20140605_SFK031_03 TB399573.[MT7]-QQEGFK[MT7].2b3_1.heavy 512.787 / 530.269 2959.0 19.08780002593994 34 16 4 6 8 1.8687872149191016 37.27485218143908 0.03259849548339844 4 0.9678049660564109 6.85955290403103 2959.0 3.011604004151461 0.0 - - - - - - - 686.8 5 10 NONO;PSPC1 non-POU domain containing, octamer-binding;paraspeckle component 1 1197 153 C20140605_SFK031_03 C20140605_SFK031_03 TB399573.[MT7]-QQEGFK[MT7].2y4_1.heavy 512.787 / 624.347 4544.0 19.08780002593994 34 16 4 6 8 1.8687872149191016 37.27485218143908 0.03259849548339844 4 0.9678049660564109 6.85955290403103 4544.0 2.6253054658338253 0.0 - - - - - - - 777.4285714285714 9 7 NONO;PSPC1 non-POU domain containing, octamer-binding;paraspeckle component 1 1199 153 C20140605_SFK031_03 C20140605_SFK031_03 TB399573.[MT7]-QQEGFK[MT7].2y5_1.heavy 512.787 / 752.406 4967.0 19.08780002593994 34 16 4 6 8 1.8687872149191016 37.27485218143908 0.03259849548339844 4 0.9678049660564109 6.85955290403103 4967.0 4.920164793087927 2.0 - - - - - - - 251.125 18 8 NONO;PSPC1 non-POU domain containing, octamer-binding;paraspeckle component 1 1201 153 C20140605_SFK031_03 C20140605_SFK031_03 TB399573.[MT7]-QQEGFK[MT7].2b5_1.heavy 512.787 / 734.359 2219.0 19.08780002593994 34 16 4 6 8 1.8687872149191016 37.27485218143908 0.03259849548339844 4 0.9678049660564109 6.85955290403103 2219.0 7.0 4.0 - - - - - - - 385.14285714285717 8 7 NONO;PSPC1 non-POU domain containing, octamer-binding;paraspeckle component 1 1203 154 C20140605_SFK031_03 C20140605_SFK031_03 TB562052.[MT7]-GANTLTSFSIQAILNK[MT7]K[MT7].4y5_1.heavy 560.335 / 903.623 12675.0 42.2963981628418 46 16 10 10 10 1.8655845945148428 36.16558399031116 0.0 3 0.961579556746337 6.275969189167667 12675.0 30.032895716252927 0.0 - - - - - - - 273.05882352941177 25 17 NKX3-2 NK3 homeobox 2 1205 154 C20140605_SFK031_03 C20140605_SFK031_03 TB562052.[MT7]-GANTLTSFSIQAILNK[MT7]K[MT7].4y4_1.heavy 560.335 / 790.539 26181.0 42.2963981628418 46 16 10 10 10 1.8655845945148428 36.16558399031116 0.0 3 0.961579556746337 6.275969189167667 26181.0 76.7390120452652 0.0 - - - - - - - 698.9090909090909 52 11 NKX3-2 NK3 homeobox 2 1207 154 C20140605_SFK031_03 C20140605_SFK031_03 TB562052.[MT7]-GANTLTSFSIQAILNK[MT7]K[MT7].4b5_1.heavy 560.335 / 601.343 29644.0 42.2963981628418 46 16 10 10 10 1.8655845945148428 36.16558399031116 0.0 3 0.961579556746337 6.275969189167667 29644.0 40.491922197004236 0.0 - - - - - - - 1200.3333333333333 59 9 NKX3-2 NK3 homeobox 2 1209 154 C20140605_SFK031_03 C20140605_SFK031_03 TB562052.[MT7]-GANTLTSFSIQAILNK[MT7]K[MT7].4y3_1.heavy 560.335 / 677.455 20778.0 42.2963981628418 46 16 10 10 10 1.8655845945148428 36.16558399031116 0.0 3 0.961579556746337 6.275969189167667 20778.0 26.93216512402814 0.0 - - - - - - - 786.7142857142857 41 14 NKX3-2 NK3 homeobox 2 1211 155 C20140605_SFK031_03 C20140605_SFK031_03 TB294666.[MT7]-FATLPR.2b3_1.heavy 424.759 / 464.263 24795.0 28.964750289916992 37 18 9 6 4 7.960200900350964 12.562497008786679 0.038700103759765625 7 0.9870919912023872 10.850867929128533 24795.0 15.907744109924337 2.0 - - - - - - - 1677.5714285714287 66 7 RAB11FIP2;EXOC1 RAB11 family interacting protein 2 (class I);exocyst complex component 1 1213 155 C20140605_SFK031_03 C20140605_SFK031_03 TB294666.[MT7]-FATLPR.2y4_1.heavy 424.759 / 486.303 28057.0 28.964750289916992 37 18 9 6 4 7.960200900350964 12.562497008786679 0.038700103759765625 7 0.9870919912023872 10.850867929128533 28057.0 24.208999078504544 2.0 - - - - - - - 217.0 67 1 RAB11FIP2;EXOC1 RAB11 family interacting protein 2 (class I);exocyst complex component 1 1215 155 C20140605_SFK031_03 C20140605_SFK031_03 TB294666.[MT7]-FATLPR.2y5_1.heavy 424.759 / 557.341 120277.0 28.964750289916992 37 18 9 6 4 7.960200900350964 12.562497008786679 0.038700103759765625 7 0.9870919912023872 10.850867929128533 120277.0 75.19967171292919 1.0 - - - - - - - 326.0 286 1 RAB11FIP2;EXOC1 RAB11 family interacting protein 2 (class I);exocyst complex component 1 1217 155 C20140605_SFK031_03 C20140605_SFK031_03 TB294666.[MT7]-FATLPR.2b4_1.heavy 424.759 / 577.347 21750.0 28.964750289916992 37 18 9 6 4 7.960200900350964 12.562497008786679 0.038700103759765625 7 0.9870919912023872 10.850867929128533 21750.0 21.599177900681795 1.0 - - - - - - - 217.0 45 1 RAB11FIP2;EXOC1 RAB11 family interacting protein 2 (class I);exocyst complex component 1 1219 156 C20140605_SFK031_03 C20140605_SFK031_03 TB561988.[MT7]-TRLEELDDFEEGSQK[MT7].4b8_1.heavy 521.765 / 1116.57 N/A 31.84269905090332 41 15 10 10 6 2.055992231241668 48.6383160794374 0.0 6 0.9535311466313244 5.70276025256399 0.0 0.0 3.0 - - - - - - - 0.0 0 0 C16orf62 chromosome 16 open reading frame 62 1221 156 C20140605_SFK031_03 C20140605_SFK031_03 TB561988.[MT7]-TRLEELDDFEEGSQK[MT7].4b8_2.heavy 521.765 / 558.786 48364.0 31.84269905090332 41 15 10 10 6 2.055992231241668 48.6383160794374 0.0 6 0.9535311466313244 5.70276025256399 48364.0 2.4647776735934217 0.0 - - - - - - - 2738.0 96 1 C16orf62 chromosome 16 open reading frame 62 1223 156 C20140605_SFK031_03 C20140605_SFK031_03 TB561988.[MT7]-TRLEELDDFEEGSQK[MT7].4b7_2.heavy 521.765 / 501.273 12515.0 31.84269905090332 41 15 10 10 6 2.055992231241668 48.6383160794374 0.0 6 0.9535311466313244 5.70276025256399 12515.0 2.4960386629508715 3.0 - - - - - - - 2738.0 27 2 C16orf62 chromosome 16 open reading frame 62 1225 156 C20140605_SFK031_03 C20140605_SFK031_03 TB561988.[MT7]-TRLEELDDFEEGSQK[MT7].4b5_1.heavy 521.765 / 773.427 4041.0 31.84269905090332 41 15 10 10 6 2.055992231241668 48.6383160794374 0.0 6 0.9535311466313244 5.70276025256399 4041.0 6.133406627651725 2.0 - - - - - - - 670.4285714285714 14 7 C16orf62 chromosome 16 open reading frame 62 1227 157 C20140605_SFK031_03 C20140605_SFK031_03 TB561699.[MT7]-ASPNLIGATGANSLGK[MT7].3y7_1.heavy 587.003 / 790.454 23189.0 31.376300811767578 47 17 10 10 10 2.7774944483979986 31.36259720577508 0.0 3 0.9778144857659897 8.270302855573453 23189.0 13.474390109045796 0.0 - - - - - - - 607.6666666666666 46 3 MEF2A myocyte enhancer factor 2A 1229 157 C20140605_SFK031_03 C20140605_SFK031_03 TB561699.[MT7]-ASPNLIGATGANSLGK[MT7].3b4_1.heavy 587.003 / 514.274 73215.0 31.376300811767578 47 17 10 10 10 2.7774944483979986 31.36259720577508 0.0 3 0.9778144857659897 8.270302855573453 73215.0 7.8883841612179895 0.0 - - - - - - - 130.0 146 1 MEF2A myocyte enhancer factor 2A 1231 157 C20140605_SFK031_03 C20140605_SFK031_03 TB561699.[MT7]-ASPNLIGATGANSLGK[MT7].3b5_1.heavy 587.003 / 627.358 93408.0 31.376300811767578 47 17 10 10 10 2.7774944483979986 31.36259720577508 0.0 3 0.9778144857659897 8.270302855573453 93408.0 15.906358596999961 0.0 - - - - - - - 912.0 186 3 MEF2A myocyte enhancer factor 2A 1233 157 C20140605_SFK031_03 C20140605_SFK031_03 TB561699.[MT7]-ASPNLIGATGANSLGK[MT7].3y4_1.heavy 587.003 / 548.352 34263.0 31.376300811767578 47 17 10 10 10 2.7774944483979986 31.36259720577508 0.0 3 0.9778144857659897 8.270302855573453 34263.0 6.19937694575725 0.0 - - - - - - - 607.6666666666666 68 3 MEF2A myocyte enhancer factor 2A 1235 158 C20140605_SFK031_03 C20140605_SFK031_03 TB560579.[MT7]-IVDIHELSVK[MT7].3b4_1.heavy 480.96 / 585.373 47063.0 33.774600982666016 50 20 10 10 10 8.009283063474557 12.48551202492004 0.0 3 0.9906745729080615 12.769971478765171 47063.0 36.54594576833585 0.0 - - - - - - - 769.375 94 8 SOS1 son of sevenless homolog 1 (Drosophila) 1237 158 C20140605_SFK031_03 C20140605_SFK031_03 TB560579.[MT7]-IVDIHELSVK[MT7].3b3_1.heavy 480.96 / 472.289 115927.0 33.774600982666016 50 20 10 10 10 8.009283063474557 12.48551202492004 0.0 3 0.9906745729080615 12.769971478765171 115927.0 57.69398428921437 0.0 - - - - - - - 1282.0 231 1 SOS1 son of sevenless homolog 1 (Drosophila) 1239 158 C20140605_SFK031_03 C20140605_SFK031_03 TB560579.[MT7]-IVDIHELSVK[MT7].3y4_1.heavy 480.96 / 590.399 41293.0 33.774600982666016 50 20 10 10 10 8.009283063474557 12.48551202492004 0.0 3 0.9906745729080615 12.769971478765171 41293.0 54.774979449393754 0.0 - - - - - - - 385.0 82 1 SOS1 son of sevenless homolog 1 (Drosophila) 1241 158 C20140605_SFK031_03 C20140605_SFK031_03 TB560579.[MT7]-IVDIHELSVK[MT7].3y5_1.heavy 480.96 / 719.442 30136.0 33.774600982666016 50 20 10 10 10 8.009283063474557 12.48551202492004 0.0 3 0.9906745729080615 12.769971478765171 30136.0 43.92783359555383 0.0 - - - - - - - 213.33333333333334 60 3 SOS1 son of sevenless homolog 1 (Drosophila) 1243 159 C20140605_SFK031_03 C20140605_SFK031_03 TB561181.[MT7]-LQETTLVANQLR.2b3_1.heavy 765.442 / 515.295 21529.0 33.673500061035156 48 18 10 10 10 10.191412251244275 9.812182800061978 0.0 3 0.9894928719064718 12.02927230512443 21529.0 31.361750055071163 0.0 - - - - - - - 714.1428571428571 43 7 MAN2B1 mannosidase, alpha, class 2B, member 1 1245 159 C20140605_SFK031_03 C20140605_SFK031_03 TB561181.[MT7]-LQETTLVANQLR.2y8_1.heavy 765.442 / 914.542 13456.0 33.673500061035156 48 18 10 10 10 10.191412251244275 9.812182800061978 0.0 3 0.9894928719064718 12.02927230512443 13456.0 48.78783625730994 0.0 - - - - - - - 292.57142857142856 26 7 MAN2B1 mannosidase, alpha, class 2B, member 1 1247 159 C20140605_SFK031_03 C20140605_SFK031_03 TB561181.[MT7]-LQETTLVANQLR.2y9_1.heavy 765.442 / 1015.59 31140.0 33.673500061035156 48 18 10 10 10 10.191412251244275 9.812182800061978 0.0 3 0.9894928719064718 12.02927230512443 31140.0 82.75841510643521 0.0 - - - - - - - 204.8 62 5 MAN2B1 mannosidase, alpha, class 2B, member 1 1249 159 C20140605_SFK031_03 C20140605_SFK031_03 TB561181.[MT7]-LQETTLVANQLR.2y10_1.heavy 765.442 / 1144.63 24733.0 33.673500061035156 48 18 10 10 10 10.191412251244275 9.812182800061978 0.0 3 0.9894928719064718 12.02927230512443 24733.0 72.32924347617178 0.0 - - - - - - - 256.0 49 8 MAN2B1 mannosidase, alpha, class 2B, member 1 1251 160 C20140605_SFK031_03 C20140605_SFK031_03 TB561435.[MT7]-DVK[MT7]PENILIK[MT7].3b6_1.heavy 534.338 / 971.54 18012.0 30.39229965209961 43 13 10 10 10 1.099376780864683 58.98489855178225 0.0 3 0.912648141690082 4.144890327524019 18012.0 89.58349206349206 0.0 - - - - - - - 252.0 36 10 RAGE renal tumor antigen 1253 160 C20140605_SFK031_03 C20140605_SFK031_03 TB561435.[MT7]-DVK[MT7]PENILIK[MT7].3y3_1.heavy 534.338 / 517.383 90814.0 30.39229965209961 43 13 10 10 10 1.099376780864683 58.98489855178225 0.0 3 0.912648141690082 4.144890327524019 90814.0 10.082180600708947 0.0 - - - - - - - 2771.0 181 1 RAGE renal tumor antigen 1255 160 C20140605_SFK031_03 C20140605_SFK031_03 TB561435.[MT7]-DVK[MT7]PENILIK[MT7].3b3_1.heavy 534.338 / 631.402 25821.0 30.39229965209961 43 13 10 10 10 1.099376780864683 58.98489855178225 0.0 3 0.912648141690082 4.144890327524019 25821.0 12.983102877935824 0.0 - - - - - - - 252.0 51 3 RAGE renal tumor antigen 1257 160 C20140605_SFK031_03 C20140605_SFK031_03 TB561435.[MT7]-DVK[MT7]PENILIK[MT7].3b7_2.heavy 534.338 / 542.816 70913.0 30.39229965209961 43 13 10 10 10 1.099376780864683 58.98489855178225 0.0 3 0.912648141690082 4.144890327524019 70913.0 129.39852499894957 0.0 - - - - - - - 378.0 141 3 RAGE renal tumor antigen 1259 161 C20140605_SFK031_03 C20140605_SFK031_03 TB556910.[MT7]-LSFEAVR.2y4_1.heavy 483.28 / 474.267 73284.0 32.569400787353516 50 20 10 10 10 6.317955937934553 15.827903990209167 0.0 3 0.9918503393688461 13.66146330509573 73284.0 17.032910514182767 0.0 - - - - - - - 3124.0 146 1 STIM1 stromal interaction molecule 1 1261 161 C20140605_SFK031_03 C20140605_SFK031_03 TB556910.[MT7]-LSFEAVR.2b3_1.heavy 483.28 / 492.294 24211.0 32.569400787353516 50 20 10 10 10 6.317955937934553 15.827903990209167 0.0 3 0.9918503393688461 13.66146330509573 24211.0 19.577866813025977 1.0 - - - - - - - 303.3333333333333 48 3 STIM1 stromal interaction molecule 1 1263 161 C20140605_SFK031_03 C20140605_SFK031_03 TB556910.[MT7]-LSFEAVR.2y6_1.heavy 483.28 / 708.367 271137.0 32.569400787353516 50 20 10 10 10 6.317955937934553 15.827903990209167 0.0 3 0.9918503393688461 13.66146330509573 271137.0 239.9758955666978 0.0 - - - - - - - 260.0 542 3 STIM1 stromal interaction molecule 1 1265 161 C20140605_SFK031_03 C20140605_SFK031_03 TB556910.[MT7]-LSFEAVR.2b5_1.heavy 483.28 / 692.374 96974.0 32.569400787353516 50 20 10 10 10 6.317955937934553 15.827903990209167 0.0 3 0.9918503393688461 13.66146330509573 96974.0 155.0816971452149 0.0 - - - - - - - 260.0 193 4 STIM1 stromal interaction molecule 1 1267 162 C20140605_SFK031_03 C20140605_SFK031_03 TB294901.[MT7]-ATIDC[CAM]AGILK[MT7].2y4_1.heavy 675.389 / 574.404 12422.0 31.162599563598633 45 15 10 10 10 8.282169803078249 12.074130617659256 0.0 3 0.9587893722450037 6.058357457945539 12422.0 16.194835714601716 0.0 - - - - - - - 251.0 24 2 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1269 162 C20140605_SFK031_03 C20140605_SFK031_03 TB294901.[MT7]-ATIDC[CAM]AGILK[MT7].2b4_1.heavy 675.389 / 545.305 27605.0 31.162599563598633 45 15 10 10 10 8.282169803078249 12.074130617659256 0.0 3 0.9587893722450037 6.058357457945539 27605.0 30.51947211155378 0.0 - - - - - - - 250.6 55 5 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1271 162 C20140605_SFK031_03 C20140605_SFK031_03 TB294901.[MT7]-ATIDC[CAM]AGILK[MT7].2y6_1.heavy 675.389 / 805.472 15434.0 31.162599563598633 45 15 10 10 10 8.282169803078249 12.074130617659256 0.0 3 0.9587893722450037 6.058357457945539 15434.0 32.26936846908317 1.0 - - - - - - - 663.0 30 7 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1273 162 C20140605_SFK031_03 C20140605_SFK031_03 TB294901.[MT7]-ATIDC[CAM]AGILK[MT7].2b7_1.heavy 675.389 / 833.394 6901.0 31.162599563598633 45 15 10 10 10 8.282169803078249 12.074130617659256 0.0 3 0.9587893722450037 6.058357457945539 6901.0 14.303908449138058 0.0 - - - - - - - 663.0 13 7 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1275 163 C20140605_SFK031_03 C20140605_SFK031_03 TB560476.[MT7]-GAAGLVVPLDPLR.2y8_1.heavy 711.433 / 908.556 26171.0 41.95855140686035 46 20 10 6 10 10.90577880257565 9.16945060139884 0.03099822998046875 3 0.993378849067272 15.158481809554184 26171.0 69.66951145155787 0.0 - - - - - - - 750.0833333333334 52 12 BCL3 B-cell CLL/lymphoma 3 1277 163 C20140605_SFK031_03 C20140605_SFK031_03 TB560476.[MT7]-GAAGLVVPLDPLR.2y6_1.heavy 711.433 / 710.42 45921.0 41.95855140686035 46 20 10 6 10 10.90577880257565 9.16945060139884 0.03099822998046875 3 0.993378849067272 15.158481809554184 45921.0 77.56968146022302 0.0 - - - - - - - 1286.2857142857142 91 7 BCL3 B-cell CLL/lymphoma 3 1279 163 C20140605_SFK031_03 C20140605_SFK031_03 TB560476.[MT7]-GAAGLVVPLDPLR.2y10_1.heavy 711.433 / 1078.66 26101.0 41.95855140686035 46 20 10 6 10 10.90577880257565 9.16945060139884 0.03099822998046875 3 0.993378849067272 15.158481809554184 26101.0 77.30550955414013 0.0 - - - - - - - 783.0 52 9 BCL3 B-cell CLL/lymphoma 3 1281 163 C20140605_SFK031_03 C20140605_SFK031_03 TB560476.[MT7]-GAAGLVVPLDPLR.2b5_1.heavy 711.433 / 514.311 62949.0 41.95855140686035 46 20 10 6 10 10.90577880257565 9.16945060139884 0.03099822998046875 3 0.993378849067272 15.158481809554184 62949.0 71.91752930678254 0.0 - - - - - - - 807.4285714285714 125 7 BCL3 B-cell CLL/lymphoma 3 1283 164 C20140605_SFK031_03 C20140605_SFK031_03 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 1293600.0 40.67190170288086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1293600.0 204.2926893325581 0.0 - - - - - - - 840.5 2587 2 1285 164 C20140605_SFK031_03 C20140605_SFK031_03 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 1623750.0 40.67190170288086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1623750.0 179.3185863794909 0.0 - - - - - - - 1206.5 3247 2 1287 164 C20140605_SFK031_03 C20140605_SFK031_03 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 2306640.0 40.67190170288086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2306640.0 226.30169842122407 0.0 - - - - - - - 1901.0 4613 2 1289 165 C20140605_SFK031_03 C20140605_SFK031_03 TB556912.[MT7]-TGSALVQR.2y4_1.heavy 488.289 / 515.33 5575.0 20.037500381469727 48 20 10 10 8 13.150649214507393 7.604187319488613 0.0 4 0.9954772027442604 18.344039985654003 5575.0 4.650726266652113 2.0 - - - - - - - 753.1111111111111 19 9 PML promyelocytic leukemia 1291 165 C20140605_SFK031_03 C20140605_SFK031_03 TB556912.[MT7]-TGSALVQR.2y5_1.heavy 488.289 / 586.367 6996.0 20.037500381469727 48 20 10 10 8 13.150649214507393 7.604187319488613 0.0 4 0.9954772027442604 18.344039985654003 6996.0 9.199968627450978 0.0 - - - - - - - 1209.5 13 8 PML promyelocytic leukemia 1293 165 C20140605_SFK031_03 C20140605_SFK031_03 TB556912.[MT7]-TGSALVQR.2b5_1.heavy 488.289 / 574.332 21863.0 20.037500381469727 48 20 10 10 8 13.150649214507393 7.604187319488613 0.0 4 0.9954772027442604 18.344039985654003 21863.0 15.816819511383736 1.0 - - - - - - - 1214.6666666666667 80 9 PML promyelocytic leukemia 1295 165 C20140605_SFK031_03 C20140605_SFK031_03 TB556912.[MT7]-TGSALVQR.2y7_1.heavy 488.289 / 730.421 41267.0 20.037500381469727 48 20 10 10 8 13.150649214507393 7.604187319488613 0.0 4 0.9954772027442604 18.344039985654003 41267.0 121.73409516957227 0.0 - - - - - - - 792.625 82 8 PML promyelocytic leukemia 1297 166 C20140605_SFK031_03 C20140605_SFK031_03 TB294873.[MT7]-GADIDAVDIK[MT7].2b8_1.heavy 652.869 / 901.438 48465.0 29.632999420166016 40 10 10 10 10 1.013854829328984 64.23087098031266 0.0 3 0.8370821870740597 3.015070196371344 48465.0 68.1803036140708 0.0 - - - - - - - 315.9230769230769 96 13 BCL3 B-cell CLL/lymphoma 3 1299 166 C20140605_SFK031_03 C20140605_SFK031_03 TB294873.[MT7]-GADIDAVDIK[MT7].2b4_1.heavy 652.869 / 501.279 15637.0 29.632999420166016 40 10 10 10 10 1.013854829328984 64.23087098031266 0.0 3 0.8370821870740597 3.015070196371344 15637.0 4.348211016349559 1.0 - - - - - - - 813.1666666666666 38 12 BCL3 B-cell CLL/lymphoma 3 1301 166 C20140605_SFK031_03 C20140605_SFK031_03 TB294873.[MT7]-GADIDAVDIK[MT7].2b6_1.heavy 652.869 / 687.343 11423.0 29.632999420166016 40 10 10 10 10 1.013854829328984 64.23087098031266 0.0 3 0.8370821870740597 3.015070196371344 11423.0 13.649285428534156 0.0 - - - - - - - 653.2222222222222 22 9 BCL3 B-cell CLL/lymphoma 3 1303 166 C20140605_SFK031_03 C20140605_SFK031_03 TB294873.[MT7]-GADIDAVDIK[MT7].2b5_1.heavy 652.869 / 616.306 27393.0 29.632999420166016 40 10 10 10 10 1.013854829328984 64.23087098031266 0.0 3 0.8370821870740597 3.015070196371344 27393.0 35.57358294916942 0.0 - - - - - - - 1695.4285714285713 54 7 BCL3 B-cell CLL/lymphoma 3 1305 167 C20140605_SFK031_03 C20140605_SFK031_03 TB561827.[MT7]-AAAAAAAAAAAAAAAGAGAGAK[MT7].3y7_1.heavy 629.021 / 675.391 76497.0 36.72370147705078 38 8 10 10 10 0.6329486565496295 95.46210017774004 0.0 3 0.7642843933570392 2.490248834914423 76497.0 116.34311893009257 0.0 - - - - - - - 271.5 152 2 SLC12A2 solute carrier family 12 (sodium/potassium/chloride transporters), member 2 1307 167 C20140605_SFK031_03 C20140605_SFK031_03 TB561827.[MT7]-AAAAAAAAAAAAAAAGAGAGAK[MT7].3b6_1.heavy 629.021 / 571.332 19640.0 36.72370147705078 38 8 10 10 10 0.6329486565496295 95.46210017774004 0.0 3 0.7642843933570392 2.490248834914423 19640.0 3.524614431527376 1.0 - - - - - - - 760.0 44 2 SLC12A2 solute carrier family 12 (sodium/potassium/chloride transporters), member 2 1309 167 C20140605_SFK031_03 C20140605_SFK031_03 TB561827.[MT7]-AAAAAAAAAAAAAAAGAGAGAK[MT7].3b5_1.heavy 629.021 / 500.295 19314.0 36.72370147705078 38 8 10 10 10 0.6329486565496295 95.46210017774004 0.0 3 0.7642843933570392 2.490248834914423 19314.0 5.969070335229928 1.0 - - - - - - - 1302.0 38 1 SLC12A2 solute carrier family 12 (sodium/potassium/chloride transporters), member 2 1311 167 C20140605_SFK031_03 C20140605_SFK031_03 TB561827.[MT7]-AAAAAAAAAAAAAAAGAGAGAK[MT7].3b7_1.heavy 629.021 / 642.369 35156.0 36.72370147705078 38 8 10 10 10 0.6329486565496295 95.46210017774004 0.0 3 0.7642843933570392 2.490248834914423 35156.0 22.33412771560237 0.0 - - - - - - - 868.0 70 1 SLC12A2 solute carrier family 12 (sodium/potassium/chloride transporters), member 2 1313 168 C20140605_SFK031_03 C20140605_SFK031_03 TB560470.[MT7]-SYTQFSNLC[CAM]R.3b4_1.heavy 473.898 / 624.311 10819.0 30.009599685668945 46 18 8 10 10 6.3084090235196815 15.851857358514543 0.0 3 0.9868472633228952 10.749224705192358 10819.0 8.787882317061417 0.0 - - - - - - - 240.0 21 1 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 1315 168 C20140605_SFK031_03 C20140605_SFK031_03 TB560470.[MT7]-SYTQFSNLC[CAM]R.3y4_1.heavy 473.898 / 562.277 13464.0 30.009599685668945 46 18 8 10 10 6.3084090235196815 15.851857358514543 0.0 3 0.9868472633228952 10.749224705192358 13464.0 19.14698940998487 1.0 - - - - - - - 312.4 26 5 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 1317 168 C20140605_SFK031_03 C20140605_SFK031_03 TB560470.[MT7]-SYTQFSNLC[CAM]R.3y8_2.heavy 473.898 / 513.245 7333.0 30.009599685668945 46 18 8 10 10 6.3084090235196815 15.851857358514543 0.0 3 0.9868472633228952 10.749224705192358 7333.0 8.709054808958312 1.0 - - - - - - - 421.0 43 2 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 1319 168 C20140605_SFK031_03 C20140605_SFK031_03 TB560470.[MT7]-SYTQFSNLC[CAM]R.3y5_1.heavy 473.898 / 649.309 16590.0 30.009599685668945 46 18 8 10 10 6.3084090235196815 15.851857358514543 0.0 3 0.9868472633228952 10.749224705192358 16590.0 14.93896791114362 0.0 - - - - - - - 300.5 33 4 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 1321 169 C20140605_SFK031_03 C20140605_SFK031_03 TB399880.[MT7]-SLGLNLALADPPESDRLQILNEAWK[MT7].4y15_2.heavy 763.673 / 970.521 55253.0 45.553725242614746 28 7 10 3 8 0.8397922377475749 76.30422872457811 0.07709884643554688 4 0.7336593949887303 2.336124258650481 55253.0 63.58568915436169 0.0 - - - - - - - 804.2 110 5 C16orf62 chromosome 16 open reading frame 62 1323 169 C20140605_SFK031_03 C20140605_SFK031_03 TB399880.[MT7]-SLGLNLALADPPESDRLQILNEAWK[MT7].4b4_1.heavy 763.673 / 515.331 5858.0 45.553725242614746 28 7 10 3 8 0.8397922377475749 76.30422872457811 0.07709884643554688 4 0.7336593949887303 2.336124258650481 5858.0 4.394412532637076 1.0 - - - - - - - 1299.5 11 8 C16orf62 chromosome 16 open reading frame 62 1325 169 C20140605_SFK031_03 C20140605_SFK031_03 TB399880.[MT7]-SLGLNLALADPPESDRLQILNEAWK[MT7].4b5_1.heavy 763.673 / 629.374 25559.0 45.553725242614746 28 7 10 3 8 0.8397922377475749 76.30422872457811 0.07709884643554688 4 0.7336593949887303 2.336124258650481 25559.0 50.91240716855387 0.0 - - - - - - - 775.2 51 10 C16orf62 chromosome 16 open reading frame 62 1327 169 C20140605_SFK031_03 C20140605_SFK031_03 TB399880.[MT7]-SLGLNLALADPPESDRLQILNEAWK[MT7].4b6_1.heavy 763.673 / 742.458 11200.0 45.553725242614746 28 7 10 3 8 0.8397922377475749 76.30422872457811 0.07709884643554688 4 0.7336593949887303 2.336124258650481 11200.0 17.189873417721518 1.0 - - - - - - - 890.125 23 8 C16orf62 chromosome 16 open reading frame 62 1329 170 C20140605_SFK031_03 C20140605_SFK031_03 TB560961.[MT7]-EVNTVLADVIK[MT7].3y3_1.heavy 496.967 / 503.367 21414.0 39.6796989440918 48 18 10 10 10 5.799222881183495 17.243689723405176 0.0 3 0.9881137417600118 11.308595513751039 21414.0 27.323649045644547 0.0 - - - - - - - 825.6666666666666 42 9 C16orf62 chromosome 16 open reading frame 62 1331 170 C20140605_SFK031_03 C20140605_SFK031_03 TB560961.[MT7]-EVNTVLADVIK[MT7].3b4_1.heavy 496.967 / 588.311 33240.0 39.6796989440918 48 18 10 10 10 5.799222881183495 17.243689723405176 0.0 3 0.9881137417600118 11.308595513751039 33240.0 74.6147770036778 0.0 - - - - - - - 733.5454545454545 66 11 C16orf62 chromosome 16 open reading frame 62 1333 170 C20140605_SFK031_03 C20140605_SFK031_03 TB560961.[MT7]-EVNTVLADVIK[MT7].3b5_1.heavy 496.967 / 687.379 17339.0 39.6796989440918 48 18 10 10 10 5.799222881183495 17.243689723405176 0.0 3 0.9881137417600118 11.308595513751039 17339.0 65.88096033402923 0.0 - - - - - - - 330.46666666666664 34 15 C16orf62 chromosome 16 open reading frame 62 1335 170 C20140605_SFK031_03 C20140605_SFK031_03 TB560961.[MT7]-EVNTVLADVIK[MT7].3y4_1.heavy 496.967 / 618.394 22293.0 39.6796989440918 48 18 10 10 10 5.799222881183495 17.243689723405176 0.0 3 0.9881137417600118 11.308595513751039 22293.0 44.02789986091794 0.0 - - - - - - - 741.8571428571429 44 7 C16orf62 chromosome 16 open reading frame 62 1337 171 C20140605_SFK031_03 C20140605_SFK031_03 TB560964.[MT7]-TNSDIVEALNK[MT7].3y3_1.heavy 497.947 / 518.342 49418.0 31.484649658203125 41 16 10 5 10 2.587652582243074 38.645064135045615 0.041500091552734375 3 0.961439056669434 6.264450842958732 49418.0 28.797392923700606 0.0 - - - - - - - 1858.142857142857 98 7 MEF2A;MEF2C myocyte enhancer factor 2A;myocyte enhancer factor 2C 1339 171 C20140605_SFK031_03 C20140605_SFK031_03 TB560964.[MT7]-TNSDIVEALNK[MT7].3b4_1.heavy 497.947 / 562.259 100787.0 31.484649658203125 41 16 10 5 10 2.587652582243074 38.645064135045615 0.041500091552734375 3 0.961439056669434 6.264450842958732 100787.0 87.2903398270766 0.0 - - - - - - - 715.0 201 2 MEF2A;MEF2C myocyte enhancer factor 2A;myocyte enhancer factor 2C 1341 171 C20140605_SFK031_03 C20140605_SFK031_03 TB560964.[MT7]-TNSDIVEALNK[MT7].3b5_1.heavy 497.947 / 675.343 71786.0 31.484649658203125 41 16 10 5 10 2.587652582243074 38.645064135045615 0.041500091552734375 3 0.961439056669434 6.264450842958732 71786.0 79.69528056669395 0.0 - - - - - - - 1188.7142857142858 143 7 MEF2A;MEF2C myocyte enhancer factor 2A;myocyte enhancer factor 2C 1343 171 C20140605_SFK031_03 C20140605_SFK031_03 TB560964.[MT7]-TNSDIVEALNK[MT7].3y4_1.heavy 497.947 / 589.379 35633.0 31.484649658203125 41 16 10 5 10 2.587652582243074 38.645064135045615 0.041500091552734375 3 0.961439056669434 6.264450842958732 35633.0 22.942138840281324 0.0 - - - - - - - 910.0 71 2 MEF2A;MEF2C myocyte enhancer factor 2A;myocyte enhancer factor 2C 1345 172 C20140605_SFK031_03 C20140605_SFK031_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 937806.0 35.64590072631836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 937806.0 174.96775474891857 0.0 - - - - - - - 283.0 1875 7 1347 172 C20140605_SFK031_03 C20140605_SFK031_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 161583.0 35.64590072631836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 161583.0 172.2633262260128 1.0 - - - - - - - 708.8 323 10 1349 172 C20140605_SFK031_03 C20140605_SFK031_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 123011.0 35.64590072631836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 123011.0 -0.1818169725007944 1.0 - - - - - - - 417.0 270 1 1351 173 C20140605_SFK031_03 C20140605_SFK031_03 TB561728.[MT7]-FAQPGTFEFEYASR.3y7_1.heavy 598.625 / 901.405 31383.0 38.24209976196289 50 20 10 10 10 5.371005891253386 18.61848637381849 0.0 3 0.9939955635526919 15.918740242431968 31383.0 130.85808851131088 0.0 - - - - - - - 312.45454545454544 62 11 PSPC1 paraspeckle component 1 1353 173 C20140605_SFK031_03 C20140605_SFK031_03 TB561728.[MT7]-FAQPGTFEFEYASR.3y6_1.heavy 598.625 / 772.362 69539.0 38.24209976196289 50 20 10 10 10 5.371005891253386 18.61848637381849 0.0 3 0.9939955635526919 15.918740242431968 69539.0 78.5407178517325 0.0 - - - - - - - 238.5 139 2 PSPC1 paraspeckle component 1 1355 173 C20140605_SFK031_03 C20140605_SFK031_03 TB561728.[MT7]-FAQPGTFEFEYASR.3y8_1.heavy 598.625 / 1048.47 18410.0 38.24209976196289 50 20 10 10 10 5.371005891253386 18.61848637381849 0.0 3 0.9939955635526919 15.918740242431968 18410.0 29.542590620139315 0.0 - - - - - - - 667.5714285714286 36 7 PSPC1 paraspeckle component 1 1357 173 C20140605_SFK031_03 C20140605_SFK031_03 TB561728.[MT7]-FAQPGTFEFEYASR.3y5_1.heavy 598.625 / 625.294 50365.0 38.24209976196289 50 20 10 10 10 5.371005891253386 18.61848637381849 0.0 3 0.9939955635526919 15.918740242431968 50365.0 98.60509234825273 0.0 - - - - - - - 334.0 100 2 PSPC1 paraspeckle component 1 1359 174 C20140605_SFK031_03 C20140605_SFK031_03 TB559643.[MT7]-ARAETEELIR.2b8_1.heavy 666.374 / 1044.54 6474.0 24.25429916381836 30 14 2 6 8 2.068742031201244 42.28899769828727 0.03639984130859375 4 0.9466891231837177 5.321155284261309 6474.0 25.66979359700267 1.0 - - - - - - - 683.0 36 7 PML promyelocytic leukemia 1361 174 C20140605_SFK031_03 C20140605_SFK031_03 TB559643.[MT7]-ARAETEELIR.2y8_1.heavy 666.374 / 960.5 4239.0 24.25429916381836 30 14 2 6 8 2.068742031201244 42.28899769828727 0.03639984130859375 4 0.9466891231837177 5.321155284261309 4239.0 34.407467532467535 0.0 - - - - - - - 245.4375 8 16 PML promyelocytic leukemia 1363 174 C20140605_SFK031_03 C20140605_SFK031_03 TB559643.[MT7]-ARAETEELIR.2b6_1.heavy 666.374 / 802.417 3083.0 24.25429916381836 30 14 2 6 8 2.068742031201244 42.28899769828727 0.03639984130859375 4 0.9466891231837177 5.321155284261309 3083.0 20.701625781625783 0.0 - - - - - - - 280.8235294117647 6 17 PML promyelocytic leukemia 1365 174 C20140605_SFK031_03 C20140605_SFK031_03 TB559643.[MT7]-ARAETEELIR.2b7_1.heavy 666.374 / 931.46 6628.0 24.25429916381836 30 14 2 6 8 2.068742031201244 42.28899769828727 0.03639984130859375 4 0.9466891231837177 5.321155284261309 6628.0 19.658510573000488 0.0 - - - - - - - 250.25 13 16 PML promyelocytic leukemia 1367 175 C20140605_SFK031_03 C20140605_SFK031_03 TB559849.[MT7]-FYVEASILK[MT7].3y3_1.heavy 453.271 / 517.383 18709.0 39.173173904418945 42 16 10 6 10 2.226256089231441 39.311732950846604 0.03549957275390625 3 0.9682480741467789 6.907508767991283 18709.0 44.46696053611318 0.0 - - - - - - - 633.6363636363636 37 11 C16orf62 chromosome 16 open reading frame 62 1369 175 C20140605_SFK031_03 C20140605_SFK031_03 TB559849.[MT7]-FYVEASILK[MT7].3b4_1.heavy 453.271 / 683.352 26872.0 39.173173904418945 42 16 10 6 10 2.226256089231441 39.311732950846604 0.03549957275390625 3 0.9682480741467789 6.907508767991283 26872.0 166.48945749585098 0.0 - - - - - - - 153.0 53 10 C16orf62 chromosome 16 open reading frame 62 1371 175 C20140605_SFK031_03 C20140605_SFK031_03 TB559849.[MT7]-FYVEASILK[MT7].3b5_1.heavy 453.271 / 754.389 13096.0 39.173173904418945 42 16 10 6 10 2.226256089231441 39.311732950846604 0.03549957275390625 3 0.9682480741467789 6.907508767991283 13096.0 177.6947450980392 0.0 - - - - - - - 175.66666666666666 26 15 C16orf62 chromosome 16 open reading frame 62 1373 175 C20140605_SFK031_03 C20140605_SFK031_03 TB559849.[MT7]-FYVEASILK[MT7].3b3_1.heavy 453.271 / 554.31 34696.0 39.173173904418945 42 16 10 6 10 2.226256089231441 39.311732950846604 0.03549957275390625 3 0.9682480741467789 6.907508767991283 34696.0 209.45498980392156 0.0 - - - - - - - 255.0 69 11 C16orf62 chromosome 16 open reading frame 62 1375 176 C20140605_SFK031_03 C20140605_SFK031_03 TB557106.[MT7]-TVEVEK[MT7].2y4_1.heavy 496.797 / 648.369 43282.0 20.688499450683594 50 20 10 10 10 6.951212396950373 14.385979637720732 0.0 3 0.9923129172122153 14.067048761567953 43282.0 110.31208476517754 0.0 - - - - - - - 707.0769230769231 86 13 STIM1 stromal interaction molecule 1 1377 176 C20140605_SFK031_03 C20140605_SFK031_03 TB557106.[MT7]-TVEVEK[MT7].2y5_1.heavy 496.797 / 747.437 42933.0 20.688499450683594 50 20 10 10 10 6.951212396950373 14.385979637720732 0.0 3 0.9923129172122153 14.067048761567953 42933.0 103.99582401330991 0.0 - - - - - - - 290.7857142857143 85 14 STIM1 stromal interaction molecule 1 1379 176 C20140605_SFK031_03 C20140605_SFK031_03 TB557106.[MT7]-TVEVEK[MT7].2b4_1.heavy 496.797 / 573.336 18849.0 20.688499450683594 50 20 10 10 10 6.951212396950373 14.385979637720732 0.0 3 0.9923129172122153 14.067048761567953 18849.0 32.76166245652305 0.0 - - - - - - - 735.0909090909091 37 11 STIM1 stromal interaction molecule 1 1381 176 C20140605_SFK031_03 C20140605_SFK031_03 TB557106.[MT7]-TVEVEK[MT7].2y3_1.heavy 496.797 / 519.326 43689.0 20.688499450683594 50 20 10 10 10 6.951212396950373 14.385979637720732 0.0 3 0.9923129172122153 14.067048761567953 43689.0 65.08962743792861 0.0 - - - - - - - 703.9 87 10 STIM1 stromal interaction molecule 1 1383 177 C20140605_SFK031_03 C20140605_SFK031_03 TB561045.[MT7]-AAVEDNHLLIK[MT7].3y10_2.heavy 504.299 / 648.376 8114.0 28.90559959411621 44 14 10 10 10 2.337523699920241 32.87093990339349 0.0 3 0.937550109091437 4.912584792493824 8114.0 5.1092653673163415 3.0 - - - - - - - 1206.857142857143 17 7 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1385 177 C20140605_SFK031_03 C20140605_SFK031_03 TB561045.[MT7]-AAVEDNHLLIK[MT7].3y3_1.heavy 504.299 / 517.383 168281.0 28.90559959411621 44 14 10 10 10 2.337523699920241 32.87093990339349 0.0 3 0.937550109091437 4.912584792493824 168281.0 60.017377741032206 0.0 - - - - - - - 1834.0 336 2 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1387 177 C20140605_SFK031_03 C20140605_SFK031_03 TB561045.[MT7]-AAVEDNHLLIK[MT7].3b6_1.heavy 504.299 / 744.364 87697.0 28.90559959411621 44 14 10 10 10 2.337523699920241 32.87093990339349 0.0 3 0.937550109091437 4.912584792493824 87697.0 37.52780632043165 0.0 - - - - - - - 762.1428571428571 175 7 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1389 177 C20140605_SFK031_03 C20140605_SFK031_03 TB561045.[MT7]-AAVEDNHLLIK[MT7].3b4_1.heavy 504.299 / 515.295 20785.0 28.90559959411621 44 14 10 10 10 2.337523699920241 32.87093990339349 0.0 3 0.937550109091437 4.912584792493824 20785.0 12.153568964505602 1.0 - - - - - - - 1234.888888888889 41 9 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1391 178 C20140605_SFK031_03 C20140605_SFK031_03 TB557415.[MT7]-TFNLEK[MT7].2b3_1.heavy 520.305 / 507.268 20918.0 28.257724285125732 44 18 10 6 10 5.747522150716168 17.398802018977786 0.03669929504394531 3 0.9824996753905395 9.31545168686855 20918.0 9.177173021032797 1.0 - - - - - - - 683.5 41 2 NONO non-POU domain containing, octamer-binding 1393 178 C20140605_SFK031_03 C20140605_SFK031_03 TB557415.[MT7]-TFNLEK[MT7].2y4_1.heavy 520.305 / 647.385 29432.0 28.257724285125732 44 18 10 6 10 5.747522150716168 17.398802018977786 0.03669929504394531 3 0.9824996753905395 9.31545168686855 29432.0 21.764326539833316 0.0 - - - - - - - 367.5 58 2 NONO non-POU domain containing, octamer-binding 1395 178 C20140605_SFK031_03 C20140605_SFK031_03 TB557415.[MT7]-TFNLEK[MT7].2y5_1.heavy 520.305 / 794.453 54449.0 28.257724285125732 44 18 10 6 10 5.747522150716168 17.398802018977786 0.03669929504394531 3 0.9824996753905395 9.31545168686855 54449.0 123.64449989658974 0.0 - - - - - - - 298.84615384615387 108 13 NONO non-POU domain containing, octamer-binding 1397 178 C20140605_SFK031_03 C20140605_SFK031_03 TB557415.[MT7]-TFNLEK[MT7].2y3_1.heavy 520.305 / 533.341 26384.0 28.257724285125732 44 18 10 6 10 5.747522150716168 17.398802018977786 0.03669929504394531 3 0.9824996753905395 9.31545168686855 26384.0 13.724250113841 1.0 - - - - - - - 946.0 52 2 NONO non-POU domain containing, octamer-binding 1399 179 C20140605_SFK031_03 C20140605_SFK031_03 TB556808.[MT7]-AEFIATR.2b3_1.heavy 476.273 / 492.258 56653.0 26.314899444580078 47 17 10 10 10 2.7994061458303916 28.625431163477753 0.0 3 0.9711222205941582 7.244856257115626 56653.0 43.41745524846761 0.0 - - - - - - - 89.0 113 1 C16orf62 chromosome 16 open reading frame 62 1401 179 C20140605_SFK031_03 C20140605_SFK031_03 TB556808.[MT7]-AEFIATR.2y5_1.heavy 476.273 / 607.356 51164.0 26.314899444580078 47 17 10 10 10 2.7994061458303916 28.625431163477753 0.0 3 0.9711222205941582 7.244856257115626 51164.0 59.032913998744505 0.0 - - - - - - - 398.5 102 4 C16orf62 chromosome 16 open reading frame 62 1403 179 C20140605_SFK031_03 C20140605_SFK031_03 TB556808.[MT7]-AEFIATR.2b4_1.heavy 476.273 / 605.341 33106.0 26.314899444580078 47 17 10 10 10 2.7994061458303916 28.625431163477753 0.0 3 0.9711222205941582 7.244856257115626 33106.0 34.109212121212124 0.0 - - - - - - - 1177.3 66 10 C16orf62 chromosome 16 open reading frame 62 1405 179 C20140605_SFK031_03 C20140605_SFK031_03 TB556808.[MT7]-AEFIATR.2y6_1.heavy 476.273 / 736.399 75507.0 26.314899444580078 47 17 10 10 10 2.7994061458303916 28.625431163477753 0.0 3 0.9711222205941582 7.244856257115626 75507.0 166.14637012771198 0.0 - - - - - - - 708.2 151 10 C16orf62 chromosome 16 open reading frame 62 1407 180 C20140605_SFK031_03 C20140605_SFK031_03 TB562174.[MT7]-ADEDGDTPLHIAVVQGNLPAVHR.4y5_1.heavy 642.838 / 579.336 270215.0 34.568599700927734 44 14 10 10 10 1.831963526925378 42.84362698701987 0.0 3 0.9402137547220257 5.021967279176719 270215.0 117.12615995115996 0.0 - - - - - - - 2408.0 540 1 BCL3 B-cell CLL/lymphoma 3 1409 180 C20140605_SFK031_03 C20140605_SFK031_03 TB562174.[MT7]-ADEDGDTPLHIAVVQGNLPAVHR.4b12_2.heavy 642.838 / 690.332 78580.0 34.568599700927734 44 14 10 10 10 1.831963526925378 42.84362698701987 0.0 3 0.9402137547220257 5.021967279176719 78580.0 35.824056159590896 0.0 - - - - - - - 380.0 157 1 BCL3 B-cell CLL/lymphoma 3 1411 180 C20140605_SFK031_03 C20140605_SFK031_03 TB562174.[MT7]-ADEDGDTPLHIAVVQGNLPAVHR.4b9_1.heavy 642.838 / 1058.48 34981.0 34.568599700927734 44 14 10 10 10 1.831963526925378 42.84362698701987 0.0 3 0.9402137547220257 5.021967279176719 34981.0 104.23186199381621 0.0 - - - - - - - 285.0 69 4 BCL3 B-cell CLL/lymphoma 3 1413 180 C20140605_SFK031_03 C20140605_SFK031_03 TB562174.[MT7]-ADEDGDTPLHIAVVQGNLPAVHR.4b6_1.heavy 642.838 / 747.291 27757.0 34.568599700927734 44 14 10 10 10 1.831963526925378 42.84362698701987 0.0 3 0.9402137547220257 5.021967279176719 27757.0 19.98123082939798 1.0 - - - - - - - 253.33333333333334 63 3 BCL3 B-cell CLL/lymphoma 3 1415 181 C20140605_SFK031_03 C20140605_SFK031_03 TB399553.[MT7]-NADIELR.2y4_1.heavy 487.773 / 530.33 2211.0 15.11769962310791 45 15 10 10 10 7.8815940422451405 12.687788721926374 0.0 3 0.9586723094258107 6.049711142797394 2211.0 3.939923892159901 0.0 - - - - - - - 264.95 4 20 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1417 181 C20140605_SFK031_03 C20140605_SFK031_03 TB399553.[MT7]-NADIELR.2b4_1.heavy 487.773 / 558.3 7464.0 15.11769962310791 45 15 10 10 10 7.8815940422451405 12.687788721926374 0.0 3 0.9586723094258107 6.049711142797394 7464.0 11.627627425233001 0.0 - - - - - - - 716.7777777777778 14 9 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1419 181 C20140605_SFK031_03 C20140605_SFK031_03 TB399553.[MT7]-NADIELR.2b6_1.heavy 487.773 / 800.427 4884.0 15.11769962310791 45 15 10 10 10 7.8815940422451405 12.687788721926374 0.0 3 0.9586723094258107 6.049711142797394 4884.0 14.03781708052162 0.0 - - - - - - - 218.85 9 20 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1421 181 C20140605_SFK031_03 C20140605_SFK031_03 TB399553.[MT7]-NADIELR.2b5_1.heavy 487.773 / 687.343 29947.0 15.11769962310791 45 15 10 10 10 7.8815940422451405 12.687788721926374 0.0 3 0.9586723094258107 6.049711142797394 29947.0 455.71521739130435 0.0 - - - - - - - 168.83333333333334 59 18 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1423 182 C20140605_SFK031_03 C20140605_SFK031_03 TB562173.[MT7]-GASGAGLAGGSLSLGQPVC[CAM]ELAASK[MT7].4b8_1.heavy 637.343 / 729.401 13750.0 38.40589904785156 45 15 10 10 10 2.133613917206319 38.462395411631746 0.0 3 0.9537315936074939 5.715196955617166 13750.0 16.345657254138267 0.0 - - - - - - - 446.0 27 1 NKX3-2 NK3 homeobox 2 1425 182 C20140605_SFK031_03 C20140605_SFK031_03 TB562173.[MT7]-GASGAGLAGGSLSLGQPVC[CAM]ELAASK[MT7].4y4_1.heavy 637.343 / 520.321 32857.0 38.40589904785156 45 15 10 10 10 2.133613917206319 38.462395411631746 0.0 3 0.9537315936074939 5.715196955617166 32857.0 14.221144507953312 0.0 - - - - - - - 1250.0 65 4 NKX3-2 NK3 homeobox 2 1427 182 C20140605_SFK031_03 C20140605_SFK031_03 TB562173.[MT7]-GASGAGLAGGSLSLGQPVC[CAM]ELAASK[MT7].4b7_1.heavy 637.343 / 658.364 20803.0 38.40589904785156 45 15 10 10 10 2.133613917206319 38.462395411631746 0.0 3 0.9537315936074939 5.715196955617166 20803.0 27.02367939081747 0.0 - - - - - - - 790.8571428571429 41 7 NKX3-2 NK3 homeobox 2 1429 182 C20140605_SFK031_03 C20140605_SFK031_03 TB562173.[MT7]-GASGAGLAGGSLSLGQPVC[CAM]ELAASK[MT7].4b6_1.heavy 637.343 / 545.28 33928.0 38.40589904785156 45 15 10 10 10 2.133613917206319 38.462395411631746 0.0 3 0.9537315936074939 5.715196955617166 33928.0 30.857990916013435 0.0 - - - - - - - 1696.375 67 8 NKX3-2 NK3 homeobox 2 1431 183 C20140605_SFK031_03 C20140605_SFK031_03 TB559449.[MT7]-GADIDAVDIK[MT7].3b6_1.heavy 435.582 / 687.343 194485.0 29.590999603271484 45 15 10 10 10 2.079183011534379 38.124569682275634 0.0 3 0.9504455511743289 5.520915370187779 194485.0 182.1871253291684 0.0 - - - - - - - 1249.0 388 4 BCL3 B-cell CLL/lymphoma 3 1433 183 C20140605_SFK031_03 C20140605_SFK031_03 TB559449.[MT7]-GADIDAVDIK[MT7].3y3_1.heavy 435.582 / 519.326 368173.0 29.590999603271484 45 15 10 10 10 2.079183011534379 38.124569682275634 0.0 3 0.9504455511743289 5.520915370187779 368173.0 80.78642188175648 0.0 - - - - - - - 813.0 736 1 BCL3 B-cell CLL/lymphoma 3 1435 183 C20140605_SFK031_03 C20140605_SFK031_03 TB559449.[MT7]-GADIDAVDIK[MT7].3b4_1.heavy 435.582 / 501.279 140229.0 29.590999603271484 45 15 10 10 10 2.079183011534379 38.124569682275634 0.0 3 0.9504455511743289 5.520915370187779 140229.0 61.000928420916274 0.0 - - - - - - - 1278.0 280 1 BCL3 B-cell CLL/lymphoma 3 1437 183 C20140605_SFK031_03 C20140605_SFK031_03 TB559449.[MT7]-GADIDAVDIK[MT7].3b5_1.heavy 435.582 / 616.306 335643.0 29.590999603271484 45 15 10 10 10 2.079183011534379 38.124569682275634 0.0 3 0.9504455511743289 5.520915370187779 335643.0 274.58502890434977 0.0 - - - - - - - 232.0 671 1 BCL3 B-cell CLL/lymphoma 3 1439 184 C20140605_SFK031_03 C20140605_SFK031_03 TB561817.[MT7]-SFADINLYREQIK[MT7].3b6_1.heavy 629.019 / 792.401 10994.0 35.47930145263672 47 17 10 10 10 3.9620018128626735 25.23976634118367 0.0 3 0.9745443131286345 7.718703485430945 10994.0 15.811491277446994 0.0 - - - - - - - 625.0 21 7 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 1441 184 C20140605_SFK031_03 C20140605_SFK031_03 TB561817.[MT7]-SFADINLYREQIK[MT7].3b4_1.heavy 629.019 / 565.274 49472.0 35.47930145263672 47 17 10 10 10 3.9620018128626735 25.23976634118367 0.0 3 0.9745443131286345 7.718703485430945 49472.0 43.11468693952136 0.0 - - - - - - - 375.0 98 1 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 1443 184 C20140605_SFK031_03 C20140605_SFK031_03 TB561817.[MT7]-SFADINLYREQIK[MT7].3y12_2.heavy 629.019 / 827.458 27109.0 35.47930145263672 47 17 10 10 10 3.9620018128626735 25.23976634118367 0.0 3 0.9745443131286345 7.718703485430945 27109.0 36.176687427921586 0.0 - - - - - - - 702.875 54 8 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 1445 184 C20140605_SFK031_03 C20140605_SFK031_03 TB561817.[MT7]-SFADINLYREQIK[MT7].3y9_2.heavy 629.019 / 660.891 38728.0 35.47930145263672 47 17 10 10 10 3.9620018128626735 25.23976634118367 0.0 3 0.9745443131286345 7.718703485430945 38728.0 47.323456061958396 1.0 - - - - - - - 749.7 84 10 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 1447 185 C20140605_SFK031_03 C20140605_SFK031_03 TB294882.[MT7]-TVTTTSYEK[MT7].2y4_1.heavy 659.361 / 670.353 2792.0 21.220800399780273 37 11 10 6 10 1.0058587819867504 57.27482954358233 0.035999298095703125 3 0.8777769521692048 3.4934925341055254 2792.0 16.9462660944206 0.0 - - - - - - - 220.52631578947367 5 19 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1449 185 C20140605_SFK031_03 C20140605_SFK031_03 TB294882.[MT7]-TVTTTSYEK[MT7].2y5_1.heavy 659.361 / 771.401 3374.0 21.220800399780273 37 11 10 6 10 1.0058587819867504 57.27482954358233 0.035999298095703125 3 0.8777769521692048 3.4934925341055254 3374.0 17.62364261168385 0.0 - - - - - - - 165.31578947368422 6 19 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1451 185 C20140605_SFK031_03 C20140605_SFK031_03 TB294882.[MT7]-TVTTTSYEK[MT7].2y3_1.heavy 659.361 / 583.321 1978.0 21.220800399780273 37 11 10 6 10 1.0058587819867504 57.27482954358233 0.035999298095703125 3 0.8777769521692048 3.4934925341055254 1978.0 5.093562231759656 0.0 - - - - - - - 284.44444444444446 3 18 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1453 185 C20140605_SFK031_03 C20140605_SFK031_03 TB294882.[MT7]-TVTTTSYEK[MT7].2y7_1.heavy 659.361 / 973.496 6748.0 21.220800399780273 37 11 10 6 10 1.0058587819867504 57.27482954358233 0.035999298095703125 3 0.8777769521692048 3.4934925341055254 6748.0 20.495358166189114 1.0 - - - - - - - 205.76923076923077 13 13 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1455 186 C20140605_SFK031_03 C20140605_SFK031_03 TB557790.[MT7]-ADLAASLK[MT7].2y4_1.heavy 538.831 / 562.368 56840.0 28.78969955444336 48 18 10 10 10 6.184437643497178 16.169618931342633 0.0 3 0.9891853792353882 11.856719615620127 56840.0 41.95805307520977 0.0 - - - - - - - 1222.75 113 8 NKX3-2 NK3 homeobox 2 1457 186 C20140605_SFK031_03 C20140605_SFK031_03 TB557790.[MT7]-ADLAASLK[MT7].2y5_1.heavy 538.831 / 633.405 58379.0 28.78969955444336 48 18 10 10 10 6.184437643497178 16.169618931342633 0.0 3 0.9891853792353882 11.856719615620127 58379.0 20.303985029721186 0.0 - - - - - - - 1429.0 116 1 NKX3-2 NK3 homeobox 2 1459 186 C20140605_SFK031_03 C20140605_SFK031_03 TB557790.[MT7]-ADLAASLK[MT7].2b4_1.heavy 538.831 / 515.295 47715.0 28.78969955444336 48 18 10 10 10 6.184437643497178 16.169618931342633 0.0 3 0.9891853792353882 11.856719615620127 47715.0 29.958562123034767 0.0 - - - - - - - 879.5 95 2 NKX3-2 NK3 homeobox 2 1461 186 C20140605_SFK031_03 C20140605_SFK031_03 TB557790.[MT7]-ADLAASLK[MT7].2y6_1.heavy 538.831 / 746.489 37820.0 28.78969955444336 48 18 10 10 10 6.184437643497178 16.169618931342633 0.0 3 0.9891853792353882 11.856719615620127 37820.0 64.15252687830014 0.0 - - - - - - - 801.2857142857143 75 7 NKX3-2 NK3 homeobox 2 1463 187 C20140605_SFK031_03 C20140605_SFK031_03 TB399870.[MT7]-ASPEAASTPRDPIDVDLPEEAER.3y7_1.heavy 870.432 / 843.421 N/A 34.52690124511719 38 16 10 10 2 2.472792417890537 32.15856031084591 0.0 14 0.9645424903344253 6.534563467102181 1679.0 2.1675712261398683 0.0 - - - - - - - 610.8181818181819 3 11 PML promyelocytic leukemia 1465 187 C20140605_SFK031_03 C20140605_SFK031_03 TB399870.[MT7]-ASPEAASTPRDPIDVDLPEEAER.3b5_1.heavy 870.432 / 600.311 1421.0 34.52690124511719 38 16 10 10 2 2.472792417890537 32.15856031084591 0.0 14 0.9645424903344253 6.534563467102181 1421.0 1.3098512703397087 3.0 - - - - - - - 274.125 2 8 PML promyelocytic leukemia 1467 187 C20140605_SFK031_03 C20140605_SFK031_03 TB399870.[MT7]-ASPEAASTPRDPIDVDLPEEAER.3y21_2.heavy 870.432 / 1154.06 2196.0 34.52690124511719 38 16 10 10 2 2.472792417890537 32.15856031084591 0.0 14 0.9645424903344253 6.534563467102181 2196.0 8.850511915904672 3.0 - - - - - - - 279.5 4 12 PML promyelocytic leukemia 1469 187 C20140605_SFK031_03 C20140605_SFK031_03 TB399870.[MT7]-ASPEAASTPRDPIDVDLPEEAER.3y9_1.heavy 870.432 / 1057.52 1679.0 34.52690124511719 38 16 10 10 2 2.472792417890537 32.15856031084591 0.0 14 0.9645424903344253 6.534563467102181 1679.0 2.5129497253570356 3.0 - - - - - - - 664.4285714285714 3 7 PML promyelocytic leukemia 1471 188 C20140605_SFK031_03 C20140605_SFK031_03 TB558175.[MT7]-ALDEMEK[MT7].2y4_1.heavy 562.299 / 680.341 9500.0 25.703033447265625 34 18 2 6 8 3.715639094047847 26.913270495025177 0.036701202392578125 4 0.9841847611072178 9.800550077771545 9500.0 17.304390322110198 0.0 - - - - - - - 697.4444444444445 19 9 PSPC1 paraspeckle component 1 1473 188 C20140605_SFK031_03 C20140605_SFK031_03 TB558175.[MT7]-ALDEMEK[MT7].2y5_1.heavy 562.299 / 795.367 4665.0 25.703033447265625 34 18 2 6 8 3.715639094047847 26.913270495025177 0.036701202392578125 4 0.9841847611072178 9.800550077771545 4665.0 13.60188679245283 0.0 - - - - - - - 751.1428571428571 9 7 PSPC1 paraspeckle component 1 1475 188 C20140605_SFK031_03 C20140605_SFK031_03 TB558175.[MT7]-ALDEMEK[MT7].2b4_1.heavy 562.299 / 573.3 N/A 25.703033447265625 34 18 2 6 8 3.715639094047847 26.913270495025177 0.036701202392578125 4 0.9841847611072178 9.800550077771545 0.0 0.0 43.0 - - - - - - - 1225.111111111111 20 9 PSPC1 paraspeckle component 1 1477 188 C20140605_SFK031_03 C20140605_SFK031_03 TB558175.[MT7]-ALDEMEK[MT7].2y3_1.heavy 562.299 / 551.298 8482.0 25.703033447265625 34 18 2 6 8 3.715639094047847 26.913270495025177 0.036701202392578125 4 0.9841847611072178 9.800550077771545 8482.0 4.477952331382049 3.0 - - - - - - - 1131.0 44 3 PSPC1 paraspeckle component 1 1479 189 C20140605_SFK031_03 C20140605_SFK031_03 TB559637.[MT7]-EVVENNLPLR.2y8_1.heavy 663.879 / 954.537 51029.0 30.694000244140625 45 15 10 10 10 3.807879057652387 26.26133826362948 0.0 3 0.9566995498375964 5.9093059746196746 51029.0 61.87996357839441 0.0 - - - - - - - 280.8 102 5 BCL6 B-cell CLL/lymphoma 6 1481 189 C20140605_SFK031_03 C20140605_SFK031_03 TB559637.[MT7]-EVVENNLPLR.2y9_1.heavy 663.879 / 1053.61 80371.0 30.694000244140625 45 15 10 10 10 3.807879057652387 26.26133826362948 0.0 3 0.9566995498375964 5.9093059746196746 80371.0 82.85796246783408 0.0 - - - - - - - 710.7142857142857 160 7 BCL6 B-cell CLL/lymphoma 6 1483 189 C20140605_SFK031_03 C20140605_SFK031_03 TB559637.[MT7]-EVVENNLPLR.2y6_1.heavy 663.879 / 726.426 16584.0 30.694000244140625 45 15 10 10 10 3.807879057652387 26.26133826362948 0.0 3 0.9566995498375964 5.9093059746196746 16584.0 17.30208286674132 1.0 - - - - - - - 688.8 42 10 BCL6 B-cell CLL/lymphoma 6 1485 189 C20140605_SFK031_03 C20140605_SFK031_03 TB559637.[MT7]-EVVENNLPLR.2y7_1.heavy 663.879 / 855.468 38527.0 30.694000244140625 45 15 10 10 10 3.807879057652387 26.26133826362948 0.0 3 0.9566995498375964 5.9093059746196746 38527.0 63.944395606272124 0.0 - - - - - - - 637.7142857142857 77 7 BCL6 B-cell CLL/lymphoma 6 1487 190 C20140605_SFK031_03 C20140605_SFK031_03 TB559635.[MT7]-VLEIPLEPK[MT7].2y5_1.heavy 663.418 / 727.447 100098.0 38.48239994049072 39 16 10 3 10 4.761760935738772 21.00063429254987 0.07500076293945312 3 0.9603680639212056 6.178668014838326 100098.0 93.91710192053652 0.0 - - - - - - - 403.8 200 5 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1489 190 C20140605_SFK031_03 C20140605_SFK031_03 TB559635.[MT7]-VLEIPLEPK[MT7].2b4_1.heavy 663.418 / 599.388 93401.0 38.48239994049072 39 16 10 3 10 4.761760935738772 21.00063429254987 0.07500076293945312 3 0.9603680639212056 6.178668014838326 93401.0 87.39202680878553 0.0 - - - - - - - 1204.0 186 8 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1491 190 C20140605_SFK031_03 C20140605_SFK031_03 TB559635.[MT7]-VLEIPLEPK[MT7].2y3_1.heavy 663.418 / 517.31 6789.0 38.48239994049072 39 16 10 3 10 4.761760935738772 21.00063429254987 0.07500076293945312 3 0.9603680639212056 6.178668014838326 6789.0 5.486106438400768 1.0 - - - - - - - 1782.5714285714287 13 7 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1493 190 C20140605_SFK031_03 C20140605_SFK031_03 TB559635.[MT7]-VLEIPLEPK[MT7].2y6_1.heavy 663.418 / 840.531 14772.0 38.48239994049072 39 16 10 3 10 4.761760935738772 21.00063429254987 0.07500076293945312 3 0.9603680639212056 6.178668014838326 14772.0 27.803980901088455 0.0 - - - - - - - 1297.2857142857142 29 7 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1495 191 C20140605_SFK031_03 C20140605_SFK031_03 TB555654.[MT7]-QAEATR.2b3_1.heavy 410.226 / 473.248 3823.0 14.551300287246704 24 0 10 6 8 0.22554411680691377 172.173016635684 0.03480052947998047 4 0.3901818106062942 1.491776121517657 3823.0 4.757300727441573 0.0 - - - - - - - 763.375 7 8 C6orf132;VGF chromosome 6 open reading frame 132;VGF nerve growth factor inducible 1497 191 C20140605_SFK031_03 C20140605_SFK031_03 TB555654.[MT7]-QAEATR.2y5_1.heavy 410.226 / 547.284 1266.0 14.551300287246704 24 0 10 6 8 0.22554411680691377 172.173016635684 0.03480052947998047 4 0.3901818106062942 1.491776121517657 1266.0 1.2139227601619567 4.0 - - - - - - - 761.2222222222222 4 9 C6orf132;VGF chromosome 6 open reading frame 132;VGF nerve growth factor inducible 1499 191 C20140605_SFK031_03 C20140605_SFK031_03 TB555654.[MT7]-QAEATR.2b4_1.heavy 410.226 / 544.285 521.0 14.551300287246704 24 0 10 6 8 0.22554411680691377 172.173016635684 0.03480052947998047 4 0.3901818106062942 1.491776121517657 521.0 0.741423835508277 8.0 - - - - - - - 382.4 2 10 C6orf132;VGF chromosome 6 open reading frame 132;VGF nerve growth factor inducible 1501 191 C20140605_SFK031_03 C20140605_SFK031_03 TB555654.[MT7]-QAEATR.2b5_1.heavy 410.226 / 645.332 7324.0 14.551300287246704 24 0 10 6 8 0.22554411680691377 172.173016635684 0.03480052947998047 4 0.3901818106062942 1.491776121517657 7324.0 16.60352644836272 0.0 - - - - - - - 369.77777777777777 14 9 C6orf132;VGF chromosome 6 open reading frame 132;VGF nerve growth factor inducible 1503 192 C20140605_SFK031_03 C20140605_SFK031_03 TB562030.[MT7]-QLAAGWGPC[CAM]EVLLSNALAR.3y7_1.heavy 724.057 / 744.436 24272.0 47.349300384521484 48 18 10 10 10 3.23041931568235 24.79117205644412 0.0 3 0.9845053228253414 9.901676486956807 24272.0 30.397571157495257 0.0 - - - - - - - 272.0 48 3 MAN2B1 mannosidase, alpha, class 2B, member 1 1505 192 C20140605_SFK031_03 C20140605_SFK031_03 TB562030.[MT7]-QLAAGWGPC[CAM]EVLLSNALAR.3y6_1.heavy 724.057 / 631.352 26159.0 47.349300384521484 48 18 10 10 10 3.23041931568235 24.79117205644412 0.0 3 0.9845053228253414 9.901676486956807 26159.0 -0.35924284352149416 2.0 - - - - - - - 867.0 62 2 MAN2B1 mannosidase, alpha, class 2B, member 1 1507 192 C20140605_SFK031_03 C20140605_SFK031_03 TB562030.[MT7]-QLAAGWGPC[CAM]EVLLSNALAR.3b5_1.heavy 724.057 / 585.348 16725.0 47.349300384521484 48 18 10 10 10 3.23041931568235 24.79117205644412 0.0 3 0.9845053228253414 9.901676486956807 16725.0 24.712710084033613 0.0 - - - - - - - 408.0 33 2 MAN2B1 mannosidase, alpha, class 2B, member 1 1509 192 C20140605_SFK031_03 C20140605_SFK031_03 TB562030.[MT7]-QLAAGWGPC[CAM]EVLLSNALAR.3b7_1.heavy 724.057 / 828.448 23660.0 47.349300384521484 48 18 10 10 10 3.23041931568235 24.79117205644412 0.0 3 0.9845053228253414 9.901676486956807 23660.0 22.878531654923073 0.0 - - - - - - - 357.0 47 1 MAN2B1 mannosidase, alpha, class 2B, member 1 1511 193 C20140605_SFK031_03 C20140605_SFK031_03 TB399695.[MT7]-AAPGAEFAPNK[MT7].2y9_1.heavy 680.877 / 1074.57 27247.0 25.12969970703125 35 9 10 6 10 1.0268408611828808 60.563599986004675 0.036800384521484375 3 0.8029024944749688 2.7328505448227856 27247.0 87.16626447183879 0.0 - - - - - - - 231.0 54 12 NONO non-POU domain containing, octamer-binding 1513 193 C20140605_SFK031_03 C20140605_SFK031_03 TB399695.[MT7]-AAPGAEFAPNK[MT7].2b6_1.heavy 680.877 / 641.338 4436.0 25.12969970703125 35 9 10 6 10 1.0268408611828808 60.563599986004675 0.036800384521484375 3 0.8029024944749688 2.7328505448227856 4436.0 5.797160883280757 1.0 - - - - - - - 301.0 8 15 NONO non-POU domain containing, octamer-binding 1515 193 C20140605_SFK031_03 C20140605_SFK031_03 TB399695.[MT7]-AAPGAEFAPNK[MT7].2y3_1.heavy 680.877 / 502.311 19406.0 25.12969970703125 35 9 10 6 10 1.0268408611828808 60.563599986004675 0.036800384521484375 3 0.8029024944749688 2.7328505448227856 19406.0 52.71293482804484 0.0 - - - - - - - 257.3125 38 16 NONO non-POU domain containing, octamer-binding 1517 193 C20140605_SFK031_03 C20140605_SFK031_03 TB399695.[MT7]-AAPGAEFAPNK[MT7].2y6_1.heavy 680.877 / 849.459 2059.0 25.12969970703125 35 9 10 6 10 1.0268408611828808 60.563599986004675 0.036800384521484375 3 0.8029024944749688 2.7328505448227856 2059.0 8.573753943217666 0.0 - - - - - - - 188.76923076923077 4 13 NONO non-POU domain containing, octamer-binding 1519 194 C20140605_SFK031_03 C20140605_SFK031_03 TB557798.[MT7]-QAHELAK[MT7].2y4_1.heavy 542.821 / 604.379 N/A 16.53753407796224 45 20 9 6 10 6.336970196191503 15.780411916738956 0.03730010986328125 3 0.9924058934346607 14.153009652283544 3776.0 3.336905709402955 1.0 - - - - - - - 276.85714285714283 8 7 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 1521 194 C20140605_SFK031_03 C20140605_SFK031_03 TB557798.[MT7]-QAHELAK[MT7].2y5_1.heavy 542.821 / 741.438 2534.0 16.53753407796224 45 20 9 6 10 6.336970196191503 15.780411916738956 0.03730010986328125 3 0.9924058934346607 14.153009652283544 2534.0 7.392392368047715 1.0 - - - - - - - 664.5 5 8 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 1523 194 C20140605_SFK031_03 C20140605_SFK031_03 TB557798.[MT7]-QAHELAK[MT7].2b4_1.heavy 542.821 / 610.307 2285.0 16.53753407796224 45 20 9 6 10 6.336970196191503 15.780411916738956 0.03730010986328125 3 0.9924058934346607 14.153009652283544 2285.0 9.60571109275299 0.0 - - - - - - - 273.22222222222223 4 18 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 1525 194 C20140605_SFK031_03 C20140605_SFK031_03 TB557798.[MT7]-QAHELAK[MT7].2y6_1.heavy 542.821 / 812.475 3577.0 16.53753407796224 45 20 9 6 10 6.336970196191503 15.780411916738956 0.03730010986328125 3 0.9924058934346607 14.153009652283544 3577.0 24.697959933897675 0.0 - - - - - - - 233.5 7 20 NRAS neuroblastoma RAS viral (v-ras) oncogene homolog 1527 195 C20140605_SFK031_03 C20140605_SFK031_03 TB556391.[MT7]-IVGNTK[MT7].2y4_1.heavy 460.294 / 563.327 78498.0 19.298999786376953 50 20 10 10 10 14.888177995525128 6.716738611672734 0.0 3 0.9973576983824695 24.00355130714849 78498.0 55.56069753780677 0.0 - - - - - - - 405.3333333333333 156 6 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1529 195 C20140605_SFK031_03 C20140605_SFK031_03 TB556391.[MT7]-IVGNTK[MT7].2y5_1.heavy 460.294 / 662.395 116054.0 19.298999786376953 50 20 10 10 10 14.888177995525128 6.716738611672734 0.0 3 0.9973576983824695 24.00355130714849 116054.0 56.3577797339036 1.0 - - - - - - - 635.0 232 1 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1531 195 C20140605_SFK031_03 C20140605_SFK031_03 TB556391.[MT7]-IVGNTK[MT7].2b4_1.heavy 460.294 / 528.326 10050.0 19.298999786376953 50 20 10 10 10 14.888177995525128 6.716738611672734 0.0 3 0.9973576983824695 24.00355130714849 10050.0 19.80872871650343 0.0 - - - - - - - 1292.2857142857142 20 7 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1533 195 C20140605_SFK031_03 C20140605_SFK031_03 TB556391.[MT7]-IVGNTK[MT7].2y3_1.heavy 460.294 / 506.306 14070.0 19.298999786376953 50 20 10 10 10 14.888177995525128 6.716738611672734 0.0 3 0.9973576983824695 24.00355130714849 14070.0 10.332546235913721 1.0 - - - - - - - 1124.125 28 8 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1535 196 C20140605_SFK031_03 C20140605_SFK031_03 TB557318.[MT7]-AVVIVDDR.2y5_1.heavy 515.804 / 617.325 76454.0 26.597999572753906 47 17 10 10 10 2.9694355126014034 27.00997513690944 0.0 3 0.9750762777550944 7.800990492681977 76454.0 39.21007493273645 0.0 - - - - - - - 900.0 152 4 NONO;SFPQ non-POU domain containing, octamer-binding;splicing factor proline/glutamine-rich 1537 196 C20140605_SFK031_03 C20140605_SFK031_03 TB557318.[MT7]-AVVIVDDR.2b4_1.heavy 515.804 / 527.367 92428.0 26.597999572753906 47 17 10 10 10 2.9694355126014034 27.00997513690944 0.0 3 0.9750762777550944 7.800990492681977 92428.0 52.835500492287494 0.0 - - - - - - - 892.3333333333334 184 3 NONO;SFPQ non-POU domain containing, octamer-binding;splicing factor proline/glutamine-rich 1539 196 C20140605_SFK031_03 C20140605_SFK031_03 TB557318.[MT7]-AVVIVDDR.2y6_1.heavy 515.804 / 716.394 92243.0 26.597999572753906 47 17 10 10 10 2.9694355126014034 27.00997513690944 0.0 3 0.9750762777550944 7.800990492681977 92243.0 39.66584684960766 0.0 - - - - - - - 831.0 184 1 NONO;SFPQ non-POU domain containing, octamer-binding;splicing factor proline/glutamine-rich 1541 196 C20140605_SFK031_03 C20140605_SFK031_03 TB557318.[MT7]-AVVIVDDR.2y7_1.heavy 515.804 / 815.462 73961.0 26.597999572753906 47 17 10 10 10 2.9694355126014034 27.00997513690944 0.0 3 0.9750762777550944 7.800990492681977 73961.0 45.313813890639054 0.0 - - - - - - - 615.3333333333334 147 3 NONO;SFPQ non-POU domain containing, octamer-binding;splicing factor proline/glutamine-rich 1543 197 C20140605_SFK031_03 C20140605_SFK031_03 TB557966.[MT7]-TFC[CAM]EGSPR.2y5_1.heavy 549.262 / 545.268 N/A 20.36699930826823 46 20 10 6 10 8.88253329440668 11.25804955473343 0.0326995849609375 3 0.997626731124826 25.32812081437755 4167.0 0.2892045454545452 3.0 - - - - - - - 1185.5555555555557 16 9 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1545 197 C20140605_SFK031_03 C20140605_SFK031_03 TB557966.[MT7]-TFC[CAM]EGSPR.2b4_1.heavy 549.262 / 682.299 4778.0 20.36699930826823 46 20 10 6 10 8.88253329440668 11.25804955473343 0.0326995849609375 3 0.997626731124826 25.32812081437755 4778.0 24.39219219219219 0.0 - - - - - - - 239.625 9 16 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1547 197 C20140605_SFK031_03 C20140605_SFK031_03 TB557966.[MT7]-TFC[CAM]EGSPR.2y6_1.heavy 549.262 / 705.299 5890.0 20.36699930826823 46 20 10 6 10 8.88253329440668 11.25804955473343 0.0326995849609375 3 0.997626731124826 25.32812081437755 5890.0 28.951425461451166 0.0 - - - - - - - 166.8235294117647 11 17 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1549 197 C20140605_SFK031_03 C20140605_SFK031_03 TB557966.[MT7]-TFC[CAM]EGSPR.2y7_1.heavy 549.262 / 852.367 13557.0 20.36699930826823 46 20 10 6 10 8.88253329440668 11.25804955473343 0.0326995849609375 3 0.997626731124826 25.32812081437755 13557.0 66.20576515698984 0.0 - - - - - - - 180.8 27 20 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1551 198 C20140605_SFK031_03 C20140605_SFK031_03 TB560219.[MT7]-GIGDPLVSVYAR.2y8_1.heavy 695.894 / 904.525 197174.0 37.60179901123047 50 20 10 10 10 6.197732671365962 16.134932773400873 0.0 3 0.9985217688092477 32.09502183241434 197174.0 501.4600376627483 0.0 - - - - - - - 310.25 394 4 C16orf62 chromosome 16 open reading frame 62 1553 198 C20140605_SFK031_03 C20140605_SFK031_03 TB560219.[MT7]-GIGDPLVSVYAR.2y10_1.heavy 695.894 / 1076.57 27414.0 37.60179901123047 50 20 10 10 10 6.197732671365962 16.134932773400873 0.0 3 0.9985217688092477 32.09502183241434 27414.0 58.0938710064857 0.0 - - - - - - - 227.5 54 10 C16orf62 chromosome 16 open reading frame 62 1555 198 C20140605_SFK031_03 C20140605_SFK031_03 TB560219.[MT7]-GIGDPLVSVYAR.2b5_1.heavy 695.894 / 584.316 3724.0 37.60179901123047 50 20 10 10 10 6.197732671365962 16.134932773400873 0.0 3 0.9985217688092477 32.09502183241434 3724.0 2.7694379188766027 1.0 - - - - - - - 689.5555555555555 7 9 C16orf62 chromosome 16 open reading frame 62 1557 198 C20140605_SFK031_03 C20140605_SFK031_03 TB560219.[MT7]-GIGDPLVSVYAR.2y11_1.heavy 695.894 / 1189.66 4759.0 37.60179901123047 50 20 10 10 10 6.197732671365962 16.134932773400873 0.0 3 0.9985217688092477 32.09502183241434 4759.0 10.386807254987872 0.0 - - - - - - - 264.0 9 9 C16orf62 chromosome 16 open reading frame 62 1559 199 C20140605_SFK031_03 C20140605_SFK031_03 TB562087.[MT7]-NLC[CAM]WDVLC[CAM]VDQPLVEDPR.3y7_1.heavy 791.388 / 825.446 39991.0 45.33225059509277 40 14 10 6 10 2.2614439776704525 44.219534504238084 0.03859710693359375 3 0.9325625822592987 4.725421072242592 39991.0 81.20100938650856 0.0 - - - - - - - 726.2857142857143 79 7 MAN2B1 mannosidase, alpha, class 2B, member 1 1561 199 C20140605_SFK031_03 C20140605_SFK031_03 TB562087.[MT7]-NLC[CAM]WDVLC[CAM]VDQPLVEDPR.3b6_1.heavy 791.388 / 932.442 52429.0 45.33225059509277 40 14 10 6 10 2.2614439776704525 44.219534504238084 0.03859710693359375 3 0.9325625822592987 4.725421072242592 52429.0 110.87678181818181 0.0 - - - - - - - 717.6666666666666 104 9 MAN2B1 mannosidase, alpha, class 2B, member 1 1563 199 C20140605_SFK031_03 C20140605_SFK031_03 TB562087.[MT7]-NLC[CAM]WDVLC[CAM]VDQPLVEDPR.3b5_1.heavy 791.388 / 833.373 52978.0 45.33225059509277 40 14 10 6 10 2.2614439776704525 44.219534504238084 0.03859710693359375 3 0.9325625822592987 4.725421072242592 52978.0 138.33822521793275 0.0 - - - - - - - 353.42857142857144 105 7 MAN2B1 mannosidase, alpha, class 2B, member 1 1565 199 C20140605_SFK031_03 C20140605_SFK031_03 TB562087.[MT7]-NLC[CAM]WDVLC[CAM]VDQPLVEDPR.3b3_1.heavy 791.388 / 532.267 19309.0 45.33225059509277 40 14 10 6 10 2.2614439776704525 44.219534504238084 0.03859710693359375 3 0.9325625822592987 4.725421072242592 19309.0 34.041165398143136 0.0 - - - - - - - 712.0 38 11 MAN2B1 mannosidase, alpha, class 2B, member 1 1567 200 C20140605_SFK031_03 C20140605_SFK031_03 TB559597.[MT7]-VFTDPSNLQR.2y8_1.heavy 660.855 / 930.464 40942.0 29.225900650024414 41 11 10 10 10 1.771517037344425 56.44879382582965 0.0 3 0.8516461746460581 3.163672973262084 40942.0 73.63581251389016 0.0 - - - - - - - 266.5 81 8 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 1569 200 C20140605_SFK031_03 C20140605_SFK031_03 TB559597.[MT7]-VFTDPSNLQR.2y9_1.heavy 660.855 / 1077.53 107571.0 29.225900650024414 41 11 10 10 10 1.771517037344425 56.44879382582965 0.0 3 0.8516461746460581 3.163672973262084 107571.0 80.35829139315452 0.0 - - - - - - - 449.0 215 2 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 1571 200 C20140605_SFK031_03 C20140605_SFK031_03 TB559597.[MT7]-VFTDPSNLQR.2b4_1.heavy 660.855 / 607.321 185641.0 29.225900650024414 41 11 10 10 10 1.771517037344425 56.44879382582965 0.0 3 0.8516461746460581 3.163672973262084 185641.0 66.07354985154376 0.0 - - - - - - - 897.0 371 1 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 1573 200 C20140605_SFK031_03 C20140605_SFK031_03 TB559597.[MT7]-VFTDPSNLQR.2y6_1.heavy 660.855 / 714.389 205496.0 29.225900650024414 41 11 10 10 10 1.771517037344425 56.44879382582965 0.0 3 0.8516461746460581 3.163672973262084 205496.0 118.90931095310725 0.0 - - - - - - - 280.5 410 2 LOC100290519;LOC100510662;MECOM;PRDM16 PR domain zinc finger protein 16-like;PR domain zinc finger protein 16-like;MDS1 and EVI1 complex locus;PR domain containing 16 1575 201 C20140605_SFK031_03 C20140605_SFK031_03 TB557961.[MT7]-REVNTVLADVIK[MT7].3y3_1.heavy 549.001 / 503.367 121096.0 35.192298889160156 43 13 10 10 10 10.58494168808036 9.447383173835469 0.0 3 0.9294246433917762 4.6179360594993195 121096.0 68.12117200399041 0.0 - - - - - - - 1385.0 242 1 C16orf62 chromosome 16 open reading frame 62 1577 201 C20140605_SFK031_03 C20140605_SFK031_03 TB557961.[MT7]-REVNTVLADVIK[MT7].3b5_1.heavy 549.001 / 744.412 66338.0 35.192298889160156 43 13 10 10 10 10.58494168808036 9.447383173835469 0.0 3 0.9294246433917762 4.6179360594993195 66338.0 58.732849035187286 0.0 - - - - - - - 283.5 132 4 C16orf62 chromosome 16 open reading frame 62 1579 201 C20140605_SFK031_03 C20140605_SFK031_03 TB557961.[MT7]-REVNTVLADVIK[MT7].3y4_1.heavy 549.001 / 618.394 155839.0 35.192298889160156 43 13 10 10 10 10.58494168808036 9.447383173835469 0.0 3 0.9294246433917762 4.6179360594993195 155839.0 134.29743988564658 0.0 - - - - - - - 378.0 311 1 C16orf62 chromosome 16 open reading frame 62 1581 201 C20140605_SFK031_03 C20140605_SFK031_03 TB557961.[MT7]-REVNTVLADVIK[MT7].3y5_1.heavy 549.001 / 689.431 149293.0 35.192298889160156 43 13 10 10 10 10.58494168808036 9.447383173835469 0.0 3 0.9294246433917762 4.6179360594993195 149293.0 140.8903645813176 0.0 - - - - - - - 645.125 298 8 C16orf62 chromosome 16 open reading frame 62 1583 202 C20140605_SFK031_03 C20140605_SFK031_03 TB294698.[MT7]-VSSAQK[MT7].2y4_1.heavy 454.276 / 577.343 4950.0 15.154199600219727 48 18 10 10 10 3.594773490810776 22.887462190588565 0.0 3 0.9858991765805689 10.380744034983982 4950.0 14.931313016880026 0.0 - - - - - - - 286.7142857142857 9 21 SOLH small optic lobes homolog (Drosophila) 1585 202 C20140605_SFK031_03 C20140605_SFK031_03 TB294698.[MT7]-VSSAQK[MT7].2y5_1.heavy 454.276 / 664.375 19993.0 15.154199600219727 48 18 10 10 10 3.594773490810776 22.887462190588565 0.0 3 0.9858991765805689 10.380744034983982 19993.0 73.6240464978151 0.0 - - - - - - - 214.41666666666666 39 12 SOLH small optic lobes homolog (Drosophila) 1587 202 C20140605_SFK031_03 C20140605_SFK031_03 TB294698.[MT7]-VSSAQK[MT7].2y3_1.heavy 454.276 / 490.311 4804.0 15.154199600219727 48 18 10 10 10 3.594773490810776 22.887462190588565 0.0 3 0.9858991765805689 10.380744034983982 4804.0 12.789984555388239 0.0 - - - - - - - 715.75 9 8 SOLH small optic lobes homolog (Drosophila) 1589 202 C20140605_SFK031_03 C20140605_SFK031_03 TB294698.[MT7]-VSSAQK[MT7].2b5_1.heavy 454.276 / 617.338 3057.0 15.154199600219727 48 18 10 10 10 3.594773490810776 22.887462190588565 0.0 3 0.9858991765805689 10.380744034983982 3057.0 2.6271256384065373 3.0 - - - - - - - 768.3333333333334 8 12 SOLH small optic lobes homolog (Drosophila) 1591 203 C20140605_SFK031_03 C20140605_SFK031_03 TB559599.[MT7]-RQTDEGEAK[MT7].3b6_1.heavy 441.237 / 831.408 1598.0 13.242300033569336 46 16 10 10 10 2.591913370397574 30.514388652242506 0.0 3 0.9687700103164999 6.965297503270877 1598.0 60.724 0.0 - - - - - - - 133.25 3 8 SOLH small optic lobes homolog (Drosophila) 1593 203 C20140605_SFK031_03 C20140605_SFK031_03 TB559599.[MT7]-RQTDEGEAK[MT7].3b4_1.heavy 441.237 / 645.344 4028.0 13.242300033569336 46 16 10 10 10 2.591913370397574 30.514388652242506 0.0 3 0.9687700103164999 6.965297503270877 4028.0 27.189 0.0 - - - - - - - 213.13333333333333 8 15 SOLH small optic lobes homolog (Drosophila) 1595 203 C20140605_SFK031_03 C20140605_SFK031_03 TB559599.[MT7]-RQTDEGEAK[MT7].3y4_1.heavy 441.237 / 548.316 9289.0 13.242300033569336 46 16 10 10 10 2.591913370397574 30.514388652242506 0.0 3 0.9687700103164999 6.965297503270877 9289.0 44.354974999999996 0.0 - - - - - - - 221.14285714285714 18 14 SOLH small optic lobes homolog (Drosophila) 1597 203 C20140605_SFK031_03 C20140605_SFK031_03 TB559599.[MT7]-RQTDEGEAK[MT7].3y5_1.heavy 441.237 / 677.359 4994.0 13.242300033569336 46 16 10 10 10 2.591913370397574 30.514388652242506 0.0 3 0.9687700103164999 6.965297503270877 4994.0 170.938469241774 0.0 - - - - - - - 224.2 9 15 SOLH small optic lobes homolog (Drosophila) 1599 204 C20140605_SFK031_03 C20140605_SFK031_03 TB557210.[MT7]-FC[CAM]VGDK[MT7].2b3_1.heavy 507.27 / 551.277 21087.0 25.25550079345703 42 12 10 10 10 0.9421419467860738 61.096581661550964 0.0 3 0.8916306839570003 3.714555508513637 21087.0 37.07604395604396 0.0 - - - - - - - 737.5833333333334 42 12 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 1601 204 C20140605_SFK031_03 C20140605_SFK031_03 TB557210.[MT7]-FC[CAM]VGDK[MT7].2y4_1.heavy 507.27 / 562.332 33656.0 25.25550079345703 42 12 10 10 10 0.9421419467860738 61.096581661550964 0.0 3 0.8916306839570003 3.714555508513637 33656.0 38.90908086953071 0.0 - - - - - - - 1264.0 67 7 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 1603 204 C20140605_SFK031_03 C20140605_SFK031_03 TB557210.[MT7]-FC[CAM]VGDK[MT7].2y5_1.heavy 507.27 / 722.362 59456.0 25.25550079345703 42 12 10 10 10 0.9421419467860738 61.096581661550964 0.0 3 0.8916306839570003 3.714555508513637 59456.0 103.65995790452932 0.0 - - - - - - - 713.5 118 8 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 1605 204 C20140605_SFK031_03 C20140605_SFK031_03 TB557210.[MT7]-FC[CAM]VGDK[MT7].2b5_1.heavy 507.27 / 723.325 66816.0 25.25550079345703 42 12 10 10 10 0.9421419467860738 61.096581661550964 0.0 3 0.8916306839570003 3.714555508513637 66816.0 109.0708585247884 0.0 - - - - - - - 1819.375 133 8 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 1607 205 C20140605_SFK031_03 C20140605_SFK031_03 TB559593.[MT7]-EVLPAGVTIK[MT7].2y5_1.heavy 657.915 / 661.437 8755.0 33.226200103759766 48 18 10 10 10 4.6078617896336675 21.702039810519178 0.0 3 0.9814127380958142 9.03815241889597 8755.0 9.77940414507772 0.0 - - - - - - - 659.75 17 8 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1609 205 C20140605_SFK031_03 C20140605_SFK031_03 TB559593.[MT7]-EVLPAGVTIK[MT7].2y3_1.heavy 657.915 / 505.347 12746.0 33.226200103759766 48 18 10 10 10 4.6078617896336675 21.702039810519178 0.0 3 0.9814127380958142 9.03815241889597 12746.0 17.008011521242373 0.0 - - - - - - - 717.2857142857143 25 7 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1611 205 C20140605_SFK031_03 C20140605_SFK031_03 TB559593.[MT7]-EVLPAGVTIK[MT7].2y6_1.heavy 657.915 / 732.474 4120.0 33.226200103759766 48 18 10 10 10 4.6078617896336675 21.702039810519178 0.0 3 0.9814127380958142 9.03815241889597 4120.0 3.51048951048951 3.0 - - - - - - - 735.5714285714286 15 7 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1613 205 C20140605_SFK031_03 C20140605_SFK031_03 TB559593.[MT7]-EVLPAGVTIK[MT7].2y7_1.heavy 657.915 / 829.526 74157.0 33.226200103759766 48 18 10 10 10 4.6078617896336675 21.702039810519178 0.0 3 0.9814127380958142 9.03815241889597 74157.0 94.08119354563306 0.0 - - - - - - - 1190.875 148 8 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1615 206 C20140605_SFK031_03 C20140605_SFK031_03 TB557640.[MT7]-EREQPPR.2b3_1.heavy 528.289 / 559.296 1894.0 13.944199562072754 48 18 10 10 10 3.3169021607334908 24.11559943657634 0.0 3 0.9850451439220538 10.07925717507264 1894.0 17.009223300970874 0.0 - - - - - - - 198.58823529411765 3 17 NONO;PSPC1 non-POU domain containing, octamer-binding;paraspeckle component 1 1617 206 C20140605_SFK031_03 C20140605_SFK031_03 TB557640.[MT7]-EREQPPR.2y5_1.heavy 528.289 / 626.326 1400.0 13.944199562072754 48 18 10 10 10 3.3169021607334908 24.11559943657634 0.0 3 0.9850451439220538 10.07925717507264 1400.0 9.101042294771299 0.0 - - - - - - - 150.0 2 17 NONO;PSPC1 non-POU domain containing, octamer-binding;paraspeckle component 1 1619 206 C20140605_SFK031_03 C20140605_SFK031_03 TB557640.[MT7]-EREQPPR.2b4_1.heavy 528.289 / 687.354 2800.0 13.944199562072754 48 18 10 10 10 3.3169021607334908 24.11559943657634 0.0 3 0.9850451439220538 10.07925717507264 2800.0 25.475156422524844 0.0 - - - - - - - 164.64285714285714 5 14 NONO;PSPC1 non-POU domain containing, octamer-binding;paraspeckle component 1 1621 206 C20140605_SFK031_03 C20140605_SFK031_03 TB557640.[MT7]-EREQPPR.2y3_1.heavy 528.289 / 369.224 1894.0 13.944199562072754 48 18 10 10 10 3.3169021607334908 24.11559943657634 0.0 3 0.9850451439220538 10.07925717507264 1894.0 4.93319231016524 0.0 - - - - - - - 253.57894736842104 3 19 NONO;PSPC1 non-POU domain containing, octamer-binding;paraspeckle component 1 1623 207 C20140605_SFK031_03 C20140605_SFK031_03 TB560804.[MT7]-IHDVIGTPAQK[MT7].3b4_1.heavy 489.624 / 609.348 97422.0 25.037700653076172 45 17 10 10 8 2.6388216618841778 30.30459142775183 0.0 4 0.9706261690814484 7.183121763574414 97422.0 183.6834844868735 1.0 - - - - - - - 691.0 214 8 RAGE renal tumor antigen 1625 207 C20140605_SFK031_03 C20140605_SFK031_03 TB560804.[MT7]-IHDVIGTPAQK[MT7].3b5_1.heavy 489.624 / 722.432 16586.0 25.037700653076172 45 17 10 10 8 2.6388216618841778 30.30459142775183 0.0 4 0.9706261690814484 7.183121763574414 16586.0 32.01124192878092 0.0 - - - - - - - 611.6 33 10 RAGE renal tumor antigen 1627 207 C20140605_SFK031_03 C20140605_SFK031_03 TB560804.[MT7]-IHDVIGTPAQK[MT7].3y4_1.heavy 489.624 / 587.363 114344.0 25.037700653076172 45 17 10 10 8 2.6388216618841778 30.30459142775183 0.0 4 0.9706261690814484 7.183121763574414 114344.0 135.59114154800739 0.0 - - - - - - - 1228.5555555555557 228 9 RAGE renal tumor antigen 1629 207 C20140605_SFK031_03 C20140605_SFK031_03 TB560804.[MT7]-IHDVIGTPAQK[MT7].3b3_1.heavy 489.624 / 510.279 108312.0 25.037700653076172 45 17 10 10 8 2.6388216618841778 30.30459142775183 0.0 4 0.9706261690814484 7.183121763574414 108312.0 122.51641923030718 0.0 - - - - - - - 1204.375 216 8 RAGE renal tumor antigen 1631 208 C20140605_SFK031_03 C20140605_SFK031_03 TB557213.[MT7]-AVVVVDDR.2y5_1.heavy 508.796 / 603.31 74972.0 24.390400886535645 43 17 10 6 10 2.785317661827365 25.51853362511116 0.03520011901855469 3 0.9741476896628432 7.659009298252004 74972.0 31.760869406113514 0.0 - - - - - - - 949.0 149 2 PSPC1 paraspeckle component 1 1633 208 C20140605_SFK031_03 C20140605_SFK031_03 TB557213.[MT7]-AVVVVDDR.2b4_1.heavy 508.796 / 513.352 96641.0 24.390400886535645 43 17 10 6 10 2.785317661827365 25.51853362511116 0.03520011901855469 3 0.9741476896628432 7.659009298252004 96641.0 25.762284833340217 0.0 - - - - - - - 1424.0 193 1 PSPC1 paraspeckle component 1 1635 208 C20140605_SFK031_03 C20140605_SFK031_03 TB557213.[MT7]-AVVVVDDR.2y6_1.heavy 508.796 / 702.378 79242.0 24.390400886535645 43 17 10 6 10 2.785317661827365 25.51853362511116 0.03520011901855469 3 0.9741476896628432 7.659009298252004 79242.0 97.40418910204912 1.0 - - - - - - - 838.4 158 5 PSPC1 paraspeckle component 1 1637 208 C20140605_SFK031_03 C20140605_SFK031_03 TB557213.[MT7]-AVVVVDDR.2y7_1.heavy 508.796 / 801.446 74023.0 24.390400886535645 43 17 10 6 10 2.785317661827365 25.51853362511116 0.03520011901855469 3 0.9741476896628432 7.659009298252004 74023.0 43.178471141602124 0.0 - - - - - - - 395.5 148 2 PSPC1 paraspeckle component 1 1639 209 C20140605_SFK031_03 C20140605_SFK031_03 TB399862.[MT7]-NLC[CAM]WDVLC[CAM]VDQPLVEDPR.2b8_1.heavy 1186.58 / 1205.56 1706.0 45.33225059509277 39 13 10 6 10 1.8057784360997589 48.94769470329124 0.03859710693359375 3 0.9173020925040488 4.2616299160906275 1706.0 2.85204563411767 0.0 - - - - - - - 202.3125 3 16 MAN2B1 mannosidase, alpha, class 2B, member 1 1641 209 C20140605_SFK031_03 C20140605_SFK031_03 TB399862.[MT7]-NLC[CAM]WDVLC[CAM]VDQPLVEDPR.2b3_1.heavy 1186.58 / 532.267 5000.0 45.33225059509277 39 13 10 6 10 1.8057784360997589 48.94769470329124 0.03859710693359375 3 0.9173020925040488 4.2616299160906275 5000.0 103.25982280431433 0.0 - - - - - - - 111.11111111111111 10 9 MAN2B1 mannosidase, alpha, class 2B, member 1 1643 209 C20140605_SFK031_03 C20140605_SFK031_03 TB399862.[MT7]-NLC[CAM]WDVLC[CAM]VDQPLVEDPR.2b7_1.heavy 1186.58 / 1045.53 7294.0 45.33225059509277 39 13 10 6 10 1.8057784360997589 48.94769470329124 0.03859710693359375 3 0.9173020925040488 4.2616299160906275 7294.0 25.61936807804763 0.0 - - - - - - - 230.5 14 12 MAN2B1 mannosidase, alpha, class 2B, member 1 1645 209 C20140605_SFK031_03 C20140605_SFK031_03 TB399862.[MT7]-NLC[CAM]WDVLC[CAM]VDQPLVEDPR.2b5_1.heavy 1186.58 / 833.373 9118.0 45.33225059509277 39 13 10 6 10 1.8057784360997589 48.94769470329124 0.03859710693359375 3 0.9173020925040488 4.2616299160906275 9118.0 88.92029252507128 0.0 - - - - - - - 194.4 18 10 MAN2B1 mannosidase, alpha, class 2B, member 1 1647 210 C20140605_SFK031_03 C20140605_SFK031_03 TB560215.[MT7]-QLWVALIEK[MT7].3y3_1.heavy 463.29 / 533.341 51041.0 44.629398345947266 44 14 10 10 10 3.1084077232727294 32.17081184405038 0.0 3 0.9307334435462121 4.661881981325968 51041.0 311.8039778548865 0.0 - - - - - - - 202.41666666666666 102 12 SOLH small optic lobes homolog (Drosophila) 1649 210 C20140605_SFK031_03 C20140605_SFK031_03 TB560215.[MT7]-QLWVALIEK[MT7].3b4_1.heavy 463.29 / 671.4 27983.0 44.629398345947266 44 14 10 10 10 3.1084077232727294 32.17081184405038 0.0 3 0.9307334435462121 4.661881981325968 27983.0 169.37194344870815 0.0 - - - - - - - 202.33333333333334 55 12 SOLH small optic lobes homolog (Drosophila) 1651 210 C20140605_SFK031_03 C20140605_SFK031_03 TB560215.[MT7]-QLWVALIEK[MT7].3b5_1.heavy 463.29 / 742.437 33052.0 44.629398345947266 44 14 10 10 10 3.1084077232727294 32.17081184405038 0.0 3 0.9307334435462121 4.661881981325968 33052.0 502.4365170462024 0.0 - - - - - - - 175.0 66 11 SOLH small optic lobes homolog (Drosophila) 1653 210 C20140605_SFK031_03 C20140605_SFK031_03 TB560215.[MT7]-QLWVALIEK[MT7].3b3_1.heavy 463.29 / 572.331 19845.0 44.629398345947266 44 14 10 10 10 3.1084077232727294 32.17081184405038 0.0 3 0.9307334435462121 4.661881981325968 19845.0 126.98024475524477 0.0 - - - - - - - 188.1818181818182 39 11 SOLH small optic lobes homolog (Drosophila) 1655 211 C20140605_SFK031_03 C20140605_SFK031_03 TB560217.[MT7]-TRLEELDDFEEGSQK[MT7].3b8_1.heavy 695.351 / 1116.57 7296.0 31.853649139404297 38 13 10 5 10 1.0625506238985492 55.706430585076056 0.04380035400390625 3 0.9249389077258887 4.476104348689901 7296.0 2.701562684510923 0.0 - - - - - - - 261.0 14 1 C16orf62 chromosome 16 open reading frame 62 1657 211 C20140605_SFK031_03 C20140605_SFK031_03 TB560217.[MT7]-TRLEELDDFEEGSQK[MT7].3y5_1.heavy 695.351 / 692.37 6645.0 31.853649139404297 38 13 10 5 10 1.0625506238985492 55.706430585076056 0.04380035400390625 3 0.9249389077258887 4.476104348689901 6645.0 2.1036331923638745 1.0 - - - - - - - 781.6 13 5 C16orf62 chromosome 16 open reading frame 62 1659 211 C20140605_SFK031_03 C20140605_SFK031_03 TB560217.[MT7]-TRLEELDDFEEGSQK[MT7].3b8_2.heavy 695.351 / 558.786 20586.0 31.853649139404297 38 13 10 5 10 1.0625506238985492 55.706430585076056 0.04380035400390625 3 0.9249389077258887 4.476104348689901 20586.0 9.613652405219097 0.0 - - - - - - - 1238.0 41 2 C16orf62 chromosome 16 open reading frame 62 1661 211 C20140605_SFK031_03 C20140605_SFK031_03 TB560217.[MT7]-TRLEELDDFEEGSQK[MT7].3y4_1.heavy 695.351 / 563.327 13420.0 31.853649139404297 38 13 10 5 10 1.0625506238985492 55.706430585076056 0.04380035400390625 3 0.9249389077258887 4.476104348689901 13420.0 2.1535703369432997 0.0 - - - - - - - 1768.2857142857142 26 7 C16orf62 chromosome 16 open reading frame 62 1663 212 C20140605_SFK031_03 C20140605_SFK031_03 TB561802.[MT7]-GFVEFAAK[MT7]PPARK[MT7].3b4_1.heavy 617.372 / 577.31 5005.0 30.694000244140625 30 8 6 10 6 0.5438692734717858 88.54256661236703 0.0 6 0.7569491106414417 2.45073840781351 5005.0 1.396438665200709 4.0 - - - - - - - 248.16666666666666 12 6 PSPC1 paraspeckle component 1 1665 212 C20140605_SFK031_03 C20140605_SFK031_03 TB561802.[MT7]-GFVEFAAK[MT7]PPARK[MT7].3y4_1.heavy 617.372 / 615.406 3940.0 30.694000244140625 30 8 6 10 6 0.5438692734717858 88.54256661236703 0.0 6 0.7569491106414417 2.45073840781351 3940.0 5.425978090766824 0.0 - - - - - - - 1247.4285714285713 7 7 PSPC1 paraspeckle component 1 1667 212 C20140605_SFK031_03 C20140605_SFK031_03 TB561802.[MT7]-GFVEFAAK[MT7]PPARK[MT7].3y5_1.heavy 617.372 / 712.459 3408.0 30.694000244140625 30 8 6 10 6 0.5438692734717858 88.54256661236703 0.0 6 0.7569491106414417 2.45073840781351 3408.0 3.3779014492753623 3.0 - - - - - - - 723.9 11 10 PSPC1 paraspeckle component 1 1669 212 C20140605_SFK031_03 C20140605_SFK031_03 TB561802.[MT7]-GFVEFAAK[MT7]PPARK[MT7].3b8_2.heavy 617.372 / 569.829 639.0 30.694000244140625 30 8 6 10 6 0.5438692734717858 88.54256661236703 0.0 6 0.7569491106414417 2.45073840781351 639.0 -0.2134279697187968 38.0 - - - - - - - 771.75 16 8 PSPC1 paraspeckle component 1 1671 213 C20140605_SFK031_03 C20140605_SFK031_03 TB555828.[MT7]-QLESSR.2b3_1.heavy 432.239 / 515.295 5703.0 15.500425100326538 34 20 0 6 8 4.240137675127653 19.041725439867005 0.038100242614746094 4 0.9920156044966135 13.802315809414418 5703.0 6.435267500309141 1.0 - - - - - - - 1268.142857142857 11 7 FMR1;SPTB fragile X mental retardation 1;spectrin, beta, erythrocytic 1673 213 C20140605_SFK031_03 C20140605_SFK031_03 TB555828.[MT7]-QLESSR.2y4_1.heavy 432.239 / 478.226 4364.0 15.500425100326538 34 20 0 6 8 4.240137675127653 19.041725439867005 0.038100242614746094 4 0.9920156044966135 13.802315809414418 4364.0 13.23506256328656 0.0 - - - - - - - 735.75 8 12 FMR1;SPTB fragile X mental retardation 1;spectrin, beta, erythrocytic 1675 213 C20140605_SFK031_03 C20140605_SFK031_03 TB555828.[MT7]-QLESSR.2y5_1.heavy 432.239 / 591.31 22863.0 15.500425100326538 34 20 0 6 8 4.240137675127653 19.041725439867005 0.038100242614746094 4 0.9920156044966135 13.802315809414418 22863.0 4.67852453696529 0.0 - - - - - - - 739.3636363636364 45 11 FMR1;SPTB fragile X mental retardation 1;spectrin, beta, erythrocytic 1677 213 C20140605_SFK031_03 C20140605_SFK031_03 TB555828.[MT7]-QLESSR.2b5_1.heavy 432.239 / 689.359 2133.0 15.500425100326538 34 20 0 6 8 4.240137675127653 19.041725439867005 0.038100242614746094 4 0.9920156044966135 13.802315809414418 2133.0 2.7496235301236407 4.0 - - - - - - - 770.2941176470588 242 17 FMR1;SPTB fragile X mental retardation 1;spectrin, beta, erythrocytic 1679 214 C20140605_SFK031_03 C20140605_SFK031_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 1791760.0 44.36029815673828 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1791760.0 492.43847451894976 0.0 - - - - - - - 1150.3333333333333 3583 9 1681 214 C20140605_SFK031_03 C20140605_SFK031_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 2851690.0 44.36029815673828 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 2851690.0 647.3361341370361 0.0 - - - - - - - 500.0 5703 1 1683 214 C20140605_SFK031_03 C20140605_SFK031_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 3335850.0 44.36029815673828 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 3335850.0 643.6564866803099 0.0 - - - - - - - 737.6666666666666 6671 3 1685 215 C20140605_SFK031_03 C20140605_SFK031_03 TB557195.[MT7]-RPALEK[MT7].2y4_1.heavy 501.321 / 604.379 794.0 18.64799976348877 42 18 10 6 8 3.0648634482323462 23.756339663020558 0.03140068054199219 4 0.9893614311590284 11.95459836550939 794.0 0.4249291784702549 29.0 - - - - - - - 718.2857142857143 4 14 MBNL1 muscleblind-like (Drosophila) 1687 215 C20140605_SFK031_03 C20140605_SFK031_03 TB557195.[MT7]-RPALEK[MT7].2b5_1.heavy 501.321 / 711.427 3018.0 18.64799976348877 42 18 10 6 8 3.0648634482323462 23.756339663020558 0.03140068054199219 4 0.9893614311590284 11.95459836550939 3018.0 7.3378043498728935 0.0 - - - - - - - 700.2307692307693 6 13 MBNL1 muscleblind-like (Drosophila) 1689 215 C20140605_SFK031_03 C20140605_SFK031_03 TB557195.[MT7]-RPALEK[MT7].2y5_1.heavy 501.321 / 701.431 15884.0 18.64799976348877 42 18 10 6 8 3.0648634482323462 23.756339663020558 0.03140068054199219 4 0.9893614311590284 11.95459836550939 15884.0 36.60921914357682 0.0 - - - - - - - 699.7777777777778 31 9 MBNL1 muscleblind-like (Drosophila) 1691 215 C20140605_SFK031_03 C20140605_SFK031_03 TB557195.[MT7]-RPALEK[MT7].2y3_1.heavy 501.321 / 533.341 2012.0 18.64799976348877 42 18 10 6 8 3.0648634482323462 23.756339663020558 0.03140068054199219 4 0.9893614311590284 11.95459836550939 2012.0 0.28139860139860134 4.0 - - - - - - - 1225.5714285714287 5 7 MBNL1 muscleblind-like (Drosophila) 1693 216 C20140605_SFK031_03 C20140605_SFK031_03 TB559715.[MT7]-NLSAPVTLNLR.2y8_1.heavy 671.402 / 883.536 13946.0 35.56340026855469 50 20 10 10 10 19.785077628449404 5.054314260370036 0.0 3 0.9984344626337727 31.1870269737368 13946.0 15.692090451448927 0.0 - - - - - - - 1252.0 27 7 MAN2B1 mannosidase, alpha, class 2B, member 1 1695 216 C20140605_SFK031_03 C20140605_SFK031_03 TB559715.[MT7]-NLSAPVTLNLR.2y9_1.heavy 671.402 / 970.568 29497.0 35.56340026855469 50 20 10 10 10 19.785077628449404 5.054314260370036 0.0 3 0.9984344626337727 31.1870269737368 29497.0 47.55003533138402 0.0 - - - - - - - 308.375 58 8 MAN2B1 mannosidase, alpha, class 2B, member 1 1697 216 C20140605_SFK031_03 C20140605_SFK031_03 TB559715.[MT7]-NLSAPVTLNLR.2y10_1.heavy 671.402 / 1083.65 24931.0 35.56340026855469 50 20 10 10 10 19.785077628449404 5.054314260370036 0.0 3 0.9984344626337727 31.1870269737368 24931.0 18.15987226642824 0.0 - - - - - - - 1340.142857142857 49 7 MAN2B1 mannosidase, alpha, class 2B, member 1 1699 216 C20140605_SFK031_03 C20140605_SFK031_03 TB559715.[MT7]-NLSAPVTLNLR.2y7_1.heavy 671.402 / 812.499 41963.0 35.56340026855469 50 20 10 10 10 19.785077628449404 5.054314260370036 0.0 3 0.9984344626337727 31.1870269737368 41963.0 58.28194444444445 0.0 - - - - - - - 790.0 83 10 MAN2B1 mannosidase, alpha, class 2B, member 1 1701 217 C20140605_SFK031_03 C20140605_SFK031_03 TB557199.[MT7]-ANLILC[CAM]R.2y4_1.heavy 502.296 / 561.318 94369.0 30.26490020751953 50 20 10 10 10 6.64306749818106 15.053286757568099 0.0 3 0.9912600864996711 13.19143331856932 94369.0 97.0941200717702 0.0 - - - - - - - 320.6666666666667 188 3 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 1703 217 C20140605_SFK031_03 C20140605_SFK031_03 TB557199.[MT7]-ANLILC[CAM]R.2y5_1.heavy 502.296 / 674.402 58906.0 30.26490020751953 50 20 10 10 10 6.64306749818106 15.053286757568099 0.0 3 0.9912600864996711 13.19143331856932 58906.0 60.38230431320639 0.0 - - - - - - - 300.5 117 2 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 1705 217 C20140605_SFK031_03 C20140605_SFK031_03 TB557199.[MT7]-ANLILC[CAM]R.2b4_1.heavy 502.296 / 556.357 76457.0 30.26490020751953 50 20 10 10 10 6.64306749818106 15.053286757568099 0.0 3 0.9912600864996711 13.19143331856932 76457.0 67.0782699631175 0.0 - - - - - - - 360.5 152 2 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 1707 217 C20140605_SFK031_03 C20140605_SFK031_03 TB557199.[MT7]-ANLILC[CAM]R.2y6_1.heavy 502.296 / 788.445 137767.0 30.26490020751953 50 20 10 10 10 6.64306749818106 15.053286757568099 0.0 3 0.9912600864996711 13.19143331856932 137767.0 260.736957166442 0.0 - - - - - - - 270.5 275 8 LMO1;LMO3 LIM domain only 1 (rhombotin 1);LIM domain only 3 (rhombotin-like 2) 1709 218 C20140605_SFK031_03 C20140605_SFK031_03 TB560406.[MT7]-AAISLVPEVPK[MT7].3b6_1.heavy 471.297 / 699.452 20471.0 36.6161003112793 43 18 10 5 10 4.513284422061081 22.15681323144554 0.0428009033203125 3 0.9890647358759141 11.79101454052875 20471.0 60.19934898506423 0.0 - - - - - - - 256.85714285714283 40 7 C16orf62 chromosome 16 open reading frame 62 1711 218 C20140605_SFK031_03 C20140605_SFK031_03 TB560406.[MT7]-AAISLVPEVPK[MT7].3b5_1.heavy 471.297 / 600.384 35543.0 36.6161003112793 43 18 10 5 10 4.513284422061081 22.15681323144554 0.0428009033203125 3 0.9890647358759141 11.79101454052875 35543.0 32.11181818181818 1.0 - - - - - - - 337.25 71 4 C16orf62 chromosome 16 open reading frame 62 1713 218 C20140605_SFK031_03 C20140605_SFK031_03 TB560406.[MT7]-AAISLVPEVPK[MT7].3y4_1.heavy 471.297 / 616.379 8773.0 36.6161003112793 43 18 10 5 10 4.513284422061081 22.15681323144554 0.0428009033203125 3 0.9890647358759141 11.79101454052875 8773.0 3.210631326839877 0.0 - - - - - - - 337.5 17 2 C16orf62 chromosome 16 open reading frame 62 1715 218 C20140605_SFK031_03 C20140605_SFK031_03 TB560406.[MT7]-AAISLVPEVPK[MT7].3y5_1.heavy 471.297 / 713.431 26658.0 36.6161003112793 43 18 10 5 10 4.513284422061081 22.15681323144554 0.0428009033203125 3 0.9890647358759141 11.79101454052875 26658.0 135.57873827893175 0.0 - - - - - - - 327.09090909090907 53 11 C16orf62 chromosome 16 open reading frame 62 1717 219 C20140605_SFK031_03 C20140605_SFK031_03 TB399710.[MT7]-C[CAM]QQC[CAM]QAEAK[MT7].2b3_1.heavy 705.839 / 561.257 578.0 14.59469985961914 43 15 10 10 8 2.116007535014978 32.04873353822336 0.0 4 0.953872004702909 5.723956851661162 578.0 4.510353842412451 10.0 - - - - - - - 0.0 1 0 PML promyelocytic leukemia 1719 219 C20140605_SFK031_03 C20140605_SFK031_03 TB399710.[MT7]-C[CAM]QQC[CAM]QAEAK[MT7].2y4_1.heavy 705.839 / 562.332 1060.0 14.59469985961914 43 15 10 10 8 2.116007535014978 32.04873353822336 0.0 4 0.953872004702909 5.723956851661162 1060.0 4.67159936291607 1.0 - - - - - - - 199.95454545454547 2 22 PML promyelocytic leukemia 1721 219 C20140605_SFK031_03 C20140605_SFK031_03 TB399710.[MT7]-C[CAM]QQC[CAM]QAEAK[MT7].2y6_1.heavy 705.839 / 850.421 899.0 14.59469985961914 43 15 10 10 8 2.116007535014978 32.04873353822336 0.0 4 0.953872004702909 5.723956851661162 899.0 35.6790625 0.0 - - - - - - - 0.0 1 0 PML promyelocytic leukemia 1723 219 C20140605_SFK031_03 C20140605_SFK031_03 TB399710.[MT7]-C[CAM]QQC[CAM]QAEAK[MT7].2b7_1.heavy 705.839 / 1049.43 1413.0 14.59469985961914 43 15 10 10 8 2.116007535014978 32.04873353822336 0.0 4 0.953872004702909 5.723956851661162 1413.0 66.12398437499999 0.0 - - - - - - - 91.57142857142857 2 7 PML promyelocytic leukemia 1725 220 C20140605_SFK031_03 C20140605_SFK031_03 TB556597.[MT7]-SQGGSSLR.2b6_1.heavy 468.255 / 648.307 9075.0 16.83217477798462 27 5 10 6 6 1.6424732522854681 60.88379208663035 0.03669929504394531 5 0.6853807875759077 2.139749674359089 9075.0 13.127026634165976 0.0 - - - - - - - 190.29166666666666 18 24 MAN2B1 mannosidase, alpha, class 2B, member 1 1727 220 C20140605_SFK031_03 C20140605_SFK031_03 TB556597.[MT7]-SQGGSSLR.2y6_1.heavy 468.255 / 576.31 11889.0 16.83217477798462 27 5 10 6 6 1.6424732522854681 60.88379208663035 0.03669929504394531 5 0.6853807875759077 2.139749674359089 11889.0 7.507522313581919 0.0 - - - - - - - 322.35714285714283 23 14 MAN2B1 mannosidase, alpha, class 2B, member 1 1729 220 C20140605_SFK031_03 C20140605_SFK031_03 TB556597.[MT7]-SQGGSSLR.2b7_1.heavy 468.255 / 761.391 728.0 16.83217477798462 27 5 10 6 6 1.6424732522854681 60.88379208663035 0.03669929504394531 5 0.6853807875759077 2.139749674359089 728.0 2.5017182130584192 6.0 - - - - - - - 180.16666666666666 2 24 MAN2B1 mannosidase, alpha, class 2B, member 1 1731 220 C20140605_SFK031_03 C20140605_SFK031_03 TB556597.[MT7]-SQGGSSLR.2y7_1.heavy 468.255 / 704.369 534.0 16.83217477798462 27 5 10 6 6 1.6424732522854681 60.88379208663035 0.03669929504394531 5 0.6853807875759077 2.139749674359089 534.0 0.6720826531296823 13.0 - - - - - - - 175.76190476190476 4 21 MAN2B1 mannosidase, alpha, class 2B, member 1 1733 221 C20140605_SFK031_03 C20140605_SFK031_03 TB559186.[MT7]-RPFIDEAK[MT7].3y3_1.heavy 421.915 / 491.295 317101.0 24.5132999420166 44 16 10 10 8 3.2605625357102013 30.669554380504607 0.0 4 0.9692633277032248 7.021262773905495 317101.0 177.74311243559228 0.0 - - - - - - - 942.0 634 1 SOX21;SOX1;SOX2;SOX3 SRY (sex determining region Y)-box 21;SRY (sex determining region Y)-box 1;SRY (sex determining region Y)-box 2;SRY (sex determining region Y)-box 3 1735 221 C20140605_SFK031_03 C20140605_SFK031_03 TB559186.[MT7]-RPFIDEAK[MT7].3b5_1.heavy 421.915 / 773.443 64598.0 24.5132999420166 44 16 10 10 8 3.2605625357102013 30.669554380504607 0.0 4 0.9692633277032248 7.021262773905495 64598.0 124.02345768880801 0.0 - - - - - - - 716.0 129 8 SOX21;SOX1;SOX2;SOX3 SRY (sex determining region Y)-box 21;SRY (sex determining region Y)-box 1;SRY (sex determining region Y)-box 2;SRY (sex determining region Y)-box 3 1737 221 C20140605_SFK031_03 C20140605_SFK031_03 TB559186.[MT7]-RPFIDEAK[MT7].3b3_1.heavy 421.915 / 545.332 153056.0 24.5132999420166 44 16 10 10 8 3.2605625357102013 30.669554380504607 0.0 4 0.9692633277032248 7.021262773905495 153056.0 69.96285201855784 1.0 - - - - - - - 1256.0 378 1 SOX21;SOX1;SOX2;SOX3 SRY (sex determining region Y)-box 21;SRY (sex determining region Y)-box 1;SRY (sex determining region Y)-box 2;SRY (sex determining region Y)-box 3 1739 221 C20140605_SFK031_03 C20140605_SFK031_03 TB559186.[MT7]-RPFIDEAK[MT7].3y4_1.heavy 421.915 / 606.321 337980.0 24.5132999420166 44 16 10 10 8 3.2605625357102013 30.669554380504607 0.0 4 0.9692633277032248 7.021262773905495 337980.0 169.57787681384457 0.0 - - - - - - - 274.5 675 2 SOX21;SOX1;SOX2;SOX3 SRY (sex determining region Y)-box 21;SRY (sex determining region Y)-box 1;SRY (sex determining region Y)-box 2;SRY (sex determining region Y)-box 3 1741 222 C20140605_SFK031_03 C20140605_SFK031_03 TB559192.[MT7]-TPLILAVEK[MT7].3y3_1.heavy 424.611 / 519.326 101038.0 37.55609893798828 44 14 10 10 10 1.9549114947599426 43.477402587964804 0.0 3 0.9479047247348766 5.383435825183454 101038.0 233.85040842469556 0.0 - - - - - - - 698.4666666666667 202 15 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1743 222 C20140605_SFK031_03 C20140605_SFK031_03 TB559192.[MT7]-TPLILAVEK[MT7].3b4_1.heavy 424.611 / 569.378 144089.0 37.55609893798828 44 14 10 10 10 1.9549114947599426 43.477402587964804 0.0 3 0.9479047247348766 5.383435825183454 144089.0 72.8315538239729 1.0 - - - - - - - 279.9 288 10 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1745 222 C20140605_SFK031_03 C20140605_SFK031_03 TB559192.[MT7]-TPLILAVEK[MT7].3y4_1.heavy 424.611 / 590.363 82262.0 37.55609893798828 44 14 10 10 10 1.9549114947599426 43.477402587964804 0.0 3 0.9479047247348766 5.383435825183454 82262.0 472.6745341495116 0.0 - - - - - - - 207.5 164 8 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1747 222 C20140605_SFK031_03 C20140605_SFK031_03 TB559192.[MT7]-TPLILAVEK[MT7].3b3_1.heavy 424.611 / 456.294 116184.0 37.55609893798828 44 14 10 10 10 1.9549114947599426 43.477402587964804 0.0 3 0.9479047247348766 5.383435825183454 116184.0 284.713025467027 0.0 - - - - - - - 531.875 232 8 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1749 223 C20140605_SFK031_03 C20140605_SFK031_03 TB560346.[MT7]-NAPYFPC[CAM]DK[MT7].3y3_1.heavy 467.235 / 566.273 60977.0 28.26689910888672 48 18 10 10 10 4.532516954143595 22.062796678251964 0.0 3 0.9846962907599751 9.963423637885898 60977.0 30.125796646247224 0.0 - - - - - - - 780.3333333333334 121 3 BCL6 B-cell CLL/lymphoma 6 1751 223 C20140605_SFK031_03 C20140605_SFK031_03 TB560346.[MT7]-NAPYFPC[CAM]DK[MT7].3b4_1.heavy 467.235 / 590.305 103651.0 28.26689910888672 48 18 10 10 10 4.532516954143595 22.062796678251964 0.0 3 0.9846962907599751 9.963423637885898 103651.0 65.62698476399699 0.0 - - - - - - - 1261.7142857142858 207 7 BCL6 B-cell CLL/lymphoma 6 1753 223 C20140605_SFK031_03 C20140605_SFK031_03 TB560346.[MT7]-NAPYFPC[CAM]DK[MT7].3b5_1.heavy 467.235 / 737.374 26179.0 28.26689910888672 48 18 10 10 10 4.532516954143595 22.062796678251964 0.0 3 0.9846962907599751 9.963423637885898 26179.0 44.64153437329948 0.0 - - - - - - - 673.8888888888889 52 9 BCL6 B-cell CLL/lymphoma 6 1755 223 C20140605_SFK031_03 C20140605_SFK031_03 TB560346.[MT7]-NAPYFPC[CAM]DK[MT7].3y4_1.heavy 467.235 / 663.325 92371.0 28.26689910888672 48 18 10 10 10 4.532516954143595 22.062796678251964 0.0 3 0.9846962907599751 9.963423637885898 92371.0 235.62484318717372 0.0 - - - - - - - 288.85714285714283 184 7 BCL6 B-cell CLL/lymphoma 6 1757 224 C20140605_SFK031_03 C20140605_SFK031_03 TB558351.[MT7]-TDRLEVC[CAM]R.2b3_1.heavy 596.815 / 517.285 1041.0 20.697874546051025 28 16 2 6 4 2.2524788180884405 29.60647237055035 0.03750038146972656 9 0.9676125185741357 6.83903169794275 1041.0 1.440484429065744 34.0 - - - - - - - 1288.7142857142858 9 7 MBNL1 muscleblind-like (Drosophila) 1759 224 C20140605_SFK031_03 C20140605_SFK031_03 TB558351.[MT7]-TDRLEVC[CAM]R.2y4_1.heavy 596.815 / 563.261 1272.0 20.697874546051025 28 16 2 6 4 2.2524788180884405 29.60647237055035 0.03750038146972656 9 0.9676125185741357 6.83903169794275 1272.0 0.4887608069164265 15.0 - - - - - - - 726.0555555555555 3 18 MBNL1 muscleblind-like (Drosophila) 1761 224 C20140605_SFK031_03 C20140605_SFK031_03 TB558351.[MT7]-TDRLEVC[CAM]R.2y5_1.heavy 596.815 / 676.345 1214.0 20.697874546051025 28 16 2 6 4 2.2524788180884405 29.60647237055035 0.03750038146972656 9 0.9676125185741357 6.83903169794275 1214.0 6.397641873498 3.0 - - - - - - - 234.04761904761904 7 21 MBNL1 muscleblind-like (Drosophila) 1763 224 C20140605_SFK031_03 C20140605_SFK031_03 TB558351.[MT7]-TDRLEVC[CAM]R.2b5_1.heavy 596.815 / 759.412 1851.0 20.697874546051025 28 16 2 6 4 2.2524788180884405 29.60647237055035 0.03750038146972656 9 0.9676125185741357 6.83903169794275 1851.0 13.99509628302732 0.0 - - - - - - - 186.0 3 23 MBNL1 muscleblind-like (Drosophila) 1765 225 C20140605_SFK031_03 C20140605_SFK031_03 TB295034.[MT7]-QTPLHLAVITTLPSVVR.3b4_1.heavy 663.737 / 584.352 81084.0 41.79942607879639 41 14 10 7 10 2.177927732674666 45.915205770942705 0.029499053955078125 3 0.9380290223331919 4.93173197460381 81084.0 70.67799833439474 0.0 - - - - - - - 1808.875 162 8 BCL3 B-cell CLL/lymphoma 3 1767 225 C20140605_SFK031_03 C20140605_SFK031_03 TB295034.[MT7]-QTPLHLAVITTLPSVVR.3y8_1.heavy 663.737 / 872.52 67322.0 41.79942607879639 41 14 10 7 10 2.177927732674666 45.915205770942705 0.029499053955078125 3 0.9380290223331919 4.93173197460381 67322.0 124.85931134997463 0.0 - - - - - - - 770.0 134 7 BCL3 B-cell CLL/lymphoma 3 1769 225 C20140605_SFK031_03 C20140605_SFK031_03 TB295034.[MT7]-QTPLHLAVITTLPSVVR.3y10_1.heavy 663.737 / 1084.67 40081.0 41.79942607879639 41 14 10 7 10 2.177927732674666 45.915205770942705 0.029499053955078125 3 0.9380290223331919 4.93173197460381 40081.0 100.3328684249344 0.0 - - - - - - - 764.4444444444445 80 9 BCL3 B-cell CLL/lymphoma 3 1771 225 C20140605_SFK031_03 C20140605_SFK031_03 TB295034.[MT7]-QTPLHLAVITTLPSVVR.3y9_1.heavy 663.737 / 985.604 63775.0 41.79942607879639 41 14 10 7 10 2.177927732674666 45.915205770942705 0.029499053955078125 3 0.9380290223331919 4.93173197460381 63775.0 124.43733731019523 0.0 - - - - - - - 717.1111111111111 127 9 BCL3 B-cell CLL/lymphoma 3 1773 226 C20140605_SFK031_03 C20140605_SFK031_03 TB558357.[MT7]-NLAQTYLAR.2y8_1.heavy 597.342 / 935.531 26772.0 31.07699966430664 50 20 10 10 10 15.003049557909943 6.665311583089304 0.0 3 0.9983909104585138 30.761960604076897 26772.0 135.53325 0.0 - - - - - - - 232.72727272727272 53 11 PML;LOC652346 promyelocytic leukemia;probable transcription factor PML-like 1775 226 C20140605_SFK031_03 C20140605_SFK031_03 TB558357.[MT7]-NLAQTYLAR.2b4_1.heavy 597.342 / 571.332 N/A 31.07699966430664 50 20 10 10 10 15.003049557909943 6.665311583089304 0.0 3 0.9983909104585138 30.761960604076897 11657.0 3.0974708333646 3.0 - - - - - - - 1729.0 23 2 PML;LOC652346 promyelocytic leukemia;probable transcription factor PML-like 1777 226 C20140605_SFK031_03 C20140605_SFK031_03 TB558357.[MT7]-NLAQTYLAR.2y6_1.heavy 597.342 / 751.41 14090.0 31.07699966430664 50 20 10 10 10 15.003049557909943 6.665311583089304 0.0 3 0.9983909104585138 30.761960604076897 14090.0 15.617818396450943 0.0 - - - - - - - 272.0 28 8 PML;LOC652346 promyelocytic leukemia;probable transcription factor PML-like 1779 226 C20140605_SFK031_03 C20140605_SFK031_03 TB558357.[MT7]-NLAQTYLAR.2y7_1.heavy 597.342 / 822.447 24979.0 31.07699966430664 50 20 10 10 10 15.003049557909943 6.665311583089304 0.0 3 0.9983909104585138 30.761960604076897 24979.0 21.378878660949354 0.0 - - - - - - - 781.5 49 10 PML;LOC652346 promyelocytic leukemia;probable transcription factor PML-like 1781 227 C20140605_SFK031_03 C20140605_SFK031_03 TB559707.[MT7]-VIAC[CAM]FDSLK[MT7].3y3_1.heavy 447.588 / 491.331 96093.0 36.89889907836914 50 20 10 10 10 12.750015638996588 7.843127634615975 0.0 3 0.9978988254174437 26.91877095008006 96093.0 158.96337053571426 0.0 - - - - - - - 410.6666666666667 192 3 MBNL2;MBNL1 muscleblind-like 2 (Drosophila);muscleblind-like (Drosophila) 1783 227 C20140605_SFK031_03 C20140605_SFK031_03 TB559707.[MT7]-VIAC[CAM]FDSLK[MT7].3b4_1.heavy 447.588 / 588.33 75037.0 36.89889907836914 50 20 10 10 10 12.750015638996588 7.843127634615975 0.0 3 0.9978988254174437 26.91877095008006 75037.0 162.3887457482993 0.0 - - - - - - - 288.0 150 7 MBNL2;MBNL1 muscleblind-like 2 (Drosophila);muscleblind-like (Drosophila) 1785 227 C20140605_SFK031_03 C20140605_SFK031_03 TB559707.[MT7]-VIAC[CAM]FDSLK[MT7].3b5_1.heavy 447.588 / 735.398 8064.0 36.89889907836914 50 20 10 10 10 12.750015638996588 7.843127634615975 0.0 3 0.9978988254174437 26.91877095008006 8064.0 43.56 1.0 - - - - - - - 205.33333333333334 16 6 MBNL2;MBNL1 muscleblind-like 2 (Drosophila);muscleblind-like (Drosophila) 1787 227 C20140605_SFK031_03 C20140605_SFK031_03 TB559707.[MT7]-VIAC[CAM]FDSLK[MT7].3y4_1.heavy 447.588 / 606.358 41999.0 36.89889907836914 50 20 10 10 10 12.750015638996588 7.843127634615975 0.0 3 0.9978988254174437 26.91877095008006 41999.0 71.60543792517007 0.0 - - - - - - - 205.33333333333334 83 6 MBNL2;MBNL1 muscleblind-like 2 (Drosophila);muscleblind-like (Drosophila) 1789 228 C20140605_SFK031_03 C20140605_SFK031_03 TB557464.[MT7]-TGLSSPDAR.2b4_1.heavy 524.281 / 503.295 21892.0 21.130800247192383 31 5 10 10 6 0.7047599043415615 93.69165528010393 0.0 5 0.6942282171627647 2.1722955312979573 21892.0 17.871919405700684 0.0 - - - - - - - 477.0 43 1 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1791 228 C20140605_SFK031_03 C20140605_SFK031_03 TB557464.[MT7]-TGLSSPDAR.2y6_1.heavy 524.281 / 632.3 636.0 21.130800247192383 31 5 10 10 6 0.7047599043415615 93.69165528010393 0.0 5 0.6942282171627647 2.1722955312979573 636.0 1.0268181818181819 31.0 - - - - - - - 777.3333333333334 9 9 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1793 228 C20140605_SFK031_03 C20140605_SFK031_03 TB557464.[MT7]-TGLSSPDAR.2b5_1.heavy 524.281 / 590.327 1749.0 21.130800247192383 31 5 10 10 6 0.7047599043415615 93.69165528010393 0.0 5 0.6942282171627647 2.1722955312979573 1749.0 2.633529411764706 4.0 - - - - - - - 625.4 6 10 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1795 228 C20140605_SFK031_03 C20140605_SFK031_03 TB557464.[MT7]-TGLSSPDAR.2y7_1.heavy 524.281 / 745.384 19560.0 21.130800247192383 31 5 10 10 6 0.7047599043415615 93.69165528010393 0.0 5 0.6942282171627647 2.1722955312979573 19560.0 49.27991120976692 0.0 - - - - - - - 602.875 39 8 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1797 229 C20140605_SFK031_03 C20140605_SFK031_03 TB399845.[MT7]-AQSNEEVVQLSPDEETK[MT7].3y6_1.heavy 731.037 / 862.427 1008.0 25.939899444580078 29 7 10 10 2 0.8973845189387477 93.59861858832166 0.0 13 0.7424826693762836 2.3777442684494767 1008.0 1.4 13.0 - - - - - - - 1146.625 9 8 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1799 229 C20140605_SFK031_03 C20140605_SFK031_03 TB399845.[MT7]-AQSNEEVVQLSPDEETK[MT7].3b6_1.heavy 731.037 / 803.365 1109.0 25.939899444580078 29 7 10 10 2 0.8973845189387477 93.59861858832166 0.0 13 0.7424826693762836 2.3777442684494767 1109.0 0.0 20.0 - - - - - - - 1171.625 10 8 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1801 229 C20140605_SFK031_03 C20140605_SFK031_03 TB399845.[MT7]-AQSNEEVVQLSPDEETK[MT7].3b4_1.heavy 731.037 / 545.28 16023.0 25.939899444580078 29 7 10 10 2 0.8973845189387477 93.59861858832166 0.0 13 0.7424826693762836 2.3777442684494767 16023.0 23.486312753536932 0.0 - - - - - - - 683.8571428571429 32 14 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1803 229 C20140605_SFK031_03 C20140605_SFK031_03 TB399845.[MT7]-AQSNEEVVQLSPDEETK[MT7].3b5_1.heavy 731.037 / 674.323 2419.0 25.939899444580078 29 7 10 10 2 0.8973845189387477 93.59861858832166 0.0 13 0.7424826693762836 2.3777442684494767 2419.0 5.446081164317267 6.0 - - - - - - - 1179.3 5 10 RNASEL ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) 1805 230 C20140605_SFK031_03 C20140605_SFK031_03 TB557465.[MT7]-NQELQK[MT7].2y4_1.heavy 524.305 / 661.4 13371.0 17.900999069213867 50 20 10 10 10 6.076117040196965 16.45787915842358 0.0 3 0.9932504420147135 15.01343700060615 13371.0 42.32015250126503 0.0 - - - - - - - 617.1666666666666 26 12 PSPC1 paraspeckle component 1 1807 230 C20140605_SFK031_03 C20140605_SFK031_03 TB557465.[MT7]-NQELQK[MT7].2b3_1.heavy 524.305 / 516.253 26279.0 17.900999069213867 50 20 10 10 10 6.076117040196965 16.45787915842358 0.0 3 0.9932504420147135 15.01343700060615 26279.0 20.648198911408688 0.0 - - - - - - - 1697.125 52 8 PSPC1 paraspeckle component 1 1809 230 C20140605_SFK031_03 C20140605_SFK031_03 TB557465.[MT7]-NQELQK[MT7].2y5_1.heavy 524.305 / 789.459 10645.0 17.900999069213867 50 20 10 10 10 6.076117040196965 16.45787915842358 0.0 3 0.9932504420147135 15.01343700060615 10645.0 50.51301821274183 0.0 - - - - - - - 216.95652173913044 21 23 PSPC1 paraspeckle component 1 1811 230 C20140605_SFK031_03 C20140605_SFK031_03 TB557465.[MT7]-NQELQK[MT7].2y3_1.heavy 524.305 / 532.357 17022.0 17.900999069213867 50 20 10 10 10 6.076117040196965 16.45787915842358 0.0 3 0.9932504420147135 15.01343700060615 17022.0 50.04318433880994 0.0 - - - - - - - 580.4285714285714 34 7 PSPC1 paraspeckle component 1 1813 231 C20140605_SFK031_03 C20140605_SFK031_03 TB559196.[MT7]-LVNLFQQGGR.2y8_1.heavy 638.368 / 919.474 151419.0 38.63460159301758 48 18 10 10 10 6.260470196508455 15.973241124248348 0.0 3 0.9845284537729438 9.909094750842858 151419.0 312.3631571879081 0.0 - - - - - - - 669.75 302 8 BCL3 B-cell CLL/lymphoma 3 1815 231 C20140605_SFK031_03 C20140605_SFK031_03 TB559196.[MT7]-LVNLFQQGGR.2y9_1.heavy 638.368 / 1018.54 243587.0 38.63460159301758 48 18 10 10 10 6.260470196508455 15.973241124248348 0.0 3 0.9845284537729438 9.909094750842858 243587.0 252.58778043070805 0.0 - - - - - - - 376.0 487 5 BCL3 B-cell CLL/lymphoma 3 1817 231 C20140605_SFK031_03 C20140605_SFK031_03 TB559196.[MT7]-LVNLFQQGGR.2y6_1.heavy 638.368 / 692.347 94143.0 38.63460159301758 48 18 10 10 10 6.260470196508455 15.973241124248348 0.0 3 0.9845284537729438 9.909094750842858 94143.0 109.12209075717882 0.0 - - - - - - - 742.6 188 10 BCL3 B-cell CLL/lymphoma 3 1819 231 C20140605_SFK031_03 C20140605_SFK031_03 TB559196.[MT7]-LVNLFQQGGR.2y7_1.heavy 638.368 / 805.432 42980.0 38.63460159301758 48 18 10 10 10 6.260470196508455 15.973241124248348 0.0 3 0.9845284537729438 9.909094750842858 42980.0 50.34136539118374 0.0 - - - - - - - 693.25 85 8 BCL3 B-cell CLL/lymphoma 3 1821 232 C20140605_SFK031_03 C20140605_SFK031_03 TB399749.[MT7]-SSPEQPRPSTSK[MT7].3y10_2.heavy 530.289 / 635.847 6957.0 15.948399543762207 44 14 10 10 10 1.7396333329398168 39.39991068967177 0.0 3 0.9383289649558777 4.943836833977356 6957.0 15.72697017268446 0.0 - - - - - - - 220.5 13 16 PML promyelocytic leukemia 1823 232 C20140605_SFK031_03 C20140605_SFK031_03 TB399749.[MT7]-SSPEQPRPSTSK[MT7].3y11_2.heavy 530.289 / 679.363 7790.0 15.948399543762207 44 14 10 10 10 1.7396333329398168 39.39991068967177 0.0 3 0.9383289649558777 4.943836833977356 7790.0 24.24438775510204 0.0 - - - - - - - 201.44444444444446 15 18 PML promyelocytic leukemia 1825 232 C20140605_SFK031_03 C20140605_SFK031_03 TB399749.[MT7]-SSPEQPRPSTSK[MT7].3b4_1.heavy 530.289 / 545.269 4018.0 15.948399543762207 44 14 10 10 10 1.7396333329398168 39.39991068967177 0.0 3 0.9383289649558777 4.943836833977356 4018.0 20.91 0.0 - - - - - - - 250.44444444444446 8 18 PML promyelocytic leukemia 1827 232 C20140605_SFK031_03 C20140605_SFK031_03 TB399749.[MT7]-SSPEQPRPSTSK[MT7].3y5_1.heavy 530.289 / 663.379 6761.0 15.948399543762207 44 14 10 10 10 1.7396333329398168 39.39991068967177 0.0 3 0.9383289649558777 4.943836833977356 6761.0 33.391061224489796 0.0 - - - - - - - 214.375 13 16 PML promyelocytic leukemia 1829 233 C20140605_SFK031_03 C20140605_SFK031_03 TB559884.[MT7]-AAPGAEFAPNK[MT7].3y3_1.heavy 454.254 / 502.311 273228.0 25.111299514770508 46 16 10 10 10 2.8106162344516794 28.574949960285668 0.0 3 0.9651454175046391 6.591175249376696 273228.0 152.1403152253652 0.0 - - - - - - - 1169.0 546 1 NONO non-POU domain containing, octamer-binding 1831 233 C20140605_SFK031_03 C20140605_SFK031_03 TB559884.[MT7]-AAPGAEFAPNK[MT7].3b6_1.heavy 454.254 / 641.338 170151.0 25.111299514770508 46 16 10 10 10 2.8106162344516794 28.574949960285668 0.0 3 0.9651454175046391 6.591175249376696 170151.0 113.74684478490637 0.0 - - - - - - - 251.0 340 3 NONO non-POU domain containing, octamer-binding 1833 233 C20140605_SFK031_03 C20140605_SFK031_03 TB559884.[MT7]-AAPGAEFAPNK[MT7].3b5_1.heavy 454.254 / 512.295 64569.0 25.111299514770508 46 16 10 10 10 2.8106162344516794 28.574949960285668 0.0 3 0.9651454175046391 6.591175249376696 64569.0 50.770130483946154 0.0 - - - - - - - 1682.857142857143 129 7 NONO non-POU domain containing, octamer-binding 1835 233 C20140605_SFK031_03 C20140605_SFK031_03 TB559884.[MT7]-AAPGAEFAPNK[MT7].3b7_1.heavy 454.254 / 788.406 15704.0 25.111299514770508 46 16 10 10 10 2.8106162344516794 28.574949960285668 0.0 3 0.9651454175046391 6.591175249376696 15704.0 74.60183632734531 0.0 - - - - - - - 266.0 31 11 NONO non-POU domain containing, octamer-binding 1837 234 C20140605_SFK031_03 C20140605_SFK031_03 TB558070.[MT7]-LTETQVK[MT7].2y4_1.heavy 553.837 / 619.39 55104.0 22.39602518081665 46 20 10 6 10 18.697427310242784 5.348329389959346 0.03149986267089844 3 0.9986087170992983 33.08295398936586 55104.0 145.64075411186468 0.0 - - - - - - - 305.7142857142857 110 14 NKX3-1;NKX3-2 NK3 homeobox 1;NK3 homeobox 2 1839 234 C20140605_SFK031_03 C20140605_SFK031_03 TB558070.[MT7]-LTETQVK[MT7].2y5_1.heavy 553.837 / 748.432 22779.0 22.39602518081665 46 20 10 6 10 18.697427310242784 5.348329389959346 0.03149986267089844 3 0.9986087170992983 33.08295398936586 22779.0 31.85696426664058 0.0 - - - - - - - 296.375 45 16 NKX3-1;NKX3-2 NK3 homeobox 1;NK3 homeobox 2 1841 234 C20140605_SFK031_03 C20140605_SFK031_03 TB558070.[MT7]-LTETQVK[MT7].2y6_1.heavy 553.837 / 849.48 88483.0 22.39602518081665 46 20 10 6 10 18.697427310242784 5.348329389959346 0.03149986267089844 3 0.9986087170992983 33.08295398936586 88483.0 107.50235646783864 0.0 - - - - - - - 782.8888888888889 176 9 NKX3-1;NKX3-2 NK3 homeobox 1;NK3 homeobox 2 1843 234 C20140605_SFK031_03 C20140605_SFK031_03 TB558070.[MT7]-LTETQVK[MT7].2b5_1.heavy 553.837 / 717.39 20870.0 22.39602518081665 46 20 10 6 10 18.697427310242784 5.348329389959346 0.03149986267089844 3 0.9986087170992983 33.08295398936586 20870.0 38.05276057096687 0.0 - - - - - - - 607.3333333333334 41 9 NKX3-1;NKX3-2 NK3 homeobox 1;NK3 homeobox 2 1845 235 C20140605_SFK031_03 C20140605_SFK031_03 TB562063.[MT7]-FGQAATMEGIGAIGGTPPAFNR.3b9_1.heavy 769.727 / 1037.48 21004.0 39.9408016204834 41 15 10 6 10 3.204264579056902 31.2084091474845 0.034000396728515625 3 0.9545323867268162 5.7656977509234295 21004.0 67.40345807624124 0.0 - - - - - - - 695.8571428571429 42 7 NONO non-POU domain containing, octamer-binding 1847 235 C20140605_SFK031_03 C20140605_SFK031_03 TB562063.[MT7]-FGQAATMEGIGAIGGTPPAFNR.3b4_1.heavy 769.727 / 548.295 6849.0 39.9408016204834 41 15 10 6 10 3.204264579056902 31.2084091474845 0.034000396728515625 3 0.9545323867268162 5.7656977509234295 6849.0 12.902825848849947 0.0 - - - - - - - 712.6363636363636 13 11 NONO non-POU domain containing, octamer-binding 1849 235 C20140605_SFK031_03 C20140605_SFK031_03 TB562063.[MT7]-FGQAATMEGIGAIGGTPPAFNR.3b5_1.heavy 769.727 / 619.332 10882.0 39.9408016204834 41 15 10 6 10 3.204264579056902 31.2084091474845 0.034000396728515625 3 0.9545323867268162 5.7656977509234295 10882.0 15.380819819718184 0.0 - - - - - - - 731.7692307692307 21 13 NONO non-POU domain containing, octamer-binding 1851 235 C20140605_SFK031_03 C20140605_SFK031_03 TB562063.[MT7]-FGQAATMEGIGAIGGTPPAFNR.3y9_1.heavy 769.727 / 916.464 23287.0 39.9408016204834 41 15 10 6 10 3.204264579056902 31.2084091474845 0.034000396728515625 3 0.9545323867268162 5.7656977509234295 23287.0 79.31308051998838 0.0 - - - - - - - 685.0 46 9 NONO non-POU domain containing, octamer-binding 1853 236 C20140605_SFK031_03 C20140605_SFK031_03 TB295007.[MT7]-FAQPGTFEFEYASR.2b3_1.heavy 897.434 / 491.273 38720.0 38.231425285339355 32 7 10 5 10 0.8433981936037491 99.7807730572637 0.042697906494140625 3 0.711649412248338 2.240608907408004 38720.0 232.45969610768057 0.0 - - - - - - - 249.30769230769232 77 13 PSPC1 paraspeckle component 1 1855 236 C20140605_SFK031_03 C20140605_SFK031_03 TB295007.[MT7]-FAQPGTFEFEYASR.2y5_1.heavy 897.434 / 625.294 710.0 38.231425285339355 32 7 10 5 10 0.8433981936037491 99.7807730572637 0.042697906494140625 3 0.711649412248338 2.240608907408004 710.0 0.5841699155295645 22.0 - - - - - - - 296.7857142857143 2 14 PSPC1 paraspeckle component 1 1857 236 C20140605_SFK031_03 C20140605_SFK031_03 TB295007.[MT7]-FAQPGTFEFEYASR.2y6_1.heavy 897.434 / 772.362 1520.0 38.231425285339355 32 7 10 5 10 0.8433981936037491 99.7807730572637 0.042697906494140625 3 0.711649412248338 2.240608907408004 1520.0 5.8778395061728395 2.0 - - - - - - - 261.75 3 12 PSPC1 paraspeckle component 1 1859 236 C20140605_SFK031_03 C20140605_SFK031_03 TB295007.[MT7]-FAQPGTFEFEYASR.2y10_1.heavy 897.434 / 1206.54 3345.0 38.231425285339355 32 7 10 5 10 0.8433981936037491 99.7807730572637 0.042697906494140625 3 0.711649412248338 2.240608907408004 3345.0 15.656988574587112 0.0 - - - - - - - 709.5555555555555 6 9 PSPC1 paraspeckle component 1 1861 237 C20140605_SFK031_03 C20140605_SFK031_03 TB295002.[MT7]-LRQEEPQSLQAAVR.3y7_1.heavy 590.331 / 744.436 110301.0 26.473800659179688 45 15 10 10 10 1.473349725842292 40.89792020853206 0.0 3 0.9573496384780369 5.954499044571753 110301.0 106.16865402932638 0.0 - - - - - - - 172.0 220 1 PML promyelocytic leukemia 1863 237 C20140605_SFK031_03 C20140605_SFK031_03 TB295002.[MT7]-LRQEEPQSLQAAVR.3b5_1.heavy 590.331 / 800.438 70403.0 26.473800659179688 45 15 10 10 10 1.473349725842292 40.89792020853206 0.0 3 0.9573496384780369 5.954499044571753 70403.0 120.79391533302186 0.0 - - - - - - - 1292.5714285714287 140 7 PML promyelocytic leukemia 1865 237 C20140605_SFK031_03 C20140605_SFK031_03 TB295002.[MT7]-LRQEEPQSLQAAVR.3y5_1.heavy 590.331 / 544.32 145287.0 26.473800659179688 45 15 10 10 10 1.473349725842292 40.89792020853206 0.0 3 0.9573496384780369 5.954499044571753 145287.0 122.61765984395853 0.0 - - - - - - - 732.5 290 2 PML promyelocytic leukemia 1867 237 C20140605_SFK031_03 C20140605_SFK031_03 TB295002.[MT7]-LRQEEPQSLQAAVR.3y9_1.heavy 590.331 / 969.548 51962.0 26.473800659179688 45 15 10 10 10 1.473349725842292 40.89792020853206 0.0 3 0.9573496384780369 5.954499044571753 51962.0 118.37618304456063 0.0 - - - - - - - 603.1111111111111 103 9 PML promyelocytic leukemia 1869 238 C20140605_SFK031_03 C20140605_SFK031_03 TB295001.[MT7]-ALLDSAAPGTLDLEAR.2y9_1.heavy 878.982 / 971.516 156994.0 38.062599182128906 40 10 10 10 10 0.5892457917351182 81.04216420594092 0.0 3 0.8363634251165422 3.008249406679925 156994.0 94.34608172729128 0.0 - - - - - - - 209.4 313 10 BCL3 B-cell CLL/lymphoma 3 1871 238 C20140605_SFK031_03 C20140605_SFK031_03 TB295001.[MT7]-ALLDSAAPGTLDLEAR.2b7_1.heavy 878.982 / 786.448 80539.0 38.062599182128906 40 10 10 10 10 0.5892457917351182 81.04216420594092 0.0 3 0.8363634251165422 3.008249406679925 80539.0 15.39753456767881 1.0 - - - - - - - 733.2857142857143 216 7 BCL3 B-cell CLL/lymphoma 3 1873 238 C20140605_SFK031_03 C20140605_SFK031_03 TB295001.[MT7]-ALLDSAAPGTLDLEAR.2b5_1.heavy 878.982 / 644.374 26916.0 38.062599182128906 40 10 10 10 10 0.5892457917351182 81.04216420594092 0.0 3 0.8363634251165422 3.008249406679925 26916.0 36.68204353557435 0.0 - - - - - - - 269.14285714285717 53 14 BCL3 B-cell CLL/lymphoma 3 1875 238 C20140605_SFK031_03 C20140605_SFK031_03 TB295001.[MT7]-ALLDSAAPGTLDLEAR.2y11_1.heavy 878.982 / 1113.59 23879.0 38.062599182128906 40 10 10 10 10 0.5892457917351182 81.04216420594092 0.0 3 0.8363634251165422 3.008249406679925 23879.0 52.41175007168864 0.0 - - - - - - - 238.0 47 11 BCL3 B-cell CLL/lymphoma 3 1877 239 C20140605_SFK031_03 C20140605_SFK031_03 TB295000.[MT7]-ELLNLTQQDYVNR.2b3_1.heavy 875.466 / 500.32 19075.0 36.3406982421875 40 10 10 10 10 0.7814377465106879 75.91825879956521 0.0 3 0.8344011573456427 2.9898525006325825 19075.0 106.95042735042736 0.0 - - - - - - - 247.0 38 9 C16orf62 chromosome 16 open reading frame 62 1879 239 C20140605_SFK031_03 C20140605_SFK031_03 TB295000.[MT7]-ELLNLTQQDYVNR.2y4_1.heavy 875.466 / 551.294 12405.0 36.3406982421875 40 10 10 10 10 0.7814377465106879 75.91825879956521 0.0 3 0.8344011573456427 2.9898525006325825 12405.0 40.9965811965812 0.0 - - - - - - - 370.5 24 12 C16orf62 chromosome 16 open reading frame 62 1881 239 C20140605_SFK031_03 C20140605_SFK031_03 TB295000.[MT7]-ELLNLTQQDYVNR.2y8_1.heavy 875.466 / 1023.49 24107.0 36.3406982421875 40 10 10 10 10 0.7814377465106879 75.91825879956521 0.0 3 0.8344011573456427 2.9898525006325825 24107.0 68.28844932844933 0.0 - - - - - - - 745.875 48 8 C16orf62 chromosome 16 open reading frame 62 1883 239 C20140605_SFK031_03 C20140605_SFK031_03 TB295000.[MT7]-ELLNLTQQDYVNR.2b4_1.heavy 875.466 / 614.363 14394.0 36.3406982421875 40 10 10 10 10 0.7814377465106879 75.91825879956521 0.0 3 0.8344011573456427 2.9898525006325825 14394.0 38.47347319347319 0.0 - - - - - - - 329.72727272727275 28 11 C16orf62 chromosome 16 open reading frame 62 1885 240 C20140605_SFK031_03 C20140605_SFK031_03 TB558943.[MT7]-LRNADIELR.3y3_1.heavy 415.246 / 417.246 40193.0 26.843900680541992 42 14 10 10 8 2.053062636607876 38.193836337297704 0.0 4 0.9373295981444164 4.903842274957921 40193.0 20.696647809038083 0.0 - - - - - - - 190.0 80 1 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1887 240 C20140605_SFK031_03 C20140605_SFK031_03 TB558943.[MT7]-LRNADIELR.3b5_1.heavy 415.246 / 714.401 18148.0 26.843900680541992 42 14 10 10 8 2.053062636607876 38.193836337297704 0.0 4 0.9373295981444164 4.903842274957921 18148.0 48.576601503759406 0.0 - - - - - - - 267.72727272727275 36 11 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1889 240 C20140605_SFK031_03 C20140605_SFK031_03 TB558943.[MT7]-LRNADIELR.3y4_1.heavy 415.246 / 530.33 N/A 26.843900680541992 42 14 10 10 8 2.053062636607876 38.193836337297704 0.0 4 0.9373295981444164 4.903842274957921 49884.0 18.171305631599346 0.0 - - - - - - - 855.0 99 3 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1891 240 C20140605_SFK031_03 C20140605_SFK031_03 TB558943.[MT7]-LRNADIELR.3y5_1.heavy 415.246 / 645.357 12067.0 26.843900680541992 42 14 10 10 8 2.053062636607876 38.193836337297704 0.0 4 0.9373295981444164 4.903842274957921 12067.0 23.20254792822933 2.0 - - - - - - - 348.3333333333333 58 9 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1893 241 C20140605_SFK031_03 C20140605_SFK031_03 TB560529.[MT7]-C[CAM]TLRNPTVAPR.3b9_2.heavy 476.934 / 579.315 10044.0 21.43257474899292 44 18 10 6 10 8.41341530344995 11.885779602368453 0.03289985656738281 3 0.9865226983132431 10.61871403384781 10044.0 6.035565602877163 0.0 - - - - - - - 1232.6363636363637 20 11 SOLH small optic lobes homolog (Drosophila) 1895 241 C20140605_SFK031_03 C20140605_SFK031_03 TB560529.[MT7]-C[CAM]TLRNPTVAPR.3y7_1.heavy 476.934 / 754.421 7596.0 21.43257474899292 44 18 10 6 10 8.41341530344995 11.885779602368453 0.03289985656738281 3 0.9865226983132431 10.61871403384781 7596.0 26.472686744442615 0.0 - - - - - - - 243.3125 15 16 SOLH small optic lobes homolog (Drosophila) 1897 241 C20140605_SFK031_03 C20140605_SFK031_03 TB560529.[MT7]-C[CAM]TLRNPTVAPR.3y6_1.heavy 476.934 / 640.378 25235.0 21.43257474899292 44 18 10 6 10 8.41341530344995 11.885779602368453 0.03289985656738281 3 0.9865226983132431 10.61871403384781 25235.0 108.5725215481564 0.0 - - - - - - - 260.7692307692308 50 13 SOLH small optic lobes homolog (Drosophila) 1899 241 C20140605_SFK031_03 C20140605_SFK031_03 TB560529.[MT7]-C[CAM]TLRNPTVAPR.3y5_1.heavy 476.934 / 543.325 10106.0 21.43257474899292 44 18 10 6 10 8.41341530344995 11.885779602368453 0.03289985656738281 3 0.9865226983132431 10.61871403384781 10106.0 9.285485521147969 0.0 - - - - - - - 1686.142857142857 20 7 SOLH small optic lobes homolog (Drosophila) 1901 242 C20140605_SFK031_03 C20140605_SFK031_03 TB557209.[MT7]-QVTFTK[MT7].2y4_1.heavy 506.307 / 640.379 73322.0 24.478200912475586 50 20 10 10 10 6.331958751109669 15.792901364443525 0.0 3 0.9943734037076314 16.445067038149475 73322.0 143.8899257442518 0.0 - - - - - - - 315.1818181818182 146 11 MEF2B;MEF2A;LOC729991-MEF2B;MEF2C;MEF2D myocyte enhancer factor 2B;myocyte enhancer factor 2A;LOC729991-MEF2B readthrough transcript;myocyte enhancer factor 2C;myocyte enhancer factor 2D 1903 242 C20140605_SFK031_03 C20140605_SFK031_03 TB557209.[MT7]-QVTFTK[MT7].2y5_1.heavy 506.307 / 739.447 69936.0 24.478200912475586 50 20 10 10 10 6.331958751109669 15.792901364443525 0.0 3 0.9943734037076314 16.445067038149475 69936.0 95.12399050209385 0.0 - - - - - - - 716.6 139 10 MEF2B;MEF2A;LOC729991-MEF2B;MEF2C;MEF2D myocyte enhancer factor 2B;myocyte enhancer factor 2A;LOC729991-MEF2B readthrough transcript;myocyte enhancer factor 2C;myocyte enhancer factor 2D 1905 242 C20140605_SFK031_03 C20140605_SFK031_03 TB557209.[MT7]-QVTFTK[MT7].2y3_1.heavy 506.307 / 539.331 37016.0 24.478200912475586 50 20 10 10 10 6.331958751109669 15.792901364443525 0.0 3 0.9943734037076314 16.445067038149475 37016.0 74.93860899545525 0.0 - - - - - - - 669.375 74 8 MEF2B;MEF2A;LOC729991-MEF2B;MEF2C;MEF2D myocyte enhancer factor 2B;myocyte enhancer factor 2A;LOC729991-MEF2B readthrough transcript;myocyte enhancer factor 2C;myocyte enhancer factor 2D 1907 242 C20140605_SFK031_03 C20140605_SFK031_03 TB557209.[MT7]-QVTFTK[MT7].2b5_1.heavy 506.307 / 721.4 6694.0 24.478200912475586 50 20 10 10 10 6.331958751109669 15.792901364443525 0.0 3 0.9943734037076314 16.445067038149475 6694.0 16.819570136078003 2.0 - - - - - - - 708.8 55 10 MEF2B;MEF2A;LOC729991-MEF2B;MEF2C;MEF2D myocyte enhancer factor 2B;myocyte enhancer factor 2A;LOC729991-MEF2B readthrough transcript;myocyte enhancer factor 2C;myocyte enhancer factor 2D 1909 243 C20140605_SFK031_03 C20140605_SFK031_03 TB557208.[MT7]-VVFTEK[MT7].2y4_1.heavy 505.81 / 668.374 57734.0 27.50124979019165 46 20 10 6 10 5.49916855733884 18.18456716816697 0.03980064392089844 3 0.99207369596693 13.852868961002274 57734.0 46.32484380262513 0.0 - - - - - - - 391.3333333333333 115 6 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1911 243 C20140605_SFK031_03 C20140605_SFK031_03 TB557208.[MT7]-VVFTEK[MT7].2y5_1.heavy 505.81 / 767.442 55972.0 27.50124979019165 46 20 10 6 10 5.49916855733884 18.18456716816697 0.03980064392089844 3 0.99207369596693 13.852868961002274 55972.0 86.89306335983501 0.0 - - - - - - - 741.0 111 7 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1913 243 C20140605_SFK031_03 C20140605_SFK031_03 TB557208.[MT7]-VVFTEK[MT7].2b4_1.heavy 505.81 / 591.362 5480.0 27.50124979019165 46 20 10 6 10 5.49916855733884 18.18456716816697 0.03980064392089844 3 0.99207369596693 13.852868961002274 5480.0 3.118082012096523 6.0 - - - - - - - 724.2 14 5 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1915 243 C20140605_SFK031_03 C20140605_SFK031_03 TB557208.[MT7]-VVFTEK[MT7].2y3_1.heavy 505.81 / 521.305 35423.0 27.50124979019165 46 20 10 6 10 5.49916855733884 18.18456716816697 0.03980064392089844 3 0.99207369596693 13.852868961002274 35423.0 45.31134749819196 0.0 - - - - - - - 812.4 70 10 NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 1917 244 C20140605_SFK031_03 C20140605_SFK031_03 TB558077.[MT7]-ISQLAAVNR.2y8_1.heavy 558.336 / 858.479 110887.0 28.08329963684082 48 20 10 10 8 6.559816645959592 15.244328522748162 0.0 4 0.9943504590114538 16.411607128720963 110887.0 122.67960460530634 0.0 - - - - - - - 319.3333333333333 221 3 PML;LOC652346 promyelocytic leukemia;probable transcription factor PML-like 1919 244 C20140605_SFK031_03 C20140605_SFK031_03 TB558077.[MT7]-ISQLAAVNR.2y5_1.heavy 558.336 / 530.305 42035.0 28.08329963684082 48 20 10 10 8 6.559816645959592 15.244328522748162 0.0 4 0.9943504590114538 16.411607128720963 42035.0 10.956384387705665 0.0 - - - - - - - 3086.0 84 1 PML;LOC652346 promyelocytic leukemia;probable transcription factor PML-like 1921 244 C20140605_SFK031_03 C20140605_SFK031_03 TB558077.[MT7]-ISQLAAVNR.2b4_1.heavy 558.336 / 586.368 18942.0 28.08329963684082 48 20 10 10 8 6.559816645959592 15.244328522748162 0.0 4 0.9943504590114538 16.411607128720963 18942.0 13.247591638306414 0.0 - - - - - - - 1234.5 37 10 PML;LOC652346 promyelocytic leukemia;probable transcription factor PML-like 1923 244 C20140605_SFK031_03 C20140605_SFK031_03 TB558077.[MT7]-ISQLAAVNR.2y6_1.heavy 558.336 / 643.389 20219.0 28.08329963684082 48 20 10 10 8 6.559816645959592 15.244328522748162 0.0 4 0.9943504590114538 16.411607128720963 20219.0 21.037895997431615 1.0 - - - - - - - 1238.2727272727273 109 11 PML;LOC652346 promyelocytic leukemia;probable transcription factor PML-like 1925 245 C20140605_SFK031_03 C20140605_SFK031_03 TB558700.[MT7]-WLTLEVC[CAM]R.2y5_1.heavy 610.833 / 676.345 34438.0 39.991798400878906 50 20 10 10 10 11.338664663874628 8.819380673511178 0.0 3 0.9984143135056658 30.988196523709597 34438.0 36.10315830296675 0.0 - - - - - - - 849.9090909090909 68 11 MBNL2;MBNL1;MBNL3 muscleblind-like 2 (Drosophila);muscleblind-like (Drosophila);muscleblind-like 3 (Drosophila) 1927 245 C20140605_SFK031_03 C20140605_SFK031_03 TB558700.[MT7]-WLTLEVC[CAM]R.2y6_1.heavy 610.833 / 777.392 85017.0 39.991798400878906 50 20 10 10 10 11.338664663874628 8.819380673511178 0.0 3 0.9984143135056658 30.988196523709597 85017.0 120.87883658877095 0.0 - - - - - - - 731.3076923076923 170 13 MBNL2;MBNL1;MBNL3 muscleblind-like 2 (Drosophila);muscleblind-like (Drosophila);muscleblind-like 3 (Drosophila) 1929 245 C20140605_SFK031_03 C20140605_SFK031_03 TB558700.[MT7]-WLTLEVC[CAM]R.2b5_1.heavy 610.833 / 787.447 25729.0 39.991798400878906 50 20 10 10 10 11.338664663874628 8.819380673511178 0.0 3 0.9984143135056658 30.988196523709597 25729.0 27.571612326711545 1.0 - - - - - - - 867.5714285714286 51 7 MBNL2;MBNL1;MBNL3 muscleblind-like 2 (Drosophila);muscleblind-like (Drosophila);muscleblind-like 3 (Drosophila) 1931 245 C20140605_SFK031_03 C20140605_SFK031_03 TB558700.[MT7]-WLTLEVC[CAM]R.2y7_1.heavy 610.833 / 890.476 111864.0 39.991798400878906 50 20 10 10 10 11.338664663874628 8.819380673511178 0.0 3 0.9984143135056658 30.988196523709597 111864.0 297.4235518886138 0.0 - - - - - - - 295.3076923076923 223 13 MBNL2;MBNL1;MBNL3 muscleblind-like 2 (Drosophila);muscleblind-like (Drosophila);muscleblind-like 3 (Drosophila) 1933 246 C20140605_SFK031_03 C20140605_SFK031_03 TB558073.[MT7]-LLSETEK[MT7].2y4_1.heavy 554.329 / 650.348 22690.0 26.163299560546875 50 20 10 10 10 6.252730347532344 15.993013362468966 0.0 3 0.9925996354602241 14.337308189754037 22690.0 32.52196096035217 0.0 - - - - - - - 778.7777777777778 45 9 SOX2 SRY (sex determining region Y)-box 2 1935 246 C20140605_SFK031_03 C20140605_SFK031_03 TB558073.[MT7]-LLSETEK[MT7].2y5_1.heavy 554.329 / 737.38 58609.0 26.163299560546875 50 20 10 10 10 6.252730347532344 15.993013362468966 0.0 3 0.9925996354602241 14.337308189754037 58609.0 90.81648162442434 0.0 - - - - - - - 766.5 117 8 SOX2 SRY (sex determining region Y)-box 2 1937 246 C20140605_SFK031_03 C20140605_SFK031_03 TB558073.[MT7]-LLSETEK[MT7].2y3_1.heavy 554.329 / 521.305 34692.0 26.163299560546875 50 20 10 10 10 6.252730347532344 15.993013362468966 0.0 3 0.9925996354602241 14.337308189754037 34692.0 24.339094155400268 0.0 - - - - - - - 1714.7142857142858 69 7 SOX2 SRY (sex determining region Y)-box 2 1939 246 C20140605_SFK031_03 C20140605_SFK031_03 TB558073.[MT7]-LLSETEK[MT7].2y6_1.heavy 554.329 / 850.464 70524.0 26.163299560546875 50 20 10 10 10 6.252730347532344 15.993013362468966 0.0 3 0.9925996354602241 14.337308189754037 70524.0 36.423543977792434 0.0 - - - - - - - 730.0 141 9 SOX2 SRY (sex determining region Y)-box 2 1941 247 C20140605_SFK031_03 C20140605_SFK031_03 TB561407.[MT7]-RRNPLSLPVEK[MT7].4b8_2.heavy 400 / 539.834 6000.0 27.25790023803711 44 16 10 10 8 4.393264071749879 22.762119091140598 0.0 4 0.9664979908275456 6.723678645653363 6000.0 14.463636363636363 0.0 - - - - - - - 280.0 12 10 SOS1 son of sevenless homolog 1 (Drosophila) 1943 247 C20140605_SFK031_03 C20140605_SFK031_03 TB561407.[MT7]-RRNPLSLPVEK[MT7].4b7_2.heavy 400 / 491.307 189302.0 27.25790023803711 44 16 10 10 8 4.393264071749879 22.762119091140598 0.0 4 0.9664979908275456 6.723678645653363 189302.0 58.087825758928574 0.0 - - - - - - - 900.0 378 1 SOS1 son of sevenless homolog 1 (Drosophila) 1945 247 C20140605_SFK031_03 C20140605_SFK031_03 TB561407.[MT7]-RRNPLSLPVEK[MT7].4y3_1.heavy 400 / 519.326 23100.0 27.25790023803711 44 16 10 10 8 4.393264071749879 22.762119091140598 0.0 4 0.9664979908275456 6.723678645653363 23100.0 11.94657894736842 1.0 - - - - - - - 333.3333333333333 46 3 SOS1 son of sevenless homolog 1 (Drosophila) 1947 247 C20140605_SFK031_03 C20140605_SFK031_03 TB561407.[MT7]-RRNPLSLPVEK[MT7].4b6_2.heavy 400 / 434.765 38800.0 27.25790023803711 44 16 10 10 8 4.393264071749879 22.762119091140598 0.0 4 0.9664979908275456 6.723678645653363 38800.0 89.12061538461538 1.0 - - - - - - - 260.0 248 5 SOS1 son of sevenless homolog 1 (Drosophila) 1949 248 C20140605_SFK031_03 C20140605_SFK031_03 TB559872.[MT7]-LRDEINLAK[MT7].3y3_1.heavy 453.945 / 475.336 71992.0 28.495749473571777 37 11 10 6 10 1.565130158905791 44.04459998462917 0.03569984436035156 3 0.8667075290578892 3.3420514525071336 71992.0 33.58422003366241 0.0 - - - - - - - 2730.777777777778 143 9 STIM1 stromal interaction molecule 1 1951 248 C20140605_SFK031_03 C20140605_SFK031_03 TB559872.[MT7]-LRDEINLAK[MT7].3b6_1.heavy 453.945 / 885.491 24904.0 28.495749473571777 37 11 10 6 10 1.565130158905791 44.04459998462917 0.03569984436035156 3 0.8667075290578892 3.3420514525071336 24904.0 205.4293087557604 0.0 - - - - - - - 225.69230769230768 49 13 STIM1 stromal interaction molecule 1 1953 248 C20140605_SFK031_03 C20140605_SFK031_03 TB559872.[MT7]-LRDEINLAK[MT7].3b4_1.heavy 453.945 / 658.364 39367.0 28.495749473571777 37 11 10 6 10 1.565130158905791 44.04459998462917 0.03569984436035156 3 0.8667075290578892 3.3420514525071336 39367.0 30.821566066383213 0.0 - - - - - - - 1242.7142857142858 78 7 STIM1 stromal interaction molecule 1 1955 248 C20140605_SFK031_03 C20140605_SFK031_03 TB559872.[MT7]-LRDEINLAK[MT7].3y4_1.heavy 453.945 / 589.379 43174.0 28.495749473571777 37 11 10 6 10 1.565130158905791 44.04459998462917 0.03569984436035156 3 0.8667075290578892 3.3420514525071336 43174.0 34.05249059006599 0.0 - - - - - - - 1244.4444444444443 86 9 STIM1 stromal interaction molecule 1 1957 249 C20140605_SFK031_03 C20140605_SFK031_03 TB558805.[MT7]-SFPHPIDK[MT7].3y3_1.heavy 410.236 / 519.326 52383.0 24.93899965286255 34 8 10 6 10 0.5010528108407127 93.93807225702474 0.03479957580566406 3 0.7858410324289032 2.6177003492304616 52383.0 43.78680532014537 0.0 - - - - - - - 967.3333333333334 104 3 SOS1 son of sevenless homolog 1 (Drosophila) 1959 249 C20140605_SFK031_03 C20140605_SFK031_03 TB558805.[MT7]-SFPHPIDK[MT7].3b4_1.heavy 410.236 / 613.321 34811.0 24.93899965286255 34 8 10 6 10 0.5010528108407127 93.93807225702474 0.03479957580566406 3 0.7858410324289032 2.6177003492304616 34811.0 51.06906220984215 0.0 - - - - - - - 783.7272727272727 69 11 SOS1 son of sevenless homolog 1 (Drosophila) 1961 249 C20140605_SFK031_03 C20140605_SFK031_03 TB558805.[MT7]-SFPHPIDK[MT7].3y4_2.heavy 410.236 / 308.693 112142.0 24.93899965286255 34 8 10 6 10 0.5010528108407127 93.93807225702474 0.03479957580566406 3 0.7858410324289032 2.6177003492304616 112142.0 60.82983544641206 0.0 - - - - - - - 712.8 224 5 SOS1 son of sevenless homolog 1 (Drosophila) 1963 249 C20140605_SFK031_03 C20140605_SFK031_03 TB558805.[MT7]-SFPHPIDK[MT7].3y4_1.heavy 410.236 / 616.379 62577.0 24.93899965286255 34 8 10 6 10 0.5010528108407127 93.93807225702474 0.03479957580566406 3 0.7858410324289032 2.6177003492304616 62577.0 51.06927611748309 0.0 - - - - - - - 884.3333333333334 125 9 SOS1 son of sevenless homolog 1 (Drosophila) 1965 250 C20140605_SFK031_03 C20140605_SFK031_03 TB557971.[MT7]-AAFSHAQVFELER.3y7_1.heavy 550.29 / 920.484 35087.0 33.673500061035156 50 20 10 10 10 9.674491470183595 10.336460609655413 0.0 3 0.9956466338875584 18.697868199871703 35087.0 298.4506379513166 0.0 - - - - - - - 257.4 70 5 NKX3-2 NK3 homeobox 2 1967 250 C20140605_SFK031_03 C20140605_SFK031_03 TB557971.[MT7]-AAFSHAQVFELER.3y6_1.heavy 550.29 / 792.425 49739.0 33.673500061035156 50 20 10 10 10 9.674491470183595 10.336460609655413 0.0 3 0.9956466338875584 18.697868199871703 49739.0 78.85903677496813 0.0 - - - - - - - 308.6 99 5 NKX3-2 NK3 homeobox 2 1969 250 C20140605_SFK031_03 C20140605_SFK031_03 TB557971.[MT7]-AAFSHAQVFELER.3b4_1.heavy 550.29 / 521.284 66961.0 33.673500061035156 50 20 10 10 10 9.674491470183595 10.336460609655413 0.0 3 0.9956466338875584 18.697868199871703 66961.0 40.289777640369834 0.0 - - - - - - - 514.0 133 1 NKX3-2 NK3 homeobox 2 1971 250 C20140605_SFK031_03 C20140605_SFK031_03 TB557971.[MT7]-AAFSHAQVFELER.3y5_1.heavy 550.29 / 693.357 73259.0 33.673500061035156 50 20 10 10 10 9.674491470183595 10.336460609655413 0.0 3 0.9956466338875584 18.697868199871703 73259.0 55.471806315460924 0.0 - - - - - - - 386.0 146 1 NKX3-2 NK3 homeobox 2 1973 251 C20140605_SFK031_03 C20140605_SFK031_03 TB558477.[MT7]-LPDSPALAK[MT7].2y6_1.heavy 600.366 / 730.458 17050.0 29.34469985961914 42 14 10 10 8 2.1039170566232763 47.53039084178394 0.0 4 0.9383313472478371 4.943933328808596 17050.0 21.883992889325896 0.0 - - - - - - - 1195.25 34 8 STIM1 stromal interaction molecule 1 1975 251 C20140605_SFK031_03 C20140605_SFK031_03 TB558477.[MT7]-LPDSPALAK[MT7].2y4_1.heavy 600.366 / 546.373 N/A 29.34469985961914 42 14 10 10 8 2.1039170566232763 47.53039084178394 0.0 4 0.9383313472478371 4.943933328808596 3571.0 0.8384641068447413 27.0 - - - - - - - 2764.714285714286 19 7 STIM1 stromal interaction molecule 1 1977 251 C20140605_SFK031_03 C20140605_SFK031_03 TB558477.[MT7]-LPDSPALAK[MT7].2y8_1.heavy 600.366 / 942.538 61632.0 29.34469985961914 42 14 10 10 8 2.1039170566232763 47.53039084178394 0.0 4 0.9383313472478371 4.943933328808596 61632.0 122.27317896767968 2.0 - - - - - - - 287.875 134 8 STIM1 stromal interaction molecule 1 1979 251 C20140605_SFK031_03 C20140605_SFK031_03 TB558477.[MT7]-LPDSPALAK[MT7].2y5_1.heavy 600.366 / 643.426 8525.0 29.34469985961914 42 14 10 10 8 2.1039170566232763 47.53039084178394 0.0 4 0.9383313472478371 4.943933328808596 8525.0 3.184418486513195 1.0 - - - - - - - 1777.2857142857142 17 7 STIM1 stromal interaction molecule 1 1981 252 C20140605_SFK031_03 C20140605_SFK031_03 TB558479.[MT7]-AEGVSTPLAGR.2b4_1.heavy 601.336 / 501.279 17397.0 24.860599517822266 45 17 10 10 8 8.92179023722785 11.208512791830856 0.0 4 0.9776445486195936 8.238691499360622 17397.0 19.164730049966202 1.0 - - - - - - - 1247.4 38 10 PML;LOC652346 promyelocytic leukemia;probable transcription factor PML-like 1983 252 C20140605_SFK031_03 C20140605_SFK031_03 TB558479.[MT7]-AEGVSTPLAGR.2y9_1.heavy 601.336 / 857.484 12474.0 24.860599517822266 45 17 10 10 8 8.92179023722785 11.208512791830856 0.0 4 0.9776445486195936 8.238691499360622 12474.0 52.64530905446041 0.0 - - - - - - - 303.88235294117646 24 17 PML;LOC652346 promyelocytic leukemia;probable transcription factor PML-like 1985 252 C20140605_SFK031_03 C20140605_SFK031_03 TB558479.[MT7]-AEGVSTPLAGR.2y10_1.heavy 601.336 / 986.526 17726.0 24.860599517822266 45 17 10 10 8 8.92179023722785 11.208512791830856 0.0 4 0.9776445486195936 8.238691499360622 17726.0 54.042212888273696 0.0 - - - - - - - 779.625 35 8 PML;LOC652346 promyelocytic leukemia;probable transcription factor PML-like 1987 252 C20140605_SFK031_03 C20140605_SFK031_03 TB558479.[MT7]-AEGVSTPLAGR.2y7_1.heavy 601.336 / 701.394 22485.0 24.860599517822266 45 17 10 10 8 8.92179023722785 11.208512791830856 0.0 4 0.9776445486195936 8.238691499360622 22485.0 58.030956784517066 0.0 - - - - - - - 388.1333333333333 44 15 PML;LOC652346 promyelocytic leukemia;probable transcription factor PML-like 1989 253 C20140605_SFK031_03 C20140605_SFK031_03 TB294684.[MT7]-GRPSGK[MT7].2y4_1.heavy 445.277 / 532.321 1227.0 13.462200164794922 30 0 10 10 10 0.22350611793972164 172.3600886284907 0.0 3 0.3951697049490527 1.498723654188559 1227.0 8.098234867860187 0.0 - - - - - - - 184.05555555555554 2 18 NONO non-POU domain containing, octamer-binding 1991 253 C20140605_SFK031_03 C20140605_SFK031_03 TB294684.[MT7]-GRPSGK[MT7].2y5_1.heavy 445.277 / 688.422 10202.0 13.462200164794922 30 0 10 10 10 0.22350611793972164 172.3600886284907 0.0 3 0.3951697049490527 1.498723654188559 10202.0 274.3236647727273 0.0 - - - - - - - 120.125 20 16 NONO non-POU domain containing, octamer-binding 1993 253 C20140605_SFK031_03 C20140605_SFK031_03 TB294684.[MT7]-GRPSGK[MT7].2y3_1.heavy 445.277 / 435.268 5633.0 13.462200164794922 30 0 10 10 10 0.22350611793972164 172.3600886284907 0.0 3 0.3951697049490527 1.498723654188559 5633.0 26.3769071429644 0.0 - - - - - - - 726.5714285714286 11 7 NONO non-POU domain containing, octamer-binding 1995 253 C20140605_SFK031_03 C20140605_SFK031_03 TB294684.[MT7]-GRPSGK[MT7].2b5_1.heavy 445.277 / 599.338 917.0 13.462200164794922 30 0 10 10 10 0.22350611793972164 172.3600886284907 0.0 3 0.3951697049490527 1.498723654188559 917.0 6.191156808982896 0.0 - - - - - - - 0.0 1 0 NONO non-POU domain containing, octamer-binding 1997 254 C20140605_SFK031_03 C20140605_SFK031_03 TB558807.[MT7]-LEMEQVWR.2b4_1.heavy 617.822 / 647.319 10624.0 37.17500114440918 41 16 10 5 10 3.6456086970100716 27.430261531363612 0.044399261474609375 3 0.9677756012504757 6.856409794618788 10624.0 8.82646255078059 0.0 - - - - - - - 443.0 21 3 MAN2B1 mannosidase, alpha, class 2B, member 1 1999 254 C20140605_SFK031_03 C20140605_SFK031_03 TB558807.[MT7]-LEMEQVWR.2y6_1.heavy 617.822 / 848.408 19145.0 37.17500114440918 41 16 10 5 10 3.6456086970100716 27.430261531363612 0.044399261474609375 3 0.9677756012504757 6.856409794618788 19145.0 45.78653614457831 0.0 - - - - - - - 319.6666666666667 38 9 MAN2B1 mannosidase, alpha, class 2B, member 1 2001 254 C20140605_SFK031_03 C20140605_SFK031_03 TB558807.[MT7]-LEMEQVWR.2b5_1.heavy 617.822 / 775.378 12948.0 37.17500114440918 41 16 10 5 10 3.6456086970100716 27.430261531363612 0.044399261474609375 3 0.9677756012504757 6.856409794618788 12948.0 11.805259685067153 0.0 - - - - - - - 774.8 25 5 MAN2B1 mannosidase, alpha, class 2B, member 1 2003 254 C20140605_SFK031_03 C20140605_SFK031_03 TB558807.[MT7]-LEMEQVWR.2y7_1.heavy 617.822 / 977.451 47253.0 37.17500114440918 41 16 10 5 10 3.6456086970100716 27.430261531363612 0.044399261474609375 3 0.9677756012504757 6.856409794618788 47253.0 39.822267032197374 0.0 - - - - - - - 1217.625 94 8 MAN2B1 mannosidase, alpha, class 2B, member 1 2005 255 C20140605_SFK031_03 C20140605_SFK031_03 TB560002.[MT7]-TFLASVQWK[MT7].3y3_1.heavy 456.602 / 605.353 15669.0 40.15640068054199 44 18 10 6 10 6.781752292711827 14.745451571191623 0.036800384521484375 3 0.986385601362285 10.564992239032664 15669.0 32.42561771561772 1.0 - - - - - - - 210.0 39 13 MAN2B1 mannosidase, alpha, class 2B, member 1 2007 255 C20140605_SFK031_03 C20140605_SFK031_03 TB560002.[MT7]-TFLASVQWK[MT7].3b4_1.heavy 456.602 / 577.347 36796.0 40.15640068054199 44 18 10 6 10 6.781752292711827 14.745451571191623 0.036800384521484375 3 0.986385601362285 10.564992239032664 36796.0 183.98000000000002 0.0 - - - - - - - 253.5 73 16 MAN2B1 mannosidase, alpha, class 2B, member 1 2009 255 C20140605_SFK031_03 C20140605_SFK031_03 TB560002.[MT7]-TFLASVQWK[MT7].3b5_1.heavy 456.602 / 664.379 22374.0 40.15640068054199 44 18 10 6 10 6.781752292711827 14.745451571191623 0.036800384521484375 3 0.986385601362285 10.564992239032664 22374.0 113.78230769230768 0.0 - - - - - - - 182.0 44 12 MAN2B1 mannosidase, alpha, class 2B, member 1 2011 255 C20140605_SFK031_03 C20140605_SFK031_03 TB560002.[MT7]-TFLASVQWK[MT7].3b3_1.heavy 456.602 / 506.31 38355.0 40.15640068054199 44 18 10 6 10 6.781752292711827 14.745451571191623 0.036800384521484375 3 0.986385601362285 10.564992239032664 38355.0 85.81125094988522 0.0 - - - - - - - 612.8571428571429 76 7 MAN2B1 mannosidase, alpha, class 2B, member 1 2013 256 C20140605_SFK031_03 C20140605_SFK031_03 TB399597.[MT7]-GLLVPALK[MT7].2y4_1.heavy 549.878 / 572.389 118856.0 37.241798400878906 46 16 10 10 10 1.2955718289010663 58.89074181778436 0.0 3 0.9620633118326313 6.316115128752106 118856.0 94.10507659013096 0.0 - - - - - - - 453.0 237 1 SOS1 son of sevenless homolog 1 (Drosophila) 2015 256 C20140605_SFK031_03 C20140605_SFK031_03 TB399597.[MT7]-GLLVPALK[MT7].2y5_1.heavy 549.878 / 671.457 22484.0 37.241798400878906 46 16 10 10 10 1.2955718289010663 58.89074181778436 0.0 3 0.9620633118326313 6.316115128752106 22484.0 23.711752895752895 1.0 - - - - - - - 1321.2857142857142 44 7 SOS1 son of sevenless homolog 1 (Drosophila) 2017 256 C20140605_SFK031_03 C20140605_SFK031_03 TB399597.[MT7]-GLLVPALK[MT7].2b4_1.heavy 549.878 / 527.367 56119.0 37.241798400878906 46 16 10 10 10 1.2955718289010663 58.89074181778436 0.0 3 0.9620633118326313 6.316115128752106 56119.0 21.25196369879184 2.0 - - - - - - - 1451.0 114 1 SOS1 son of sevenless homolog 1 (Drosophila) 2019 256 C20140605_SFK031_03 C20140605_SFK031_03 TB399597.[MT7]-GLLVPALK[MT7].2y6_1.heavy 549.878 / 784.541 4170.0 37.241798400878906 46 16 10 10 10 1.2955718289010663 58.89074181778436 0.0 3 0.9620633118326313 6.316115128752106 4170.0 5.334618772043621 1.0 - - - - - - - 764.1428571428571 17 7 SOS1 son of sevenless homolog 1 (Drosophila) 2021 257 C20140605_SFK031_03 C20140605_SFK031_03 TB558339.[MT7]-QRFESIEQVNNLR.3y7_1.heavy 592.987 / 872.458 36252.0 29.632999420166016 44 14 10 10 10 3.4248352831114843 29.198484520735654 0.0 3 0.9468409663516062 5.328818298369588 36252.0 47.31599141850285 1.0 - - - - - - - 234.0 74 6 RAGE renal tumor antigen 2023 257 C20140605_SFK031_03 C20140605_SFK031_03 TB558339.[MT7]-QRFESIEQVNNLR.3b4_1.heavy 592.987 / 705.38 11109.0 29.632999420166016 44 14 10 10 10 3.4248352831114843 29.198484520735654 0.0 3 0.9468409663516062 5.328818298369588 11109.0 10.609035607702056 1.0 - - - - - - - 741.0 34 9 RAGE renal tumor antigen 2025 257 C20140605_SFK031_03 C20140605_SFK031_03 TB558339.[MT7]-QRFESIEQVNNLR.3y4_1.heavy 592.987 / 516.289 96009.0 29.632999420166016 44 14 10 10 10 3.4248352831114843 29.198484520735654 0.0 3 0.9468409663516062 5.328818298369588 96009.0 78.41864481974514 0.0 - - - - - - - 819.0 192 1 RAGE renal tumor antigen 2027 257 C20140605_SFK031_03 C20140605_SFK031_03 TB558339.[MT7]-QRFESIEQVNNLR.3y5_1.heavy 592.987 / 615.357 74959.0 29.632999420166016 44 14 10 10 10 3.4248352831114843 29.198484520735654 0.0 3 0.9468409663516062 5.328818298369588 74959.0 57.39408637095262 0.0 - - - - - - - 409.5 149 2 RAGE renal tumor antigen 2029 258 C20140605_SFK031_03 C20140605_SFK031_03 TB561205.[MT7]-GIGDPLVSVY[MT7]AR.3b6_1.heavy 512.299 / 697.4 14271.0 32.610198974609375 40 10 10 10 10 1.714950617906628 58.31071691269223 0.0 3 0.8286936335119804 2.938132523660322 14271.0 13.108939892339825 0.0 - - - - - - - 778.125 28 8 C16orf62 chromosome 16 open reading frame 62 2031 258 C20140605_SFK031_03 C20140605_SFK031_03 TB561205.[MT7]-GIGDPLVSVY[MT7]AR.3y6_1.heavy 512.299 / 838.49 16217.0 32.610198974609375 40 10 10 10 10 1.714950617906628 58.31071691269223 0.0 3 0.8286936335119804 2.938132523660322 16217.0 48.23704896775874 0.0 - - - - - - - 244.88888888888889 32 9 C16orf62 chromosome 16 open reading frame 62 2033 258 C20140605_SFK031_03 C20140605_SFK031_03 TB561205.[MT7]-GIGDPLVSVY[MT7]AR.3y8_2.heavy 512.299 / 524.817 114946.0 32.610198974609375 40 10 10 10 10 1.714950617906628 58.31071691269223 0.0 3 0.8286936335119804 2.938132523660322 114946.0 384.41427864418654 0.0 - - - - - - - 302.5 229 6 C16orf62 chromosome 16 open reading frame 62 2035 258 C20140605_SFK031_03 C20140605_SFK031_03 TB561205.[MT7]-GIGDPLVSVY[MT7]AR.3y5_1.heavy 512.299 / 739.422 23482.0 32.610198974609375 40 10 10 10 10 1.714950617906628 58.31071691269223 0.0 3 0.8286936335119804 2.938132523660322 23482.0 61.93100918520864 0.0 - - - - - - - 240.71428571428572 46 7 C16orf62 chromosome 16 open reading frame 62 2037 259 C20140605_SFK031_03 C20140605_SFK031_03 TB561203.[MT7]-ETC[CAM]LNWFFK[MT7].3y3_1.heavy 511.599 / 585.352 49651.0 44.282798767089844 44 14 10 10 10 1.6033350526220298 42.99459911393102 0.0 3 0.9440880497885918 5.194759675977667 49651.0 132.0307151963284 0.0 - - - - - - - 690.7777777777778 99 9 C16orf62 chromosome 16 open reading frame 62 2039 259 C20140605_SFK031_03 C20140605_SFK031_03 TB561203.[MT7]-ETC[CAM]LNWFFK[MT7].3b4_1.heavy 511.599 / 648.314 18999.0 44.282798767089844 44 14 10 10 10 1.6033350526220298 42.99459911393102 0.0 3 0.9440880497885918 5.194759675977667 18999.0 51.910865439093484 0.0 - - - - - - - 193.06666666666666 37 15 C16orf62 chromosome 16 open reading frame 62 2041 259 C20140605_SFK031_03 C20140605_SFK031_03 TB561203.[MT7]-ETC[CAM]LNWFFK[MT7].3b5_1.heavy 511.599 / 762.357 30723.0 44.282798767089844 44 14 10 10 10 1.6033350526220298 42.99459911393102 0.0 3 0.9440880497885918 5.194759675977667 30723.0 174.22235084718585 0.0 - - - - - - - 120.1 61 10 C16orf62 chromosome 16 open reading frame 62 2043 259 C20140605_SFK031_03 C20140605_SFK031_03 TB561203.[MT7]-ETC[CAM]LNWFFK[MT7].3b3_1.heavy 511.599 / 535.23 27474.0 44.282798767089844 44 14 10 10 10 1.6033350526220298 42.99459911393102 0.0 3 0.9440880497885918 5.194759675977667 27474.0 247.52518867924528 0.0 - - - - - - - 232.07142857142858 54 14 C16orf62 chromosome 16 open reading frame 62 2045 260 C20140605_SFK031_03 C20140605_SFK031_03 TB558946.[MT7]-LVVVGAGGVGK[MT7].3b4_1.heavy 415.271 / 555.399 350655.0 31.07699966430664 47 17 10 10 10 3.161993534863541 26.931994916686335 0.0 3 0.9781803439287532 8.339606546858814 350655.0 245.8808608753618 0.0 - - - - - - - 388.0 701 1 HRAS;KRAS;NRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 2047 260 C20140605_SFK031_03 C20140605_SFK031_03 TB558946.[MT7]-LVVVGAGGVGK[MT7].3b5_1.heavy 415.271 / 612.42 810601.0 31.07699966430664 47 17 10 10 10 3.161993534863541 26.931994916686335 0.0 3 0.9781803439287532 8.339606546858814 810601.0 755.2627531480763 0.0 - - - - - - - 259.0 1621 2 HRAS;KRAS;NRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 2049 260 C20140605_SFK031_03 C20140605_SFK031_03 TB558946.[MT7]-LVVVGAGGVGK[MT7].3b3_1.heavy 415.271 / 456.33 784568.0 31.07699966430664 47 17 10 10 10 3.161993534863541 26.931994916686335 0.0 3 0.9781803439287532 8.339606546858814 784568.0 617.651549632759 0.0 - - - - - - - 905.0 1569 1 HRAS;KRAS;NRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 2051 260 C20140605_SFK031_03 C20140605_SFK031_03 TB558946.[MT7]-LVVVGAGGVGK[MT7].3y5_1.heavy 415.271 / 561.348 437542.0 31.07699966430664 47 17 10 10 10 3.161993534863541 26.931994916686335 0.0 3 0.9781803439287532 8.339606546858814 437542.0 139.57440375374028 0.0 - - - - - - - 323.5 875 2 HRAS;KRAS;NRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog;v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog;neuroblastoma RAS viral (v-ras) oncogene homolog 2053 261 C20140605_SFK031_03 C20140605_SFK031_03 TB295013.[MT7]-ELVDYFLNVATAQGR.3b6_1.heavy 613.996 / 911.463 196179.0 49.5265007019043 41 11 10 10 10 0.9581591623470875 69.10543772329618 0.0 3 0.8513018079058264 3.159911566063579 196179.0 481.15576096699294 0.0 - - - - - - - 276.5833333333333 392 12 MAN2B1 mannosidase, alpha, class 2B, member 1 2055 261 C20140605_SFK031_03 C20140605_SFK031_03 TB295013.[MT7]-ELVDYFLNVATAQGR.3y6_1.heavy 613.996 / 603.321 440200.0 49.5265007019043 41 11 10 10 10 0.9581591623470875 69.10543772329618 0.0 3 0.8513018079058264 3.159911566063579 440200.0 607.6480197148389 0.0 - - - - - - - 413.3333333333333 880 3 MAN2B1 mannosidase, alpha, class 2B, member 1 2057 261 C20140605_SFK031_03 C20140605_SFK031_03 TB295013.[MT7]-ELVDYFLNVATAQGR.3b4_1.heavy 613.996 / 601.331 262800.0 49.5265007019043 41 11 10 10 10 0.9581591623470875 69.10543772329618 0.0 3 0.8513018079058264 3.159911566063579 262800.0 780.3886889460153 0.0 - - - - - - - 295.77777777777777 525 9 MAN2B1 mannosidase, alpha, class 2B, member 1 2059 261 C20140605_SFK031_03 C20140605_SFK031_03 TB295013.[MT7]-ELVDYFLNVATAQGR.3b5_1.heavy 613.996 / 764.395 208577.0 49.5265007019043 41 11 10 10 10 0.9581591623470875 69.10543772329618 0.0 3 0.8513018079058264 3.159911566063579 208577.0 489.48811497069903 0.0 - - - - - - - 255.2 417 10 MAN2B1 mannosidase, alpha, class 2B, member 1